WorldWideScience

Sample records for dla amerykanskiego przemyslu

  1. Internal DLA and the Gaussian free field

    CERN Document Server

    Jerison, David; Sheffield, Scott

    2011-01-01

    In previous works, we showed that the internal DLA cluster on \\Z^d with t particles is a.s. spherical up to a maximal error of O(\\log t) if d=2 and O(\\sqrt{\\log t}) if d > 2. This paper addresses "average error": in a certain sense, the average deviation of internal DLA from its mean shape is of constant order when d=2 and of order r^{1-d/2} (for a radius r cluster) in general. Appropriately normalized, the fluctuations (taken over time and space) scale to a variant of the Gaussian free field.

  2. 76 FR 22681 - Defense Logistics Agency (DLA) Address Directory

    Science.gov (United States)

    2011-04-22

    ... of the Secretary Defense Logistics Agency (DLA) Address Directory AGENCY: Department of Defense. ACTION: Notice. SUMMARY: The Defense Logistics Agency (DLA) is updating its Address Directory which is.... Jody Sinkler, 703-767-5045. SUPPLEMENTARY INFORMATION: DLA Address Directory: Defense Logistics...

  3. DLA Piper律师事务所

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    DLA Piper在世界20个国家设有53家办事处.在美国拥有1.400名律师.在欧洲和亚洲拥有1.500名律师。是世界上办公网络最广泛.律师人数最多的律师事务所之一。

  4. Total Quality Management, DLA Finance Center

    Science.gov (United States)

    1989-07-01

    ton. DC 20503. DATE 3. REPORT TYPE AND DATES COVERED SJuly 1989 4. TITLE AND SUBTIT’LE 5. FUNDING NUMBERS Total Quality Management , DLA Finance Center 6...1989 ~ D 14. SUBJECT TERMS 15. NUMBER OF PAGES TQM ( Total Quality Management ), Continuous Process Improvement. ., I Management 16. PRICE CODE 17...CONCEPTS TQM BASICS Total Quality Management (TQM) is a concept which is based on the work of a variety of people in a variety of fields. It includes

  5. DLA-X Total Quality Management (TQM) Implementation Plan

    Science.gov (United States)

    1989-07-01

    PAGES TOM ( Total Quality Management ), Continuous Process Improvement.( .) 4L-- Administration 16. PRICE CODE 17. SECURITY CLASSIFICATION 18. SECURITY...NSN 7540-01-280-5500 Standard Form 298 (Rev. 2-89) Pr.-cr,bed by ANSI Std ,,fl.f 296-102 DLA-X TOTAL QUALITY MANAGEMENT (TQM) IMPLEMENTATION PLAN o...application of proven Total Quality Management techniques. Quality Policy: Responsibility for quality is delegated to every employee ;11 DLA-X. Every

  6. Additive Manufacturing: Which DLA-Managed Legacy Parts are Potential AM Candidates

    Science.gov (United States)

    2016-07-01

    Prescreening R&D Tool Appendix C Military Service and DLA Supply Chain Points of Contact Appendix D DLA Legacy Parts AM Prescreening R&D Tool User Guide...detailed discussions with our DLA stakeholders in the Aviation, Land and Maritime, and Troop Sup- port supply management organizations, who deal daily...Code (AMSC) Direct query EBS Acquisition Advice Code (AAC) Direct query EBS DLA Supply Chain Direct query EBS DLA Profit Center Direct query EBS

  7. Total Quality Management Implementation Plan: DLA-N

    Science.gov (United States)

    1989-07-01

    e Wastimto , n. Othe 20 Seato3 4. TITLE AND SUBTITLE S. FUNDING NUMBERS DLA-N Total Quality Management 6. AUTHOR(S) 7. PERFORMING ORGANIZATION NAME(S...PAGES TQM ( Total Quality Management ), Continuous Process Improvement.(; , Defense National Stockpile 16. PRICE CODEI17. SECURITY CLASSIFICATION 18...IUNCLASSIFIED UL NSN 7540-01-280-5500 Standard Form 298 (Rev. 2-89) pr"!Cbed ty ANSI Std Z39’B6 296-102 DLA - N TOTAL QUALITY MANAGEMENT IMPLEMENTATION PLAN I

  8. Lacunarity and multifractal analysis of the large DLA mass distribution

    Science.gov (United States)

    Rodriguez-Romo, Suemi; Sosa-Herrera, Antonio

    2013-08-01

    We show the methodology used to analyze fractal and mass-multifractal properties of very large Diffusion-Limited Aggregation (DLA) clusters with a maximum of 109 particles for 2D aggregates and 108 particles for 3D clusters, to support our main result; the scaling behavior obtained by our experimental results corresponds to the expected performance of monofractal objects. In order to estimate lacunarity measures for large DLA clusters, we develop a variant of the gliding-box algorithm which reduces the computer time needed to obtain experimental results. We show how our mass multifractal data have a tendency to present monofractal behavior for the mass distribution of the cases presented in this paper in the limit of very large clusters. Lacunarity analysis shows, provided we study small clusters mass distributions, data which might be interpreted as two different values of fractal dimensions while the cluster grows; however, this effect tends to vanish when the cluster size increases further, in such a way that monofractality is achieved. The outcomes of this paper lead us to conclude that the previously reported mass multifractality behavior (Vicsek et al., 1990 [13]) detected for DLA clusters is a consequence of finite size effects and floating point precision limitations and not an intrinsic feature of the phenomena, since the scaling behavior of our DLA clusters space corresponds to monofractal objects, being this situation remarkably noticeable in the limit of very large clusters.

  9. Typology of Empirical Attributes: Dissimilarity Linkage Analysis (DLA).

    Science.gov (United States)

    Dubin, Robert; Champoux, Joseph E.

    Dissimilarity Linkage Analysis (DLA) is an extremely simple procedure for developing a typology from empirical attributes that permits the clustering of entities. First the procedure develops a taxonomy of types from empirical attributes possessed by entities in the sample. Second, the procedure assigns entities to one, and only one, type in the…

  10. 32 CFR Appendix H to Part 323 - DLA Exemption Rules

    Science.gov (United States)

    2010-07-01

    ...) when access to accounting disclosures and access to or amendment of records would cause the identity of... cited provisions. c. ID: S100.50 DLA-GC (Specific exemption). 1. System name: Fraud and Irregularities.... Reasons: From subsection (c)(3) because granting access to the accounting for each disclosure as...

  11. Financial Reporting of DLA-Owned Bulk Petroleum Products

    Science.gov (United States)

    2007-11-02

    Defense Fuel Sites. The 511 fuel sites managed 864 line items that were reflected in the DLA Financial Inventory Account ( FIA ) subsidiary ledger...Financial Management Functional Area. Objective: Reengineer DoD business practices. Goal: Standardize, reduce, clarify, and reissue financial and...the Chief Financial Officers Act of 1990, as amended by the Federal Financial Management Act of 1994. This is the fifth in a series of reports on the

  12. A study of the association between chronic superficial keratitis and polymorphisms in the upstream regulatory regions of DLA-DRB1, DLA-DQB1 and DLA-DQA1.

    Science.gov (United States)

    Barrientos, Laura S; Zapata, Gustavo; Crespi, Julian A; Posik, Diego M; Díaz, Silvina; It, Veronica; Peral-García, Pilar; Giovambattista, Guillermo

    2013-12-15

    Canine chronic superficial keratitis (CSK) is an inflammatory corneal disease that primarily occurs in German shepherd dogs (GSDs). Several studies support the hypothesis that CSK is an immune-mediated disease. To investigate the genetic factors associated with CSK development, the upstream regulatory regions (URRs) of the DLA-DRB, -DQA and -DQB genes were genotyped in 60 dogs, including 32 CSK animals. LD analysis identified two blocks (r(2)≤45), with two DLA-DRB1 and five DLA-DQB1 haplotypes. Analysis of DLA-URR alleles/haplotypes showed a significant association between DQB1*-154 [C/T] (p=0.016) and CSK, suggesting that the T variant may increase the risk for developing CSK disease (OR=3, 95% CI=1.25-7.68). When haplotype associations were performed, the URR-DQB*CATT haplotype was significantly associated with CSK (p=0.016), increasing the risk of develop this disease over two-fold (OR=3, 95%, CI=1.25-7.68). These results showed that dogs homozygous at DRB1*69 [C/T] had a risk for developing CSK disease that was over four times the risk for heterozygotes. This genetic association supports the previous clinical, histological and pharmacological studies that suggest that CSK is an immune-mediated disease, and this association could potentially be used to identify susceptible animals.

  13. Improving DLA Supply Chain Agility: Lead Times, Order Quantities, and Information Flow

    Science.gov (United States)

    2015-01-01

    performance-based agreements reflecting negotiations between the services and DLA, historical levels, and reactions to customer complaints . With...regard to customer complaints , DLA can be thought of as also reacting to competing pressures and making the trade-off between minimizing total complaints ...military items to the armed services and other organizations. In doing so, it faces the challenge of maintaining a high degree of customer service at

  14. Simulation of DLA grating structures in the frequency domain

    Science.gov (United States)

    Egenolf, T.; Boine-Frankenheim, O.; Niedermayer, U.

    2017-07-01

    Dielectric laser accelerators (DLA) driven by ultrashort laser pulses can reach orders of magnitude larger gradients than contemporary RF electron accelerators. A new implemented field solver based on the finite element method in the frequency domain allows the efficient calculation of the structure constant, i.e. the ratio of energy gain to laser peak amplitude. We present the maximization of this ratio as a parameter study looking at a single grating period only. Based on this optimized shape the entire design of a beta-matched grating is completed in an iterative process. The period length of a beta-matched grating increases due to the increasing velocity of the electron when a subrelativistic beam is accelerated. The determination of the optimal length of each grating period thus requires the knowledge of the energy gain within all so far crossed periods. Furthermore, we outline to reverse the excitation in the presented solver for beam coupling impedance calculations and an estimation of the beam loading intensity limit.

  15. Simulating extremely metal-poor gas and DLA metal content at redshift z=7

    CERN Document Server

    Maio, Umberto; Mueller, Volker

    2013-01-01

    We present the first theoretical study of metals in damped Ly-alpha (DLA) systems at redshift z=7. The features of cold, primordial gas are studied by means of N-body, hydro, chemistry simulations, including atomic and molecular non-equilibrium chemistry, cooling, star formation for population III and population II-I regimes, stellar evolution, cosmic metal spreading according to proper yields (for He, C, O, Si, Fe, Mg, S, etc.) and lifetimes, and feedback effects. Theoretical expectations are then compared to recently available constraints from DLA observations. We find that DLA galaxies at z=7 account for 10 per cent of the whole galaxy population and for most of the metal-poor galaxies at these epochs. About 7 per cent of these DLA galaxies contain purely pristine material and 34 per cent of them consist of very weakly polluted gas, being, therefore, suitable candidate s as population III sites. The remaining 59 per cent are enriched above ~10^{-4} Zsun. Additionally, DLA candidates appear to have: gas mas...

  16. Quantitative DLA-based compressed sensing for T1-weighted acquisitions

    Science.gov (United States)

    Svehla, Pavel; Nguyen, Khieu-Van; Li, Jing-Rebecca; Ciobanu, Luisa

    2017-08-01

    High resolution Manganese Enhanced Magnetic Resonance Imaging (MEMRI), which uses manganese as a T1 contrast agent, has great potential for functional imaging of live neuronal tissue at single neuron scale. However, reaching high resolutions often requires long acquisition times which can lead to reduced image quality due to sample deterioration and hardware instability. Compressed Sensing (CS) techniques offer the opportunity to significantly reduce the imaging time. The purpose of this work is to test the feasibility of CS acquisitions based on Diffusion Limited Aggregation (DLA) sampling patterns for high resolution quantitative T1-weighted imaging. Fully encoded and DLA-CS T1-weighted images of Aplysia californica neural tissue were acquired on a 17.2T MRI system. The MR signal corresponding to single, identified neurons was quantified for both versions of the T1 weighted images. For a 50% undersampling, DLA-CS can accurately quantify signal intensities in T1-weighted acquisitions leading to only 1.37% differences when compared to the fully encoded data, with minimal impact on image spatial resolution. In addition, we compared the conventional polynomial undersampling scheme with the DLA and showed that, for the data at hand, the latter performs better. Depending on the image signal to noise ratio, higher undersampling ratios can be used to further reduce the acquisition time in MEMRI based functional studies of living tissues.

  17. 78 FR 64493 - Juneau Hydropower, Inc.; Notice of Subsequent Draft License Application (DLA) and Draft...

    Science.gov (United States)

    2013-10-29

    ... Energy Regulatory Commission Juneau Hydropower, Inc.; Notice of Subsequent Draft License Application (DLA..., 2013. d. Applicant: Juneau Hydropower, Inc. e. Name of Project: Sweetheart Lake Hydroelectric Project.... Applicant Contact: Duff Mitchell, Business Manager, Juneau Hydropower, Inc., P.O. Box 22775, Juneau, AK...

  18. 75 FR 43944 - Membership of the Defense Logistics Agency (DLA) Senior Executive Service (SES) Performance...

    Science.gov (United States)

    2010-07-27

    ... Defense Logistics Agency Membership of the Defense Logistics Agency (DLA) Senior Executive Service (SES... performance awards and other actions related to management of the SES cadre. DATES: Effective Date: September 16, 2010. ADDRESSES: Defense Logistics Agency, 8725 John J. Kingman Road, Suite 2533, Fort...

  19. 76 FR 38117 - Notice of Intent To Prepare an Environmental Assessment Regarding DLA Energy's Mobility Fuel...

    Science.gov (United States)

    2011-06-29

    ... Mobility Fuel Purchasing Programs AGENCY: Defense Logistics Agency Energy (DLA Energy), DoD. ACTION: Notice... Programs. SUMMARY: The Defense Logistics Agency is America's combat logistics support agency responsible.... Scoping is used to gain insight into the issues to be addressed and to identify other significant issues...

  20. Improving DLA Aviation Engineering’s Support to its Customers and the DoD Supply Chain

    Science.gov (United States)

    2014-10-01

    effort and require the active support of the Director, DLA and the USD(AT&L). Post Script A separate IDA study addressed the business model issue...that it sells to its industrial customers and operational forces; this is accomplished through the application of cost recovery rates, i.e...surcharges, to the sales price of consumable items. Since DLA Aviation and the ESAs primarily avoid implementing the FAR’s first article test policies and

  1. GRB 130606A within a sub-DLA at redshift 5.91

    CERN Document Server

    Castro-Tirado, A J; Ellison, S L; Jelínek, M; Martín-Carrillo, A; Bromm, V; Gorosabel, J; Bremer, M; Winters, J M; Hanlon, L; Meegan, S; Topinka, M; Pandey, S B; Guziy, S; Jeong, S; Sonbas, E; Pozanenko, A S; Cunniffe, R; Fernández-Muñoz, R; Ferrero, P; Gehrels, N; Hudec, R; Kubánek, P; Lara-Gil, O; Muñoz-Martínez, V F; Pérez-Ramírez, D; Štrobl, J; Álvarez-Iglesias, C; Inasaridze, R; Rumyantsev, V; Volnova, A; Hellmich, S; Mottola, S; Cerón, J M Castro; Cepa, J; Göğüş, E; Güver, T; Taş, Ö Önal; Park, I H; Sabau-Graziati, L; Tejero, A

    2013-01-01

    Events such as GRB130606A at z=5.91, offer an exciting new window into pre-galactic metal enrichment in these very high redshift host galaxies. We study the environment and host galaxy of GRB 130606A, a high-z event, in the context of a high redshift population of GRBs. We have obtained multiwavelength observations from radio to gamma-ray, concentrating particularly on the X-ray evolution as well as the optical photometric and spectroscopic data analysis. With an initial Lorentz bulk factor in the range \\Gamma_0 ~ 65-220, the X-ray afterglow evolution can be explained by a time-dependent photoionization of the local circumburst medium, within a compact and dense environment. The host galaxy is a sub-DLA (log N (HI) = 19.85+/-0.15), with a metallicity content in the range from ~1/7 to ~1/60 of solar. Highly ionized species (N V and Si IV) are also detected. This is the second highest redshift burst with a measured GRB-DLA metallicity and only the third GRB absorber with sub-DLA HI column density. GRB ' lightho...

  2. OCENA BEZPIECZEŃSTWA NA PRZEJŚCIACH DLA PIESZYCH PRZY POMOCY ANALIZY OBRAZU WIDEO

    Directory of Open Access Journals (Sweden)

    Piotr SZAGAŁA

    2016-07-01

    Full Text Available Pomimo ogólnej poprawy bezpieczeństwa ruchu drogowego w Polsce, liczba wypadków na przejściach dla pieszych nie zmniejszyła się w ciągu ostatnich czterech lat. W niniejszym artykule przedstawiono rezultaty projektu badawczego MOBIS, którego celem było opracowanie zastępczych miar bezpieczeństwa, opartych na wykrywaniu konfliktów pomiędzy pieszymi i pojazdami z wykorzystaniem analizy obrazu wideo. W okresie ponad 40 dni zarejestrowano ruch pieszych i pojazdów na dwóch przejściach dla pieszych bez sygnalizacji świetlnej w Warszawie i we Wrocławiu. Przy wykorzystaniu przetwarzania obrazu określono trajektorie ruchu pojazdów i pieszych. Uzyskano od 600 do 1000 sytuacji spotkań pieszy-pojazd dziennie. Obliczono parametry opisujące interakcje pieszych i pojazdów – profile prędkości, minimalną odległość między uczestnikami, przyspieszenia itp. Klasyfikacja sytuacji została oparta na interakcjach pieszych i pojazdów.. Na podstawie czasu po opuszczeniu strefy konfliktu (PET oraz prędkości pojazdu zidentyfikowano sytuacje niebezpieczne. Jako zastępczą miarę bezpieczeństwa na przejściach dla pieszych zaproponowano Wskaźnik Zagrożenia Pieszych (WZP, który określa promil sytuacji niebezpiecznych występujących na danym przejściu.

  3. Evaluation of a DLA-79 allele associated with multiple immune-mediated diseases in dogs.

    Science.gov (United States)

    Friedenberg, Steven G; Buhrman, Greg; Chdid, Lhoucine; Olby, Natasha J; Olivry, Thierry; Guillaumin, Julien; O'Toole, Theresa; Goggs, Robert; Kennedy, Lorna J; Rose, Robert B; Meurs, Kathryn M

    2016-03-01

    Immune-mediated diseases are common and life-threatening disorders in dogs. Many canine immune-mediated diseases have strong breed predispositions and are believed to be inherited. However, the genetic mutations that cause these diseases are mostly unknown. As many immune-mediated diseases in humans share polymorphisms among a common set of genes, we conducted a candidate gene study of 15 of these genes across four immune-mediated diseases (immune-mediated hemolytic anemia, immune-mediated thrombocytopenia, immune-mediated polyarthritis (IMPA), and atopic dermatitis) in 195 affected and 206 unaffected dogs to assess whether causative or predictive polymorphisms might exist in similar genes in dogs. We demonstrate a strong association (Fisher's exact p = 0.0004 for allelic association, p = 0.0035 for genotypic association) between two polymorphic positions (10 bp apart) in exon 2 of one allele in DLA-79, DLA-79*001:02, and multiple immune-mediated diseases. The frequency of this allele was significantly higher in dogs with immune-mediated disease than in control dogs (0.21 vs. 0.12) and ranged from 0.28 in dogs with IMPA to 0.15 in dogs with atopic dermatitis. This allele has two non-synonymous substitutions (compared with the reference allele, DLA-79*001:01), resulting in F33L and N37D amino acid changes. These mutations occur in the peptide-binding pocket of the protein, and based upon our computational modeling studies, are likely to affect critical interactions with the peptide N-terminus. Further studies are warranted to confirm these findings more broadly and to determine the specific mechanism by which the identified variants alter canine immune system function.

  4. A new galactic chemical evolution model with dust: results for dwarf irregular galaxies and DLA systems

    Science.gov (United States)

    Gioannini, L.; Matteucci, F.; Vladilo, G.; Calura, F.

    2017-01-01

    We present a galactic chemical evolution model which adopts updated prescriptions for all the main processes governing the dust cycle. We follow in detail the evolution of the abundances of several chemical species (C, O, S, Si, Fe and Zn) in the gas and dust of a typical dwarf irregular galaxy. The dwarf irregular galaxy is assumed to evolve with a low but continuous level of star formation and experience galactic winds triggered by supernova (SN) explosions. We predict the evolution of the gas to dust ratio in such a galaxy and discuss critically the main processes involving dust, such as dust production by asymptotic giant branch stars and Type II SNe, destruction and accretion (gas condensation in clouds). We then apply our model to damped Lyman α (DLA) systems which are believed to be dwarf irregulars, as witnessed by their abundance patterns. Our main conclusions are the following. (i) We can reproduce the observed gas to dust ratio in dwarf galaxies. (ii) We find that the process of dust accretion plays a fundamental role in the evolution of dust and in certain cases it becomes the dominant process in the dust cycle. On the other hand, dust destruction seems to be a negligible process in irregulars. (iii) Concerning DLA systems, we show that the observed gas-phase abundances of silicon, normalized to volatile elements (zinc and sulfur), are in agreement with our model. (iv) The abundances of iron and silicon in DLA systems suggest that the two elements undergo a different history of dust formation and evolution. Our work casts light on the nature of iron-rich dust: the observed depletion pattern of iron is well reproduced only when an additional source of iron dust is considered. Here we explore the possibility of a contribution from Type Ia SNe as well as an efficient accretion of iron nanoparticles.

  5. A study of the circum-galactic medium at z ~ 0.6 using DLA-galaxies

    CERN Document Server

    Rahmani, Hadi; Turnshek, David A; Rao, Sandhya M; Quiret, Samuel; Hamilton, Timothy S; Kulkarni, Varsha P; Monier, Eric M

    2016-01-01

    We present the study of a sample of nine QSO fields, with damped-Ly-alpha (DLA) or sub-DLA systems at z~0.6, observed with the X-Shooter spectrograph at the Very Large Telescope. By suitably positioning the X-Shooter slit based on high spatial resolution images of HST/ACS we are able to detect absorbing galaxies in 7 out of 9 fields (~ 78\\% success rate) at impact parameters from 10 to 30 kpc. In 5 out of 7 fields the absorbing galaxies are confirmed via detection of multiple emission lines at the redshift of DLAs where only 1 out of 5 also emits a faint continuum. In 2 out of these 5 fields we detect a second galaxy at the DLA redshift. Extinction corrected star formation rates (SFR) of these DLA-galaxies, estimated using their H-alpha fluxes, are in the range 0.3-6.7 M_sun yr^-1. The emission metallicities of these five DLA-galaxies are estimated to be from 0.2 to 0.9 Z_sun. Based on the Voigt profile fits to absorption lines we find the metallicity of the absorbing neutral gas to be in a range of 0.05--0.6...

  6. Spatially Resolved Emission of a High-redshift DLA Galaxy with the Keck/OSIRIS IFU

    Science.gov (United States)

    Jorgenson, Regina A.; Wolfe, Arthur M.

    2014-04-01

    We present the first Keck/OSIRIS infrared IFU observations of a high-redshift damped Lyα (DLA) galaxy detected in the line of sight to a background quasar. By utilizing the Laser Guide Star Adaptive Optics to reduce the quasar point-spread function to FWHM ~ 0.''15, we were able to search for and map the foreground DLA emission free from the quasar contamination. We present maps of the Hα and [O III] λλ5007, 4959 emission of DLA 2222-0946 at a redshift of z ~ 2.35. From the composite spectrum over the Hα emission region, we measure a star formation rate of 9.5 ± 1.0 M ⊙ yr-1 and a dynamical mass of M dyn = 6.1 × 109 M ⊙. The average star formation rate surface density is langΣSFRrang = 0.55 M ⊙ yr-1 kpc-2, with a central peak of 1.7 M ⊙ yr-1 kpc-2. Using the standard Kennicutt-Schmidt relation, this corresponds to a gas mass surface density of Σgas = 243 M ⊙ pc-2. Integrating over the size of the galaxy, we find a total gas mass of M gas = 4.2 × 109 M ⊙. We estimate the gas fraction of DLA 2222-0946 to be f gas ~ 40%. We detect [N II] λ6583 emission at 3σ significance with a flux corresponding to a metallicity of 75% solar. Comparing this metallicity with that derived from the low-ion absorption gas ~6 kpc away, ~30% solar, indicates possible evidence for a metallicity gradient or enriched in/outflow of gas. Kinematically, both Hα and [O III] emission show relatively constant velocity fields over the central galactic region. While we detect some red and blueshifted clumps of emission, they do not correspond with rotational signatures that support an edge-on disk interpretation. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

  7. Spatially resolved emission of a high-redshift DLA galaxy with the Keck/OSIRIS IFU

    Energy Technology Data Exchange (ETDEWEB)

    Jorgenson, Regina A. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI, 96822 (United States); Wolfe, Arthur M., E-mail: raj@ifa.hawaii.edu [Department of Physics and Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0424 (United States)

    2014-04-10

    We present the first Keck/OSIRIS infrared IFU observations of a high-redshift damped Lyα (DLA) galaxy detected in the line of sight to a background quasar. By utilizing the Laser Guide Star Adaptive Optics to reduce the quasar point-spread function to FWHM ∼ 0.''15, we were able to search for and map the foreground DLA emission free from the quasar contamination. We present maps of the Hα and [O III] λλ5007, 4959 emission of DLA 2222–0946 at a redshift of z ∼ 2.35. From the composite spectrum over the Hα emission region, we measure a star formation rate of 9.5 ± 1.0 M {sub ☉} yr{sup –1} and a dynamical mass of M {sub dyn} = 6.1 × 10{sup 9} M {sub ☉}. The average star formation rate surface density is (Σ{sub SFR}) = 0.55 M {sub ☉} yr{sup –1} kpc{sup –2}, with a central peak of 1.7 M {sub ☉} yr{sup –1} kpc{sup –2}. Using the standard Kennicutt-Schmidt relation, this corresponds to a gas mass surface density of Σ{sub gas} = 243 M {sub ☉} pc{sup –2}. Integrating over the size of the galaxy, we find a total gas mass of M {sub gas} = 4.2 × 10{sup 9} M {sub ☉}. We estimate the gas fraction of DLA 2222–0946 to be f {sub gas} ∼ 40%. We detect [N II] λ6583 emission at 3σ significance with a flux corresponding to a metallicity of 75% solar. Comparing this metallicity with that derived from the low-ion absorption gas ∼6 kpc away, ∼30% solar, indicates possible evidence for a metallicity gradient or enriched in/outflow of gas. Kinematically, both Hα and [O III] emission show relatively constant velocity fields over the central galactic region. While we detect some red and blueshifted clumps of emission, they do not correspond with rotational signatures that support an edge-on disk interpretation.

  8. Molecular hydrogen from z = 0.0963 DLA towards the QSO J1619+3342

    CERN Document Server

    Srianand, Raghunathan; Muzahid, Sowgat; Mohan, Vijay

    2014-01-01

    We report the detection of H2 in a zabs= 0.0963 Damped Lyman-{\\alpha} (DLA) system towards zem = 0.4716 QSO J1619+3342. This DLA has log N(H I) = 20.55 (0.10), 18.13 < log N(H2) < 18.40, [S/H] = -0.62 (0.13), [Fe/S] = -1.00 (0.17) and the molecular fraction -2.11 < log f(H2) < -1.85. The inferred gas kinetic temperature using the rotational level population is in the range 95 - 132 K. We do not detect C I or C II* absorption from this system. Using R- and V-band deep images we identify a sub-L* galaxy at an impact parameter of 14 kpc from the line of sight, having consistent photometric redshift, as a possible host for the absorber. We use the photoionization code CLOUDY to get the physical conditions in the H2 component using the observational constrains from H2, C I, C II* and Mg I. All the observations can be consistently explained if one or more of the following is true: (i) Carbon is underabundant by more than 0.6 dex as seen in halo stars with Z ~ 0.1 Z_sun, (ii) H I associated with H2 compo...

  9. Engraftment of DLA-nonidentical unrelated canine marrow after high-dose fractionated total body irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Deeg, H.J. (Fred Hutchinson Cancer Research Center, Seattle, WA); Storb, R.; Shulman, H.M.; Weiden, P.L.; Graham, T.C.; Thomas, E.D.

    1982-04-01

    Marrow transplants were carried out between unrelated DLA-nonidentical dogs. Recipients were conditioned for transplantation by total body irradiation (TBI) given either as a single dose of 9 Gy (900 rad) or fractionated in three increments of 6 Gy (600 rad) each at intervals of 48 hr. All recipients received marrow, less than or equal to to 4 X 10/sup 8/ cells/kg, and no buffy coat cells. No immunosuppression was given after grafting. All 10 dogs given single-dose total body irradiation failed to show engraftment and died with marrow aplasia and infectious complications (median survival 12 days). In contrast, all 10 dogs given fractionated TBI had sustained engraftment and died with graft-versus-host disease (GVHD) and infectious complications (median survival 12.5 days). None of the dogs died from radiation-induced gastroenteritis.In conclusion, resistance to DLA-nonidentical unrelated marrow grafts can be abrogated by high-dose TBI. This technique may allow hemopoietic engraftment even after in vitro manipulation of the marrow such as lymphocyte depletion by cell separation or treatment with anti-T cell antisera.

  10. Engraftment of DLA-nonidentical unrelated canine marrow after high-dose fractionated total body irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Deeg, H.J.; Storb, R.; Shulman, H.M.; Weiden, P.L.; Graham, T.C.; Thomas, E.D.

    1982-04-01

    Marrow transplants were carried out between unrelated DLA-nonidentical dogs. Recipients were conditioned for transplantation by total body irradiation (TBI) given eigher as a single dose of 9 Gy (900 rad) or fractionated in three increments of 6 Gy (600 rad) each at intervals of 48 hr. All recipients received marrow, less than or equal to 4 x 10(8) cells/kg, and no buffy coat cells. No immunosuppression was given after grafting. All 10 dogs given single dose total body irradiation failed to show engraftment and died with marrow aplasia and infectious complications (median survival 12 days). In contrast, all 10 dogs given fractionated TBI had sustained engraftment and died with graft-versus-host disease (GVHD) and infectious complications (median survival 12.5 days). None of the dogs died from radiation-induced gastroenteritis. In conclusion, resistance to DLA-nonidentical unrelated marrow grafts can be abrogated by high-dose TBI. This technique may allow hemopoietic engraftment even after i vitro manipulation of the marrow such as lymphocyte depletion by cell separation or treatment with anti-T cell antisera.

  11. 32 CFR 621.1 - Loan of Army/Defense Logistics Agency (DLA) owned property for use at national and State...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Loan of Army/Defense Logistics Agency (DLA) owned... of Army/Defense Logistics Agency (DLA) owned property for use at national and State conventions. (a... and facilities on loan. (iv) Costs of packaging, packing, transportation and handling from source of...

  12. Early Fuel Cell Market Deployments: ARRA and Combined (IAA, DLA, ARRA): Quarter 4 2013 Composite Data Products

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, J.; Sprik, S.

    2014-06-01

    This report includes the composite data products (CDPs) for early fuel cell market deployments in quarter 4 of 2013. Results are presented for ARRA (projects funded by the American Recovery and Reinvestment Act of 2009 [ARRA]) and Combined (projects funded by DOE Interagency Agreements [IAA], Department of Defense Defense Logistics Agency [DLA], and ARRA).

  13. Increased genetic risk or protection for canine autoimmune lymphocytic thyroiditis in Giant Schnauzers depends on DLA class II genotype.

    Science.gov (United States)

    Wilbe, M; Sundberg, K; Hansen, I R; Strandberg, E; Nachreiner, R F; Hedhammar, A; Kennedy, L J; Andersson, G; Björnerfeldt, S

    2010-06-01

    Dogs represent an excellent comparative model for autoimmune thyroiditis as several dog breeds develop canine lymphocytic thyroiditis (CLT), which is clinically similar to Hashimoto's thyroiditis in human. We obtained evidence that dog leukocyte antigen (DLA) class II genotype function as either genetic risk factor that predisposes for CLT or as protective factor against the disease. Genetic diversity at their DLA-DRB1, -DQA1, and -DQB1 loci were defined and potential association to major histocompatibility complex II haplotypes and alleles was analyzed. Giant Schnauzers carrying the DLA-DRB1*01201/DQA1*00101/DQB1*00201 haplotype showed an increased risk (odds ratio of 6.5) for developing CLT. The same risk haplotype has, to date, been observed in three different breeds affected by this disease, Giant Schnauzer, Dobermann, and Labrador Retriever, indicating that it is a common genetic risk factor in a variety of breeds affected by this disease. Importantly, protection for development of the disease was found in dogs carrying the DLA-DRB1*01301/DQA1*00301/DQB1*00501 haplotype (odds ratio of 0.3).

  14. Czy potrzebujemy nowej definicji języka dla potrzeb glottodydaktycznych?

    OpenAIRE

    Garncarek, Piotr

    2013-01-01

    W artykule zakładam, że glottodydaktyka nie jest domeną językoznawczą. To powód, dla którego potrzebujemy poszukać nowej, niezależnej od językoznawstwa definicji nauczanego języka, określanego filozoficznie, kulturowo, antropologicznie i etnograficznie. Podany w wątpliwość jest tutaj pogląd, że nauczanie języka ojczystego jako obcego może być traktowane jako zwyczajna praktyka glottodydaktyczna. Przestrzeń kulturowa takiego nauczania jest bowiem czymś więcej, niż tylko aktywnym...

  15. OTRZYMYWANIE CIENKICH WARSTW ABSORBERA CIGS METODĄ ROZPYLANIA MAGNETRONOWEGO DLA ZASTOSOWAŃ FOTOWOLTAICZNYCH

    Directory of Open Access Journals (Sweden)

    Sławomir GUŁKOWSKI

    w cienkowarstwowych ogniwach słonecznych. Metoda rozpylania magnetronowego jest efektywną metodą produkcji cienkich warstw CIGS. Proces nanoszenia warstw można podzielić na dwie zasadnicze części: pierwsza to tworzenie prekursora CIG, tj. nanoszenie warstw metalicznych miedzi, galu i indu w odpowiednich proporcjach. Etap drugi to krystalizacja absorbera CIGS w wyniku procesu wygrzewania prekursora w obecności selenu. W artykule skupiono się na opracowaniu odpowiednich proporcji poszczególnych pierwiastków wchodzących w skład prekursora. Przebadano następujące konfiguracje nanoszenia poszczególnych warstw absorbera: CuGa/In oraz CuGa/In/Cu. Poszczególne warstwy naniesione zostały na podłoże molibdenowe, stanowiące tylny kontakt ogniwa budowanego na bazie absorbera CIGS. Warstwa molibdenu została przebadana metodą czteroostrzową w celu znalezienia zależności rezystywności od grubości warstwy. Przeprowadzono analizę składu pierwiastkowego warstwy za pomocą skaningowego mikroskopu elektronowego wyposażonego w system EDS. Dla każdej z otrzymanych warstw określono atomowe współczynniki proporcji występowania miedzi oraz galu w składzie warstwy. Na podstawie otrzymanych wyników badań dokonano optymalizacji parametrów technologicznych procesu takich jak: moc katody, ciśnienie oraz czas procesu, a także temperatura. Znaleziono zależności grubości warstw w funkcji czasu nanoszenia dla ustalonych warunków ciśnienia i mocy. Grubości poszczególnych warstw określono na podstawie badań profilometrycznych. W oparciu o opracowane parametry wykonane warstwy prekursora poddawane są obróbce termicznej w celu uzyskania absorbera CIGS.

  16. Ganoderma lucidum total triterpenes attenuate DLA induced ascites and EAC induced solid tumours in Swiss albino mice.

    Science.gov (United States)

    Smina, T P; Mathew, J; Janardhanan, K K

    2016-04-30

    G. lucidum total triterpenes were assessed for its apoptosis-inducing and anti-tumour activities. The ability of the total triterpenes to induce apoptosis was evaluated in Dalton's lymphoma ascites (DLA) and Ehrlich's ascites carcinoma (EAC) cell lines. Total triterpenes were found to be highly cytotoxic to DLA and EAC cell lines with IC50 values 5 ± 0.32 and 7.9 ± 0.2 µg/ml respectively. Total triterpenes induced apoptosis in both cell lines which is evident from the DNA fragmentation assay. Anti-tumour activity was accessed using DLA induced solid and EAC induced ascites tumour models in Swiss albino mice. Administration of 10, 50 and 100 mg/kg b. wt. total triterpenes showed 11.86, 27.27 and 40.57% increase in life span of animals in ascites tumour model. Treatment with 10, 50 and 100 mg/kg b. wt. total triterpenes exhibited 76.86, 85.01 and 91.03% inhibition in tumour volume and 67.96, 72.38 and 77.90% inhibition in tumour weight respectively in the solid tumour model. The study reveals the significant dose-dependent anti-tumour activity of total triterpenes in both models. Total triterpenes were more active against the solid tumour than the ascites tumour. The anti-oxidant potential and ability to induce cell-specific apoptosis could be contributing to its anti-tumour activities.

  17. Mg II Absorber Number Density at z~0.05 Implications for Omega_DLA Evolution

    CERN Document Server

    Churchill, C W

    2001-01-01

    [Abridged] A 147 quasar/AGN spectra, obtained with FOS/HST, have been searched for Mg II absorbers for 0 = 0.06, yielding dN/dz = 0.22(+0.12)(-0.09) for absorbers with W_r > 0.6 Ang. This is consistent with the value expected if these systems do not evolve from higher redshifts (z = 2.2). (2) No systems with W_r 0.2 galaxies. (3) Three systems are candidates for damped Lyman-alpha absorbers (DLAs). Based upon the results of Rao & Turnshek (2000, ApJS, 130, 1), this translates to dN/dz = 0.08(+0.09)(-0.05) for DLAs at z ~ 0. This would suggest that dN/dz for DLAs does not evolve from z = 4 to z = 0. However, because of the distribution of H I mass in 21-cm selected galaxies, the Rao & Turnshek finding that the cosmological H I mass density, Omega_DLA, decreases either rapidly from z = 0.5 to z = 0, or more gradually from z = 1.5, still holds.

  18. A new galactic chemical evolution model with dust: results for dwarf irregular galaxies and DLA systems

    Science.gov (United States)

    Gioannini, L.; Matteucci, F.; Vladilo, G.; Calura, F.

    2016-09-01

    We present a galactic chemical evolution model which adopts updated prescriptions for all the main processes governing the dust cycle. We follow in detail the evolution of the abundances of several chemical species (C, O, S, Si, Fe and Zn) in the gas and dust of a typical dwarf irregular galaxy. The dwarf irregular galaxy is assumed to evolve with a low but continuous level of star formation and experience galactic winds triggered by supernova explosions. We predict the evolution of the gas to dust ratio in such a galaxy and discuss critically the main processes involving dust, such as dust production by AGB stars and Type II SNe, destruction and accretion (gas condensation in clouds). We then apply our model to Damped Lyman-α systems which are believed to be dwarf irregulars, as witnessed by their abundance patterns. Our main conclusions are: i) we can reproduce the observed gas to dust ratio in dwarf galaxies. ii) We find that the process of dust accretion plays a fundamental role in the evolution of dust and in certain cases it becomes the dominant process in the dust cycle. On the other hand, dust destruction seems to be a negligible process in irregulars. iii) Concerning Damped Lyman-α systems, we show that the observed gas-phase abundances of silicon, normalized to volatile elements (zinc and sulfur), are in agreement with our model. iv) The abundances of iron and silicon in DLA systems suggest that the two elements undergo a different history of dust formation and evolution. Our work casts light on the nature of iron-rich dust: the observed depletion pattern of iron is well reproduced only when an additional source of iron dust is considered. Here we explore the possibility of a contribution from Type Ia SNe as well as an efficient accretion of iron nano-particles.

  19. Canine DLA-79 gene: an improved typing method, identification of new alleles and its role in graft rejection and graft-versus-host disease.

    Science.gov (United States)

    Venkataraman, G M; Geraghty, D; Fox, J; Graves, S S; Zellmer, E; Storer, B E; Torok-Storb, B J; Storb, R

    2013-04-01

    Developing a preclinical canine model that predicts outcomes for hematopoietic cell transplantation in humans requires a model that mimics the degree of matching between human donor and recipient major histocompatibility complex (MHC) genes. The polymorphic class I and class II genes in mammals are typically located in a single chromosome as part of the MHC complex. However, a divergent class I gene in dogs, designated dog leukocyte antigen-79 (DLA-79), is located on chromosome 18 while other MHC genes are on chromosome 12. This gene is not taken into account while DLA matching for transplantation. Though divergent, this gene shares significant similarity in sequence and exon-intron architecture with other class I genes, and is transcribed. Little is known about the polymorphisms of DLA-79 and their potential role in transplantation. This study was aimed at exploring the reason for high rate of rejection seen in DLA-matched dogs given reduced intensity conditioning, in particular, the possibility that DLA-79 allele mismatches may be the cause. We found that about 82% of 407 dogs typed were homozygous for a single, reference allele. Owing to the high prevalence of a single allele, 87 of the 108 dogs (∼80%) transplanted were matched for DLA-79 with their donor. In conclusion, we have developed an efficient method to type alleles of a divergent MHC gene in dogs and identified two new alleles. We did not find any statistical correlation between DLA-79 allele disparity and graft rejection or graft-versus-host disease, among our transplant dogs.

  20. Effectiveness of daily living abilities (DLA) as a tool for evaluating vocational competencies: study of non-disabled workers aged 45 and over.

    Science.gov (United States)

    Kikuchi, E; Murakami, K

    1995-05-01

    A questionnaire survey was conducted on 28-55 items of daily living abilities (DLA) linked to 13 basic vocational competencies such as memory, learning, planning, judgement, muscular power and concentration covering a total of 505 non-disabled blue collar male workers aged 45 and over. Results of the survey were as follows, (1) The 457 subjects were grouped into five groups ranging from normal to unsound groups according to the degree of DLA; (2) The reduction of DLA has directionality to two factors, memory and muscular power; (3) DLA provide clues for aging; (4) Among basic vocational competencies, muscular power showed the highest performance with a small standard deviation, while concentration scored low points with a large standard deviation (p learning ability, agility and concentration (p < .05); Since the findings showed various characteristics of vocational competencies and the aging process precisely in blue collar workers aged 45 and over, we assumed that the DLA survey is one of the alternatives for evaluating workers vocational competencies.

  1. The Magellanic Bridge as a DLA System: Physical Properties of Cold Gas toward PKS0312-770

    CERN Document Server

    Misawa, Toru; Kobulnicky, Henry A; Wakker, Bart P; Bland-Hawthorn, Joss

    2009-01-01

    We measure the physical properties of a local multi-component absorption-line system at V_sol ~ 200 km/s toward the quasar PKS0312-770 behind the Magellanic Bridge (MB) using Hubble Space Telescope STIS spectroscopy in conjunction with photoionization modeling. At an impact parameter of ~ 10 kpc from the Small Magellanic Cloud (SMC), this sightline provides a unique opportunity to probe the chemical properties and ionization structure in a nearby absorption line system with a column density of logN(HI) ~ 20.2, at the transition between Damped Lyman Alpha (DLA) and sub-DLA systems. We find that metallicity of -1.0 < logZ < -0.5 and ionization parameter of -6 < logU < -5 for three low-ionization components and logU ~ -2.6 for one high-ionization component. One component at V_sol = 207 km/s shows an alpha-element abundance log(Si/H) ~ -5.0, making it ~ 0.2 dex more metal rich than both SMC H II regions and stars within the MB and the SMC. The N/Si ratio in this component is log(N/Si) = -0.3+/-0.1, ma...

  2. The host of GRB 030323 at z=3.372: A very high column density DLA system with a low metallicity

    OpenAIRE

    Vreeswijk, P. M.; Ellison, S.L.; Ledoux, C.; Wijers, R. A. M. J.; Fynbo, J. P. U.; Møller, P.; Henden, A.; Hjorth, J.; Masi, G

    2004-01-01

    We present photometry and spectroscopy of the afterglow of GRB 030323. VLT spectra of the afterglow show damped Lyalpha (DLA) absorption and low- and high-ionization lines at a redshift z=3.3718B10.0005. The inferred neutral hydrogen column density, log N(H I)=21.90B10.07, is larger than any (GRB- or QSO-) DLA H I column density inferred directly from Lyalpha in absorption. From the afterglow photometry, we derive a conservative upper limit to the host-galaxy extinction: AV

  3. Serwisy społecznościowe dla naukowców (SSN) na przykładzie ResearchGate i Academia.edu

    OpenAIRE

    Rozkosz, Ewa

    2014-01-01

    Artykuł ma na celu przedstawienie wybranych funkcji serwisów społecznościowych dla naukowców (SSN). Dokonano analizy dwóch najpopularniejszych serwisów: ResearchGate oraz Academia.edu. Ewa Rozkosz

  4. The galaxy counterpart of the high-metallicity and 16 kpc impact parameter DLA towards Q0918+1636 - a challenge to galaxy formation models?

    CERN Document Server

    Sommer-Larsen, J

    2016-01-01

    The quasar Q0918+1636 (z=3.07) has an intervening high-metallicity Damped Lyman-alpha Absorber (DLA) along the line of sight, at a redshift of z=2.58. The DLA is located at a large impact parameter of 16.2 kpc, and has an almost solar metallicity. It is shown, that a novel type of cosmological galaxy formation models, invoking a new SNII feedback prescription, the Haardt & Madau (2012) UVB field and explicit treatment of UVB self-shielding, can reproduce the observed characteristics of the DLA. UV radiation from young stellar populations in the galaxy, in particular in the photon energy range 10.36-13.61 eV (relating to Sulfur II abundance), are also considered in the analysis. It is found that a) for L~L* galaxies (at z=2.58), about 10% of the sight-lines through the galaxies at impact parameter 16.2 kpc will display a Sulfur II column density N(SII)$>$ 10$^{15.82}$ cm$^{-2}$ (the observed value for the DLA), and b) considering only cases where a near-solar metallicity will be detected at 16.2 kpc impact...

  5. The galaxy counterpart of the high-metallicity and 16 kpc impact parameter DLA towards Q 0918+1636 - a challenge to galaxy formation models?

    Science.gov (United States)

    Sommer-Larsen, J.; Fynbo, J. P. U.

    2016-10-01

    The quasar Q0918+1636 (z=3.07) has an intervening high-metallicity Damped Lyman-α Absorber (DLA) along the line of sight, at a redshift of z=2.58. The DLA is located at a large impact parameter of 16.2 kpc, and despite this large impact parameter it has a very high metallicity (consistent with solar). In this paper it is investigated whether a novel type of galaxy formation models, based on hydrodynamical/gravitational TreeSPH simulations invoking a new SNII feedback prescription, the Haardt & Madau (2012) ultra-violet background radiation (UVB) field and explicit treatment of UVB self-shielding effects, can reproduce the observed characteristics of the DLA. Effects of UV radiation from young stellar populations in the galaxy, in particular in the photon energy range 10.36-13.61 eV (of relevance for the abundance of Sulfur II), are also considered in the analysis. It is found that a) for L˜L⋆ galaxies (at z=2.58), about 10% of the sight-lines through the galaxies at impact parameter b=16.2 kpc will display a Sulfur II column density of N({SII)} ≥ 10^{15.82} cm-2 (the observed value for the DLA), and b) considering only cases where a near-solar metallicity will be detected at 16.2 kpc impact parameter, the (Bayesian) probability distribution of galaxy star formation rate (SFR) peaks near the value actually observed for the DLA galaxy counterpart of 27^{+20}_{-9} {M_⊙}/yr. The probability that the SFR lies in the range 10-100 M⊙/yr is found to be 0.65-0.80 for a very broad range of assumptions about the z=2.58 galaxy luminosity function. Hence, the main result is that extreme galaxies are not required to match the high impact parameter and high metallicity DLA. In fact, very good agreement between the theoretical predictions and the observed properties of the proposed DLA galaxy counterpart is found. It is argued, that the bulk of the α-elements, like Sulfur, traced by the high metal column density, b=16.2 kpc absorption lines, have been produced by

  6. The galaxy counterpart of the high-metallicity and 16 kpc impact parameter DLA towards Q 0918+1636 - a challenge to galaxy formation models?

    Science.gov (United States)

    Sommer-Larsen, J.; Fynbo, J. P. U.

    2017-01-01

    The quasar Q0918+1636 (z = 3.07) has an intervening high-metallicity damped Lyman α absorber (DLA) along the line of sight, at a redshift of z = 2.58. The DLA is located at a large impact parameter of 16.2 kpc, and despite this large impact parameter, it has a very high metallicity (consistent with solar). In this paper, it is investigated whether a novel type of galaxy formation models, based on hydrodynamical/gravitational TreeSPH simulations invoking a new Supernova Type II feedback prescription, the Haardt & Madau most recent ultraviolet background radiation (UVB) field and explicit treatment of UVB self-shielding effects, can reproduce the observed characteristics of the DLA. Effects of UV radiation from young stellar populations in the galaxy, in particular in the photon energy range 10.36-13.61 eV (relating to Sulphur II abundance), are also considered in the analysis. It is found that (a) for L ˜ L⋆ galaxies (at z = 2.58), about 10 per cent of the sight-lines through the galaxies at impact parameter b = 16.2 kpc will display a Sulphur II column density of N({S II)} ≥ 10^{15.82} cm-2 (the observed value for the DLA), and (b) considering only cases where a near-solar metallicity will be detected at 16.2 kpc impact parameter, the (Bayesian) probability distribution of galaxy star formation rate peaks near the value observed for the DLA galaxy counterpart of 27^{+20}_{-9} { M_{⊙}} yr-1. It is argued that the bulk of the α-elements, like Sulphur, traced by the high metal column density, b = 16.2 kpc absorption lines, have been produced by evolving stars in the inner galaxy, and subsequently transported outwards by galactic winds.

  7. Drosera indica L: Potential effect on liver enzyme, lipid profile and hormone change in DaltonAND#8217;s lymphoma ascites (DLA bearing mice

    Directory of Open Access Journals (Sweden)

    Raju Asirvatham

    2012-04-01

    Result: Both ethanol and aqueous extracts of D. indica L at doses of 250 and 500mg/kg extracts showed significant (p<0.001 effects on the elevated liver enzyme, lipid profile and hormonal changes to normal. Conclusion: The results of the present study demonstrated that both extracts were able to normalize the cancer induced liver enzyme, lipid profile and hormone changes in DLA bearing mice. [J Intercult Ethnopharmacol 2012; 1(2.000: 69-73

  8. A newly discovered DLA and associated Ly-alpha emission in the spectra of the gravitationally lensed quasar UM 673A,B

    CERN Document Server

    Cooke, Ryan; Steidel, Charles C; King, Lindsay J; Rudie, Gwen C; Rakic, Olivera

    2010-01-01

    The sightline to the brighter member of the gravitationally lensed quasar pair UM 673A,B intersects a damped Lyman-alpha system (DLA) at z = 1.62650 which, because of its low redshift, has not been recognised before. Our high quality echelle spectra of the pair, obtained with HIRES on the Keck I telescope, show a drop in neutral hydrogen column density N(H I) by a factor of at least 400 between UM 673A and B, indicating that the DLA's extent in this direction is much less than the 2.7 kpc separation between the two sightlines at z = 1.62650. By reassessing this new case together with published data on other QSO pairs, we conclude that the typical size (radius) of DLAs at these redshifts is R ~ (5 +/- 3) kpc, smaller than previously realised. Highly ionized gas associated with the DLA is more extended, as we find only small differences in the C IV absorption profiles between the two sightlines. Coincident with UM 673B, we detect a weak and narrow Ly-alpha emission line which we attribute to star formation acti...

  9. DLA class II alleles and haplotypes are associated with risk for and protection from chronic hepatitis in the English Springer spaniel.

    Directory of Open Access Journals (Sweden)

    Nicholas H Bexfield

    Full Text Available Chronic hepatitis (CH is common in dogs in the United Kingdom. An increased prevalence of the disease is seen in the English Springer spaniel (ESS, and this breed suffer from a severe form with young to middle aged female dogs being predisposed. The disease shares histological features with those of human viral hepatitis, although the specific aetiological agent has not yet been identified. The aim of the current study was to investigate whether dog leucocyte antigen (DLA class II alleles and haplotypes are associated with susceptibility/resistance to CH in the ESS. Sequence-based genotyping of the polymorphic exon 2 from DLA-DRB1, -DQA1 and -DQB1 class II loci were performed in 66 ESSs with CH and 84 healthy controls. There was a significant difference in the distribution of the protective alleles DRB1*00501 (3.0% vs. 12.0%, odds ratio [OR] = 0.23, 95% confidence interval [CI] = 0.06-0.74 and DQB1*00501 (3.8% vs. 12.0%, OR = 0.29, 95% CI = 0.09-0.85 between cases and controls. The haplotype DLA-DRB1*00501/DQA1*00301/DQB1*00501 was present in 11.9% of controls and 3.0% of cases and was significantly associated with protection against disease development (OR = 0.26, 95% CI = 0.08-0.80. There was a significant difference in the distribution of the risk alleles DRB1*00601 (14.4% vs. 6.5%, OR = 2.40, 95% CI = 1.10-5.63 and DQB1*00701 (14.4% vs. 6.5%, OR = 2.40, 95% CI = 1.10-5.63 between cases and controls. A risk haplotype (DLA-DRB1*00601/DQA1*005011/DQB1*00701 was present in 14.4% of cases and 6.5% of controls and conferred an elevated risk of developing CH with an OR of 3.13 (95% CI = 1.20-8.26. These results demonstrate that DLA class II is significantly associated with risk and protection from developing CH in ESSs.

  10. Bacteriological studies of blood, tissue fluid, lymph and lymph nodes in patients with acute dermatolymphangioadenitis (DLA) in course of 'filarial' lymphedema.

    Science.gov (United States)

    Olszewski, W L; Jamal, S; Manokaran, G; Pani, S; Kumaraswami, V; Kubicka, U; Lukomska, B; Tripathi, F M; Swoboda, E; Meisel-Mikolajczyk, F; Stelmach, E; Zaleska, M

    1999-10-15

    Filarial lymphedema is complicated by frequent episodes of dermatolymphangioadenitis (DLA). Severe systemic symptoms during attacks of DLA resemble those of septicemia. The question we asked was whether bacterial isolates can be found in the peripheral blood of patients during the episodes of DLA. Out of 100 patients referred to us with 'filarial' lymphedema 14 displayed acute and five subacute symptoms of DLA. All were on admission blood microfilariae negative but had a positive test in the past. Blood bacterial isolates were found in nine cases, four acute (21%) and five subacute (26%). In 10 acute cases blood cultures were found negative. Six blood isolates belonged to Bacilli, four to Cocci and one was Sarcina. To identify the sites of origin of bacterial dissemination, swabs taken from the calf skin biopsy wounds and tissue fluid, lymph and lymph node specimens were cultured. Swabs from the calf skin biopsy wound contained isolates in nine (47%) cases. They were Bacilli in nine, Cocci in three, Acinetobacter and Erwinia in two cases. Tissue fluid was collected from 10 patients and contained Bacilli in four (40%) and Staphylococci in three (30%). Lymph was drained in four patients and contained isolates in all samples (100%). They were Staphylococcus epidermis, xylosus and aureus, Acinetobacter, Bacillus subtilis and Sarcina. Three lymph nodes were biopsied and contained Staphylococcus chromogenes, xylosus, Enterococcus and Bacillus cereus. In six cases the same phenotypically defined species of bacteria were found in blood and limb tissues or fluids. In the 'control' group of patients with lymphedema without acute or subacute changes all blood cultures were negative. Interestingly, swabs from biopsy wound of these patients contained isolates in 80%, tissue fluid in 68%, lymph in 70% and lymph nodes in 58% of cases. In healthy controls, tissue fluid did not contain bacteria, and lymph isolates were found only in 12% of cases. This study demonstrates that

  11. Histocompatibility studies in a closely bred colony of dogs. 3. Genetic definition of the DL-A system of canine histocompatibility, with particular reference to the comparative immunogenicity of the major transplantable organs.

    Science.gov (United States)

    Dausset, J; Rapaport, F T; Cannon, F D; Ferrebee, J W

    1971-11-01

    The segregation of the canine DL-A leukocyte group antigen(s) b, c, d, e, f, g, h, k, l, and m has been traced in 141 consecutive matings in the Cooperstown Colony of beagles. All of the leukocyte antigen(s) were regularly transmitted en bloc from parent to offspring, with no instance of independent segregation. A total of 23 haplotypes, including six different DL-A antigen patterns (gl, bkhfm, bkcd, e, be, fgl) was observed. 31 different DL-A phenotypes were observed in a population of 100 mongrel dogs. A number of statistically significant positive and negative associations between individual DL-A antigenic components occurred in this population. The results support the concept of the DL-A system as a complex immunogenetic system governed by a single region (or locus) of an autosomal pair of chromosomes. Studies of skin, kidney, heart, and liver allografts in the Cooperstown Colony indicated that the longest allograft survivals occur under genetically and serologically defined conditions of donor-recipient DL-A compatibility. Skin and renal allografts generally behaved in parallel fashion, while cardiac allografts survived for longer periods of time (MST = 47.1 days) than kidneys (MST = 28.1 days) or skin (MST = 25.1 days) under conditions of DL-A identity. Heart transplants were rejected at a more rapid rate than kidney, however, in DL-A-incompatible donor-recipient combinations. Liver transplants were accorded the longest survival time (MST = 76.2 days) under conditions of DL-A identity, but were rejected at a rapid rate (MST = 5 days) in DL-A-incompatible nonlittermate donor-recipient pairs. The results provide further evidence that the DL-A system is the principal system of histocompatibility in the canine species. The differences in survival of different organs under similar conditions of donor-recipient DL-A compatibility suggest, however, the existence of a number of unknown variables which may also be capable of significantly affecting allograft behavior.

  12. Plan Zadań Ochronnych dla obszaru Natura 2000 Dąbrowy Ceranowskie PLH 140024 w świetle gospodarki leśnej

    Directory of Open Access Journals (Sweden)

    Michał Falkowski

    2015-06-01

    Full Text Available Praca przedstawia projekt Planu Zadań Ochronnych dla obszaru Natura 2000 Dąbrowy Ceranowskie PLH140024, w którym przedmiotami ochrony są siedliska przyrodnicze: 9170 Grąd środkowoeuropejski i subkontynentalny (Galio-Carpinetum, Tilio- -Carpinetum i 91I0* Ciepłolubne dąbrowy (Quercetalia pubescenti-petraeae. Celem pracy jest utrzymanie lub odtworzenie właściwego stanu przedmiotów ochrony, który to obowiązek wynika z art. 6(1 Dyrektywy Rady 92/43/EWG zwanej Dyrektywą Siedliskową [Dyrektywa... 1992]. Jest to dokument planistyczny sporządzany na okres 10 lat, będący narzędziem ochrony tego obszaru, a ściślej przedmiotów ochrony znajdujących się w jego obrębie. Stan zachowania grądów w obszarze został określony jako zły (U2. Z kolei stan dąbrów świetlistych oceniono jako niezadawalający (U1. W przypadku grądów brak jest odpowiedniej ilości martwego drewna, nie występują wszystkie fazy rozkładu drzew stojących i leżących kłód. Dla dąbrów ciepłolubnych głównymi zagrożeniami są proces sukcesji oraz wzrastające zacienienie runa. Głównym celem Planu Zadań Ochronnych dla siedliska 9170 jest zachowanie dotychczasowej (około 10% w skali obszaru jego powierzchni oraz poprawa jego struktury i funkcji. W przypadku siedliska przyrodniczego 91I0* celem jest zachowanie dotychczasowej (około 70% w skali ob -szaru powierzchni siedliska, poprawa warunków świetlnych, powstrzymanie procesu sukcesji oraz eliminacji gatunków obcych ekologicznie i geograficznie.

  13. Galaxy counterparts of metal-rich damped Lyman-alpha absorbers - II. A solar-metallicity, molecular-rich, and dusty DLA at z_abs=2.58

    CERN Document Server

    Fynbo, J P U; Noterdaeme, P; Christensen, L; Moller, P; Durgapal, A K; Goldoni, P; Kaper, L; Krogager, J -K; Laursen, P; Maund, J R; Milvang-Jensen, B; Okoshi, K; Rasmussen, P K; Thorsen, T J; Toft, S; Zafar, T

    2010-01-01

    [Abridged]. Here, we report on the discovery of the galaxy counterpart of the z_abs=2.58 DLA on the line-of-sight to the z=3.07 quasar SDSS J091826.16+163609.0. The galaxy counterpart of the DLA is detected in the OIII 5007 and OII 3726,3729 emission lines redshifted into the NIR at an impact parameter of 16 kpc. Ly-alpha emission is not detected. The upper limit implies that Ly-alpha emission from this galaxy is suppressed by more than an order of magnitude. The DLA is amongst the most metal-rich DLAs studied so far at comparable redshifts. We find evidence for substantial depletion of refractory elements onto dust grains. Fitting the main metal line component of the DLA, which is located at z_abs=2.5832 and accounts for at least 85% of the total column density of low-ionisation species, we measure metal abundances from ZnII, SII, SiII, CrII, MnII, FeII and NiII of -0.12, -0.26, -0.46, -0.88, -0.92, -1.03 and -0.78, respectively. In addition, we detect absorption in the Lyman and Werner bands of hydrogen, wh...

  14.  Znaczenie dorobku naukowego Profesor Elżbiety Burzym dla rozwoju nauki i praktyki rachunkowości w Polsce

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2014-04-01

    Full Text Available  Celem artykułu jest przypomnienie znaczenia dorobku naukowego Profesor Elżbiety Burzym dla rozwo-ju teorii rachunkowości, badań naukowych w tej dyscyplinie oraz praktyki rachunkowości w Polsce. Przedmiotem artykułu są definicje, tezy, poglądy i koncepcje teoretyczne systemu rachunkowości oraz systemu rachunku kosztów formułowane przez Profesor Burzym, które stanowią znaczący wkład w rozwój teorii rachunkowości w Polsce. W artykule objaśniono na przykładzie z literatury skutki roz-wiązywania problemów rachunkowości z perspektywy proceduralno-formalnej, a nie merytorycznej, która dominowała w opracowaniach naukowych Profesor Burzym.

  15. Výpočet rozložení vztlaku po rozpětí křídla Glauertovou metodou

    OpenAIRE

    Kubíček, Martin

    2008-01-01

    Cílem této práce bylo provést zjednoduššený výpočet rozložení vztlaku po rozpětí křídla letounu RAPID 200 jež je dvousedadlový, celokovový dolnoplošník s přímým křídlem a běžným uspořádáním pohonné jednotky, Glauertovou metodou pomocí programu MathCad. This work is focused on a simplified calculation lift distribution along wing span of aircraft RAPID 200. This is a two –seat, all metal lower wing airplane with a straight wing and usual setting of power unit. Glauert method is used to calc...

  16. Tax Competition Or Tax Coordination? What Is Better For The European Union? / Konkurewncja Podatkowa Czy Koordynacja Podatków? Co Jest Lepsze Dla Unii Europejskiej?

    Directory of Open Access Journals (Sweden)

    Działo Joanna

    2015-06-01

    Full Text Available Konkurencja podatkowa to stosowanie takiej polityki podatkowej, która pozwoli na utrzymanie lub zwiększenie atrakcyjności danego obszaru dla lokalizacji inwestycji. Konkurencja podatkowa stosowana jest zwłaszcza przez kraje stosunkowo słabo rozwinięte, gdyż napływ kapitału zagranicznego daje im możliwość wdrożenia nowoczesnych technologii, nowych metod zarządzania i zwiększenia eksportu. Jednym ze skutków konkurencji podatkowej jest powstawanie rajów podatkowych, krajów lub terytoriów korzystających z preferencyjnych stawek podatkowych w celu pozyskania kapitału z zagranicy. Analiza porównawcza stawek podatku dochodowego w krajach UE i niektórych rajach podatkowych pokazuje, że pomimo stopniowego obniżania stawek tych podatków w UE, zjawisko konkurencji podatkowej jest nadal bardzo silne, a pozycja rajów podatkowych jako terytoriów oferujących relatywnie niskie stawki podatkowe wydaje się być niezagrożona. W tym kontekście powstaje pytanie, czy konkurencja podatkowa jest prawdziwym problemem dla państw członkowskich UE oraz czy istnieją argumenty przemawiające za harmonizacją lub przynajmniej koordynacją podatków w krajach UE. Rozważania prowadzone w niniejszym artykule wskazują, że argumenty za wprowadzeniem koordynacji podatków w UE nie są jeszcze zbyt silne. Zarówno konkurencja podatkowa, jak i koordynacja podatków mają swoich zwolenników i przeciwników.

  17. Międzynarodowy Standard Sprawozdawczości Finansowej dla Małych i Średnich Przedsiębiorstw - istota, ocena, przyszłość

    Directory of Open Access Journals (Sweden)

    Marcin Kędzior

    2010-11-01

    Full Text Available Celem artykułu jest przedstawienie istoty oraz ocena oraz określenie przyszłości Międzynarodowego Standardu Sprawozdawczości Finansowej dla Małych i Średnich Przedsiębiorstw. W opracowaniu zaprezentowano definicję sektora małych i średnich przedsiębiorstw, cele i potrzeby wprowadzenia standardu. W dalszej części przeprowadzono opis standardów, dokonano jego oceny, a także przedstawiono opinie przedstawicieli wybranych organizacji księgowych i audytorskich w Europie. Poddano analizie wpływ MSSF dla MŚP na sektor MŚP oraz badania dotyczące MSSF dla MŚP. Zaprezentowano krajowe systemy rachunkowości po wprowadzeniu tych standardów, a także zarysowano ich przyszłość na świecie i dokonano oceny całego projektu.

  18. Wiedza i deklarowane postawy rodziców wobec szczepień ochronnych dla dzieci w Warszawie i Tallinie = Knowledge and declared attitude of parents to protective vaccination for children in Warsaw and Tallin

    OpenAIRE

    Klotško, Małgorzata; Walewska-Zielecka, Bożena; Olejniczak, Dominik; Skonieczna, Joanna

    2015-01-01

    Klotško Małgorzata, Walewska-Zielecka Bożena, Olejniczak Dominik, Skonieczna Joanna. Wiedza i deklarowane postawy rodziców wobec szczepień ochronnych dla dzieci w Warszawie i Tallinie = Knowledge and declared attitude of parents to protective vaccination for children in Warsaw and Tallin. Journal of Education, Health and Sport. 2015;5(12):89-98. ISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.35011 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%2812%29%3A89-...

  19. Realizacja „Programu zapobiegania zaburzeniom depresyjnym dla dzieci i młodzieży” w województwie łódzkim

    Directory of Open Access Journals (Sweden)

    Justyna Felcenloben

    2015-10-01

    Full Text Available Zaburzenia depresyjne stanowią istotny czynnik ryzyka zachowań samobójczych wśród nastolatków. Wykazano, że u młodocianych pacjentów po próbach samobójczych z rozpoznaną depresją występują określone czynniki ryzyka, w tym trudności szkolne i w relacjach z rówieśnikami. W programach prewencji samobójstw podkreśla się potrzebę wczesnego wykrywania zaburzeń depresyjnych i szybkiego wdrażania odpowiednich strategii terapeutycznych. Prezentowany w artykule „Program zapobiegania zaburzeniom depresyjnym dla dzieci i młodzieży” został opracowany w Departamencie Polityki Zdrowotnej Urzędu Marszałkowskiego Województwa Łódzkiego. Realizowany jest corocznie od 2010 roku przez podmioty wyłaniane w otwartych konkursach ofert. Główne cele Programu to zmniejszenie częstości występowania pełnoobjawowej depresji przez zidentyfikowanie u badanych dzieci czynników predysponujących do jej wystąpienia oraz redukcja tych czynników za sprawą zastosowanej interwencji, czyli uczestnictwa w zajęciach warsztatowych. Za cele szczegółowe autorzy uznali m.in. nabycie pożądanych umiejętności społecznych, nazywania i wyrażania odczuwanych emocji, poznanie technik radzenia sobie ze stresem, poprawę samooceny, a także podniesienie stanu wiedzy dzieci i ich rodzin na temat depresji, metod jej profilaktyki i leczenia, co może być szczególnie przydatne w przypadku pojawienia się lub nawrotu choroby. Analiza efektywności Programu obejmowała lata 2010–2013. Każdego roku Programem obejmowano ponad 0,5% populacji województwa łódzkiego w wieku 11–16 lat, łącznie w ciągu czterech lat przebadano ponad 2% populacji w tej grupie wiekowej. Do warsztatów terapeutycznych zakwalifikowano niemal co drugiego ucznia z ryzykiem depresji (20% nastolatków przebadanych w pierwszym etapie programu, u co piątego dziecka stwierdzono konieczność dalszej diagnostyki bądź terapii w poradni zdrowia

  20. Výpočty proudění a přenosu tepla pro optimalizaci konstrukce bubnové sušičky prádla

    OpenAIRE

    Čermák, Martin

    2013-01-01

    V rámci této práce byla provedena komplexní analýza elektricky vyhřívané bubnové sušičky prádla s cílem identifikovat možnosti optimalizace její konstrukce vedoucí ke zlepšení přestupu tepla. Pro řešení byl zvolen postup využívající výpočtovou dynamiku tekutin (CFD). K dosažení dostatečně detailního popisu zadaného problému byl využit komerční software Fluent společně se speciálně vyvinutým modelem přenosu tepla. Within this thesis a complex analysis of an electrically heated tumble clothe...

  1. Outplacement dla firm - bariery, potrzeby, czynniki rozwoju

    OpenAIRE

    Klimczuk, Andrzej; Klimczuk-Kochańska, Magdalena

    2012-01-01

    Polish Abstract: Raport omawia następujące zagadnienia: - Pojęcie i istota outplacementu - Zarys historii outplacementu - Zwolnienia monitorowane w kontekście procesów derekrutacyjnych - Outplacement w warunkach wzrostu ryzyka i elastyczności organizacji - Outplacement narzędziem społecznej odpowiedzialności biznesu i ekonomii społecznej - Praktyka stosowania outplacementu w Polsce - Korzyści i bariery stosowania outplacementu z perspektywy przedsiębiorstw English Abs...

  2. The origin of dispersion in DLA metallicities

    CERN Document Server

    Dvorkin, Irina; Vangioni, Elisabeth; Petitjean, Patrick; Olive, Keith A

    2015-01-01

    Recent chemical abundance measurements of damped Ly-alpha absorbers (DLAs) revealed an intrinsic scatter in their metallicity of ~0.5 dex out to z~5. In order to explore the origin of this scatter, we build a semi-analytic model which traces the chemical evolution of the interstellar matter in small regions of the Universe with different mean density, from over- to underdense regions. We show that the different histories of structure formation in these regions, namely halo abundance, mass and stellar content, is reflected in the chemical properties of the protogalaxies, and in particular of DLAs. We calculate mean metallicity-redshift relations and show that the metallicity dispersion arising from this environmental effect amounts to ~0.25 dex and is an important contributor to the observed overall intrinsic scatter.

  3. DLA’s Hydrogen Fuel Cell Pilots

    Science.gov (United States)

    2009-05-07

    DLA’s Hydrogen Fuel Cell Pilots E2S2 Conference May 7, 2009 Rob Hardison LMI rhardison@lmi.org Report Documentation Page Form ApprovedOMB No. 0704...2009 to 00-00-2009 4. TITLE AND SUBTITLE DLA’s Hydrogen Fuel Cell Pilots 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6...and fuel cells offer potential „green‟ solutions •DLA‟s efforts to measure and improve viability of fuel cells DoD is supporting long term solutions

  4. DLA kinematics and outflows from starburst galaxies

    CERN Document Server

    Razoumov, Alexei O

    2008-01-01

    We present results from a numerical study of the multiphase interstellar medium in sub-Lyman-break galaxy protogalactic clumps. Such clumps are abundant at z=3 and are thought to be a major contributor to damped Ly-alpha absorption. We model the formation of winds from these clumps and show that during star formation episodes they feature outflows with neutral gas velocity widths up to several hundred km/s. Such outflows are consistent with the observed high-velocity dispersion in DLAs. In our models thermal energy feedback from winds and supernovae results in efficient outflows only when cold (~ 300 K), dense (> 100 msun/pc^3) clouds are resolved at grid resolution of 12 pc. At lower 24 pc resolution the first signs of the multiphase medium are spotted; however, at this low resolution thermal injection of feedback energy cannot yet create hot expanding bubbles around star-forming regions -- instead feedback tends to erase high-density peaks and suppress star formation. At 12 pc resolution feedback compresses...

  5. DLA Energy Biofuel Feedstock Metrics Study

    Science.gov (United States)

    2012-12-11

    moderately/highly in- vasive  Metric 2: Genetically modified organism ( GMO ) hazard, Yes/No and Hazard Category  Metric 3: Species hybridization...4– biofuel distribution Stage # 5– biofuel use Metric 1: State inva- siveness ranking Yes Minimal Minimal No No Metric 2: GMO hazard Yes...may utilize GMO microbial or microalgae species across the applicable biofuel life cycles (stages 1–3). The following consequence Metrics 4–6 then

  6. Outplacement dla firm - bariery, potrzeby, czynniki rozwoju

    OpenAIRE

    Klimczuk, Andrzej; Klimczuk-Kochańska, Magdalena

    2015-01-01

    Polish Abstract: Raport omawia następujące zagadnienia: - Pojęcie i istota outplacementu - Zarys historii outplacementu - Zwolnienia monitorowane w kontekście procesów derekrutacyjnych - Outplacement w warunkach wzrostu ryzyka i elastyczności organizacji - Outplacement narzędziem społecznej odpowiedzialności biznesu i ekonomii społecznej - Praktyka stosowania outplacementu w Polsce - Korzyści i bariery stosowania outplacementu z perspektywy przedsiębiorstw English Abs...

  7. Analytical Method of Designing and Selecting Take-Up Systems for Mining Belt Conveyors / Analityczna Metoda Projektowania i Doboru UKŁADÓW Napinania Dla GÓRNICZYCH PRZENOŚNIKÓW TAŚMOWYCH

    Science.gov (United States)

    Kulinowski, Piotr

    2013-12-01

    ężystości taśmy uwzględnianego w obliczeniach drogi napinania jest korygowana na podstawie zależności przedstawionej w niniejszym artykule. Zastępczy moduł sprężystości taśmy powinien być uwzględniony w algorytmie obliczania długości skokuwózka napinającego, szczególnie dla przenośników, których złożony profil trasy może przyczynić się do lokalnego zmniejszenia sił w taśmie. W kolejnej części artykułu przedstawiono metodę konstruowania charakterystyk statycznych urządzeń napinających taśmę (Jabłoński, 1988), które wykorzystano do opisu stosowanych układów napinania taśmy. Spośród stosowanych urządzeń napinających przedstawiono rozwiązania ze stałym położeniem bębna napinającego podczas pracy przenośnika - tzw. sztywne urządzenia napinające oraz ze zmiennym położeniem bębna napinającego w czasie pracy przenośnika - grawitacyjne, hydrauliczne, automatyczne i nadążne. Na diagramach opisujących charakterystykę napinania, poza wymaganą wartością siły w taśmie zbiegającej z bębna napędowego, przedstawiono spodziewany przebieg jej zmiany w funkcji momentu napędowego, charakterystyczny dla danego typu urządzenia napinającego taśmę (Kulinowski, 2012). Podsumowanie artykułu stanowi przedstawienie propozycji wykorzystania charakterystyk statycznych urządzeń napinających do oceny pracy ciernego, bębnowego układu napędowego przenośnika taśmowego. Przedstawiona w artykule metoda obliczeniowa została weryfikowana poprzez badania przemysłowe i realizacje wielu złożonych projektów przenośników taśmowych uzupełnionych analizą wyników badań symulacyjnych dynamiki pracy modeli urządzeń napinających taśmę (Kulinowski, 2012).

  8. New Criteria to Assess Seismic and Rock Burst Hazard in Coal Mines / Nowe Kryteria Dla Oceny Zagrożenia Sejsmicznego I Tąpaniami W Kopalniach Węgla Kamiennego

    Science.gov (United States)

    Mutke, Grzegorz; Dubiński, Józef; Lurka, Adam

    2015-09-01

    niektórych przypadkach również wypadki śmiertelne. Przedstawiono podstawowe parametry sejsmologiczne stosowane w kraju i w świecie do oceny zagrożenia sejsmicznego. Opisano podstawowe zasady metody kompleksowej oceny stanu zagrożenia tąpnięciem, w skład której wchodzi metoda sejsmologiczna bieżącej (pomiarowej) oceny stanu zagrożenia. Od wielu lat, wraz z ciągłym rozwojem bazy aparaturowej i możliwości w zakresie cyfrowej rejestracji sejsmogramów oraz przetwarzania i interpretacji danych pomiarowych wzrasta znaczenie metod sejsmicznych, które są dzisiaj powszechnie stosowane w polskich kopalniach zagrożonych tąpaniami. Ciągła obserwacja zjawisk sejsmicznych indukowanych w trakcie rozwoju procesu eksploatacji pokładów węgla umożliwiła, w oparciu o zgromadzoną bazę danych, opracowywanie nowych kryteriów zagrożenia sejsmicznego oraz zagrożenia tąpnięciem, które winny wyraźnie poprawić efektywność metody sejsmologii górniczej. W artykule przedstawiono nowe kryteria oceny stanu bieżącego zagrożenia tąpaniami zaproponowane do stosowania w polskich kopalniach węgla kamiennego, które prowadzą eksploatację systemem ścianowym. Kryteria te są oparte na wynikach ciągłej rejestracji sejsmologicznej, połączonej z bieżącą analizą zarejestrowanych wstrząsów i obliczaniem wybranych parametrów sejsmologicznych. Parametry te to położenie ognisk wstrząsów w stosunku do wyrobisk eksploatacyjnych, energia sejsmiczna wstrząsów, suma energii sejsmicznej wyzwolona na każde 5m postępu ściany eksploatacyjnej, wartość wagowanego parametru amplitudy prędkości drgań PPVW, moment sejsmiczny M0, indeks energii EI oraz parametr b rozkładu wstrząsów według relacji Gutenberga-Richtera. Wartości powyższych parametrów są określane dla każdej doby lub w przesuwających się co dobę oknach czasowych lub oknach zawierających określoną liczbę wstrząsów, a następnie porównywane, raz na dobę, z ich wartościami

  9. The relationship between working capital and profitability in food industry firms in Poland Relacje miedzy kapitalem obrotowym a rentownoscia w przedsiebiorstwach przemyslu spozywczego w Polsce

    Directory of Open Access Journals (Sweden)

    Zbigniew GOLAS

    2013-03-01

    Full Text Available The article presents the results of the effectiveness of working capital management in the food industry in Poland. The study was conducted in the 30 branches (classes of the food industry over the period 2005-2009, based on unpublished data of the Central Statistical Office. The effectiveness of working capital management were evaluated using a cycles of inventories, receivables, liabilities and cash conversion cycle and in relation to rates of return earned on assets. Studies have shown that in industries where these cycles are the shortest achieved the highest rate of return. The beneficial effect of shortening the cycle of working capital on profitability is also verified by using regression analysis.W artykule przedstawiono wyniki badan efektywnosci zarzadzania kapitalem obrotowym w przemysle spozywczym w Polsce w ukladzie 30 branz (klas w okresie 2005-2009. Efektywnosc zarzadzania kapitalem obrotowym oceniono przy zastosowaniu cyklu zapasw, naleznosci, zobowiazan i konwersji gotwki oraz w odniesieniu do uzyskiwanych stp zwrotu z aktyww. Badania wykazaly, ze w branzach, w kth wymienione cykle byly najkre uzyskiwano najwyzsze stopy zwrotu. Korzystny wplyw skracania cykli kapitalu obrotowego na rentownosc zweryfikowano rwniez przy zastosowaniu analizy regresji.

  10. Materials of 3. scientific-technical seminar: Materials Investigation for Power Industry; Materialy 3. seminarium naukowo-technicznego: Badania Materialowe na Potrzeby Elektrowni i Przemyslu Energetycznego

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    The report is an assembly of the papers concerning material problems during the exploitation of power stations as well as during construction and exploitation of gas pipelines. The accreditation problems according to the European Standards and Office of Technical Inspection prescription are also discussed.

  11. Fundusze strukturalne dla bibliotek w okresie programowania 2007-2013

    Directory of Open Access Journals (Sweden)

    Maria Wojcińska

    2009-01-01

    Full Text Available Polska w ramach funduszy strukturalnych otrzyma w okresie programowania 2007-2013 około 67,3 mld euro. Jest to największa pomoc przyznana dotychczas państwu członkowskiemu w ramach Polityki Spójności Unii Europejskiej. Przed bibliotekami – zarówno naukowymi, jak również publicznymi czy nawet szkolnymi pojawiła się więc kolejna szansa na dofinansowanie działalności. W artykule przedstawione są możliwości skorzystania przez te instytucje z funduszy strukturalnych w latach 2007-2013 w ramach Programu Operacyjnego Infrastruktura i Środowisko, Programu Operacyjnego Rozwój Polski Wschodniej, Wielkopolskiego Regionalnego Programu Operacyjnego oraz Programu Operacyjnego Kapitał Ludzki.

  12. Navy Additive Manufacturing: Policy Analysis for Future DLA Material Support

    Science.gov (United States)

    2014-12-01

    NAVY ADDITIVE MANUFACTURING TECHNOLOGIES The Navy currently operates AM machines in depots, labs, hospitals and other warfare centers. Four major...Lorincz, J. (2014). Additive Joins Subtractive on Advanced All-in-One Machines . Manufacturing Engineering, 152(4), 67–69,71–72,74–77. McNulty, C. M...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA MBA PROFESSIONAL REPORT NAVY ADDITIVE MANUFACTURING : POLICY ANALYSIS FOR FUTURE

  13. Electron accelerators for radiosterilization; Akceleratory elektronow dla potrzeb sterylizacji radiacyjnej

    Energy Technology Data Exchange (ETDEWEB)

    Zimek, Z. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)

    1997-10-01

    The applications of electron accelerators in commercial plants for radiosterilization have been shown. Advantages of such irradiation source have been presented. The types and parameters of accelerators being installed in worldwide irradiation plants for radiosterilization have been listed as well. 2 tabs.

  14. Innowacyjny system zraszania dla wyrobisk ścianowych.

    Directory of Open Access Journals (Sweden)

    Dominik Bałaga

    2016-09-01

    Full Text Available W artykule przedstawiono innowacyjny system zraszania typu KOMAG, przeznaczony do ograniczania zapylenia generowanego podczas urabiania kombajnami w systemach ścianowych. Zaprezentowano jego budowę, parametry pracy oraz zasadę działania. Omówiono wyniki badań jego skuteczności działania przeprowadzonych w warunkach rzeczywistych.

  15. Early Lessons Learned from DLA Hydrogen Demonstration Projects

    Science.gov (United States)

    2011-05-12

    Improve Manufacturing Readiness Levels (MRLs) for fuel cells and electrolyzers • “Green” hydrogen – reduced CO2 emissions Objectives: • “Green” H2...WORKFORCE DEVELOPMENT 0 500 1000 1500 2000 2500 3000 3500 4000 Fi lls /W ee k Air Products Count by Segment Cars /Buses Mat Handling 10/2008...reliability. • New humidifier design to increase humidifier life. • Design and manufacturing improvements for air compressor , reducing cost by ~10

  16. Izoflawony jako alternatywa dla terapii hormonalnej wieku menopauzalnego

    Directory of Open Access Journals (Sweden)

    Michał Bijak

    2010-12-01

    Full Text Available Isoflavones are members of flavonoids which belong to phytoestrogens, a group of non-steroid plant substancesthe chemical structure of which is similar to 17-β-estradiol. One of the richest sources of isoflavones issoybeans and legumes. The most important representatives of this class of compounds which have biologicalactivity are daidzein and genistein. Isoflavones are able to bind to estrogen receptors (ER however, their affinityto ER-β is higher than ER-α. Interaction isoflavones with ER lead to their activation. which causes cell response.The last epidemiological studies provide evidence that in Asia where soya is present in the traditional diet,women have less negative symptoms of menopause compared with the Western population. Clinical studiescarried out in recent years have shown that soy protein or genistein supplementation reduces the number ofhot flushes in post menopausal women. Similar results are shown for bone health. Genistein supplementationcauses an increase in bone mineral density (BMD and decrease in levels of bone resorption markers at a levelcomparable to hormone therapy. Isoflavones have also positive effects on the cardiovascular system. For allthese reasons isoflavones are becoming an increasingly popular and safe alternative to hormone therapy forwomen with menopausal symptoms. This article describes the structure and metabolism of isoflavones as wellas mechanism of action and results of clinical studies in postmenopausal women receiving isoflavones.

  17. How DLA’s Supply Performance Affects Air Force Readiness

    Science.gov (United States)

    1990-10-01

    used by the Air Force, Navy, and Army, as well) are described in a paper by Victor J. Presutti, Jr., and Richard C. Trepp , "More Ado About Economic...how wholesale safety-level requirements for consumables were to be computed. The basic approach of the Presutti/ Trepp method is to minimize ordering

  18. Batched Triangular DLA for Very Small Matrices on GPUs

    KAUST Repository

    Charara, Ali

    2017-03-13

    In several scientific applications, like tensor contractions in deep learning computation or data compression in hierarchical low rank matrix approximation, the bulk of computation typically resides in performing thousands of independent dense linear algebra operations on very small matrix sizes (usually less than 100). Batched dense linear algebra kernels are becoming ubiquitous for such scientific computations. Within a single API call, these kernels are capable of simultaneously launching a large number of similar matrix computations, removing the expensive overhead of multiple API calls while increasing the utilization of the underlying hardware.

  19. Strategic Material Supply Mitigation Initiatives within DLA - Strategic Materials

    Science.gov (United States)

    2012-05-24

    34’ ) • •~t I’ ’" " ... ’ " ’ . . " M N "! n :.e M J! ’U ~" :.: n :.! 30 ’ " ’ ’ ’ "’ : :JS "’ K Ca Sc Ti v Cr Mn Fe Co Ni Cu Zn Ga Ge Ps Se Br Kr...reactors · JET ·ITER • DoE Weapons • Nuclear fuels • Braze materials • Additives (developmental) Beryllium IMU BerytiLm Sunshade and Optics

  20. Summaries of the 40. Scientific Assembly of Polish Chemical Society and Association of Engineers and Technicians of Chemical Industry; Streszczenia 40. Zjazdu Naukowego Polskiego Towarzystwa Chemicznego i Stowarzyszenia Inzynierow i Technikow Przemyslu Chemicznego

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    Annual 40. Scientific Assembly of Polish Chemical Society and Association of Engineers and Technicians of Chemical Industry has been held in Gdansk on 22-26 September 1997. The most valuable scientific results obtained in Polish Laboratories have been presented in 22 main sections and 7 symposia directed especially at following subjects: analytical chemistry, biochemistry, solid state chemistry and material science, physical chemistry, heteroorganic and coordination chemistry, medical and pharmaceutical chemistry, metalorganic chemistry, inorganic and organic chemistry, polymers chemistry, chemistry and environment protection, theoretical chemistry, chemical didactics, photochemistry, radiation chemistry and chemical kinetics, chemical engineering, catalysis, crystallochemistry, chemical technology, electrochemistry, and instrumental methods.

  1. Kriegsbeute-Ausstellung Posen 1917. Propagandowa wystawa dla szerokiej publiczności

    Directory of Open Access Journals (Sweden)

    Jakub Skutecki

    2014-01-01

    Full Text Available W zbiorach ikonograficznych Biblioteki Uniwersyteckiej w Poznaniu znajduje się seria widokówek dokumentujących zorganizowaną w 1917 roku Wystawę Zdobyczy Wojennych (Kriegsbeute-Ausstellung Posen 1917, jedną z serii propagandowych ekspozycji prezentujących sukcesy armii niemieckich na wszystkich frontach wielkiej wojny. W czasie trwania wystawy w pobliżu belgijskiego Passchendaele toczyła się jedna z najkrwawszych bitew, a w Poznaniu – codzienne życie w wojennej rzeczywistości.

  2. Demand Forecasting: DLA’S Aviation Supply Chain High Value Products

    Science.gov (United States)

    2015-04-09

    seems to dominate the pattern of product demand from FY10 to FY13. However, as discussed above, the outlier demand value in FY13 could have zapped out...seems to dominate the pattern of product demand, and on the other, an extreme outlier value that could zap out some of the FY14 product demand. We

  3. Outplacement dla firm - bariery, potrzeby, czynniki rozwoju (Outplacement for Companies - Barriers, Needs, Growth Factors)

    OpenAIRE

    Klimczuk, Andrzej; Klimczuk-Kochańska, Magdalena

    2012-01-01

    Polish Abstract: Raport omawia następujące zagadnienia: - Pojęcie i istota outplacementu - Zarys historii outplacementu - Zwolnienia monitorowane w kontekście procesów derekrutacyjnych - Outplacement w warunkach wzrostu ryzyka i elastyczności organizacji - Outplacement narzędziem społecznej odpowiedzialności biznesu i ekonomii społecznej - Praktyka stosowania outplacementu w Polsce - Korzyści i bariery stosowania outplacementu z perspektywy przedsiębiorstw English Abstract: This report discus...

  4. Sieciowe usługi informacyjne dla nauk technicznych : BazTech, BazTOL

    OpenAIRE

    2007-01-01

    The paper presents the current state and plans for development of the BazTech "Polish Technical Journals Contents" database. It is created by 22 academic libraries and centers for scientific information. The project is coordinated by the Cracow University of Technology. The Baz Tech database, situated at http://baztech.icm.edu.pl (ICM UW server), within the framework of the project "Virtual Scientific Library" lists over 400 journals. The paper also describes the assumptions for the creation ...

  5. 32 CFR Appendix A to Part 1285 - Gaining Access to DLA Records

    Science.gov (United States)

    2010-07-01

    ..., materials handling equipment, kitchen and laundry equipment, woodworking and metalworking machines... Part 1285 National Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS DEFENSE LOGISTICS AGENCY FREEDOM OF INFORMATION ACT PROGRAM Pt. 1285, App. A Appendix A to...

  6. Przyspieszona nauka konkurencji. Przewodnik dla zbłąkanych w gąszczu reformy

    Directory of Open Access Journals (Sweden)

    Piotr Szenajch

    2012-12-01

    Full Text Available Crash course on competition. A guide for the lost in the tangle of reform The key resolutions of the reform of the Polish system of science and higher education entered into force in the academic year 2011/2012. This essay contains an in-depth reading of the key governmental documents and legal acts that introduced the reform. Additionally, it comprises a description of the intensive critical discussion on the reform that, unfortunately, started only when the legislative process was nearly finished. Drawing from this debate and developing its interpretations, the essay analyses key institutional solutions of the reform; its fundamental assumptions; its rhetoric and, generally, its discursive background. Such solutions as: moving towards a more competition-based system of public funding for institutions and individuals; intensification of supervision based on quantitatively measured achievement, or enforcing a multi-level integration of public universities with the local business sector do not address the most urgent problems of the underfinanced and insecure students, PhD candidates and academics. In their naively individualistic approach, the reformers ignore the reflection on the social reproduction or the collective and structural aspects of scientific fields. Their monolithic vision of science leads them to imposing requirements developed for natural and technical disciplines upon social sciences and humanities. Finally, what they present as objective expert knowledge grounding the reform can be interpreted as based on deeply conservative economical and ethical assumptions as well as detached from a comprehensive empirical diagnosis.

  7. A new galactic chemical evolution model with dust: results for dwarf irregular galaxies and DLA systems

    CERN Document Server

    Gioannini, Lorenzo; Vladilo, Giovanni; Calura, Francesco

    2016-01-01

    We present a galactic chemical evolution model which adopts updated prescriptions for all the main processes governing the dust cycle. We follow in detail the evolution of the abundances of several chemical species (C, O, S, Si, Fe and Zn) in the gas and dust of a typical dwarf irregular galaxy. The dwarf irregular galaxy is assumed to evolve with a low but continuous level of star formation and experience galactic winds triggered by supernova explosions. We predict the evolution of the gas to dust ratio in such a galaxy and discuss critically the main processes involving dust, such as dust production by AGB stars and Type II SNe, destruction and accretion (gas condensation in clouds). We then apply our model to Damped Lyman-Alpha systems which are believed to be dwarf irregulars, as witnessed by their abundance patterns. Our main conclusions are: i) we can reproduce the observed gas to dust ratio in dwarf galaxies. ii) We find that the process of dust accretion plays a fundamental role in the evolution of du...

  8. Star Formation from DLA Gas in the Outskirts of Lyman Break Galaxies at z~3

    CERN Document Server

    Rafelski, Marc; Chen, Hsiao-Wen

    2010-01-01

    We present evidence for spatially extended low surface brightness emission around Lyman break galaxies (LBGs) in the V-band image of the Hubble Ultra Deep Field, corresponding to the z~3 rest-frame FUV light, which is a sensitive measure of Star Formation Rates (SFRs). We find that the covering fraction of molecular gas at z~3 is not adequate to explain the emission in the outskirts of LBGs, while the covering fraction of neutral atomic-dominated hydrogen gas at high redshift is sufficient. We develop a theoretical framework to connect this emission around LBGs to the expected emission from neutral H I gas i.e., Damped Lyman Alpha systems (DLAs), using the Kennicutt-Schmidt (KS) relation. Working under the hypothesis that the observed FUV emission in the outskirts of LBGs is from in-situ star formation in atomic-dominated hydrogen gas, the results suggest that the SFR efficiency in such gas at z~3 is between factors of 10 and 50 lower than predictions based on the local KS relation. The total star formation r...

  9. A cold component and the complex velocity structure of DLA1331+170

    CERN Document Server

    Carswell, R F; Wolfe, A M; Murphy, M T

    2010-01-01

    [ABRIDGED] We examine the velocity structure in the gas associated with \\ion{H}{1} in the damped Ly$\\alpha$ absorption system at redshift $z=1.7764$ towards the QSO $1331+170$ using 21cm data, optical and STIS spectra. We find at least two, and possibly three, components showing \\ion{C}{1} lines. One of these has Doppler parameter $b=0.55${\\kms}, corresponding to a kinetic temperature of 220K if the broadening is thermal. We re-examine the H$_2$ analysis undertaken by \\citet{Cui05} using the neutral carbon velocity structure, and find a model which is, consistent with a mixture of collisional and background radiation excitation of the observed H$_2$ rotational levels. For singly ionized heavy elements we find eight components covering a velocity range of $\\sim 110$ {\\kms}. The \\ion{H}{1} structure is expected to follow some combination of the singly ionized and neutral gas, but the 21cm absorption profile is considerably different. This may be because of the different extent and brightness distributions of th...

  10. Diagnostyczna funkcja arteterapii na oddziale psychiatrycznym dla młodzieży – opis przypadku

    Directory of Open Access Journals (Sweden)

    Agnieszka Gmitrowicz

    2012-09-01

    Full Text Available Opis przypadku klinicznego dotyczy analizy dynamiki obrazu psychopatologicznego u pacjentki hospitalizowanej w Klinice Psychiatrii Młodzieżowej, w kontekście twórczości spontanicznej oraz inspirowanej w trakcie indywidualnych zajęć arteterapii. Proces rediagnozy – z choroby afektywnej dwubiegunowej na zaburzenia schizoafektywne – został zapoczątkowany w toku omawiania prac plastycznych pacjentki. W jej twórczości podczas kolejnej fazy depresyjnej bez objawów psychotycznych zaczęły występować: cechy znacznej dezorganizacji, symbole, deformacja postaci, kontaminacje, nieuzasadnione treścią podziały przestrzeni, zachwiania perspektywy, o kilka miesięcy wyprzedzające rozwój pełnoobjawowej psychozy o obrazie schizofrenii. Osiemnastoletnia pacjentka, chorująca od roku, początkowo była leczona z powodu manii w przebiegu choroby afektywnej dwubiegunowej. Prezentowała podwyższony nastrój i napęd, przyspieszony tok myślenia, wypowiadała urojenia wielkościowe, posłannicze, skracała dystans, relacjonowała „wyostrzenie zmysłów”, „poszerzenie świadomości”, chciała „nieść światu piękno”. Relacjonowała, że od dawna obserwuje u siebie wahania nastroju – od stanów „depresji” z uczuciem smutku, wyczerpania, anhedonii, nadmierną sennością, znacznym spadkiem aktywności, myślami samobójczymi do stanów „euforii”, „hiperaktywności”. Krótko po wypisie pacjentka odstawiła leki i po kilku miesiącach trafiła ponownie na oddział z objawami epizodu depresji i tendencjami samobójczymi. W trakcie tej hospitalizacji pacjentce zaproponowano udział w indywidualnych zajęciach arteterapeutycznych z uwagi na jej spontaniczną twórczość plastyczną (w tym malowanie na ścianach oraz odmowę udziału w zajęciach grupowych. Zespół terapeutyczny, w skład którego wchodziła arteterapeutka, określił następujące cele arteterapii: diagnostyczny, komunikacyjny, integracyjny i katartyczny. Dodatkową rolą arteterapeutki było inicjowanie zmian w funkcjonowaniu pacjentki oraz indywidualnego procesu twórczego.

  11. SYSTEM WYŚWIETLANIA PARAMETRÓW LOTU DLA ŚMIGŁOWCA TYPU Mi-17 – WYNIKI BADAŃ

    Directory of Open Access Journals (Sweden)

    Bęczkowski Grzegorz

    2015-08-01

    Full Text Available Przedmiotem artykułu są badania w locie nowo opracowanego systemu wyświetlania parametrów lotu (SWPL. Omawiany system przeznaczony jest do zobrazowania na wyświetlaczu przeziernym umieszczonym przed okiem pilota pełnej informacji pilotażowo-nawigacyjnej, ostrzeganiu o sytuacji niebezpiecznej na pokładzie śmigłowca i sygnalizacji błędów pracy systemów pokładowych. System przystosowany jest do pracy w warunkach dziennych i nocnych, przy czym w warunkach nocnych współpracuje z goglami noktowizyjnymi stosowanymi w lotnictwie Sił Zbrojnych RP.

  12. Chemopreventive effect and HPTLC fingerprinting analysis of Jasminum sambac (L.) Ait. Extract against DLA-induced lymphoma in experimental animals.

    Science.gov (United States)

    Kalaiselvi, M; Narmadha, R; Ragavendran, P; Vidya, B; Gomathi, D; Raj, C Arul; Starlinraj, T; Gopalakrishnan, V K; Uma, C; Kalaivani, K

    2013-02-01

    The anticancer activity of the ethanolic extract of Jasminum sambac against Dalton's lymphoma ascites-induced lymphatic cancer in Swiss albino mice was investigated. The anticancer activity of J. sambac was studied against lymphoma using lipid profiles, biochemical parameters, and membrane-bound marker enzymes by standard procedures. A high-performance thin-layer chromatography fingerprinting analysis showed the presence of terpenoids and flavonoids. The levels of cholesterol, triglyceride, VLDL cholesterol, and LDL cholesterol were significantly decreased in tumor-induced mice, while HDL cholesterol showed increased levels compared with those profiles. On treatment with J. sambac, the levels were brought back to near normal. The albumin, creatinine, total protein, urea, and uric acid contents were also approaching normal values. There was s significant increase in the levels of ATPase in group II. These levels were brought back to normal upon plant extract treatment of mice. DNA fragmentation occurred in the tumor-induced group of tissue, and treatment with ethanolic extract reduced the DNA damage caused by lymphoma. Expression of lactate dehydrogenase (LDH) isoenzymes shows an increase in the levels of LDH-4 and LDH-5 in cancer-bearing animals which is brought back to near normal. Histopathological investigation showed normal sections of liver tissues in the treatment group. The results found in mice treated with ethanolic extract 100 mg kg(-1) body weight quite promising and were comparable with the standard drug 5-fluorouracil. The statistically processed results support the conclusion that the ethanolic extract of J. sambac flower (100 mg kg(-1)) possesses a dose-dependent significant anticancer activity against lymphoma.

  13. Followup Audit: DLA Officials Took Appropriate Actions to Address Concerns With Repair Parts for the High Mobility Multipurpose Wheeled Vehicle

    Science.gov (United States)

    2016-04-29

    Requiring Comment Contracting Officer, Defense Logistics Agency Land and Maritime None INSPECTOR GENERAL DEPARTMENT OF DEFENSE 4800 MARK CENTER DRIVE...that would affect our findings and conclusions. Therefore, we determined that the data were sufficiently reliable for the purpose of this followup...April 4, 2014 Report No. D-2013-090, “Improved Guidance Needed to Obtain Fair and Reasonable Prices for Sole-Source Spare Parts Procured By the

  14. DLA TEST Defense Infrastructure: Improvement Needed in Energy Reporting and Security Funding at Installations with Limited Connectivity

    Science.gov (United States)

    2016-01-01

    turbines . However, the officials said the wind is too turbulent at these locations, such that the wind has knocked down a wind turbine prototype that was...adding wind turbines for electrical generation could cause disruptions in the electrical frequency of the grid. Despite the potential challenges...164 DOD Energy Management arrays on rooftops and car ports. Almost all of the installation housing is owned by a private developer and has solar

  15. Ideologia gender realnym zagrożeniem dla małżeństwa i rodziny

    OpenAIRE

    Pawłowicz, Jacek Jan

    2012-01-01

    Gender jest jedną z tych niebezpiecznych i szeroko dziś lansowanych ideologii, która walczy z tradycyjną rodziną i macierzyństwem. Macierzyństwo i wychowywanie dzieci są według niej formą ucisku kobiety. Dlatego antykoncepcja, aborcja na żądanie, rozpasanie seksualne są warunkami niezbędnymi do „wyzwolenia” kobiet. Ideologia ta zakłada, że człowiek nie rodzi się ani kobietą, ani mężczyzną w sensie kulturowym. To dana kultura konstruuje określenia „kobieta” i „mężczyzna” i w ten sposób dete...

  16. Coal/Biomass-to-Liquids Demonstration Testing for DLA Energy: Report on Project Tests, Evaluations, and Recommendations

    Science.gov (United States)

    2015-08-20

    Wood/Coal Blends 6-91 Table 6-73: WPC Test Plan 6-92 Table 6-74: Ultimate and Chlorine Analyses of Primary Feed Components and Target MSW 6-94 Table...C16H10 pyrene C16H10 fluroanthene (same as pyrene) CaO calcium oxide CH4 methane Cl chlorine CO carbon monoxide CO2 carbon dioxide Fe2O3 iron...also used to measure trace levels of key hydrocarbons such as methane, ethylene , ethane, and propene. Draeger tubes were selectively used to measure

  17. The primordial deuterium abundance: subDLA system at zabs = 2.437 towards the QSO J 1444+2919

    Science.gov (United States)

    Balashev, S. A.; Zavarygin, E. O.; Ivanchik, A. V.; Telikova, K. N.; Varshalovich, D. A.

    2016-05-01

    We report a new detection of neutral deuterium in the sub-Damped Lyman Alpha system with low metallicity [O/H] = -2.042 ± 0.005 at zabs = 2.437 towards QSO J 1444+2919. The hydrogen column density in this system is logN(H I) =19.983 ± 0.010 and the measured value of deuterium abundance is log(D/H) = -4.706 ± 0.007stat ± 0.067syst. This system meets the set of strict selection criteria stated recently by Cooke et al. 2014 and, therefore, widens the Precision Sample of D/H. However, possible underestimation of systematic errors can bring a bias into the mean D/H value (especially if one uses a weighted mean). Hence, it might be reasonable to relax these selection criteria and thus increase the number of acceptable absorption systems with measured D/H values. The unweighted mean value of 15 robust D/H measurements gives a conservative value of the primordial deuterium abundance (D/H)p = (2.54 ± 0.19) × 10-5 which is in good agreement with the prediction given by analysis of the cosmic microwave background radiation for the standard big bang nucleosynthesis. By means of the derived unweighted mean (D/H)p value the baryon density of the Universe Ωbh2 = 0.0218 ± 0.0010 and the baryon-to-photon ratio η = (5.96 ± 0.27) × 10-10 have been deduced. These values have confidence intervals which are less stringent than that obtained for the Precision Sample and, thus, leave a broader window for new physics. The latter is particularly important in the light of the lithium problem.

  18. Biblioteczne warsztaty nauki języka włoskiego dla dzieci - nauka poprzez zabawę

    OpenAIRE

    Koman Aleksandra

    2016-01-01

    During the Week of Italian Culture organised by the Pedagogical University of Cracow a library workshop of teaching the Italian language to preschool children was arranged. The program was based on Bobles, activating the linguistic memory through physical activation, and included three games which were supposed to help the children to memorise, in an accessible way, the names of colours, animals, and some basic expressions in Italian. Moreover, the children also participated in the artistic p...

  19. Poszukiwanie alternatyw dla kary pozbawienia wolności — ujęcie prawno porównawcze

    OpenAIRE

    Tobis, Aleksander

    1986-01-01

    The article is divided into four parts. The first one discusses the efforts of the Committee of Delinquency Problems, the organ of the Council of Europe, in the field of organizational and scientific actions concerning the problems of searching alternative means to deprivation of liberty punishment. Several recommendations and resolutions were passed. Also the socialist States undertook certain efforts in order to avoid application of the deprivation of liberty punishment,. ...

  20. Biblioteczne warsztaty nauki języka włoskiego dla dzieci - nauka poprzez zabawę

    Directory of Open Access Journals (Sweden)

    Koman Aleksandra

    2016-12-01

    Full Text Available During the Week of Italian Culture organised by the Pedagogical University of Cracow a library workshop of teaching the Italian language to preschool children was arranged. The program was based on Bobles, activating the linguistic memory through physical activation, and included three games which were supposed to help the children to memorise, in an accessible way, the names of colours, animals, and some basic expressions in Italian. Moreover, the children also participated in the artistic part of the workshop and the revision part. Events like these are not only an unconventional attempt at teaching a foreign language to children, but also a great example of active participation of libraries in the process of education of the youngest user.

  1. Program obnovy venkovského sídla Miličín (okres Benešov)

    OpenAIRE

    TUPÁ, Nikola

    2013-01-01

    This bachelor thesis deals with the recovery program of rural municipality, which is situated in the district Benešov ? municipality Miličín. In the introductory chapter is given an analysis of literature on rural development and directing of it. Attention is also devoted to materials of regional and territorial development processed for addressing municipality and region. After come a characteristic of the municipality, its physiographical units and components of human geography. The main po...

  2. Activity Based Costing within a DLA Depot’s Planning and Resource Management Department: A Model and Analysis

    Science.gov (United States)

    1994-09-01

    2) is composed of two sections. The first section is the Analysis and Review section ( RBA ) This section i s primarily composed of budget analysts...of the local area led to these policy guidelines though exceptions are readily made for special circumstances. The output i.s measured by the number of...manhours available for the analysts (both management a4nd budget) and the accounting technicians. The monetary value of each of these outputs (all

  3. DLA (Defense Logistics Agency) Quality Circles Workshop Held at Alexandria, Virginia on 7-9 August 1985.

    Science.gov (United States)

    1985-08-09

    personality conflicts but avoiding group therapy. He discussed the barriers in communicating, such as selective hearing and believing, and stereotyping ...Hopper. ""Creative process -- Making of the new or rearranging of the old in a new way." Walt Disney . 5. Creative Behavior formula: C3 = I x D x E x A I

  4. Choice of getting elements for different mining and geology conditions; Dobor organow urabiajacych dla roznych warunkow gorniczo-geologicznych

    Energy Technology Data Exchange (ETDEWEB)

    Krauze, K. [Akademia Gorniczo-Hutnicza, Cracow (Poland); Skrzypiec, A. [Zabrzanskie Zaklady Naprawcze Przemyslu Weglowego S.A. (Poland)

    1995-12-01

    One of the basic conditions of proper operation of longwall cutter-loader is a right choice of getting elements which meet the user`s requirements. The presented choice and design procedure of milling worm elements, using computer technique, allows to reduce time of choice decision as well as design time of the elements for the required mining and geology conditions. This method and computer programs were implemented in the Zabrze Coal Industry Repair Workshops at Zabrze. (author). 6 refs., 9 figs.

  5. The concept of the geoportal for the youngest generation on the example of Koszalin. (Polish Title: Koncepcja portalu geoinformacyjnego dla najmlodszego pokolenia na przykladzie miasta Koszalin)

    Science.gov (United States)

    Szczepaniak-Kołtun, Z.

    2015-12-01

    General access to the Internet and the facility of obtaining spatial data contribute to the existence of geoportals. The diversity of such portals relate not only to their administrative range (national, regional, communal) but also to a wide range of themes (for instance for mushroom pickers, globetrotters...). It allows the usage of geoportals by a larger and diverse group of society. Despite such diversity it can be observed that these portals are directed at adult society and young people who already have a certain amount of geographical knowledge. Considering that from an early age children have contact with the Internet, a good practice for them would be a geoinformational portal created for children. Such early learning would lead to the creation of children's "geo-intellect" by developing their visual and spatial intelligence. Exploring the world, including in a virtual form, it is a way of shaping the imagination of children. It is a type of learning through play, and therefore children can assimilate "geo-knowledge" in an imperceptible way. In this article the author, with the help of his 8-year-old daughter and her peers wants to present the concepts of geoportal for children, which would include the most important objects for little recipients. By using the colour pictograms the portal shows the places where children can play (playgrounds, sports fields), eat a "little something" (ice cream parlour), or take the family to "attractive points" (parks, cinemas, railway station). To achieve better spatial identification the children's geoinformational portal also shows characteristic buildings (town hall, churches) as well as natural objects (rivers, lakes).The Geoportal for the youngest generation is a way for shaping good habits in surfing the Internet, but also it can be a counterweight to social networks being in common use.

  6. Znaczenie intencji dla moralnej oceny czynu - stanowisko Daniela Wegnera (THE MEANING OF INTENTION FOR MORAL EVALUATION OF AN ACTION - DANIEL WEGNER VIEW

    Directory of Open Access Journals (Sweden)

    Marcin Cichosz

    2008-12-01

    Full Text Available In the article, the author attempts to compare and confront Daniel Wegner's idea of a conscious will with the selected ethic doctrines in the context of relationship between intention and the moral evaluation of an action. According to the utilitarian doctrine, when one evaluates an action intention should not be considered because only the results of an action are relevant. On the other hand, Kant and the ethics of love for fellowmen claim that intention is a direct cause of action, therefore, it is intention that should really be evaluated. On the basis of Wegner's model of a conscious will, one may state that an utilitarian attitude is more justified in many causes. In the act of volition, intention serves only as a commentary, rather than as a cause (as it is commonly believed. In Wegner's opinion the main role of intention is to explain action in the context of the plans, desires and beliefs of an agent. It is all due to the fact that in social interactions, one should always have the ability to explain one's own behavior: ignorance of the causes of one's behavior is inadmissible in this context (odium of insane action. Moreover, when intention and action match, a specific kind of feeling - phenomenal will - is added to the act of volition. This particular feeling not only strengthens the relationship between intention and action. but it also helps the agent to distinguish his own actions from other actions of other agents. It means that the ultimate form of intention may be completely different from the actual causes of a particular type of behavior.To conclude, due to Wegner's work, the utilitarian doctrine gained strong support for the thesis that intention should not be considered during the moral evaluation of action.

  7. Galaxy counterparts of metal-rich damped Lyα absorbers - I. The case of the z= 2.35 DLA towards Q 2222−0946

    NARCIS (Netherlands)

    Fynbo, J.P.U.; Laursen, P.; Ledoux, C.; Møller, P.; Durgapal, A.K.; Goldoni, P.; Gullberg, B.; Kaper, L.; Maund, J.; Noterdaeme, P.; Östlin, G.; Strandet, M.L.; Toft, S.; Vreeswijk, P.M.; Zafar, T.

    2010-01-01

    We have initiated a survey using the newly commissioned X-shooter spectrograph to target candidate relatively metal-rich damped Lyα absorbers (DLAs). Our rationale is that high-metallicity DLAs due to the luminosity-metallicity relation likely will have the most luminous galaxy counterparts. In

  8. Statistical analysis of radiological diagnostics in the population of the Wroclaw province; Diagnostyka rentgenowska dla ludnosci wojewodztwa wroclawskiego w ujeciu statystycznym

    Energy Technology Data Exchange (ETDEWEB)

    Demczuk, P. [Oddzial Ochrony Radiologicznej, Wojewodzka Stacja Sanitarno-Epidemiologiczna, Wroclaw (Poland); Jankowski, J. [Zaklad Ochrony Radiologicznej, Instytut Medycyny Pracy, Lodz (Poland)

    1997-12-31

    The authors present statistical data on the frequency and kinds of radiological examinations performed in the Wroclaw province. The average number of examinations in 1995 was estimated at 608 per 1000 inhabitants. The chest X-ray examinations make one fourth of all diagnostic radiological examinations. (author)

  9. Computer technology helpful to minimize drilling costs in ZPNiG; Wykorzystanie techniki komputerowej dla minimalizacji kosztow wiercenia w ZPNiG Krakow

    Energy Technology Data Exchange (ETDEWEB)

    Fugiel, K.A. [Zaklad Poszukiwania Nafty i Gazu, Krakow (Poland)

    1996-02-01

    The paper shows the data acquisition system in a field laboratory unit of Drillab Co. It enables analyses of drilling costs at real time of rig operations. Major equations to reckon drilling costs have been given and performed simulations pointed out necessity to use though not cheap, but `aggressive`, efficient, durable and repeatable equipment, which substantially will lower costs of drilling. (author). 4 refs., 10 figs., 2 tabs.

  10. Stage models of homosexual identity formation. Implications for therapeutic practice [Stadialne modele formowania się tożsamości homoseksualnej. Implikacje dla praktyki terapeutycznej

    Directory of Open Access Journals (Sweden)

    Mijas, Magdalena

    2012-10-01

    Full Text Available The authors discuss stage models of gay and lesbian identity formation first proposed during the 1970s within affirmative approaches to homosexuality. The process of developing homosexual identity is characterized here with linearly ordered stages distinguished around major developmental events leading to new self-definition. Among many stage proposals the authors have chosen and presented two: by Vivienne Cass and Susan McCarn with Ruth Fassinger. The presented models were analysed in terms of their usefulness in therapeutic practice aimed at promoting the formation of gay identity, for which they have been originally designed. An important part of this discussion is evaluation of the accuracy of developmental process descriptions contained in stage models.

  11. Ponowoczesność jako nowa szansa dla Oświecenia, czyli o konieczności przezwyciężenia nowoczesności

    Directory of Open Access Journals (Sweden)

    Markus Lipowicz

    2013-06-01

    Full Text Available Post-modernity as a New Chance for the Enlightenment: On Necessity of Overcoming Modernity. The aim of this paper is to demonstrate that the end of modernity does not necessary comprise a cultural regress but can also be seen as new stage of the process of Enlightenment in Western history. After the presentation of popular and commonly recognized definitions of modernity and postmodernity, the author will attempt to demonstrate the main limitations of modernity on the basis of philosophies of Max Stirner and Frederic Nietzsche. The author’s main objection to modernity is its tendency to reproduce the centralistic structure of pre-modern traditional communities in which one metaphysical term designated the universally obligatory norms. By way of crashing this structure, postmodernity opens new possibilities to an individual for creating new, particular values, thus enabling the individual to discover new forms of self-realization. To make human life in such a decentralized society possible, the individual would have to attain a new mental level. Civil education, therefore, has to go beyond the borders of modernity and be open to new ways of learning and solving social conflict.

  12. Radiologic anatomy of the paranasal sinuses in computed tomography for the need of the endoscopic surgery; Anatomia radiologiczna zatok przynosowych w obrazach tomografii komputerowej dla potrzeb chirurgii endoskopowej

    Energy Technology Data Exchange (ETDEWEB)

    Boguslawska-Staniaszczyk, R.; Krzeski, A.; Mastalerski, J. [Centralny Szpital MSW, Warsaw (Poland)]|[Akademia Medyczna, Warsaw (Poland)

    1994-12-31

    Computed tomography is the most useful method in the endoscopic surgery of the nose and paranasal sinuses. CT examination is necessary for planing and the extent of the surgery. In this publication the method of CT examination and radiological anatomy of the nose and paranasal sinuses is described. (author). 15 refs, 10 figs.

  13. Selected Methods of Rock Structure Disintegration to Control Mining Hazards / Wybrane Metody Dezintegracji Struktury Skał Dla Zwalczania Zagrożeń Górniczych

    Science.gov (United States)

    Kabiesz, Józef; Lurka, Adam; Drzewiecki, Jan

    2015-09-01

    Natural hazards are inseparable element of underground mining, particularly of coal mining process. They are combated on a regular basis by many measures and effectiveness of these measures determines work safety in mines. Attempts to improve the effectiveness, presented in the paper is based on interference of seismic waves generated by blasting in a selected area of the rock mass and on modification of blasting technology. Preliminary results of detonating classical and new type of explosives in specific temperature and pressure conditions are analyzed. Theoretical and practical consideration of obtaining an interference effect of seismic waves is discussed. A device for making systems of starting notches and a construction of a chamber to test explosives are presented. Nieodłącznym elementem podziemnego górnictwa, szczególnie węglowego, są zagrożenia naturalne. Ich zwalczanie jest codzienną praktyką, a jego skuteczność decydująco wpływa na bezpieczeństwo pracy. Przedstawione w artykule próby poprawy tej skuteczności obejmują badania efektu nakładania się w wybranym obszarze górotworu drgań generowanych robotami strzałowymi oraz informacje o próbach modyfikacji strzelniczych technik szczelinowania skał, a także wstępne wyniki badania charakterystyk eksplozji klasycznych i nowych materiałów wybuchowych w nietypowych warunkach temperatur i ciśnienia. Omówiono między innymi teoretyczne i praktyczne warunki uzyskiwania efektu interferencji drgań oraz przedstawiono urządzenie do wykonywania systemów tzw. szczelin zarodnikowych i konstrukcję komory będącej elementem stanowiska do badania MW.

  14. Wyzwania kryzysu zadłużenia strefy euro dla poszukiwania nowej roli Niemiec w Unii Europejskiej w XX wieku

    OpenAIRE

    Cziomer, Erhard

    2012-01-01

    The challenges posed by the eurozone debt for Germany in searching for its new role in the European Union in the 21st century The paper tries to present the role and importance of Germany for overcoming the debt crisis and searching for a new role to play in the EU. It consists of three parts, which concentrate on an analysis of the following issues: 1) the origin, nature and implications of the eurozone crisis for Germany, 2) the role of Germany in the efforts to overcome the eurozone ...

  15. {sup 29}Si MAS NMR for the zeolite Y - gallium oxide system; {sup 29}Si mas NMR dla ukladu fojazyt-tlenek galu

    Energy Technology Data Exchange (ETDEWEB)

    Sulikowski, B.; Derewinski, M. [Inst. Katalizy i Fizykochemii Powierzchni, Polska Akademia Nauk, Cracow (Poland); Olejniczak, Z.; Segnowski, S. [Institute of Nuclear Physics, Cracow (Poland)

    1994-12-31

    Wide-pore zeolites modified by gallium oxide has been prepared for catalytic use. Its physico-chemical and catalytic properties have been studied. The structure changes of the catalyst have been investigated by means of MAS NMR spectroscopy. Spectra of {sup 29}Si has been described and discussed. 11 refs, 4 figs, 2 tabs.

  16. The primordial deuterium abundance: subDLA system at $z_{\\rm abs}=2.437$ towards the QSO J1444+2919

    CERN Document Server

    Balashev, S A; Ivanchik, A V; Telikova, K N; Varshalovich, D A

    2015-01-01

    We report a new detection of neutral deuterium in the sub Damped Lyman Alpha system with low metallicity [O/H]\\,=\\,$-2.042 \\pm 0.005$ at $z_{\\rm abs}=2.437$ towards QSO~J\\,1444$+$2919. The hydrogen column density in this system is log$N$(H\\,{\\sc i})~$=19.983\\pm0.010$ and the measured value of deuterium abundance is log(D/H)~$=-4.706\\pm0.007_{\\rm stat}\\pm0.067_{\\rm syst}$. This system meets the set of strict selection criteria stated recently by Cooke et al. and, therefore, widens the {\\it Precision Sample} of D/H. However, possible underestimation of systematic errors can bring bias into the mean D/H value (especially if use a weighted mean). Hence, it might be reasonable to relax these selection criteria and, thus, increase the number of acceptable absorption systems with measured D/H values. In addition, an unweighted mean value might be more appropriate to describe the primordial deuterium abundance. The unweighted mean value of the whole D/H data sample available to date (15 measurements) gives a conserva...

  17. Przemiany w gospodarce światowej z perspektywy przedsiębiorstwa. Fazy rozwoju kapitalizmu i ich konsekwencje dla podmiotów gospodarczych

    OpenAIRE

    Rosińska, Magdalena

    2007-01-01

    The changes which take place in world economy influence the organizational systems and strategies of global market payers. It seems that the most important participants of that process are international corporations. Their position is the consequence of the capitalism transformation and its evolution from the enterprise to management and later investors’ form. The main aim of the paper is to prove the necessity of change in enterprises’ management systems as a consequence of wo...

  18. VLT/UVES observations of peculiar alpha abundances in a sub-DLA at z ~ 1.8 towards the quasar B1101-26

    CERN Document Server

    Fox, Anne; Fechner, Cora

    2014-01-01

    We present a detailed analysis of chemical abundances in a sub-damped Lyman alpha absorber at z=1.839 towards the quasar B1101-26, based on a very-high-resolution (R ~ 75,000) and high-signal-to-noise (S/N >100) spectrum observed with the UV Visual Echelle spectrograph (UVES) installed on the ESO Very Large Telescope (VLT). The absorption line profiles are resolved into a maximum of eleven velocity components spanning a rest-frame velocity range of 200 km/s. Detected ions include CII, CIV, NII, OI, MgI, MgII, AlII, AlIII, SiII, SiIII, SiIV, FeII, and possibly SII. The total neutral hydrogen column density is log N(HI) = 19.48 +/- 0.01. From measurements of column densities and Doppler parameters we estimate element abundances of the above-given elements. The overall metallicity, as traced by [OI/HI], is -1.56 +/- 0.01. For the nitrogen-to-oxygen ratio we derive an upper limit of [NI/OI] < -0.65, which suggests a chemically young absorption line system. This is supported by a supersolar alpha/Fe ratio of [S...

  19. Educational Conditions for (Self-Development of Children’s Resistance to Consumerism in the Family/ Warunki edukacyjne w rodzinach dla rozwijania oporu dzieci wobec konsumpcjonizmu

    Directory of Open Access Journals (Sweden)

    JUODAITYTĖ AUDRONĖ

    2015-06-01

    Full Text Available The article presents the results of the research on the development of 6–7 year old children’s resistance to consumerism in the family, conducted in 2012–2013. The research was conducted combining qualitative and quantitative methods of research. The method of interviews with the child and parents’ survey was applied. The research investigated the situation of the development of children’s resistance to consumerism in the family, disclosed children’s consumerism experience, which includes children’s knowledge of places of trade and their visits to them, children’s knowledge about the assortment of products, brands and the main providers of knowledge about consumption and consumerism for children, namely family members, peers and the media. The article also presents the analysis of children’s knowledge of advertising, children’s perceptions about TV advertising and their attitudes to it. Based on re- search results, educational conditions that are important for development of 6–7 year old children’s resistance to consumerism are distinguished.

  20. Historyczne miasta oraz ich rozwój dla potrzeb społeczeństwa (nowe dzielnice autorstwa Renzo Piano)

    OpenAIRE

    Bonenberg, A.

    2014-01-01

    Интеграция новых урбанизированных образований с существующей исторической городской тканью представляет собой сложную задачу для градостроителей и архитекторов. Проекты, выполненные под руководством Ренцо Пьяно для Тренто (реализации 2013), Генуи и Милана демонстрируют современные способы регенерации городских районах и их интеграции с окружающей городской тканью. Разнообразие и специфичность этих трех проектов можно рассматривать в качестве иллюстрации современных тенденций исторических горо...

  1. Comparison of the Rates of Uni- and Bi-Molecular Diffusion Controlled Reactions on Circular, Filled Aggregate and DLA Fractal Aggregate in Two Dimensions.

    Science.gov (United States)

    1987-05-07

    CLASSIFICATION Of THIS PAGIL(Whan Data Entered) It is found that the reaction rates of OLA agigregates are comnatible with * that of circular aggregates with...NOSC Wayne State University Code 521 Detroit, Michigan 49207 San Diego, California 91232 Or. W.E. Moerner I.B.M. Corporation Almaden Research Center 650

  2. Index of coal machinability as basis for location and selection of coal ploughs. Wskaznik skrawalnosci wegla jako podstawa dla lokalizacji i doboru strugow weglowych

    Energy Technology Data Exchange (ETDEWEB)

    Krauze, K.; Ptak, J.; Flaga, S. (Akademia Gorniczo-Hutnicza, Cracow (Poland)); Bondek, S.

    1994-09-01

    The article describes a new device and a measuring method of coal machinability index designed for assessment of possible location of plough in a given long wall. By means of this device, the measurement of coal machinability index in selected beds of WESOLA colliery as well as assessment of possible use of plough in a given long wall working have been made. Using the machinability index the power demand of plough head driving motors has been determined. (author). 5 refs., 3 figs., 1 tab.

  3. Galaxy counterparts of metal-rich damped Lyα absorbers: II. A solar-metallicity and dusty DLA at zabs= 2.58

    NARCIS (Netherlands)

    Fynbo, J.P.U.; Ledoux, C.; Noterdaeme, P.; Christensen, L.; Møller, P.; Durgapal, A.K.; Goldoni, P.; Kaper, L.; Krogager, J. -K; Laursen, P.; Maund, J.R.; Milvang-Jensen, B.; Okoshi, K.; Rasmussen, P.K.; Thorsen, T. J.; Toft, S.; Zafar, T.

    2011-01-01

    This is the second paper of a series reporting on the results from a survey conducted with the ESO VLT/X-shooter spectrograph. We target high-metallicity damped Lyman α absorbers (DLAs) with the aim of investigating the relation between galaxies detected in emission and those detected in absorption.

  4. Data of evolutionary structure change: 3DLAD-3DLAC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3DLAD-3DLAC 3DLA 3DLA D C SMNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMAR...ACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHRGAVLGVVPKSYLPTYREFYERRQMAPGDGERGTIRIGGADVAFGTDLLFAASDL...PGFVLHVEICEDMFVPMPPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYAAAGEGESTTDLAWDGQTMIWENG...YDVTFENVQAGLRTDYLFRIANQRGGIVLGTGDLSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEEAKVGPFALQDFSLFQ...GDWRAPSDMSARIWLDQIDREVPKG SMNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADL

  5. Data of evolutionary structure change: 3DLAB-3DLAC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3DLAB-3DLAC 3DLA 3DLA B C -MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMAR...ACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHRGAVLGVVPKSYLPTYREFYERRQMAPGDGERGTIRIGGADVAFGTDLLFAASDL...PGFVLHVEICEDMFVPMPPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYAAAGEGESTTDLAWDGQTMIWENG...---TFENVQAGLRTDYLFRIANQRGGIVLGTGDLSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEITSEAKVGPFALQDFS...SPRGDWRAPSDMSARIWLDQIDREVPKG SMNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADL

  6. Data of evolutionary structure change: 3DLAB-3DLAD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3DLAB-3DLAD 3DLA 3DLA B D -MNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMAR...ACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHRGAVLGVVPKSYLPTYREFYERRQMAPGDGERGTIRIGGADVAFGTDLLFAASDL...PGFVLHVEICEDMFVPMPPSAEAALAGATVLANLSGSPITIGRAEDRRLLARSASARCLAAYVYAAAGEGESTTDLAWDGQTMIWENG...--TFENVQAGLRTDYLFRIANQRGGIVLGTGDLSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEITSEAKVGPFALQDFSL...PRGDWRAPSDMSARIWLDQIDREVPKG SMNFYSAYQHGFVRVAACTHHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADL

  7. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 6 (7540-9999).

    Science.gov (United States)

    1984-01-01

    CONTRACTOR TOTAL 17C. 31 EZELL OIL COMPANY INC CALIFORNIA DLA LIQUID PROPELLANTS & FUEL PETROLEUM BASE 5 EZELL TEXACO DISTRIBUTOR ALABAMA OLA LIQUID...LIQUID PROPELLANTS & FUEL PETROLEUM BASE IC016 TEXAS DLA LIQUID PROPELLANTS & FUEL PETROLEUM BASE 75.2!3 CONTRACTOR TOTAL 87.3 TEXACO LTD UN KINGDOM DLA...MARKETING ECUADOR DLA FUEL OILS 339 UN KINGDOM DLA FUEL OILS 13.284 TEXAS DLA FUEL OILS 26C.5C7 CONTRACTOR TOTAL 274.130 COLDIRON FUEL INC NEW YORK DLA FUEL

  8. Loglines. January - February 2011

    Science.gov (United States)

    2011-02-01

    fuel tankers from small-arms Adding Operational Data 24 Cultural Improvements 26 Green Light 36 We are DLA 28 Ten Questions with ... 30 DLA NewsWire...2,000 in the past 10 years. Norma Jara builds Unitized Group Rations at DLA Distribution San Joaquin, Calif. DLA officials are studying distribution...said. The analytical software uses a com- mon database between USTRANSCOM, DLA and the services. The result is a model that highlights areas in which ef

  9. Przebieg i znaczenie zajęć arteterapeutycznych dla dziewcząt cierpiących na jadłowstręt psychiczny, hospitalizowanych na oddziale psychiatrii dziecięcej. Doniesienie wstępne

    Directory of Open Access Journals (Sweden)

    Joanna Kondracka

    2014-06-01

    Full Text Available Celem niniejszej pracy była obserwacja i ewaluacja dotychczasowego przebiegu badania nad rolą warsztatów arteterapeutycznych w procesie zdrowienia nastoletnich pacjentek cierpiących na jadłowstręt psychiczny. Od grudnia 2011 roku autorka pracy, psycholog z tytułem plastyka ceramika, prowadzi warsztaty arteterapii na oddziale psychiatrii wieku rozwojowego. Do czerwca 2013 roku w zajęciach wzięło udział 27 pacjentek, spośród których 15 spełniło kryteria włączające do badania. Dziewczęta są badane po przyjęciu na oddział oraz 6 miesięcy po zakończeniu leczenia za pomocą następujących narzędzi: EAT-26 (Eating Attitudes Test, EDI (Eating Disorder Inventory, YSR (Youth Self-Report – jedno z narzędzi z grupy Child Behavior Checklist – oraz KBPK (Kwestionariusz do Badania Poczucia Kontroli. Dodatkowo po ukończeniu cyklu warsztatów arteterapeutycznych pacjentki są proszone o wypełnienie ankiet ewaluacyjnych. Ich dotychczasowe wyniki przedstawiono w załączeniu. Obserwacje zdobyte przez autorkę w przebiegu prowadzenia zajęć arteterapeutycznych oraz wnioski wypływające z ankiet ewaluacyjnych wskazują na zapotrzebowanie na tego typu formę terapii wśród osób hospitalizowanych z powodu jadłowstrętu psychicznego. Na obecnym etapie badań trudno wykazać pozytywny wpływ arteterapii na proces zdrowienia pacjentek. Autorka ma nadzieję, że analiza wyników uzyskanych od ostatecznej liczby badanych umożliwi rzetelną ocenę skuteczności arteterapii w leczeniu jadłowstrętu psychicznego.

  10. Possible directions for the agricultural trade liberalisation under Doha Round and the European Union's stand. Conclusions for Poland Możliwe kierunki liberalizacji handlu rolnego w ramach Rundy Doha a stanowisko Unii Europejskiej. Wnioski dla Polski

    Directory of Open Access Journals (Sweden)

    Elżbieta Daszkowska

    2007-12-01

    Full Text Available This article aims at presenting the agricultural aspect of ongoing negotiations in the scoupe of the Doha Round. In this paper are set out interests and positions of the most important groups of countries in WTO and key pillars of agriculture negotiations.

  11. Estimation of physical conditions in the cold phase of the interstellar medium in the sub-DLA system at z = 2.06 in the spectrum of the quasar J 2123-0050

    Science.gov (United States)

    Klimenko, V. V.; Balashev, S. A.; Ivanchik, A. V.; Varshalovich, D. A.

    2016-03-01

    An independent analysis of the molecular hydrogen absorption system at redshift z abs = 2.059 in the spectrum of the quasar J 2123-0050 is presented. The H2 system consists of two components (A and B) with column densities log N_{{H_2}}^A = 17.94 ± 0.01 and N_{{H_2}}^B = 15.16 ± 0.02. The spectrum exhibits the lines of HDmolecules (log N HD A = 13.87±0.06) and the neutral speciesCI and Cl I associated with the H2 absorption system. For the molecular hydrogen lines near the quasar's Ly β and OVI emission lines, we detect a nonzero residual flux, 3% of the total flux, caused by the effect of partial coverage of the quasar's broad-line region by an H2 cloud. Due to the smallness of the residual flux, the effect does not affect the H2 column density being determined but increases the statistics of observations of the partial coverage effect to four cases. The uniqueness of the system being investigated is manifested in a high abundance of the neutral species H2 and CI at the lowest HI column density, log N HI = 19.18 ± 0.15, among the highredshift systems. The H2 and CI column densities in the system being investigated turn out to be higher than those in similar systems in our Galaxy and theMagellanic Clouds by two or three orders ofmagnitude. The N_{HD} /2N_{H_2 } ratio for component A has turned out to be also unusually high, (4.26 ± 0.60) × 10-5, which exceeds the deuterium abundance (D/H) for high-redshift systems by a factor of 1.5. Using the HI, H2, HD, and CI column densities as well as the populations of excited H2 and CI levels, we have investigated the physical conditions in components A and B. Component A represents the optically thick case; the gas has a low number density ( 30 cm-3) and a temperature T 140 K. In component B, the mediumis optically thin with n H ≤ 100 cm-3 and T ≥ 100 K. The ultraviolet (UV) background intensity in the clouds exceeds the mean intensity in our Galaxy by almost an order ofmagnitude. A high gas ionization fraction, n_{H^ + } /n_H ˜ 10^{ - 2}, which can be the result of partial shielding of the systemfrom hard UV radiation, is needed to describe the high HD and CI column densities. Using our simulations with the PDRMeudon code, we can reconstruct the observed column densities of the species within the model with a constant density ( n H 40 cm-3). A high H2 formation rate (higher than the mean Galactic value by a factor of 10-40) and high gas ionization fraction and UV background intensity are needed in this case.

  12. Obecność w powietrzu atmosferycznym grzybów z gatunku Fusarium culmorum i ich oporność na antymikotyki – hipotetyczne zagrożenie dla zdrowia ludzi

    Directory of Open Access Journals (Sweden)

    Katarzyna Wolny-Koładka

    2016-03-01

    Full Text Available Introduction. In the atmospheric air, fungal spores of the genus Fusarium are present which may be resistant to antifungal drugs used in medicine. The aim of this study was to determine the sensitivity to selected antimycotics, and to identify the MIC (minimum inhibitory concentration for strains belonging to the species F. culmorum. Material and methods. Fungal strains were isolated from atmospheric air sampling in the vicinity of fields where winter wheat was cultivated. Evaluation of susceptibility to antifungal drugs was carried out using E-test strips. Results. All isolates were characterized by resistance to ketoconazole, itraconazole and fluconazole. MIC for amphotericin B was 0.023 µg · cm–3, for voriconazole 0.016 µg·cm–3, for posaconazole 0.006 µg·cm–3 and for caspofungin 0.25 µg·cm–3. Among the isolates tested, 8 were resistant to voriconazole, 3 resistant to posaconazole and 10 resistant to amphotericin B. Conclusions. The examined strains presented different sensitivity to antifungal drugs. The strongest fungicidal activity was found in the case of: posaconazole, voriconazole and amphotericin B. In the atmospheric air there may exist strains of F. culmorum which have natural resistance to some antimycotics.

  13. Stabilization of the photogrammetric system for a gyrocopter in terms of the LiDAR data quality. (Polish Title: Stabilizacja systemu pomiarowego dla wiatrakowca w aspekcie jakości danych LiDAR)

    Science.gov (United States)

    Kolecki, J.; Prochaska, M.; Piątek, P.; Baranowski, J.; Kurczyński, Z.

    2015-12-01

    The definition of the quality parameters of a point cloud acquired using the airborne laser scanning is the element of almost every terms of reference involving airborne spatial data acquisition. The quality of the LiDAR data should not be identified only with accuracy and should be examined in a wider aspect taking into account other parameters of the point cloud that was acquired as a result of a flight. For instance the Polish legal regulations provide the requirements concerning the coverage of the strips and the point density. The above mentioned parameters of the LiDAR data can be influenced to some extent by many factors concerning the flight itself such as a varying speed as well as the horizontal and vertical deflections from the planned flight line. However, vibrations and angular deflections seem to influence the point cloud quality to the highest extent. LiDAR data acquisition without required stabilizing system makes keeping the required quality parameters very hard. Within the research project which aimed to develop the prototype of the ultralight, stabilized mapping platform for the gyrocopter, a number of analyses concerning the optimal stabilization scenario were carried out. Tools including scripts and computer programs for analyzing the impact of the deflections on the data quality have been developed. The proper stabilization variant has been established taking into account three separate deflection components, i.e.: roll, pitch and yaw.

  14. The use of geo-technologies for land use mapping on reclaimed areas. (Polish Title: Zastosowanie technik geomatycznych w opracowywaniu map pokrycia i użytkowania terenu dla obszarów zrekultywowanych)

    Science.gov (United States)

    Szostak, M.; Nowicka, M.

    2013-12-01

    The aim of this study was to investigate the possible use of geotechniques and generally available geodata for mapping land cover on reclaimed areas . The choice of subject was dictated by the growing number of such areas and the related problem of restoring their value. The validity of the use of modern technology, including GIS, photogrammetry and remote sensing, was determined, especially for the land cover classes mapping that are relevant in assessing the effects of reclamation and analyzes of the changes taking place on such sites. The study was performed for dump site of the Sulphur Mine "Machów", which is an example of the reclaimed area, located in the Tarnobrzeski district. The research materials consisted of aerial orthophotos, which were the basis of on-screen vectorization of land cover classes; Landsat satellite images, which were used in the pixel based classification; and the CORINE Land Cover database as a general reference to the global maps of land cover and land use. The site was characterized by relatively large mosaic of landscape which is typical for reclaimed areas. Due to this fact, high resolution aerial photos were most suitable for the land cover mapping, allowing distinguishing highest number of land cover classes. The process was also successfully automated with the means of pixel-based image classification on the satellite images. This resulted also in the subjectivity of the operator and time costs. The effort made to develop land cover classes, supported with thorough knowledge of the operator, is important for the proper evaluation of the reclamation process.

  15. Value of radionuclide angiocardiography for determination of left ventricular volume in patients with valvular heart disease; Wartosc angiokardiografii radioizotopowej dla oznaczania objetosci lewej komory u chorych z zastawkowymi wadami serca

    Energy Technology Data Exchange (ETDEWEB)

    Konieczna, S.; Madeja, G.; Gosiewska-Marcinkowska, E.; Szumilak, B.; Brodzki, L.M.; Leszek, P. [Instytut Kardiologii, Warsaw (Poland)

    1992-12-31

    The aim of this study was to investigate usability of the Massardo method in calculating the left ventricular volume in patients with valvular defect. The group consisted of 21 patients with mitral defect. Left ventricular volumes obtained by contrast ventriculography were used for reference. The correlation coefficient between these two methods was 0.94, SEE=29 ml, V{sub nucl}=0.94 V{sub c.vent}+11. The end-systolic and end-diastolic outlines were marked manually. We concluded that the Massardo methods is an effective method of calculating the left ventricular volume also in group of patients with mitral defect. (author). 11 refs, 4 tabs.

  16. Starting of H9ANFNb(P91) steel tubing production for energetics in domestic steel-works; Uruchomienie w krajowych hutach produkcji rur ze stali H9AMFNb(P91) przeznaczonych dla energetyki

    Energy Technology Data Exchange (ETDEWEB)

    Wiedermann, J. [Instytut Metalurgii Zelaza, Gliwice (Poland); Bieniek, K. [Huta Jednosc, Siemianowice Slaskie (Poland); Pogoda, K. [Huta Batory, Chorzow (Poland)

    1996-12-31

    The results of primary investigations and attempt of ferritic steel H9AMFNb production in domestic steel-works have been reported. The prototype series of tubes for energetic boilers have been tested and their mechanical properties determined. It has been found the applicability of the material for use in energetics. 9 refs, 4 figs, 3 tabs.

  17. Phase Composition of Iron Ore Sinters Produced with Biomass as a Substitute for the Coke Fuel / Skład Fazowy Spieków Żelaza Wytworzonych Z Dodatkiem Biomasy Jako Zamiennika Dla Koksu

    Directory of Open Access Journals (Sweden)

    Mežibrický R.

    2015-12-01

    Full Text Available The effort to minimize CO2 emissions leads the existing integrated steel plants to implement alternative biomass-based fuels that dispose of equilibrium carbon balance. The fuel is a key factor in the iron ore sinter production, so it is essential to know its impact not just on mechanical properties of the finished sintered ore but also on the mineral composition as the mineral phases together determine all observed sinter properties. For this purpose the samples prepared by replacing a part of coke breeze with charcoal or walnut shell substitute were subjected to the observation under the light microscope, also using etching, to the phase identification by chemical EDX analysis on the scanning electron microscope and to the phase composition quantification by X-Ray diffraction analysis. The studied microstructure areas in the vicinity of the pores left by fuel grains were neither characterized by different phases nor by changed chemical composition of these phases even thought mineral matter of the used fuels were substantially different in terms of the chemical composition. The only feature of the burned substitute fuels were ash particles arranged in characteristic shapes. The main reason of variation in ratios of respective mineral phases of samples appeared to be thermal conditions that were reflected in the content of unreacted non-ferrous phases. Coke substitution in the sinter mixture has no negative impact on the phase composition of the produced sinters, which confirms the prospective use of biofuels in the sintering process.

  18. The Valve Gear Systems Timing Parameters Identification for Marine Diesel Engines Diagnostics / Identyfikacja Parametrów Układów Rozrządu Silników Okrętowych Dla Potrzeb Diagnostyki

    Directory of Open Access Journals (Sweden)

    Lus Tomasz

    2015-09-01

    Full Text Available W referacie przedstawiono wyniki badań, których celem było opracowanie metody diagnozowania okrętowych szybkoobrotowych silników tłokowych. Polska Marynarka Wojenna eksploatuje znaczną liczbę silników tego typu również na okrętach podwodnych. Silniki tego typu nie posiadają zaworów indykatorowych, co komplikuje możliwość oceny procesu spalania i ich stanu technicznego. Akademia Marynarki Wojennej w Gdyni od lat prowadzi badania związane z rozwojem metod diagnozowania okrętowych tłokowych silników spalinowych. W ostatnich latach prowadzone są prace nad metodami diagnozowania szybkoobrotowych silników okrętowych bazującymi na analizie obwiedni przyspieszeń drgań generowanych przez układy rozrządu zaworowego i układ paliwowy. W referacie zaprezentowano wybrane wyniki badań prowadzonych na silnikach Mercedes-Maybach typu MB820 stosowanych na okrętach podwodnych klasy Kobben.

  19. Projekt przetwarzania danych dla realizacji funkcji gospodarki materiałowej nie objętych pakietem STOCK CONTROL (wykorzystujący zbiór transakcyjny TRANFL)

    OpenAIRE

    Małecka, Grażyna

    1986-01-01

    The article contains a proposition of expanding computerization of materials management in Housing Construction Company using packages of STOCK CONTROL programmes. The proposition is based on utilization of TRANFL transaction set built with the help of this package. It includes a detailed description of computerized execution of the following functions connected with materials management: - accounting of materials costs, - execution of orders (records and control), - statistics...

  20. Estimation of physical conditions in the cold phase of the ISM in the sub-DLA system at z = 2.06 in the spectrum of the quasar J2123-0050

    CERN Document Server

    Klimenko, V V; Ivanchik, A V; Varshalovich, D A

    2016-01-01

    An independent analysis of the molecular hydrogen absorption system at z = 2.059 in the spectrum of the quasar J2123-0050 is presented. The H_2 system consists of two components (A and B) with column densities log N^A(H_2) = 17.94+/-0.01 and log N^B(H_2) = 15.16+/-0.02. The spectrum exhibits the lines of HD molecules (log N^A(HD) = 13.87+/-0.06) and the neutral species C I and Cl I associated with the H_2 absorption system. For the molecular hydrogen lines near the quasar's Ly_beta and O VI emission lines, we detect a nonzero residual flux, ~3% of the total flux, caused by the effect of partial coverage of the quasar's broad-line region by an H_2 cloud. The uniqueness of the system being investigated is manifested in a high abundance of the neutral species H_2 and C I at the lowest H I column density, log N(H I) = 19.18+/-0.15, among the high redshift systems. The N(HD)/2N(H_2) ratio for component A has turned out to be also unusually high, (4.26+/-0.60)x10^{-5}. We have investigated the physical conditions i...

  1. Znaczenie badań nad zmiennoscią liści grabu dla celów paleobotanicznych [Studies on the variability of hornbeam-leaves and their importance for paleobotany

    Directory of Open Access Journals (Sweden)

    M. Białobrzeska

    2015-01-01

    Full Text Available The aim of the investigations on the variability of the leves of Carpinus betulus was to characterize a chosen population on the basis of all types of its leaves. The results obtained from the measurements of the leaves, which provided a picture of their variability, were compared with the autumn fall of the same population, i.e. with the material which some time might become fossil material. It appeared that three fundamental types of leaves may be distinguished on the shoots of Carpinus betulus: l. short, broad, roundish or egg-shaped leaves with broad apical angles and a heart-shaped base, which grew out of the first nodes, 2. slim leaves with acute apical and basal angles, their broadest part situated high, which were encountered on nodes VII-X of the long shoots, and 3. large, oval leaves derived from nodes IV-VI and regarded as typical of the species Carpinus betulus. The asymmetry of the base of blade appeared to be an important character. This asymmetry vanished gradually from node to node towards the apex of shoot.

  2. Changes in The Content of Biodegradable Organic Matter in Tap Water in The City of Częstochowa / Zmiany Zawartości Biodegradowalnej Materii Organicznej w Wodzie Wodociagowej Dla Miasta Częstochowy

    Science.gov (United States)

    Rakocz, Klaudia; Rosińska, Agata

    2016-03-01

    This paper presents research aimed at the assessment of biodegradable organic carbon content changes (BDOC) during water disinfection process. The water samples examined in the research came from intakes, pumping stations at treatment plants situated in the Silesia district and water consumers. The examined water was underground water. One water sample was disinfected by sodium sub chloride while the other one by ozone. BDOC was determined using the Joret method, which involves observation of dissolved organic carbon (DOC) decrease in the examined water. The research has shown that BDOC content fluctuates at every stage of the treatment process and distribution of the examined water. Another analyzed parameter was biological stability of water.

  3. Udział Biblioteki Głównej Uniwersytetu Pedagogicznego im. Komisji Edukacji Narodowej w Krakowie w działalności uniwersytetów dla dzieci

    Directory of Open Access Journals (Sweden)

    Folga Agnieszka

    2016-12-01

    Full Text Available The article presents the idea of establishing Children’s Universities, and in particular, the focus is on the University for Children and Parents at the Pedagogical University in Cracow and the Wadowice Children's University. The cooperation between these institutions and the Main Library of the Pedagogical University is described; the activities carried out are discussed and the importance of consolidating reading habits in children is highlighted. The aim of the cooperation was to present the library as a place that participates in and supports the actions organized by the University.

  4. Changes in The Content of Biodegradable Organic Matter in Tap Water in The City of Częstochowa / Zmiany Zawartości Biodegradowalnej Materii Organicznej w Wodzie Wodociagowej Dla Miasta Częstochowy

    Directory of Open Access Journals (Sweden)

    Rakocz Klaudia

    2016-03-01

    Full Text Available This paper presents research aimed at the assessment of biodegradable organic carbon content changes (BDOC during water disinfection process. The water samples examined in the research came from intakes, pumping stations at treatment plants situated in the Silesia district and water consumers. The examined water was underground water. One water sample was disinfected by sodium sub chloride while the other one by ozone. BDOC was determined using the Joret method, which involves observation of dissolved organic carbon (DOC decrease in the examined water. The research has shown that BDOC content fluctuates at every stage of the treatment process and distribution of the examined water. Another analyzed parameter was biological stability of water.

  5. Loglines. November - December 2011

    Science.gov (United States)

    2011-12-01

    of the DLA organization in the Pacific and its people,” said DLA Energy Pacific Commander Navy Capt. Kevin Henderson. “The organizations came...am a firm believer that DLA today is built on the sacrifices, deeds and hard work of those who preceded us. Those early plank -holder employees

  6. Defense Inventory: Defense Logistics Agency Needs to Expand on Efforts to More Effectively Manage Spare Parts

    Science.gov (United States)

    2010-05-01

    those levels in its reorder point calculus . 12A purchase request is a requisition for an item that has not yet been placed on order. A purchase...mean that DLA is being wasteful. They asserted that DLA strives to be a good steward of government resources. However, without such metrics, DLA cannot

  7. 77 FR 46653 - Defense Logistics Agency Privacy Program

    Science.gov (United States)

    2012-08-06

    ... of the Secretary 32 CFR Part 323 RIN 0790-AI86 Defense Logistics Agency Privacy Program AGENCY: Defense Logistics Agency, DoD. ACTION: Proposed rule with request for comments. SUMMARY: The Defense Logistics Agency (DLA) is proposing to amend the DLA Privacy Program Regulation. The DLA Privacy...

  8. The evolution of neutral gas in damped Lyman α systems from the XQ-100 survey

    DEFF Research Database (Denmark)

    Sánchez-Ramírez, R.; Ellison, S. L.; Prochaska, J. X.

    2015-01-01

    We present a sample of 38 intervening Damped Lyman $\\alpha$ (DLA) systems identified towards 100 $z>3.5$ quasars, observed during the XQ-100 survey. The XQ-100 DLA sample is combined with major DLA surveys in the literature. The final combined sample consists of 742 DLAs over a redshift range app...

  9. Official publications of the Ministry of Mining and Power Industry

    Energy Technology Data Exchange (ETDEWEB)

    1986-01-01

    A review is presented of publications issued by the Ministry since 1980. The following publications are evaluated: Gornictwo i Energetyka monthly (issued since 1984, official information on mining, power industry, energy policy of Poland), Vademecum ochrony i ksztaltowania srodowiska w resorcie gornictwa i energetyki (Environmental protection in mining and power industry, Warsaw, 1982, 1983, 1985 with data on environmental protection and a review of regulations), Zbior przepisow o stopniach gorniczych (Regulations on mining degrees, Warsaw, 1983), Rocznik statystyczny Ministerstwa Gornictwa i Energetyki 1984 (Statistical Yearbook of the Ministry of Mining and Power Industry 1984, covers 1981, 1982, 1983), Statystyka przemyslu weglowego w Polsce (Statistics of coal industry in Poland, confidential material), Statystyka rozwoju elektroenergetyki polskiej (Statistics of power industry development in Poland). A further 10 publications issued by the Ministry cover economic problems of the coal industry and power generation as well as regulations issued by the Ministry.

  10. Low-Redshift Damped Lyman Alpha Galaxies Towards the Quasars B2 0827+243, PKS 0952+179, PKS 1127-145, and PKS 1629+120

    CERN Document Server

    Rao, S M; Turnshek, D A; Lane, W M; Monier, E M; Bergeron, J; Rao, Sandhya M.; Nestor, Daniel B.; Turnshek, David A.; Lane, Wendy M.; Monier, Eric M.; Bergeron, Jacqueline

    2003-01-01

    We present optical and near-infrared ground-based imaging results on four low-redshift damped Lyman alpha (DLA) galaxies. The corresponding DLA systems were discovered in our Hubble Space Telescope spectroscopic surveys for DLAs in known strong MgII absorption-line systems towards the quasars B2 0827+243 (z{DLA}=0.525), PKS 0952+179 (z{DLA}=0.239), PKS 1127-145 (z_{DLA}=0.313), and PKS 1629+120 (z{DLA}=0.532). The DLA galaxies span a mixture of morphological types from patchy, irregular, and low-surface-brightness to spiral galaxies. The luminosities range from 0.02L_K^* to 1.2L_K^*. We also discovered several extremely red objects (EROs) in two of these fields and discuss the possibility that they are associated with the DLA galaxies. These observations add to the small but growing list of DLA galaxies at low redshift. At the present time, 14 DLA galaxies in the redshift range $0.05 \\lesssim z \\lesssim 1$ have been studied. The distributions of DLA galaxy properties for these 14 cases are discussed and some ...

  11. Sprogvidenskabens kognitive spørgsmål

    DEFF Research Database (Denmark)

    Steffensen, S. V.

    2016-01-01

    (including embodied micro-dynamics and trans-situational resources). Further, DLA sees such coordinative actions as ecologically embedded, i.e. interwoven with the numerous activities that constitute human existence. The article opens with a review of how linguistics and the language sciences have......This article introduces the Distributed Language Approach (DLA), which is a contemporary framework in the language sciences. Building on recent developments in cognitive science, DLA takes a naturalistic perspective. According to this perspective, DLA rejects the view that the idea of 'language...... incorporated insights from cognitive science in the second half of the 20th century. It then discusses the recent developments in cognitive science that DLA draws on, in particular Distributed Cognition and Ecological Psychology. Finally, the article presents DLA by discussing five foundational assumptions...

  12. Long terminal repeats are not the sole determinants of virulence for equine infectious anemia virus.

    Science.gov (United States)

    Tu, Y-B; Zhou, T; Yuan, X-F; Qiu, H-J; Xue, F; Sun, C-Q; Wang, L; Wu, D-L; Peng, J-M; Kong, X-G; Tong, G-Z

    2007-01-01

    The long terminal repeats (LTRs) of equine infectious anemia virus donkey leukocyte-attenuated virus (EIAV-DLA) were substituted with those of the wild-type EIAV-L (wt EIAV-L, the parent virus of EIAV-DLA). The resulting chimeric plasmid was designated pOK-LTR DLA/L. Purified pOK-LTR DLA/L was transfected into monocyte-derived macrophage (MDM) cultures prepared from EIAV-negative, heparinized whole blood from a donkey. Eighth-passage cell cultures developed the typical cytopathogenic effects (CPE) of EIAV infection, and virions with typical EIAV profiles were observed with an electron microscope. Horses were inoculated with the chimeric virus or EIAV-DLA and challenged with the wt EIAV-L strain six months later. All of the horses inoculated with either the chimeric virus or EIAV-DLA were protected from disease, whereas the control horses died with typical EIA symptoms.

  13. Laplacian growth phenomena with the third boundary condition: Crossover from dense structure to diffusion-limited aggregation fractal

    Science.gov (United States)

    Nagatani, Takashi

    1989-12-01

    A Laplacian growth model with the third boundary condition, (1-P)∂Φ/∂n-PΦ=0, is considered in order to study the effect of the sticking probability of the diffusion-limited aggregation (DLA), where Φ is the harmonic function satisfying the Laplace equation and ∂Φ/∂n the derivative normal to the interface. The crossover from the dense structure to the DLA fractal is investigated by using a two-parameter position-space renormalization-group method. A global flow diagram in two-parameter space is obtained. It is found that there are two nontrivial fixed points, the Eden point and the DLA point. The DLA point corresponding to the DLA fractal is stable in all directions, while the Eden point is a saddle point. When the sticking probability P is not 1, the aggregate must eventually cross over to the DLA fractal. The crossover exponent φ and crossover radius r× are calculated.

  14. Compendium of Operations Research and Economic Analysis Studies

    Science.gov (United States)

    1992-10-01

    three components performed in different areas resolved the problem. (DLA-LO Project 6034) 88-19. Enhanced DLA Distribucion System (Em1S) - ’Poolin6...dealing with the management of the DISMS upgrade. They fell into four areas : documentation, program management, self-assessment, and Technology. DLA-92...analysis was to evaluate the mechanization design, identify any design problems, and recommend solutions or possible improvements. Three major areas of

  15. Dollar Summary of Federal Supply Classification and Service Category by Company, FY83, Part 1 (1005-5811).

    Science.gov (United States)

    1983-01-01

    36 HEIM INCOM I? ARIZONA DLA BEARINGS PLAIN UNMOUNTED 168 HEIR UNIVERSA CORP CALIFORNIA NAVY BEARINGS PLAIN UNMOUNTED 37 HOFFERT MARIO NEW JERSEY DLA...CIRCUIT BOARD MFG MACH 34 B H ENTERPRISES NEW JERSEY ARMY PRINTED CIRCUIT BOARD MFG MACH 39 BIAZZI MARIO DR ING SA CALIFORNIA USAF PRINTED CIRCUIT BOARD...DLA EARTH MOVING AND EXCAVATING EQUIPMENT 78 BENEDETTI CORP GERMANY ARMY EARTH MOVING AND EXCAVATING EQUIPMENT 385 BROADLINE CORP IOWA USAF EARTH MOVING

  16. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 3 (4610-5925).

    Science.gov (United States)

    1984-01-01

    DLA VALVES NONPOWERED 71 STATE TOTAL 1,115 P V F MARKETING INC OHIO DLA VALVES NONPOWERED 29 TEXAS DLA VALVES NONPOWERED 74 CONTRACTOR TOTAL 1C3 STO6...MISCELLANEOUS CONSTRUCTION MATERIALS 70 LADERA’S MARKETING PHILIPPINE NAVY MISCELLANEOUS CONSTRUCTION MATERIALS 32 LATTIMORE MATERIALS COMPANY TEXAS OCE...MISCELLANEOUS CONSTRUCTION MATERIALS 115 PELLA OF GEORGIA INC GEORGIA NAVY MISCELLANEOUS CONSTRUCTION MATERIALS 44 PRODUCTOS METALICS CENTRO AMER HONDURAS ARMY

  17. The Relevance of the De Broglie Velocity (V sub 1 = h/2md sub 1) to Shock Loading Induced Reactions in Lead Azide

    Science.gov (United States)

    1991-09-01

    induced reactive pressure levels for dextrinated and single crystal lead azide are compared to predicted Pv1 magnitudes. PV1 = P. CL V1 where V, = h...EXPERIMENTAL REACTIVE SHOCK PRESSURES AND COMPARISON WITH Pv1 PREDICTIONS .................. 4 A. Dextrinated Lead Azide (DLA... Dextrinated Lead Azide (DLA) DLA is a mixture of lead azide and dextrin . Dextrination of lead azide provides han- dling and safety benefits 15, Vol. 2, Chpt

  18. Defense Inventory: DOD Needs Additional Information for Managing War Reserve Levels of Meals Ready to Eat

    Science.gov (United States)

    2015-05-01

    affect future demand. Without obtaining this information from the military services, DLA may be limited in its ability to optimize the supply chain ...future demand, DLA may be limited in its ability to optimize the supply chain across the department. Forecasting demand for supplies has been a long...across the department. DLA uses various supply - chain strategies to balance cost with readiness in meeting the need for items identified as WRM and needed

  19. Office of Command Security Total Quality Management Plan

    Science.gov (United States)

    1989-07-01

    outlines the Office of Command Security instruction for TQM implementation. Keywords: TQM ( Total Quality Management ), DLA Office of Command Security, Continuous process improvement, Automatic data processing security.

  20. Proceedings of the DOD (Department of Defense) Standardization and Data Management Conference Supporting the Acquisition Process Held in Linthicum, Maryland on August 22-24, 1988

    Science.gov (United States)

    1988-01-01

    Chairman] ASD/ENSI - DEFENSE LOGISTICS AGENCY -- Mr Don Atkinson DLA-0L -- Mr Fred Harris DLA-SE -- Mr Bob Schmitt DLA-Q S 3 IX-46 4. KEY ACTIVITIES...Mr. Fred Kohout, OASD/DASD(P) * ’CL XI-2 Summary for Rights in Technical Data Panel Discussion The rights in technical data panel was co-chaired by...RICHAtRD L. &RAWLEY MR. JOSEPH B BRAUER DLA. DE-ENSE FUEL SUPPLY CENTER ROME AIR DEVELOF ,iENT CENTER DFSC-CSS RBR CAIMIERON STAT ION GRIFFISS AFE NY 1

  1. 77 FR 72333 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-12-05

    ... Defense Logistics Agency uses the report as the principal instrument for measuring the performance of... Technical Assistance Center Cooperative Agreement Performance Report, DLA Form 1806; OMB Control Number...

  2. Numerical Non-Equilibrium and Smoothing of Solutions in The Difference Method for Plane 2-Dimensional Adhesive Joints / Nierównowaga Numeryczna i Wygładzanie Rozwiazań w Metodzie Różnicowej Dla Dwuwymiarowych Połączeń Klejowych

    Directory of Open Access Journals (Sweden)

    Rapp Piotr

    2016-03-01

    Full Text Available The subject of the paper is related to problems with numerical errors in the finite difference method used to solve equations of the theory of elasticity describing 2- dimensional adhesive joints in the plane stress state. Adhesive joints are described in terms of displacements by four elliptic partial differential equations of the second order with static and kinematic boundary conditions. If adhesive joint is constrained as a statically determinate body and is loaded by a self-equilibrated loading, the finite difference solution is sensitive to kinematic boundary conditions. Displacements computed at the constraints are not exactly zero. Thus, the solution features a numerical error as if the adhesive joint was not in equilibrium. Herein this phenomenon is called numerical non-equilibrium. The disturbances in displacements and stress distributions can be decreased or eliminated by a correction of loading acting on the adhesive joint or by smoothing of solutions based on Dirichlet boundary value problem.

  3. Wskazania wychowawcze dla polskich rŚląsku katolickiego czasopisma „Monika” w drugiej połowie XIX wieku/ Educational Guidelines for Polish Families in Silesia of Catholic Journal “Monica” in the Second Half of the Nineteenth Century

    Directory of Open Access Journals (Sweden)

    GRZEGORZ MICHALSKI

    2014-06-01

    Full Text Available Szczególną rolę w rozwijaniu zainteresowania sprawami narodowymi i problemami życia społecznego odegrały wśród diaspory polskiej na Górnym Śląsku w drugiej połowie XIX wieku czasopisma wydawane w języku polskim, które były tematycznie sprofilowane i przekazywały odbiorcom, z jednej strony, wyspecjalizowaną wiedzę,z drugiej – podpowiadały, jak i w jaki sposób mogą oni rozwiązywać codzienne problemy. Do takich pism należał tygodnik „Monika”, który przez cały okres ukazywania się był wyłącznie poświęcony chrześcijańskiemu wychowaniu dzieci. Udzielając w każdym numerze szczegółowych rad pedagogicznych, rozwijano u rodziców, szczególnie matek, przekonanie o związku między wyznawaną przez nich wiarą katolicką i wynikającymi z niej obowiązkami wychowawczymi. Na łamach czasopisma przekonywano, że najwaniejsżą powinnością rodziców wobec dzieci jest dbałość o takie ukształtowanie relacji między poszczególnymi członkami rodziny, aby składały się one na wzorowe ognisko domowe, w którym dzieci nie tylko doświadczają danej od Boga prawdziwej miłości, ale otrzymują także, wynikające z Dekalogu, przykłady zachowań religijnych i moralnych oraz postępowania w stosunkach z innymi osobami. Przyjmując taką perspektywę pojmowania rodziny, jako środowiska wychowawczego, ukazywano cechy matki w roli pierwszej i najważniejszej wychowawczyni, podpowiadano, jakie powinna stosować metody i środki oddziaływania, opisywano typowe błędy wychowawcze, aby przestrzec ją przed ich popełnianiem.

  4. The energetic structure and recombination processes for selected lanthanides in the crystals Ca{sub x}Cd{sub 1-x}F{sub 2} and ZnS; Struktura energetyczna i procesy rekombinacji dla wybranych pierwiastkow z grupy ziem rzadkich w krysztalach Ca{sub x}Cd{sub 1-x}F{sub 2} in ZnS

    Energy Technology Data Exchange (ETDEWEB)

    Swiatek, K. [Polska Akademia Nauk, Warsaw (Poland). Inst. Fizyki

    1991-12-31

    The results of investigations on ionization and recombination processes in crystals of Ca{sub x}Cd{sub 1-x}F{sub 2} type doped of europium as well as in crystals and thin layers of ZnS doped of Eu, Yb, Sm and Tb have been presented and discussed. Several scientific methods and analytical techniques have been used, among them electron spin resonance (ESR), photo-ESR, absorption and emission spectroscopy. Theoretical consideration and modeling of physical processes have enabled to understand the mechanism of observed phenomena. 227 refs, 61 figs, 9 tabs.

  5. Quality control system preparation for photogrammetric and laser scanning missions of Spanish national plan of aerial orthophotogpaphy (PNOA). (Polish Title: Opracowanie systemu kontroli jakości realizacji nalotów fotogrametrycznych i skaningowych dla hiszpańskiego narodowego planu ortofotomapy lotniczej (PNOA))

    Science.gov (United States)

    Rzonca, A.

    2013-12-01

    The paper presents the state of the art of quality control of photogrammetric and laser scanning data captured by airborne sensors. The described subject is very important for photogrammetric and LiDAR project execution, because the data quality a prior decides about the final product quality. On the other hand, precise and effective quality control process allows to execute the missions without wide margin of safety, especially in case of the mountain areas projects. For introduction, the author presents theoretical background of the quality control, basing on his own experience, instructions and technical documentation. He describes several variants of organization solutions. Basically, there are two main approaches: quality control of the captured data and the control of discrepancies of the flight plan and its results of its execution. Both of them are able to use test of control and analysis of the data. The test is an automatic algorithm controlling the data and generating the control report. Analysis is a less complicated process, that is based on documentation, data and metadata manual check. The example of quality control system for large area project was presented. The project is being realized periodically for the territory of all Spain and named National Plan of Aerial Orthophotography (Plan Nacional de Ortofotografía Aérea, PNOA). The system of the internal control guarantees its results soon after the flight and informs the flight team of the company. It allows to correct all the errors shortly after the flight and it might stop transferring the data to another team or company, for further data processing. The described system of data quality control contains geometrical and radiometrical control of photogrammetric data and geometrical control of LiDAR data. According to all specified parameters, it checks all of them and generates the reports. They are very helpful in case of some errors or low quality data. The paper includes the author experience in the field of data quality control, presents the conclusions and suggestions of the organization and technical aspects, with a short definition of the necessary control software.

  6. Vnější ekonomická rovnováha zemí jižního křídla eurozóny v kontextu světové ekonomické krize.

    OpenAIRE

    Rakouský, Tomáš

    2013-01-01

    This diploma thesis focuses on changes in the external balance of Portugal, Italy, Greece and Spain in the period of financial and economic crisis after 2008. The theoretical framework is based on an exact definition of external balance, ultimately as neither surplus nor deficit of a relevant balance in terms of balance of payments. Potential impacts of monetary and fiscal policies on the external balance are described there as well, using the IS-LM-BP model. The second part of the thesis, wh...

  7. Założenia rekreacji terapeutycznej i jej rola na podstawie badań przeprowadzonych w wakacyjnym ośrodku rekreacyjnym Barretstown dla dzieci cierpiących na choroby przewlekłe i zagrażające życiu

    Directory of Open Access Journals (Sweden)

    Joanna Kondracka

    2013-03-01

    Full Text Available Wraz z postępem medycyny maleje liczba dzieci umierających na poważne choroby somatyczne, takie jak nowotwory, białaczka, choroby układu odpornościowego. Jednocześnie wzrasta liczba dzieci, które latami żyją z poważną, prze‑ wlekłą chorobą i na co dzień borykają się ze skutkami ubocznymi długoterminowego leczenia, niemożnością uczest‑ nictwa w normalnych aktywnościach swych rówieśników, ze swoją odmiennością i stałym poczuciem zagrożenia. Do takich właśnie dzieci adresowane są organizowane w USA i w krajach Europy Zachodniej obozy terapeutyczne. Barretstown w Irlandii jest jednym z tego typu ośrodków, gdzie pomaga się dzieciom przy użyciu rekreacji terapeu‑ tycznej (therapeutic recreation, TR. Jest to metoda oparta na procesie przemiany, możliwej, gdy dziecko poczuje się wyjątkowe i niepowtarzalne, bezpieczne i szczęśliwe. U podłoża teoretycznego TR leży wiara w zdolność jednostki do wzbogacenia i zdefiniowania siebie na nowo w oparciu o cztery etapy towarzyszące działaniom: wyzwanie, suk‑ ces, refleksja, odkrycie. Według profesora Petera Kearneya, pediatry z Uniwersytetu w Cork w Irlandii, przemiana, jakiej mogą doświadczać uczestnicy obozów w Barretstown, przypomina proces przejścia znany w literaturze tema‑ tu jako rite of passage. W Barretstown przeprowadzonych zostało kilka badań mających na celu ustalenie skuteczno‑ ści i wpływu TR na poprawę stanu dzieci. Ich rezultaty przedstawia poniższe opracowanie. Istnieje wyraźna potrze‑ ba kontynuacji badań oraz studiów poszczególnych przypadków. Jednocześnie dotychczasowe wyniki i obserwacje psychologów potwierdzają istotną rolę TR we wspieraniu oraz leczeniu dzieci dotkniętych przez poważne chronicz‑ ne choroby somatyczne oraz ich rodzin.

  8. 75 FR 19377 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2010-04-14

    .... S500.20 SYSTEM NAME: Defense Logistics Agency (DLA) Criminal Incident Reporting System Records (DCIRS... denied any right, privilege, or benefit for which he would otherwise be entitled by Federal law or for... manager.'' ] S500.20 SYSTEM NAME: Defense Logistics Agency (DLA) Criminal Incident Reporting...

  9. 78 FR 45182 - Clarification of Sourcing Requirements for the Procurement List

    Science.gov (United States)

    2013-07-26

    ... take full advantage of the Department of Defense (DoD) 4140.1-R, DoD Supply Chain Materiel Management Regulation, the AbilityOne Program is designating the Defense Logistics Agency (DLA) as an additional... Supply Management Relationships Under the National Supply System provides DLA the authority to...

  10. 32 CFR Appendix to Part 277 - Program Fraud Civil Remedies

    Science.gov (United States)

    2010-07-01

    ... General Counsel, Defense Logistics Agency (GC, DLA), shall be the reviewing official for all cases... Agency. The General Counsel, Defense Logistics Agency (GC, DLA), and GC, NSA, may redelegate their... copying. 6. Each party shall bear its own costs of discovery. V. Exchange of Witness Lists, Statements...

  11. Section 847 Requirements for Senior Defense Officials Seeking Employment with Defense Contractors

    Science.gov (United States)

    2016-03-31

    National Security Agency [NSA]) did not use AGEAR. The DLA Deputy DAEO explained that DLA was under the false impression that SOCO had placed AGEAR...database, AGEAR only contains source documents and there is no source-to-electronic records trail that establishes the trustworthiness of these documents

  12. 2010 Department of Defense (DoD) Chemical and Biological Defense Program (CBDP) Portfolio

    Science.gov (United States)

    2010-03-01

    Lotion ( RSDL ) N/A 6505-01-507-5074/ 6910-01-507-5141 03-881/03-0882 N/A DLA 8 • Super Tropical Bleach (STB) N/A 6850-00-297-6653 N/A N/A DLA 3 Kits... RSDL ) .................................................122 Rotary Wing (RW

  13. 78 FR 25853 - Defense Logistics Agency Privacy Program

    Science.gov (United States)

    2013-05-03

    ... of the Secretary 32 CFR Part 323 RIN 0790-AI86 Defense Logistics Agency Privacy Program AGENCY: Defense Logistics Agency, DoD. ACTION: Final rule. SUMMARY: The Defense Logistics Agency (DLA) is revising... Defense Logistics Agency's implementation of the Privacy Act of 1974, as amended. In addition, DLA...

  14. Discovery of a Damped Lya Absorber at z = 3.3 along a galaxy sight-line in the SSA22 field

    CERN Document Server

    Mawatari, K; Kousai, K; Hayashino, T; Cooke, R; Prochaska, J X; Yamada, T; Matsuda, Y

    2015-01-01

    Using galaxies as background light sources to map the Lya absorption lines is a novel approach to study Damped Lya Absorbers (DLAs). We report the discovery of an intervening z = 3.335 +- 0.007 DLA along a galaxy sight-line identified among 80 Lyman Break Galaxy (LBG) spectra obtained with our VLT/VIMOS survey in the SSA22 field. The measured DLA neutral hydrogen (HI) column density is log (NHI/cm^{-2}) = 21.68 +- 0.17. The DLA covering fraction over the extended background LBG is > 70 % (2 sigma), yielding a conservative constraint on the DLA area as > 1 kpc^2. Our search for a counterpart galaxy hosting this DLA concludes that there is no counterpart galaxy with star formation rate (SFR) larger than a few Msun yr^{-1}, ruling out an unobscured violent star formation in the DLA gas cloud. We also rule out the possibility that the host galaxy of the DLA is a passive galaxy with Mstar > 5 x 10^{10} Msun or a heavily dust-obscured galaxy with E(B-V) > 2. The DLA may coincide in a large-scale overdensity of the ...

  15. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 5 (6630-7530).

    Science.gov (United States)

    1984-01-01

    08 DU PONT El DE NEMOURS AND CO NEW JERSEY ARMY GASES COMPRESSED AND LIQUEFIED 31 USAF GASES COMPRESSED AND LIQUEFIED 25 STATE TOTAL 56 FOREX CHEMICAL... FOREX CHEMICAL CORP NEW JERSEY DLA MISCELLANEOUS CHEMICAL SPECIALTIES 11l OASTON POWER TOOLS ARKANSAS DLA MISCELLANEOUS CHEMICAL SPECIALTIES 432

  16. Quality Control Review of the Defense Logistics Agency Audit Organization

    Science.gov (United States)

    2014-12-19

    all auditors are required to follow, and established an internal quality assurance division that performs ongoing, periodic assessments of work...audit organization performing audits or attestation engagements or both have an appropriate internal quality control system in place and undergo an...2010, the DLA OIG addressed our recommendation to implement official policies and procedures, which all auditors are required to follow. The DLA

  17. 48 CFR 204.7202-1 - CAGE codes.

    Science.gov (United States)

    2010-10-01

    ...-free 1-888-352-9333); (B) The on-line access to the CAGE file through the Defense Logistics Information System; (C) The on-line access to the Defense Logistics Agency (DLA) CAGE file through the DLA Network or....39-M, Federal Logistics Information System (FLIS) Procedures Manual, prescribe use of CAGE codes. (b...

  18. 78 FR 17383 - Notice of Availability of Environmental Assessment and Draft Finding of No Significant Impact...

    Science.gov (United States)

    2013-03-21

    ... Significant Impact Regarding DLA Energy's Mobility Fuel Purchasing Programs AGENCY: Defense Logistics Agency... implementation of a systemic change to the use of commercial standard Jet A aviation fuel in most aircraft could... proposed action, DLA would continue using existing commercial methods for fuel distribution; any...

  19. 32 CFR 1292.2 - Policy.

    Science.gov (United States)

    2010-07-01

    ... Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS SECURITY OF DLA ACTIVITIES AND RESOURCES § 1292.2 Policy. (a) Military Heads of DLA field activities are authorized to issue... command and may issue security regulations and orders in fulfillment of their responsibility to protect...

  20. 32 CFR 1288.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS REGISTRATION... this part 1288. (2) The inspector general, DLA (DLA-I) will procure, issue, and control inspector... this part 1288 when implemented. (2) Procure, issue, and control vehicle decals in accordance with this...

  1. Loglines. November-December 2014

    Science.gov (United States)

    2014-12-01

    of food for dining facilities in Afghanistan. DLA Disposition Services employees in Europe also help sell copper scrap that’s collected in...Petty Officer 2nd Class Charles Poplin (left) and Petty Officer 1st Class Robert Young construct pillars as part of a pier project in Romania. DLA has

  2. Loglines. July-August 2011

    Science.gov (United States)

    2011-08-01

    Corps of Engineers projects in Afghanistan. Editor’s note: This article contains information from previous DLA Today articles . DLA Troop Support...authentic andouille sausage ,” Fairbanks stated. The biggest impact of the new menu was the addition of Baskin-Robbins ice cream, he added. For weeks

  3. Complete multipactor suppression in an X-band dielectric-loaded accelerating structure

    Energy Technology Data Exchange (ETDEWEB)

    Jing, C. [Euclid Techlabs, LLC, 5900 Harper Rd, Solon, Ohio 44139, USA; High Energy Physics Division, Argonne National Laboratory, Argonne, Illinois 60439, USA; Gold, S. H. [Plasma Physics Division, Naval Research Laboratory, Washington, DC 20375, USA; Fischer, Richard [Plasma Physics Division, Naval Research Laboratory, Washington, DC 20375, USA; Gai, W. [High Energy Physics Division, Argonne National Laboratory, Argonne, Illinois 60439, USA

    2016-05-09

    Multipactor is a major issue limiting the gradient of rf-driven Dielectric-Loaded Accelerating (DLA) structures. Theoretical models have predicted that an axial magnetic field applied to DLA structures may completely block the multipactor discharge. However, previous attempts to demonstrate this magnetic field effect in an X-band traveling-wave DLA structure were inconclusive, due to the axial variation of the applied magnetic field, and showed only partial suppression of the multipactor loading [Jing et al., Appl. Phys. Lett. 103, 213503 (2013)]. The present experiment has been performed under improved conditions with a uniform axial magnetic field extending along the length of an X-band standing-wave DLA structure. Multipactor loading began to be continuously reduced starting from 3.5 kG applied magnetic field and was completely suppressed at 8 kG. Dependence of multipactor suppression on the rf gradient inside the DLA structure was also measured.

  4. Bacterial Fractal Growth in the Concentration Field of Nutrient

    Science.gov (United States)

    Fujikawa, Hiroshi; Matsushita, Mitsugu

    1991-01-01

    A Bacillus subtilis strain is found to grow through the diffusion-limited aggregation (DLA) process on agar plates. The organism is spotted on the agar plate containing a low concentration of peptone as a single nutrient and incubated at 35°C. The colony pattern grown on the plate surface is self-similar with the fractal dimension of 1.73± 0.02. Bacterial DLA branches are shown to grow in a concentration field of nutrient from the fact that they grow predominantly in the direction of higher nutrient concentration. The colonial morphology varies with the nutrient and agar concentrations of an agar plate, including DLA, a round type, dense branching morphology (DBM), and a spreading without openings. Two neighboring colonies repulse each other in DLA and DBM types only. On an agar plate containing glycerol the colony becomes remarkably round, quite different from the DLA morphology.

  5. Influence of saw blade clearance over the workpiece on tool-wear

    Directory of Open Access Journals (Sweden)

    Mikuláš Siklienka

    2008-12-01

    Full Text Available This paper presents the results of experimental measurement of tool-wear in the cutting process with circular saw of oak wood depending on the upper clearance of 5mmand 50 mm, respectively. The circular saw blade made of HSS by Pilana was used for the experiment. The measurement was carried out by the experimental equipment designed by the Department of Woodworking, Technical University of Zvolen and DMMA–36 circular saw made by Reszelski Zaklad Przemyslu Leoenictwa in Reszel. The tool-wear was evaluated by two parameters and namely by the radius of the cutting edge rn and by the cutting edge recession SV. The results of tool-wear are presented in dependence on the indicated chip length and cutting material length. With the change of the clearance from 5 mm to 50 mm and with the thickness of the test specimen h = 30 mm almost double amount of sawn wood is required to attain the same chip length. The results have shown that in dependence on the length of the cutting material, the tool wear is smaller at a higher clearance of saw blade over the workpiece.

  6. Risk assessment of dermatolymphangioadenitis by lymphoscintigraphy in patients with lower extremity lymphedema

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Joon Young; Hwang, Ji Hye; Park, Jung Mi; Lee, Kyung Han; Kim, Sang Eun; Kim, Dong Ik; Lee, Byung Boong; Kim, Byung Tae [College of Medicine, Sungkyunkwan Univ., Seoul (Korea, Republic of)

    1999-02-01

    Dermatolymphangioadenitis (DLA) is a common and serious complication of lymphedema which deteriorates lymphatic function. The purpose of this study was to assess the risk of DLA by lymphoscintigraphy in patients with lower extremity lymphedema. The subjects were 59 edematous lower extremities of 50 patients without previous episode of DLA and 12 lower extremities of 6 controls. Whole body images were acquired 1 min and 2 hr after subcutaneous injection of 37 MBq of Tc-99m-antimony sulfide colloid into interdigital spaces of both feet before therapy for lymphedema. The lymphoscintigrapic and clinical variables were compared between groups with or without occurrence of DLA during clinical follow up. There were 20 episodes of DLA in 12 extremities during clinical follow-up (19{+-}6 months). On univariate analysis, there were significant differences in ilioinguinal lymph node uptake, uptake pattern of main lymphatic vessel, clinical stage and therapy compliance between the two groups. After multivariate analysis, only the uptake pattern of main lymphatic vessel and therapy compliance were confirmed to be independent variables. In other words, non-visualized main lymphatic vessel and poor compliance to therapy were more frequent in extremities with subsequent occurrence of DLA. Lymphoscintigraphy can be used to predict the risk of DLA and may thus be helpful for determining the initial therapeutic plan in patients with lower extremity lymphedema.

  7. Microbiome Remodeling via the Montmorillonite Adsorption-Excretion Axis Prevents Obesity-related Metabolic Disorders.

    Science.gov (United States)

    Xu, Pengfei; Hong, Fan; Wang, Jialin; Cong, Yusheng; Dai, Shu; Wang, Sheng; Wang, Jing; Jin, Xi; Wang, Fang; Liu, Jin; Zhai, Yonggong

    2017-02-01

    Obesity and its related metabolic disorders are closely correlated with gut dysbiosis. Montmorillonite is a common medicine used to treat diarrhea. We have previously found that dietary lipid adsorbent-montmorillonite (DLA-M) has an unexpected role in preventing obesity. The aim of this study was to further investigate whether DLA-M regulates intestinal absorption and gut microbiota to prevent obesity-related metabolic disorders. Here, we show that DLA-M absorbs free fatty acids (FFA) and endotoxins in vitro and in vivo. Moreover, the combination of fluorescent tracer technique and polarized light microscopy showed that DLA-M crystals immobilized BODIPY® FL C16 and FITC-LPS, respectively, in the digestive tract in situ. HFD-fed mice treated with DLA-M showed mild changes in the composition of the gut microbiota, particularly increases in short-chain fatty acids (SCFA)-producing Blautia bacteria and decreases in endotoxin-producing Desulfovibrio bacteria, these changes were positively correlated with obesity and inflammation. Our results indicated that DLA-M immobilizes FFA and endotoxins in the digestive tract via the adsorption-excretion axis and DLA-M may potentially be used as a prebiotic to prevent intestinal dysbiosis and obesity-associated metabolic disorders in obese individuals.

  8. Proviral genomic sequence analysis of Chinese donkey leukocyte attenuated equine infectious anemia virus vaccine and its parental virus strain Liaoning

    Institute of Scientific and Technical Information of China (English)

    王柳; 童光志; 刘红全; 杨志彪; 仇华吉; 孔宪刚; 王玫

    2002-01-01

    Proviral DNA was extracted from donkey leukocyte infected with Chinese donkey leukocyte attenuated equine infectious anemia virus(DLA-EIAV), and peripheral blood lymphocytes(PBL) from a horse infected with the virulent EIAV strain Liaoning(EIAV L). The entire proviral DNA from both viruses was cloned and sequenced. The lengths of complete genomic sequences of DLA-EIAV and EIAV L provirus were 8266 bp and 8235 bp, respectively. Sequence comparison indicated that DLA-EIAV shares 97.0% and 97.5% in sequence homology with EIAV L and donkey-adapted EIAV(DA-EIAV), respectively. Lots of variations occurred in long terminal repeat(LTR, consisting of U3, R, U5), ORF S2, and env regions between DLA-EIAV and EIAV L. The nucleotide sequence differences of the two viruses in U3, R, U5, ORF S2, and env are 13.2%, 7.5%, 5.1%, 3.9%, and 2.7%, respectively, and predicted amino acid sequence differences in env and S2 coding regions are 4.4% and 8.8%, respectively. Six conserved regions are characterized in Gp90. There is a cis-activating GATA motif in ENH of DLA-EIAV and EIAV L. Two N-linked glycosylation sites disappeared in DLA-EIAV Gp90 in comparison with that of EIAV L. A bHLH transcription factor binding consensus sequence was found in LTR of DLA-EIAV but not in EIAV L. Furthermore, there is a mutation in the stem of DLA-EIAV TAR resulting in formation of a uridine tuber. Further study is needed to uncover the relationship between sequence changes and their biological functions of DLA-EIAV and L.

  9. DISCOVERY OF A DAMPED Lyα ABSORBER AT z = 3.3 ALONG A GALAXY SIGHT-LINE IN THE SSA22 FIELD

    Energy Technology Data Exchange (ETDEWEB)

    Mawatari, K.; Inoue, A. K. [College of General Education, Osaka Sangyo University, 3-1-1, Nakagaito, Daito, Osaka, 574-8530 (Japan); Kousai, K.; Hayashino, T. [Research Center for Neutrino Science, General School of Science, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Cooke, R.; Prochaska, J. X. [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Yamada, T. [Astronomical Institute, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Matsuda, Y., E-mail: mawatari@las.osaka-sandai.ac.jp [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan)

    2016-02-01

    Using galaxies as background light sources to map the Lyα absorption lines is a novel approach to study Damped Lyα Absorbers (DLAs). We report the discovery of an intervening z = 3.335 ± 0.007 DLA along a galaxy sight-line identified among 80 Lyman Break Galaxy (LBG) spectra obtained with our Very Large Telescope/Visible Multi-Object Spectrograph survey in the SSA22 field. The measured DLA neutral hydrogen (H i) column density is log(N{sub H} {sub i}/cm{sup −2}) = 21.68 ± 0.17. The DLA covering fraction over the extended background LBG is >70% (2σ), yielding a conservative constraint on the DLA area of ≳1 kpc{sup 2}. Our search for a counterpart galaxy hosting this DLA concludes that there is no counterpart galaxy with star formation rate larger than a few M{sub ⊙} yr{sup −1}, ruling out an unobscured violent star formation in the DLA gas cloud. We also rule out the possibility that the host galaxy of the DLA is a passive galaxy with M{sub *} ≳ 5 × 10{sup 10}M{sub ⊙} or a heavily dust-obscured galaxy with E(B − V) ≳ 2. The DLA may coincide with a large-scale overdensity of the spectroscopic LBGs. The occurrence rate of the DLA is compatible with that of DLAs found in QSO sight-lines.

  10. D-lactic acid production by Sporolactobacillus inulinus Y2-8 immobilized in fibrous bed bioreactor using corn flour hydrolyzate.

    Science.gov (United States)

    Zhao, Ting; Liu, Dong; Ren, Hengfei; Shi, Xinchi; Zhao, Nan; Chen, Yong; Ying, Hanjie

    2014-12-28

    In this study, a fibrous bed bioreactor (FBB) was used for D-lactic acid (D-LA) production by Sporolactobacillus inulinus Y2-8. Corn flour hydrolyzed with α-amylase and saccharifying enzyme was used as a cost-efficient and nutrient-rich substrate for D-LA production. A maximal starch conversion rate of 93.78% was obtained. The optimum pH for D-LA production was determined to be 6.5. Ammonia water was determined to be an ideal neutralizing agent, which improved the D-LA production and purification processes. Batch fermentation and fedbatch fermentation, with both free cells and immobilized cells, were compared to highlight the advantages of FBB fermentation. In batch mode, the D-LA production rate of FBB fermentation was 1.62 g/l/h, which was 37.29% higher than that of free-cell fermentation, and the D-LA optical purities of the two fermentation methods were above 99.00%. In fed-batch mode, the maximum D-LA concentration attained by FBB fermentation was 218.8 g/l, which was 37.67% higher than that of free-cell fermentation. Repeated-batch fermentation was performed to determine the long-term performance of the FBB system, and the data indicated that the average D-LA production rate was 1.62 g/l/h and the average yield was 0.98 g/g. Thus, hydrolyzed corn flour fermented by S. inulinus Y2-8 in a FBB may be used for improving D-LA fermentation by using ammonia water as the neutralizing agent.

  11. Loglines. November - December 2010

    Science.gov (United States)

    2010-12-01

    Suite 2545 Fort Belvoir, VA 22060-6221 703-767-6200 E-mail: loglines@dla.mil Facebook : www.facebook.com/dla.mil DLA Director Navy Vice Adm. Alan S...uniform, helmet and other protective equipment also came from us. When that Soldier heads to the dining facility, he’ll eat food provided by Troop...painkillers and alcohol once helped him escape the symptoms of his post-traumatic stress disorder , but he has since sought therapy and flushed the drugs

  12. Loglines. May-June 2014

    Science.gov (United States)

    2014-06-01

    life cycle course, Contingency Operations, is delivered by DLA Training instructors Susan Guerrero and Kathleen Schulz at the DLA Disposition...or discuss how best to partner with the agency, they start at Susan Witek’s desk. “[We want] to provide our allies an opportunity to come and learn...They’ll see if the truck starts and look under the hood . From there, they’ll decide which ones they want.” In the past, DLA took a more passive

  13. Rodzina dotknięta przemocą – możliwości i formy pomocy na podstawie badań Specjalistycznych Ośrodków Wsparcia dla Ofiar Przemocy w Rodzinie w regionie dolnośląskim/ Violence Affected Family – Possibilities and Forms of Assistance Based on the Research of Specialist Centers of Support for Victims of Domestic Violence in the Region of Lower Silesia

    Directory of Open Access Journals (Sweden)

    BEATA ŚWIĄTEK

    2011-01-01

    Full Text Available Family has always created an indispensable environment for a man to fulfill his needs and for his development. Family makes our lives meaningful, helps to put plans into practice and to assign goals. The need for belonging to a family constitutes a value dear to all communities. In the literature of the subject there exists a general division into functional and non-functional families. One of the factors determining a family's capability is violence. It influences the quality of the offspring upbringing, family relationships and bonds. In its air social competence of parents declines and their attitude to family-related responsibilities deteriorates. The issue of domestic violence is tackles by specialists of the area of law, psychology, sociology, pedagogy and medicine, who are studying sources and methods of fighting with this phenomenon. Its social damage is so devastating that its unambiguous definition is almost impossible. In the face of a serious threat generated by domestic violence in recent years, there have been held campaigns, workshops, local and nationwide conferences to promote assistance to violence-stricken victims. Preventive schemes have also been developed to restrain violence in schools and local community. Violence affected individuals can seek help in centers founded especially for this purpose and maintained by local councils (MOPS or county councils (PCPR, as well as non-government organizations and associations. A comprehensive support for families suffering from domestic violence is provided by Emergency Intervention Centers and Specialist Centers of Support for Victims of domestic Violence. In the region of Lower Silesia there exist two institutions of such a character, one inWroclaw and the other one in Walbrzych. Their activity involves therapeutic tasks, aid and provision for victims of domestic violence.

  14. Role of Direct Laser Acceleration of Electrons in a Laser Wakefield Accelerator with Ionization Injection

    Science.gov (United States)

    Shaw, J. L.; Lemos, N.; Amorim, L. D.; Vafaei-Najafabadi, N.; Marsh, K. A.; Tsung, F. S.; Mori, W. B.; Joshi, C.

    2017-02-01

    We show the first experimental demonstration that electrons being accelerated in a laser wakefield accelerator operating in the forced or blowout regimes gain significant energy from both the direct laser acceleration (DLA) and the laser wakefield acceleration mechanisms. Supporting full-scale 3D particle-in-cell simulations elucidate the role of the DLA of electrons in a laser wakefield accelerator when ionization injection of electrons is employed. An explanation is given for how electrons can maintain the DLA resonance condition in a laser wakefield accelerator despite the evolving properties of both the drive laser and the electrons. The produced electron beams exhibit characteristic features that are indicative of DLA as an additional acceleration mechanism.

  15. Research

    African Journals Online (AJOL)

    uncommitted, and represents the student's attitude in the learning process.[1] ... shown that the learning environment alone can push a student towards a ... Students may primarily use either a deep learning approach (DLA) or surface learning ...

  16. Detection of emission lines from z ~ 3 DLAs towards the QSO J2358+0149

    CERN Document Server

    Srianand, Raghunathan; Noterdaeme, Pasquier; Petitjean, Patrick; Krühler, Thomas; Japelj, Jure; Pâris, Isabelle; Kashikawa, Nobunari

    2016-01-01

    Using VLT/X-shooter we searched for emission line galaxies associated to four damped Lyman-$\\alpha$ systems (DLAs) and one sub-DLA at 2.73=10 per cent. No other emission line is detected from this system. Because the DLA has a small velocity separation from the quasar (~500 km s^{-1}) and the DLA emission is located within a small projected distance ($\\rho<5$ kpc), we also explore the possibility that the Ly$\\alpha$ emission is being induced by the QSO itself. QSO induced Ly$\\alpha$ fluorescence is possible if the DLA is within a physical separation of 340 kpc to the QSO. Detection of stellar continuum light and/or the oxygen emission lines would disfavor this possibility. We do not detect any emission line from the remaining three systems.

  17. Cosmochemistry, cosmology and fundamental constants: High-resolution spectroscopy of damped Lyman-alpha systems

    CERN Document Server

    Quast, R; Smette, A; Garcet, O; Ledoux, C; López, S; Wisotzki, L

    2004-01-01

    Spectroscopy of QSO absorption lines provides essential observational input for the study of nucleosynthesis and chemical evolution of galaxies at high redshift. But new observations may indicate that present chemical abundance data are biased due to deficient spectral resolution and unknown selection effects: Recent high-resolution spectra reveal the hitherto unperceived chemical nonuniformity of molecular hydrogen-bearing damped Lyman-alpha (DLA) systems, and the novel H/ESO DLA survey produces compelling evidence for faint QSOs being attenuated by dust. We present a revised analysis of the molecular hydrogen-bearing DLA complex toward HE 0515-4414 showing nonuniform differential depletion of chemical elements onto dust grains, and introduce to the H/ESO DLA survey and its implications. Conclusively, we aim at starting an unbiased chemical abundance database established on high-resolution spectroscopic observations. New data to probe the temperature-redshift relation predicted by standard cosmology and to t...

  18. Double-crossover phenomena in Laplacian growth: Effects of sticking probability and finite viscosity ratio

    Science.gov (United States)

    Nagatani, Takashi; Stanley, H. Eugene

    1990-03-01

    A combined effect of sticking probability and finite viscosity ratio is studied on the pattern formation in Laplacian growth. A renormalization-group theory is developed to study the crossover phenomena between the diffusion-limited aggregation (DLA) and nonfractal structure. A two-stage crossover phenomenon is analyzed by using a three-parameter position-space renormalization-group method. A global flow diagram in three-parameter space is obtained. It is found that there are three nontrivial fixed points, the first Eden point, the DLA point and the second Eden point. The second Eden point corresponding to the dense structure is stable in all directions, while the first Eden point and the DLA point are saddle points. When the sticking probability P is small and the viscosity ratio is finite, the aggregate must cross over from the dense structure, through the DLA fractal, finally to the dense aggregate.

  19. Phase transition and crossover in diffusion-limited aggregation with reaction times

    Science.gov (United States)

    Nagatani, Takashi; Stanley, H. Eugene

    1990-09-01

    A generalized diffusion-limited aggregation (DLA) with reaction times that has been proposed by Bunde and Miyazima [Phys. Rev. A 38, 2099 (1988)] is considered. Crossover from the DLA to the diffusion-limited self-avoiding walk (DLSAW) is investigated by using the two-parameter position-space renormalization-group method. The crossover exponent and the crossover radius are calculated. The geometrical phase transition between DLA and DLSAW found by Bunde and Miyajima is analyzed by making use of the three-parameter position-space renormalization-group method. A global flow diagram in the three-parameter space is obtained. Above the percolation threshold all the renormalization flows are merged into the DLA point. Below the threshold all the renormalization flows are merged into the DLSAW point. When the reaction time is large, the double-crossover phenomenon occurs below the threshold.

  20. Diffusion-Limited Aggregation on Percolating Cluster: Crossover and Multifractal Structure

    Science.gov (United States)

    Nagatani, Takashi; Stanley, H. Eugene

    1991-04-01

    Viscous fingering in porous media is considered as the diffusion-limited aggregation (DLA) on the percolating cluster. The crossover between percolation and DLA is studied by using a three-parameter position-space renormalization-group approach. The global flow diagram in the two-parameter space is obtained. It is found that there are two nontrivial fixed points, the percolation point and the DLA point. Above the percolation threshold, the system crosses eventually over to the DLA fractal on the perfect lattice. The fractal nature and the multifractal structure of the growth probability distribution are derived from the position-space renormalization-group method. The multifractal structure at the percolation threshold is compared with that at the perfect lattice.

  1. Distributed Leadership Agency and Its Relationship to Individual Autonomy and Occupational Self-Efficacy

    DEFF Research Database (Denmark)

    Unterrainer, Christine; Jeppesen, Hans Jeppe; Jønsson, Thomas Faurholt

    2017-01-01

    The purpose of the present study is the investigation of distributed leadership agency (DLA). DLA is an activity-based concept, which is defined as employees’ active participation in leadership tasks. By combining a descriptive and a normative approach DLA has the potential of real employee...... empowerment. It can protect from arbitrary managerial power and lead to employees’ personal development through sharing organizational resources, influencing leadership activities and joint decision making in companies. The study examines individually perceived autonomy as an antecedent and employees......-sectional as well as cross-lagged relationships and an autoregressive model for analyzing the half-longitudinal mediation. The results revealed a significant positive effect of DLA on employees’ occupational self-efficacy cross-sectionally at Time 1 (n = 117) and Time 2 (n = 67), as well as cross-lagged (n = 67...

  2. Spatially Resolved Emission of a z~3 Damped Lyman Alpha Galaxy with Keck/OSIRIS IFU

    Science.gov (United States)

    Christenson, Holly; Jorgenson, Regina

    2017-01-01

    The damped Lyman alpha (DLA) class of galaxies contains most of the neutral hydrogen gas over cosmic time. Few DLAs have been detected directly, which limits our knowledge of fundamental properties like size and mass. We present Keck/OSIRIS infrared integral field spectroscopy (IFU) observations of a DLA that was first detected in absorption toward a background quasar. Our observations use the Keck Laser Guide Star Adaptive Optics system to reduce the point-spread function of the quasar, making it possible to spatially resolve the DLA emission. We map this emission in O[III] 5007 Å. At redshift z~3, this DLA represents one of the highest redshift DLAs mapped with IFU spectroscopy. We present measurements of the star formation rate, metallicity, and gas mass of the galaxy.This project was supported in part by the NSF REU grant AST-1358980 and by the Nantucket Maria Mitchell Association.

  3. Multifractal analysis of the branch structure of diffusion-limited aggregates

    Science.gov (United States)

    Hanan, W. G.; Heffernan, D. M.

    2012-02-01

    We examine the branch structure of radial diffusion-limited aggregation (DLA) clusters for evidence of multifractality. The lacunarity of DLA clusters is measured and the generalized dimensions D(q) of their mass distribution is estimated using the sandbox method. We find that the global n-fold symmetry of the aggregates can induce anomalous scaling behavior into these measurements. However, negating the effects of this symmetry, standard scaling is recovered.

  4. Stationary Growth and Unique Invariant Harmonic Measure of Cylindrical Diffusion Limited Aggregation

    Science.gov (United States)

    Marchetti, Riccardo; Taloni, Alessandro; Caglioti, Emanuele; Loreto, Vittorio; Pietronero, Luciano

    2012-08-01

    We prove that the harmonic measure is stationary, unique, and invariant on the interface of diffusion limited aggregation (DLA) growing on a cylinder surface. We provide a detailed theoretical analysis puzzling together multiscaling, multifractality, and conformal invariance, supported by extensive numerical simulations of clusters built using conformal mappings and on a lattice. The growth properties of the active and frozen zones are clearly elucidated. We show that the unique scaling exponent characterizing the stationary growth is the DLA fractal dimension.

  5. Improving Supply Management: The CALS Connection

    Science.gov (United States)

    1992-02-01

    several data systems and presents the data online through prestructured reports and responses to ad hoc queries. Status: Operational. 12. 5-2 CALS...DLA Online Characteristics Search System DLA LOGRUN allows users to search for items by characteristics. After modernization, a much improved system...Committee SMR - source, maintenance, and recoverability (code) SPOC Ships Parts Control Center (Navy) SPS = Ships’ Provisioning System (Navy) SPTD

  6. Annual Statement of Assurance. Fiscal Year 1991

    Science.gov (United States)

    1991-01-01

    Albuquerque, New Mexico . During the summer of FY 1990, DCMC began the process of eliminating redundancy and took steps toward creating a more efficient...between CPAS and MOCAS . Date: Milestone: 10/91 Coordinate concept with DFAS and the Air Force. 11/91 Begin reporting Negative Unliquidated Obligation...System Base Operating Supply System (BOSS) DLA C Mechanization of Contract DLA C Administration Services ( MOCAS ) MILITARY PAYROLL SYSTEM Joint Uniform

  7. Defense Logistics Agency Support for Environmental Sustainability - Products and Services Supporting Environmental Requirements

    Science.gov (United States)

    2011-05-12

    call our toll free number 1-800-352-2852 DLA Troop Support WARFIGHTER FOCUSED, GLOBALLY RESPONSIVE SUPPLY CHAIN LEADERSHIP 38 Biobased Plastic Flatware...clear plastic bag. DLA Troop Support WARFIGHTER FOCUSED, GLOBALLY RESPONSIVE SUPPLY CHAIN LEADERSHIP 39Jun10 Biobased Plastic Flatware Offered by JWOD NIB...Toner Cartridges • Vehicular Wet Battery Program • Heavy Equipment Procurement Program • Energy Efficient Lighting • Biobased Fuels • Biobased

  8. The influence of sample size on the estimation of net premiums and net premiums' size in civil responsibility car insurance

    OpenAIRE

    Szymańska, Anna

    2011-01-01

    W pracy przedstawiono zastosowanie estymatorów bayesowskich do taryfikacji a posteriori w ubezpieczeniach komunikacyjnych OC. Składki netto wyznaczono za pomocą zasady wartości oczekiwanej oraz zasady kwantyla rzędu E. Porównano otrzymane stawki składek dla różnej liczebności próby dla rozkładu wielkości szkód typu Pareto.

  9. VizieR Online Data Catalog: SDSS damped Ly{alpha} survey: DR1 (Prochaska+, 2004)

    Science.gov (United States)

    Prochaska, J. X.; Herbert-Fort, S.

    2005-11-01

    We present the results from an automated search for damped Ly{alpha} (DLA) systems in the quasar spectra of Data Release 1 from the Sloan Digital Sky Survey (SDSS-DR1). At z~2.5, this homogeneous data set has greater statistical significance than the previous two decades of research. We derive a statistical sample of 71 DLA systems (>50 previously unpublished) at z>2.1 and measure HI column densities directly from the SDSS spectra. (1 data file).

  10. Supply Chain Modeling: Downstream Risk Assessment Methodology (DRAM) Summary of Development and Application

    Science.gov (United States)

    2015-04-01

    Stockpile Requirements,” for the Strategic Materials Office of the Defense Logistics Agency (DLA). The views, opinions, and findings should not be... Logistics Agency Strategic Materials (DLA SM) to provide the capability to analyze supply chains of strategic and critical materials and the... material feedstock requirements. The fundamental approach is mass flow analysis, from raw material through each step in production. The model must also

  11. Report to the Congressional Defense Committees: Status of the Department of Defense’s Business Transformation Efforts

    Science.gov (United States)

    2008-03-15

    every time. The Enterprise Business System (EBS), DLA’s ERP platform for supply chain management, was developed and introduced into DLA operations with...providers. • Improve efficiency of DoD procurement by consolidating eCommerce ordering sites, adding a Customer Care Module and improving credit card...to the units deployed in austere environments. The capability leverages more flexible and mobile platforms to collect and disseminate shipment

  12. Loglines. March-April 2015

    Science.gov (United States)

    2015-04-01

    Form 298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 Lt. Gen . Andy Busch, USAF Director, Defense Logistics Agency is what this edition of Loglines is...our warfighters and for our nation. I look forward to working with each and every one of you. DLA Director Air Force Lt. Gen . Andy Busch DLA Vice...include the Office of the Secretary of Defense, the Defense Advanced Research Projects Agency, the Competitors line up in shopping carts as they

  13. Loglines. May - June 2012

    Science.gov (United States)

    2012-06-01

    history of supply support in Philadelphia weaves through several name and location changes during peace and war: equipping the Lewis and Clark...Troop Support Clothing and Textiles helps get blankets to those in need through the federal Homeless Support Program. Humanitarian Aid 12 DLA...more than $3 million, said Renee Fromberg, DLA Troop Support Clothing and Textiles program manager. “The blankets go to individuals Story by

  14. 2010 Defense Logistics Agency Enterprise Supplier Conference and Exhibition

    Science.gov (United States)

    2010-08-25

    DLA Contracting Services Office SB Dayton, OH 45459-4157 Hess Corporation DLA Energy LB Woodbridge...James McClaugherty Mr. Milton Lewis Batteries & Tires Dan McGrath Hardware Ruth Herman Land - Columbus COL Ryan Kivett Ben Roberts Land and Maritime...Customer Sales Orders: 61K / month • Annual Sales: $150M Ruth Herman Division Chief Harry MacCord Diversified Hardware I Andrea Wicker Diversified

  15. Defense AT and L.

    Science.gov (United States)

    2014-06-01

    Agency (DLA). DLA manages an inventory of more than 5 million line items with annual sales in excess of $44 billion. The inventory is warehoused...to “Just in Time” supply chain management. But are we ready today to stop buying spares for our warehouse shelves and to sell off all of our...the use of a scalable data structure, XML tagging and indexing, Web services and federated output scripts . A Web-based process not only would

  16. Characterizations of Nanofluid Heat Transfer Enhancements

    Science.gov (United States)

    2013-09-06

    water treatment coagulants such as alum or iron, coagulant saturation conditions and sweep coagulation problems can be avoided [64]. Aggregation rates...DLA and RLA are unusual, but similar to other studies where salts were used to promote DLA for polystyrene latex resulting in low fractal dimensions of...1.55 [68] or where salts were used to promote RLA for colloidal goethite resulting in a low fractal dimensions of 1.96 [69]. These low fractal

  17. DoD Value Engineering Conference Report. Value Engineering (VE) - A Tool that Benefits Line Management Held at Leesburg, Virginia on 1-2 November 1984. Part 2. Plenary Session,

    Science.gov (United States)

    1985-06-01

    Office" Workshop B R. Bruner Room 3471-3475 "VEP/VECP" Workshop C R. Bidwell Room 2464-2466. "VEP/VECP Administration, Negotiation, and Implementation...981-3316 DWICK, Jerome No C General Engineer DLA, Defense Contract Administration Services Management Area *, . 201 Varick Street New York, NY 10014...2181/AV 441-2181 BRUNER , Richard G. No B Executive Director Technical and Logistics Services Defense Logistics Agency (DLA-S) . Cameron Station

  18. Poly(glycerol sebacate)/poly(butylene succinate-butylene dilinoleate) fibrous scaffolds for cardiac tissue engineering.

    Science.gov (United States)

    Tallawi, Marwa; Zebrowski, David C; Rai, Ranjana; Roether, Judith A; Schubert, Dirk W; El Fray, Miroslawa; Engel, Felix B; Aifantis, Katerina E; Boccaccini, Aldo R

    2015-06-01

    The present article investigates the use of a novel electrospun fibrous blend of poly(glycerol sebacate) (PGS) and poly(butylene succinate-butylene dilinoleate) (PBS-DLA) as a candidate for cardiac tissue engineering. Random electrospun fibers with various PGS/PBS-DLA compositions (70/30, 60/40, 50/50, and 0/100) were fabricated. To examine the suitability of these fiber blends for heart patches, their morphology, as well as their physical, chemical, and mechanical properties were measured before examining their biocompatibility through cell adhesion. The fabricated fibers were bead-free and exhibited a relatively narrow diameter distribution. The addition of PBS-DLA to PGS resulted in an increase of the average fiber diameter, whereas increasing the amount of PBS-DLA decreased the hydrophilicity and the water uptake of the nanofibrous scaffolds to values that approached those of neat PBS-DLA nanofibers. Moreover, the addition of PBS-DLA significantly increased the elastic modulus. Initial toxicity studies with C2C12 myoblast cells up to 72 h confirmed nontoxic behavior of the blends. Immunofluorescence analyses and scanning electron microscopy analyses confirmed that C2C12 cells showed better cell attachment and proliferation on electrospun mats with higher PBS-DLA content. However, immunofluorescence analyses of the 3-day-old rat cardiomyocytes cultured for 2 and 5 days demonstrated better attachment on the 70/30 fibers containing well-aligned sarcomeres and expressing high amounts of connexin 43 in cellular junctions indicating efficient cell-to-cell communication. It can be concluded, therefore, that fibrous PGS/PBS-DLA scaffolds exhibit promising characteristics as a biomaterial for cardiac patch applications.

  19. Ecological Assessment of the Effects of Army Training Activities on a Desert Ecosystem. National Training Center, Fort Irwin, California

    Science.gov (United States)

    1985-06-01

    Soil shrinkage may also contribute to an upward movement of gravel (Ref. 117). Associated algae and lichens provide a "cement" that gives rigidity to the...The mechanism of its origin has been debated for more than 100 years. The involvement of a variety of biological agents has been proposed: lichens ...20310 ATTN% DEN (23) US Govt Printing Office 22304 DLA ATTN: DLA-WI 22314 Receiving Sect/Depository Copies (2) DNA ATTN: NADS 20305 US Army Env. Hygiene

  20. Metabolic engineering and adaptive evolution for efficient production of D-lactic acid in Saccharomyces cerevisiae.

    Science.gov (United States)

    Baek, Seung-Ho; Kwon, Eunice Y; Kim, Yong Hwan; Hahn, Ji-Sook

    2016-03-01

    There is an increasing demand for microbial production of lactic acid (LA) as a monomer of biodegradable poly lactic acid (PLA). Both optical isomers, D-LA and L-LA, are required to produce stereocomplex PLA with improved properties. In this study, we developed Saccharomyces cerevisiae strains for efficient production of D-LA. D-LA production was achieved by expressing highly stereospecific D-lactate dehydrogenase gene (ldhA, LEUM_1756) from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 in S. cerevisiae lacking natural LA production activity. D-LA consumption after glucose depletion was inhibited by deleting DLD1 encoding D-lactate dehydrogenase and JEN1 encoding monocarboxylate transporter. In addition, ethanol production was reduced by deleting PDC1 and ADH1 genes encoding major pyruvate decarboxylase and alcohol dehydrogenase, respectively, and glycerol production was eliminated by deleting GPD1 and GPD2 genes encoding glycerol-3-phosphate dehydrogenase. LA tolerance of the engineered D-LA-producing strain was enhanced by adaptive evolution and overexpression of HAA1 encoding a transcriptional activator involved in weak acid stress response, resulting in effective D-LA production up to 48.9 g/L without neutralization. In a flask fed-batch fermentation under neutralizing condition, our evolved strain produced 112.0 g/L D-LA with a yield of 0.80 g/g glucose and a productivity of 2.2 g/(L · h).

  1. Alleles of the major histocompatibility complex play a role in the pathogenesis of pancreatic acinar atrophy in dogs.

    Science.gov (United States)

    Tsai, Kate L; Starr-Moss, Alison N; Venkataraman, Gopalakrishnan M; Robinson, Christopher; Kennedy, Lorna J; Steiner, Jörg M; Clark, Leigh Anne

    2013-07-01

    Exocrine pancreatic insufficiency (EPI) is a disease wherein pancreatic acinar cells fail to synthesize and secrete sufficient amounts of digestive enzymes for normal digestion of food. EPI affects many dog breeds, with a dramatically higher prevalence in the German shepherd dog (GSD) population. In this breed and perhaps others, EPI most often results from degeneration of the acinar cells of the pancreas, a hereditary disorder termed pancreatic acinar atrophy (PAA). Evidence of lymphocytic infiltration indicates that PAA is an autoimmune disease, but the genetic etiology remains unclear. Data from global gene expression and single nucleotide polymorphism profiles in the GSD suggest the involvement of the major histocompatibility complex [MHC; dog leukocyte antigen (DLA)]. To determine if alleles of the MHC influence development of EPI, genotyping of polymorphic class I (DLA-88) and II loci (DLA-DRB1, DLA-DQA1, and DLA-DQB1) was carried out for 70 affected and 63 control GSDs, and four-locus haplotypes were determined. One haplotype containing a novel allele of DLA-88 is very highly associated with EPI (OR > 17; P = 0.000125), while two haplotypes were found to confer protection from EPI (P = 0.00087 and 0.0115). Described herein is the genotyping of MHC class I and II loci in a GSD cohort, establishment of four-locus haplotypes, and association of alleles/haplotypes with EPI.

  2. The evolution of neutral gas in damped Lyman $\\alpha$ systems from the XQ-100 survey

    CERN Document Server

    Sánchez-Ramírez, R; Prochaska, J X; Berg, T A M; López, S; D'Odorico, V; Becker, G D; Christensen, L; Cupani, G; Denney, K D; Pâris, I; Worseck, G; Gorosabel, J

    2015-01-01

    We present a sample of 38 intervening Damped Lyman $\\alpha$ (DLA) systems identified towards 100 $z>3.5$ quasars, observed during the XQ-100 survey. The XQ-100 DLA sample is combined with major DLA surveys in the literature. The final combined sample consists of 742 DLAs over a redshift range approximately $1.6 < z_{\\rm abs} < 5.0$. We develop a novel technique for computing $\\Omega_{\\rm HI}^{\\rm DLA}$ as a continuous function of redshift, and we thoroughly assess and quantify the sources of error therein, including fitting errors and incomplete sampling of the high column density end of the column density distribution function. There is a statistically significant redshift evolution in $\\Omega_{\\rm HI}^{\\rm DLA}$ ($\\geq 3 \\sigma$) from $z \\sim 2$ to $z \\sim$ 5. In order to make a complete assessment of the redshift evolution of $\\Omega_{\\rm HI}$, we combine our high redshift DLA sample with absorption surveys at intermediate redshift and 21cm emission line surveys of the local universe. Although $\\Omeg...

  3. A ghostly damped Ly α system revealed by metal absorption lines

    Science.gov (United States)

    Fathivavsari, H.; Petitjean, P.; Zou, S.; Noterdaeme, P.; Ledoux, C.; Krühler, T.; Srianand, R.

    2017-03-01

    We report the discovery of the first 'ghostly' damped Ly α absorption system (DLA), which is identified by the presence of absorption from strong low-ion species at zabs = 1.704 65 along the line of sight to the quasar SDSS J113341.29-005740.0 with zem = 1.704 41. No Ly α absorption trough is seen associated with these absorptions because the DLA trough is filled with the leaked emission from the broad emission-line region of the quasar. By modelling the quasar spectrum and analysing the metal lines, we derive log N(H I)(cm-2) ∼21.0 ± 0.3. The DLA cloud is small (≤0.32 pc), thus not covering entirely the broad-line region and is located at ≥39 pc from the central active galactic nucleus (AGN). Although the DLA is slightly redshifted relative to the quasar, its metallicity ([S/H] = -0.41 ± 0.30) is intermediate between what is expected from infalling and outflowing gas. It could be possible that the DLA is part of some infalling material accreting on to the quasar host galaxy through filaments, and that its metallicity is raised by mixing with the enriched outflowing gas emanating from the central AGN. Current DLA surveys miss these 'ghostly' DLAs, and it would be important to quantify the statistics of this population by searching the Sloan Digital Sky Survey (SDSS) data base using metal absorption templates.

  4. 中国冬小麦puroindoline类型分布及其对溶剂保持力的影响%Distribution of Puroindoline Alleles in Chinese Winter Wheats and Its Effect on Solvent Retention Capacity

    Institute of Scientific and Technical Information of China (English)

    陈锋; 钱森和; 张艳; 夏先春; 何中虎

    2005-01-01

    以中国4个冬麦区的244份小麦品种(系)为材料,对籽粒硬度、面粉颗粒度大小、puroindoline等位变异类型和溶剂保持力进行了研究.结果表明,中国冬小麦中有5种puroindoline类型,分别为Pina-Dla/Pinb-Dla(野生型)、Pina-Dlb/Pinb-Dla、Pina-Dla/Pinb-Dlb、Pina-Dla/Pinb-Dld和Pina-Dla/Pinb-Dlp.Pina-Dla/Pinb-Dlp为新变异类型,目前仅在我国品种(系)中发现.硬质麦中以Pina-Dla/Pinb-Dlb类型最为广泛,占硬质麦的81.2%,Pina-Dlb/Pinb-Dla,Pina-Dla/Pinb-Dld和新类型Pina-Dla/Pinb-Dlp分别占硬麦的9.7%、1.2%和7.9%.籽粒硬度及面粉颗粒大小与4种溶剂保持力之间的相关均达1%显著水平,其中以水溶剂保持力与硬度之间的关系最为密切,与SKCS和NIR硬度值之间的相关系数分别为0.73和0.64.Pina-Dlb/Pinb-Dla类型的水溶剂保持力和碳酸钠溶剂保持力平均值最大,分别为68.1和85.8,均与Pina-Dla/Pinb-Dlb类型之间差异达5%显著水平.同时,各个麦区间的硬度值和溶剂保持力也有所不同,其中北部冬麦区和西南冬麦区的水溶剂保持力间及北部冬麦区和长江中下游冬麦区的碳酸钠溶剂保持力间差异也达到了5%显著水平.这为改进我国小麦籽粒硬度及将溶剂保持力用于早代选择提供了理论基础.

  5. Puroindoline b位点近等基因系对小麦面粉及面包和馒头品质的影响%Wheat Flour, Pan Bread, and Steamed Bread Qualities of Common Wheat Near-Isogenic Lines Differing in Puroindoline b Alleles

    Institute of Scientific and Technical Information of China (English)

    马冬云; 张艳; 夏先春; Craig F MORRIS; 何中虎

    2010-01-01

    明确不同硬度等位基因与加工品质的关系对小麦品质改良具有重要意义.本文以7个Puroindoline b位点近等基因系为材料,研究了不同硬度等位基因对小麦面粉及面包和馒头品质的影响.结果表明,Pina-Dlb/Pinb-Dla基因型的籽粒硬度值、蛋白质含量以及破损淀粉含量较高;而Pina-Dla/Pinb-Dld基因型的出粉率、面粉亮度较高,具有较好的磨粉品质.和面仪参数中的峰高、峰宽和8 min尾高均以Pina-Dlb/Pinb-Dla基因型数值最高,Pina-Dla/Pinb-Dld基因型最低,且两者之间的差异均达到显著水平;Pina-Dlb/Pinb-Dla基因型的衰落角最小.Pina-Dla/Pinb-Dlc和Pina-Dla/Pinb-Dld基因型具有较高馒头色泽和张弛性评分,较好的馒头制作品质;Pina-Dla/Pinb-Dle和Pina-Dla/Pinb-Dlg基因型次之.Pina-Dla/Pinb-Dlf基因型的面包总评分略优于其他基因型.

  6. Controlling the Direct Laser Acceleration Inside a Plasma Bubble Using Lasers' Polarization and Wavelength

    Science.gov (United States)

    Zhang, Xi; Khudik, Vladimir; Zgadzaj, Rafal; Bernstein, Aaron; Downer, Mike; Shvets, Gennady

    2016-10-01

    The combination of the direct laser acceleration and laser wakefield acceleration (DLA and LWFA) mechanisms has been recently proposed for increasing the total electron energy gain. Here we will report on the effects of the polarization and wavelength of the DLA pulse on the properties of the accelerated beam. Specifically, we address the moderate-power regime, where the laser powers of the leading LWFA and the trailing DLA pulses are not very much larger than the critical power. Three cases will be discussed: (a) the DLA pulse has the same wavelength and polarization as the LWFA pulse, (b) the wavelengths are the same but the polarizations are orthogonal, and (c) the wavelength of the DLA pulse is twice shorter than that of the LWFA pulse. LWFA via particle-in-cell (PIC) simulations. It is found that both (b) and (c) scenarios result in higher tolerance to pulse-delay jitter. The most promising scenario is (c) because it enables higher final electron bunch energy and charge. This work is supported by the US DOE Grant DE-SC0007889 and the AFOSR Grant FA9550-14-1-0045.

  7. Apomorphine and its esters: Differences in Caco-2 cell permeability and chylomicron affinity.

    Science.gov (United States)

    Borkar, Nrupa; Chen, Zhizhong; Saaby, Lasse; Müllertz, Anette; Håkansson, Anders E; Schönbeck, Christian; Yang, Mingshi; Holm, René; Mu, Huiling

    2016-07-25

    Oral delivery of apomorphine via prodrug principle may be a potential treatment for Parkinson's disease. The purpose of this study was to investigate the transport and stability of apomorphine and its esters across Caco-2 cell monolayer and their affinity towards chylomicrons. Apomorphine, monolauroyl apomorphine (MLA) and dilauroyl apomorphine (DLA) were subjected to apical to basolateral (A-B) and basolateral to apical (B-A) transport across Caco-2 cell monolayer. The stability of these compounds was also assessed by incubation at intestinal pH and physiological pH with and without Caco-2 cells. Molecular dynamics (MD) simulations were performed to understand the stability of the esters on a molecular level. The affinity of the compounds towards plasma derived chylomicrons was assessed. The A-B transport of intact DLA was about 150 times lower than the transport of apomorphine. In contrast, MLA was highly unstable in the aqueous media leading to apomorphine appearance basolaterally. MD simulations possibly explained the differences in hydrolysis susceptibilities of DLA and MLA. The affinity of apomorphine diesters towards plasma derived chylomicrons provided an understanding of their potential lymphatic transport. The intact DLA transport is not favorable; therefore, the conversion of DLA to MLA is an important step for intestinal apomorphine absorption.

  8. The demand for clean-fuel vehicles by Dutch local authorities. A stated choice analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hagen, P.

    2012-08-15

    Previous research showed that the era of cheap fossil fuels is over. Also, 23% of the worldwide emission of CO2 is produced by road transport. These problems demand a change in the propulsion of vehicles. Because the diffusion of clean-fuel vehicles is not happening at this moment, something has to change. Rogers' diffusion of innovation theory is used to state that a critical mass of vehicles is needed to stimulate the diffusion of these vehicles. Due to public procurement Dutch local authorities (DLA's) can help stimulating this diffusion. Unfortunately these DLA's are not purchasing clean-fuel vehicles yet. To gain insight in what is hampering the diffusion of these vehicles by DLA's, a discrete choice experiment was created about the preferences by these DLA's. Six vehicle attributes were used to describe each vehicle. The results showed that the initial purchase price and the amount of local emission were experienced as the most important attributes by DLA's, where initial purchase price has a negative influence and local emission a positive influence in the choice for a new vehicle. Next, fuel price, range and availability of the fuel were found evenly important. Fuel price had a negative influence and both range and availability of fuel had a positive influence on the choice for a new vehicle. Finally, time to refuel/recharge was found least important and also negatively influencing the choice.

  9. Damped Lyman-alpha absorbers as a probe of stellar feedback

    CERN Document Server

    Bird, Simeon; Haehnelt, Martin; Sijacki, Debora; Genel, Shy; Torrey, Paul; Springel, Volker; Hernquist, Lars

    2014-01-01

    We examine the abundance, clustering and metallicity of Damped Lyman-$\\alpha$ Absorbers (DLAs) in hydrodynamic cosmological simulations using the moving mesh code AREPO. We incorporate models of supernova and AGN feedback, and molecular hydrogen formation. We compare our simulations to the column density distribution function at $z=3$, the total DLA abundance at $z=2-4$, the measured DLA bias at $z=2$ and DLA metallicities at $z=2-4$. Our preferred models produce populations of DLAs in good agreement with most of these observations, except the DLA abundance at $z < 3$, which we show requires stronger feedback in $10^{11-12} h^{-1} M_\\odot$ mass halos. While the DLA population probes a range of halo masses, we find the cross-section is dominated by halos of mass $10^{10.5} h^{-1} M_\\odot$ at $z=3$ and $10^{11} h^{-1} M_\\odot$ at $z=2$. Simulations without feedback are in strong tension with all these observables, indicating a need for strong stellar feedback at $z=2-4$ independently of the star formation th...

  10. An extended fractal growth regime in the diffusion limited aggregation including edge diffusion

    Directory of Open Access Journals (Sweden)

    Aritra Ghosh

    2016-01-01

    Full Text Available We have investigated on-lattice diffusion limited aggregation (DLA involving edge diffusion and compared the results with the standard DLA model. For both cases, we observe the existence of a crossover from the fractal to the compact regime as a function of sticking coefficient. However, our modified DLA model including edge diffusion shows an extended fractal growth regime like an earlier theoretical result using realistic growth models and physical parameters [Zhang et al., Phys. Rev. Lett. 73 (1994 1829]. While the results of Zhang et al. showed the existence of the extended fractal growth regime only on triangular but not on square lattices, we find its existence on the square lattice. There is experimental evidence of this growth regime on a square lattice. The standard DLA model cannot characterize fractal morphology as the fractal dimension (Hausdorff dimension, DH is insensitive to morphology. It also predicts DH = DP (the perimeter dimension. For the usual fractal structures, observed in growth experiments on surfaces, the perimeter dimension can differ significantly (DH ≠ DP depending on the morphology. Our modified DLA model shows minor sensitivity to this difference.

  11. Effects of the precursor electron bunch on quasi-phase matched direct laser acceleration

    Science.gov (United States)

    Lin, M.-W.; Hsieh, C.-Y.; Liu, Y.-L.; Chen, S.-H.; Jovanovic, I.

    2016-12-01

    Direct laser acceleration (DLA) of electrons can be achieved by utilizing the axial field of a well-guided, radially polarized laser pulse in a density-modulated plasma waveguide. When a laser pulse of a few terawatt (TW) peak power is applied, however, the laser ponderomotive force perturbs plasma electrons to concentrate in the center, such that the generated electrostatic fields can significantly defocus the externally injected electron witness bunch and considerably deteriorate the acceleration efficiency. To improve the performance of DLA, a leading electron bunch, which acts as a precursor, can be introduced in DLA to effectively confine the witness bunch. Three-dimensional particle-in-cell simulations have been conducted to demonstrate that the transverse properties of the witness bunch can be significantly improved when a precursor bunch is used. Selected bunch transverse sizes, bunch charges, and axial separation from the witness bunch have been assigned to the precursor in a series of DLA simulations. Since a favorable ion-focusing force is provided by the precursor, the transverse properties of witness bunch can be maintained when a relatively high-power (˜2 TW) laser pulse is used in DLA, and an improved overall acceleration efficiency can be achieved.

  12. The First Observations of Low Redshift Damped Lyman-alpha Systems with the Cosmic Origins Spectrograph

    CERN Document Server

    Meiring, Joseph D; Prochaska, Jason X; Tumlinson, Jason; Werk, Jessica; Jenkins, Edward B; Thom, Chris; O'Meara, John M; Sembach, Kenneth R

    2011-01-01

    We report on the first Cosmic Origins Spectrograph (COS) observations of damped and sub-damped Lyman-alpha (DLA) systems discovered in a new survey of the gaseous halos of low-redshift galaxies. From observations of 37 sightlines, we have discovered three DLAs and four sub-DLAs. We measure the neutral gas density Omega(HI), and redshift density dN/dz, of DLA and sub-DLA systems at z<0.35. We find dN/dz=0.25 and Omega(HI)=1.4x10^-3 for DLAs, and dN/dz=0.08 with Omega(HI)=4.2x10^-5 for sub-DLAs over a redshift path delta z=11.9. To demonstrate the scientific potential of such systems, we present a detailed analysis of the DLA at z=0.1140 in the spectrum of SDSS J1009+0713. Profile fits to the absorption lines determine log N(H I)=20.68pm0.10 with a metallicity determined from the undepleted element Sulfur of [S/H]=-0.62pm0.18. The abundance pattern of this DLA is similar to that of higher z DLAs, showing mild depletion of the refractory elements Fe and Ti with [S/Fe]=+0.24pm0.22 and [S/Ti]=+0.28pm0.15. Nitro...

  13. The Effectiveness of Organic Pollutants Removal in Constructed Wetland with Horizontal Sub-Surface Flow / Efektywność Usuwania Zanieczyszczeń Organicznych W Oczyszczalni Hydrofitowej

    Directory of Open Access Journals (Sweden)

    Jakubaszek Anita

    2015-03-01

    Full Text Available W pracy przedstawiono wyniki badań dotyczące efektywności usuwania ze ścieków zanieczyszczeń organicznych w oczyszczalni hydrofitowej. Średnia skuteczność oczyszczania wyrażona jako obniżenie wartości ChZT w ściekach była na poziomie 77%, dla BZT5 80%, a dla OWO 82%. Analizowano również wpływ sezonowych zmian temperatury oraz okresu wegetacji i spoczynku roślin na skuteczność oczyszczania ścieków. Wyniki badań wykazały obniżenie efektywności usuwania zanieczyszczeń organicznych ze ścieków wyrażonych przez ChZT i BZT5 oraz zawiesiny ogólnej w okresie jesienno-zimowym. W okresie wegetacyjnym obiekt w Małyszynie charakteryzował się efektywnością oczyszczania ścieków na poziomie: 78% dla ChZT, 82% dla BZT5, a w sezonie pozawegetacyjnym skuteczność uległa obniżeniu do 75% w przypadku ChZT oraz 74% dla BZT5. Zawiesina ogólna w okresie wegetacji trzciny usuwana była w 88%, a w okresie powegetacyjnym w 69%.

  14. A ghostly damped Ly$\\alpha$ system revealed by metal absorption lines

    CERN Document Server

    Fathivavsari, Hassan; Zou, Siwei; Noterdaeme, Pasquier; Ledoux, Cédric; Krühler, Thomas; Srianand, Raghunathan

    2016-01-01

    We report the discovery of the first 'ghostly' damped Ly$\\alpha$ absorption system (DLA), which is identified by the presence of absorption from strong low-ion species at $z_{\\rm abs}=1.70465$ along the line of sight to the quasar SDSSJ113341.29$-$005740.0 with $z_{\\rm em}=1.70441$. No Ly$\\alpha$ absorption trough is seen associated with these absorptions because the DLA trough is filled with the leaked emission from the broad emission line region of the quasar. By modeling the quasar spectrum and analyzing the metal lines, we derive log$N$(HI)(cm$^{-2}$)$\\sim$21.0 $\\pm$ 0.3. The DLA cloud is small ($\\le$ 0.32 pc) thus not covering entirely the broad line region and is located at $\\ge$ 39 pc from the central active galactic nucleus (AGN). Although the DLA is slightly redshifted relative to the quasar, its metallicity ([S/H]=$-$0.41$\\pm$0.30) is intermediate between what is expected from infalling and outflowing gas. It could be possible that the DLA is part of some infalling material accreting onto the quasar...

  15. Antiproliferative and antioxidant activity of Aegle marmelos (Linn. leaves in Dalton′s Lymphoma Ascites transplanted mice

    Directory of Open Access Journals (Sweden)

    Vijaya Chockalingam

    2012-01-01

    Full Text Available Objective: The present investigation was performed to evaluate the antiproliferative and antioxidant activity of Aegle marmelos leaves in Dalton′s Lymphoma Ascites (DLA-bearing mice. Materials and Methods: The DLA cells maintained in vivo in Swiss albino mice were used for developing ascitic tumor in mice by intraperitoneal transplantation. The standardized 50% ethanolic extract of A. marmelos leaves (AMEE was administered intraperitoneally in dose levels 200 and 400 mg/kg, after 24 hours of tumor inoculation in mice for two weeks. Results: The AMEE treatment significantly prevented (P<0.001 the increase in body weight due to tumor cell growth and increased the mean survival time of the tumor-bearing mice as compared to the untreated DLA control mice. The treatment of DLA-bearing mice brought down the Alanine Aminotransferase (ALAT, Aspartate Aminotransferase (ASAT, and alkaline phosphatase to normal levels. The extract decreased the levels of hepatic lipid peroxidation and increased the levels of hepatic antioxidants Glutathione, Superoxide Dismutase (SOD, and catalase. All the changes observed with AMEE treatment were dose dependent. Conclusion: The hydroalcoholic extract of A. marmelos exhibits strong antitumor and antioxidant activities in DLA-bearing mice.

  16. Multipactor Physics, Acceleration, and Breakdown in Dielectric-Loaded Accelerating Structures

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, Richard P. [Naval Research Lab., Washington, DC (United States); Gold, Steven H. [Naval Research Lab., Washington, DC (United States)

    2016-07-01

    The objective of this 3-year program is to study the physics issues associated with rf acceleration in dielectric-loaded accelerating (DLA) structures, with a focus on the key issue of multipactor loading, which has been found to cause very significant rf power loss in DLA structures whenever the rf pulsewidth exceeds the multipactor risetime (~10 ns). The experiments are carried out in the X-band magnicon laboratory at the Naval Research Laboratory (NRL) in collaboration with Argonne National Laboratory (ANL) and Euclid Techlabs LLC, who develop the test structures with support from the DoE SBIR program. There are two main elements in the research program: (1) high-power tests of DLA structures using the magnicon output (20 MW @11.4 GHz), and (2) tests of electron acceleration in DLA structures using relativistic electrons from a compact X-band accelerator. The work during this period has focused on a study of the use of an axial magnetic field to suppress multipactor in DLA structures, with several new high power tests carried out at NRL, and on preparation of the accelerator for the electron acceleration experiments.

  17. Dihydrolipoamide acyltransferase is critical for Mycobacterium tuberculosis pathogenesis.

    Science.gov (United States)

    Shi, Shuangping; Ehrt, Sabine

    2006-01-01

    Mycobacterium tuberculosis has evolved to persist in host macrophages, where it faces a nutrient-poor environment and is exposed to oxidative and nitrosative stress. To defend itself against oxidative/nitrosative stress, M. tuberculosis expresses an NADH-dependent peroxidase and peroxynitrite reductase that is encoded by ahpC, ahpD, lpd, and dlaT. In addition to its central role in the peroxynitrite reductase complex, dlaT (Rv2215) also encodes the E2 component of pyruvate dehydrogenase. Here we demonstrate that inactivation of dlaT in the chromosome of H37Rv resulted in a mutant (H37RvDeltadlaT) that displayed phenotypes associated with DlaT's role in metabolism and in defense against nitrosative stress. The H37RvDeltadlaT strain showed retarded growth in vitro and was highly susceptible to killing by acidified sodium nitrite. Mouse macrophages readily killed intracellular H37RvDeltadlaT organisms, and in mice dlaT was required for full virulence.

  18. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    your work, school or social  activities , or caused significant distress?                 NO                      YES    POSTTRAUMATIC    STRESS ...ants were instructed not to look directly at the lights, but to relax ith their eyes open. At 1015, the thirty-minute active light con- ition was...Cortico-Limbic Activation Across Anxiety Disorders, Center for Anxiety, Depression, and Stress , McLean Hospital, Belmont, MA [Invited Lecture] 2010

  19. A Method to Measure the Mass of Damped Ly-alpha Absorber Host Galaxies Using Fluctuations in 21cm Emission

    CERN Document Server

    Wyithe, Stuart

    2008-01-01

    Observations of damped Ly-alpha absorbers (DLA) indicate that the fraction of hydrogen in its neutral form (HI) is significant by mass at all redshifts. This gas represents the reservoir of material that is available for star formation at late times. As a result, observational identification of the systems in which this neutral hydrogen resides is an important missing ingredient in models of galaxy formation. Precise identification of DLA host mass via traditional clustering studies is not practical owing to the small numbers of known systems being spread across sparsely distributed sight lines. However following the completion of reionization, 21cm surface brightness fluctuations will be dominated by neutral hydrogen in DLAs. Observations of these fluctuations will measure the combined clustering signal from all DLAs within a large volume. We show that measurement of the spherically averaged power-spectrum of 21cm intensity fluctuations due to DLAs could be used to measure the galaxy bias for DLA host galaxi...

  20. Convergent validity test, construct validity test and external validity test of the David Liberman algorithm

    Directory of Open Access Journals (Sweden)

    David Maldavsky

    2013-08-01

    Full Text Available The author first exposes a complement of a previous test about convergent validity, then a construct validity test and finally an external validity test of the David Liberman algorithm.  The first part of the paper focused on a complementary aspect, the differential sensitivity of the DLA 1 in an external comparison (to other methods, and 2 in an internal comparison (between two ways of using the same method, the DLA.  The construct validity test exposes the concepts underlined to DLA, their operationalization and some corrections emerging from several empirical studies we carried out.  The external validity test examines the possibility of using the investigation of a single case and its relation with the investigation of a more extended sample.

  1. Statistical properties of damped Lyman-alpha systems from Sloan Digital Sky Survey DR12

    CERN Document Server

    Bird, Simeon; Ho, Shirley

    2016-01-01

    We present new estimates for the statistical properties of damped Lyman-$\\alpha$ absorbers (DLAs). We compute the column density distribution function at $z>2$, the line density, $\\mathrm{d}N/\\mathrm{d}X$, and the neutral hydrogen density, $\\Omega_\\mathrm{DLA}$. Our estimates are derived from the DLA catalogue of \\cite{Garnett:2016}, which uses the SDSS--III DR12 quasar spectroscopic survey. This catalogue provides a probability that a given spectrum contains a DLA, allowing us to use even the noisiest data without biasing our results and thus substantially increase our sample size. We measure a non-zero column density distribution function at $95\\%$ confidence for all column densities $N_\\mathrm{HI} 4$. We show that our results are insensitive to the signal-to-noise ratio of the spectra, but that there is a residual dependence on quasar redshift for $z<2.5$, which may be due to remaining systematics in our analysis.

  2. Visual Similarity Based Document Layout Analysis

    Institute of Scientific and Technical Information of China (English)

    Di Wen; Xiao-Qing Ding

    2006-01-01

    In this paper, a visual similarity based document layout analysis (DLA) scheme is proposed, which by using clustering strategy can adaptively deal with documents in different languages, with different layout structures and skew angles. Aiming at a robust and adaptive DLA approach, the authors first manage to find a set of representative filters and statistics to characterize typical texture patterns in document images, which is through a visual similarity testing process.Texture features are then extracted from these filters and passed into a dynamic clustering procedure, which is called visual similarity clustering. Finally, text contents are located from the clustered results. Benefit from this scheme, the algorithm demonstrates strong robustness and adaptability in a wide variety of documents, which previous traditional DLA approaches do not possess.

  3. Diffusion-Limited Aggregation with Polygon Particles

    Institute of Scientific and Technical Information of China (English)

    邓礼; 王延颋; 欧阳钟灿

    2012-01-01

    Diffusion-limited aggregation (DLA) assumes that particles perform pure random walk at a finite tem- perature and aggregate when they come close enough and stick together. Although it is well known that DLA in two dimensions results in a ramified fractal structure, how the particle shape influences the formed morphology is still un- clear. In this work, we perform the off-lattice two-dimensional DLA simulations with different particle shapes of triangle, quadrangle, pentagon, hexagon, and octagon, respectively, and compare with the results for circular particles. Our results indicate that different particle shapes only change the local structure, but have no effects on the global structure of the formed fractal duster. The local compactness decreases as the number of polygon edges increases.

  4. Periodic growth of Bacillus subtilis colonies on agar plates

    Science.gov (United States)

    Fujikawa, Hiroshi

    1992-10-01

    Bacillus subtilis colonies show periodic growth on agar plates. The organism has been observed to show several colony morphologies including diffusion-limited aggregation (DLA) type, dense branching morphology (DBM), Eden type, and spreading without producing openings. The agar concentration for the periodic growth is higher than that of DBM and lower than that of DLA or Eden type. The nutrient (peptone) concentration for the periodic growth is higher than that of DLA and DBM and lower than that of Eden type. The colony grows towards a place with higher peptone concentration. These findings suggest that the diffusion of nutrient particles, i.e. the concentration gradient of peptone particles at the growing perimeter of a colony, would be essentially involved in the periodic growth. The distance between concentric rings of a colony is constant and intervention between two colonies is not observed, unlike the Liesegang ring.

  5. Progress on High Power Tests of Dielectric-Loaded Accelerating Structures

    CERN Document Server

    Jing, Chunguang; Gold, Steven H; Kinkead, Allen; Konecny, Richard; Power, John G

    2005-01-01

    This paper presents a progress report on a series of high-power rf experiments that were carried out to evaluate the potential of the Dielectric-Loaded Accelerating (DLA) structure for high-gradient accelerator operation. Since the last PAC meeting in 2003, we have tested DLA structures loaded with two different ceramic materials: Alumina (Al2O3) and MCT (MgxCa1-xTiO3). The alumina-based DLA experiments have concentrated on the effects of multipactor in the structures under high-power operation, and its suppression using TiN coatings, while the MCT experiments have investigated the dielectric joint breakdown observed in the structures due to local field enhancement. In both cases, physical models have been set up, and the potential engineering solutions are being investigated.

  6. Franco i Stalin. Związek Sowiecki w polityce Hiszpanii w okresie drugiej wojny światowej

    OpenAIRE

    Kaczorowski, Bartosz

    2016-01-01

    Nieczęsto w historii stosunków międzynarodowych zdarzało się, by za swojego największego wroga dany rząd uznawał państwo oddalone odeń o kilka tysięcy kilometrów. Taka sytuacja wystąpiła jednak w przypadku Hiszpanii generała Francisco Franco, która w okresie drugiej wojny światowej prowadziła skrajnie antysowiecką politykę. Moskwa była konsekwentnie traktowana przez Madryt jako niebezpieczeństwo nie tylko dla jego niezależności i dla władzy obozu narodowego, ale także dla dalszych losów europ...

  7. Fractal Aggregation of Copper Particles using Electroless Cell

    Directory of Open Access Journals (Sweden)

    S.Q.Chishty

    2013-12-01

    Full Text Available A phenomenon In which the particles performing Brownian motion when hit the aggregates become the part of it is known as Diffusion limited aggregation (DLA, which produces a fractal shape. Experimental efforts are discussed through which some DLA shapes arc obtained. For this purpose different electrolytic solutions are used. Electro less cells are also designed and constructed using standard methods. The cells have to be flexible in the sense that changing of plates and solutions should be easier for photography. We used compounds of copper,. for growth of fractals. Within a very short time metallic dendrites appeared in the cell at different operating conditions. These images were photographed, while desired branching structures in copper sulphate solution were seen. Results thus obtained are compared with the growth of DLA.

  8. Wybrane Aspekty Zużywania Się Połączeń Wpustowych I Wielowypustowych W Procesie Eksploatacji

    Directory of Open Access Journals (Sweden)

    Gębura Andrzej

    2014-12-01

    Full Text Available W artykule przedstawiono wybrane wady połączeń wielowypustowych: mimośrodowości, przekoszenia, zwiększonych luzów. Przedstawiono znaczenie tych wad dla poprawności funkcjonowania całego zespołu napędowego. Zaprezentowano swoisty katalog tych wad w formie: wizualnego zużycia, pomiarów mechanicznych płaszczyzn przyporu, opisu matematycznego przebiegów dynamiki ruchu takiego połączenia, zobrazowań dla metod FAM-C i FDM-A. Zaznaczono skutki długotrwałej eksploatacji połączeń wielowypustowych o nadmiernym zużyciu dla bezpieczeństwa latania

  9. Structural five-fold symmetry in the fractal morphology of diffusion-limited aggregates

    Science.gov (United States)

    Arneodo, A.; Argoul, F.; Muzy, J. F.; Tabard, M.

    1992-09-01

    The statistical self-similarity of the geometry of diffusion-limited aggregates and the multifractal nature of the growth probability distribution on the surface of the growing clusters are investigated using the wavelet transform. This study reveals the existence of a predominant structural five-fold symmetry in the internal frozen region as well as in the active outer region of the interface. This observation is corroborated by a statistical analysis of the screening effects that govern diffusion-limited aggregation (DLA) growth in linear and sector-shaped cells. The existence of this symmetry is likely to be a clue to a hierarchichal fractal ordering. We report on the discovery of Fibonacci sequences in the inner extinct region of large mass off-lattice DLA clusters, with a branching ratio which converges asymptotically to the golden mean. We suggest an interpretation of the DLA morphology as a “quasifractal” counterpart of the well-ordered snowflake fractal architecture.

  10. Exploring Damped Lyα System Host Galaxies Using Gamma-Ray Bursts

    Science.gov (United States)

    Toy, Vicki L.; Cucchiara, Antonino; Veilleux, Sylvain; Fumagalli, Michele; Rafelski, Marc; Rahmati, Alireza; Cenko, S. Bradley; Capone, John I.; Pasham, Dheeraj R.

    2016-12-01

    We present a sample of 45 Damped Lyα system (DLA; {N}{{H}{{I}}} ≥slant 2× {10}20 {{cm}}-2) counterparts (33 detections, 12 upper limits) which host gamma-ray bursts (GRB-DLAs) in order to investigate star formation and metallicity within galaxies hosting DLAs. Our sample spans z˜ 2{--}6 and is nearly three times larger than any previously detected DLA counterparts survey based on quasar line-of-sight searches (QSO-DLAs). We report star formation rates (SFRs) from rest-frame UV photometry and spectral energy distribution modeling. We find that DLA counterpart SFRs are not correlated with either redshift or H i column density. Thanks to the combination of Hubble Space Telescope and ground-based observations, we also investigate DLA host star formation efficiency. Our GRB-DLA counterpart sample spans both higher efficiency and low efficiency star formation regions compared to the local Kennicutt-Schmidt relation, local star formation laws, and z˜ 3 cosmological simulations. We also compare the depletion times of our DLA hosts sample to other objects in the local universe; our sample appears to deviate from the star formation efficiencies measured in local spiral and dwarf galaxies. Furthermore, we find similar efficiencies as local inner disks, SMC, and Lyman-break galaxy outskirts. Finally, our enrichment time measurements show a spread of systems with under- and over-abundance of metals, which may suggest that these systems had episodic star formation and a metal enrichment/depletion as a result of strong stellar feedback and/or metal inflow/outflow.

  11. THE FIRST OBSERVATIONS OF LOW-REDSHIFT DAMPED Ly{alpha} SYSTEMS WITH THE COSMIC ORIGINS SPECTROGRAPH: CHEMICAL ABUNDANCES AND AFFILIATED GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Battisti, A. J.; Meiring, J. D.; Tripp, T. M. [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Prochaska, J. X.; Werk, J. K. [Department of Astronomy and Astrophysics, University of California Observatories-Lick Observatory, UC Santa Cruz, CA 95064 (United States); Jenkins, E. B. [Department of Astrophysical Sciences, Princeton University Observatory, Princeton, NJ 08544 (United States); Lehner, N. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Tumlinson, J.; Thom, C. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2012-01-10

    We present Cosmic Origins Spectrograph (COS) measurements of metal abundances in eight 0.083 < z{sub abs} < 0.321 damped Ly{alpha} (DLA) and sub-DLA absorption systems serendipitously discovered in the COS-Halos survey. We find that these systems show a large range in metallicities, with -1.10 < [Z/H] < 0.31, similar to the spread found at higher redshifts. These low-redshift systems on average have subsolar metallicities, but do show a rise in metallicity over cosmic time when compared to higher-redshift systems. We find that the average sub-DLA metallicity is higher than the average DLA metallicity at all redshifts. Nitrogen is underabundant with respect to {alpha}-group elements in all but perhaps one of the absorbers. In some cases, [N/{alpha}] is significantly below the lowest nitrogen measurements in nearby galaxies. Systems for which depletion patterns can be studied show little, if any, depletion, which is characteristic of Milky Way halo-type gas. We also identify affiliated galaxies for three of the sub-DLAs using spectra obtained from a Keck/Low Resolution Imaging Spectrometer (LRIS). None of these sub-DLAs arise in the stellar disks of luminous galaxies; instead, these absorbers may exist in galaxy halos at impact parameters ranging from 38 to 92 kpc. Multiple galaxies are present near two of the sub-DLAs, and galaxy interactions may play a role in the dispersal of the gas. Many of these low-redshift absorbers exhibit simple kinematics, but one sub-DLA has a complicated mix of at least 13 components spread over 150 km s{sup -1}. We find three galaxies near this sub-DLA, which also suggests that galaxy interactions roil the gas. This study reinforces the view that DLAs have a variety of origins, and low-redshift studies are crucial for understanding absorber-galaxy connections.

  12. Reciprocal regulation of protein synthesis and carbon metabolism for thylakoid membrane biogenesis.

    Directory of Open Access Journals (Sweden)

    Alexandra-Viola Bohne

    Full Text Available Metabolic control of gene expression coordinates the levels of specific gene products to meet cellular demand for their activities. This control can be exerted by metabolites acting as regulatory signals and/or a class of metabolic enzymes with dual functions as regulators of gene expression. However, little is known about how metabolic signals affect the balance between enzymatic and regulatory roles of these dual functional proteins. We previously described the RNA binding activity of a 63 kDa chloroplast protein from Chlamydomonas reinhardtii, which has been implicated in expression of the psbA mRNA, encoding the D1 protein of photosystem II. Here, we identify this factor as dihydrolipoamide acetyltransferase (DLA2, a subunit of the chloroplast pyruvate dehydrogenase complex (cpPDC, which is known to provide acetyl-CoA for fatty acid synthesis. Analyses of RNAi lines revealed that DLA2 is involved in the synthesis of both D1 and acetyl-CoA. Gel filtration analyses demonstrated an RNP complex containing DLA2 and the chloroplast psbA mRNA specifically in cells metabolizing acetate. An intrinsic RNA binding activity of DLA2 was confirmed by in vitro RNA binding assays. Results of fluorescence microscopy and subcellular fractionation experiments support a role of DLA2 in acetate-dependent localization of the psbA mRNA to a translation zone within the chloroplast. Reciprocally, the activity of the cpPDC was specifically affected by binding of psbA mRNA. Beyond that, in silico analysis and in vitro RNA binding studies using recombinant proteins support the possibility that RNA binding is an ancient feature of dihydrolipoamide acetyltransferases. Our results suggest a regulatory function of DLA2 in response to growth on reduced carbon energy sources. This raises the intriguing possibility that this regulation functions to coordinate the synthesis of lipids and proteins for the biogenesis of photosynthetic membranes.

  13. The Determination of the Magnetoelectric Coupling Coefficient in Ferroelectric–Ferromagnetic Composite Based on PZT–Ferrite

    OpenAIRE

    Bartkowska J.A.; Zachariasz R.; Bochenek D.; Ilczuk J.

    2013-01-01

    W niniejszej pracy określono współczynnik sprzężenia magnetoelektrycznego na podstawie pomiarów temperaturowych zależności przenikalności dielektrycznej, wykonanych dla multiterroikowego kompozytu. Materiałem badań był ferroelektrycz.no- terromagnetyczny kompozyt powstały na bazie PZT i ferrytu. Przebadano temperaturowe zależności przenikalności dielek- trycznej (e) dla kilku różnych częstotliwości pola pomiarowego. Z pomiarów dielektrycznych określono temperaturę przemiany fazowej z fazy fer...

  14. Internal Friction in the Ferroelectric – Ferromagnetic Composites

    OpenAIRE

    Zachariasz R.; Bartkowska J.A.; Bochenek D.; Niemiec P.

    2013-01-01

    W pracy wyznaczano temperaturowe Q-1(T) i amplitudowe Q-1(e) zależności tarcia wewnętrznego dla ferroelektrycz.no - ferromagnetycznych kompozytów powstałych na bazie PZT i ferrytu. Na wykresach temperaturowych zależności tarcia wewnętrznego, uzyskanych dla badanych materiałów, obserwowano występowanie maksimum w zakresie wysokich temperatur. Do opisu maksimum zastosowany został model Wanga. który uwzględnia oddziaływania związane z lepko-sprężystym ruchem ferroelektrycznych ścian domenowych. ...

  15. Targets for Marine Corps Purchasing and Supply Management Initiatives: Spend Analysis Findings

    Science.gov (United States)

    2011-01-01

    lubricants, oils, and waxes (FSG 91), DD350 data include $6.5 billion in pur- chases, while ACF data include only $47 million in purchases. For DLA purchases...of medical, dental , and veterinary equip- ment and supplies (FSG 65), ACF data include 14,573 DLA contracts totaling $3.1 billion while DD350 data...value items most amenable to being automated have been so. For medical, dental , and veterinary equipment and supplies used at least in part by the

  16. Measuring distributed leadership agency in a hospital context

    DEFF Research Database (Denmark)

    Jønsson, Thomas; Unterrainer, Christine; Jeppesen, Hans Jeppe

    2016-01-01

    , discriminant and convergent validity, and ANOVAs were applied to analyze group differences in DLA. Findings: The identified uni-dimensional questionnaire consists of seven items, as it is different from, but associated with, empowering leadership, organizational influence, attitude to participation and trust...... in management. As theoretically predicted, DLA is positively related to self-efficacy, job-satisfaction and innovative behaviour. Chief physicians, permanent employees and employee representatives scored higher on the scale than the rest of their respective counterparts. Practice implications: The survey offers...

  17. Distributed leadership agency and innovative behaviour

    DEFF Research Database (Denmark)

    Ottsen, Christina L.; Jønsson, Thomas Faurholt; Kähler, Helena Grøn

    2017-01-01

    Distributed leadership agency (DLA) is a specific form of employee agency, in which employees participate actively in undertaking leadership tasks in different domains. The present study assumes a distributed leadership paradigm that focuses on employees as potential leadership agents per se. We ...... propose that this approach to leadership may provide a substantial understanding of employees’ engagement in innovation at work.......Distributed leadership agency (DLA) is a specific form of employee agency, in which employees participate actively in undertaking leadership tasks in different domains. The present study assumes a distributed leadership paradigm that focuses on employees as potential leadership agents per se. We...

  18. Photoacoustic ultrasound sources from diffusion-limited aggregates

    Science.gov (United States)

    Patel, Krutik; Brubaker, Morgan; Kotlerman, Alexander; Salazar, Robert; Wolf, Eli; Weld, David M.

    2016-10-01

    Metallic diffusion-limited aggregate (DLA) films are well-known to exhibit near-perfect broadband optical absorption. We demonstrate that such films also manifest a substantial and relatively material-independent photoacoustic response, as a consequence of their random nanostructure. We theoretically and experimentally analyze the photoacoustic phenomena in DLA films and show that they can be used to create broadband air-coupled acoustic sources. These sources are inexpensive and simple to fabricate and work into the ultrasonic regime. We illustrate the device possibilities by building and testing an optically addressed acoustic phased array capable of producing virtually arbitrary acoustic intensity patterns in air.

  19. Facet Reflection Coefficient of Phase-locked Diode Laser Array in an External Cavity

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    A diode laser array(DLA)positioned in an external cavity can receive the radiations emitted from its neighboring elements (C1) and that of itself (S) after being reflected at the DLA facet as well as from the external mirror (C0). Considering the fact that|C0/S| should be larger than unity if the external cavity is effective,and|C1/S| should be larger than unity if the phase locking may be established in the external cavity.The requirements on the reflection at the facet of the diode laser array have been specified in terms of the cavity length and reflection coefficient of the external mirror.

  20. Diffusion-Limited Aggregation in Potato Starch and Hydrogen Borate Electrolyte System

    Directory of Open Access Journals (Sweden)

    Tuhina Tiwari

    2013-01-01

    Full Text Available Natural growth of diffusion-limited aggregate (DLA, without any external stimuli, in boric acid doped starch system is reported here. Fractals grown were confirmed to be of diffusion-limited aggregate (DLA pattern having fractal dimension ~1.49. Effect of substrate and humidity on growth pattern has also been discussed. The existence of a different vibration band of H3BO3 in FTIR confirmed that growth structures are related to boric acid. XRD pattern has shown broad peak along with some sharp peaks. Broad peak is related to starch’s amorphous nature, as where intense sharp peaks are due to boric acid.

  1. The Elimination of Corrosion . . . is Nanotechnology the Answer to the USAF’s #1 Aging Aircraft Dilemma

    Science.gov (United States)

    2009-04-01

    Air Logistics Center Engineer: CAStLE Course Development Summary‖ 12 Askeland , ―The Science and Engineering of Materials,‖ pg 85 13 Shoales...A-10 Service Life Extension Program Wing Rebuilding,‖ https://www.dodmantech.com/successes/DLA/dla_A-10_SLEP_SS.pdf 24 Askeland , ―The Science and...Initiative Workshops, 2002-2004 66 ibid, pgs 5, 9 67 Askeland , ―The Science and Engineering of Materials,‖ pg 673 68 Moreno, et al. ―Corrosion

  2. Topological Self-Similar Networks Introduced by Diffusion-Limited Aggregation Mechanism

    Institute of Scientific and Technical Information of China (English)

    YANG Lei; PEI Wen-Jiang; LI Tao; CHEUNG Yiu-Ming; HE Zhen-Ya

    2008-01-01

    @@ We propose a model for growing fractal networks based on the mechanisms learned from the diffusion-limited aggregation (DLA) model in fractal geometries in the viewpoint of network.By studying the DLA network,our model introduces multiplicative growth,aging and geographical preferential attachment mechanisms,whereby featuring topological self-similar property and hierarchical modularity.According to the results of theoretical analysis and simulation,the degree distribution of the proposed model shows a mixed degree distribution (i.e.,exponential and algebraic degree distribution) and the fractal dimension and clustering coefficient can be tuned by changing the values of parameters.

  3. Observation of Conservations Laws in Diffusion Limited Aggregation

    CERN Document Server

    Mineev-Weinstein, M B; Mineev-Weinstein, Mark B.; Mainieri, Ronnie

    1994-01-01

    We repeat the numerical experiments for diffusion limited aggregation (DLA) and show that there is a potentially infinite set of conserved quantities for the long time asymptotics. We connect these observations with the exact integrability of the continuum limit of the DLA (quasi-static Stefan problem). The conserved quantities of the Stefan problem (harmonic moments) when discretized are our conserved quantities. These numerical experiments show that the exact integrability of the Stefan problem may be continued beyond the formation of cusps in the moving boundary.

  4. Fractal-to-nonfractal crossover for viscous fingers

    Science.gov (United States)

    Lee, Jysoo; Coniglio, Antonio; Stanley, H. Eugene

    1990-04-01

    We propose a position-space renormalization-group approach to the problem of viscous fingering in the absence of surface tension, with arbitrary viscosity ratio between the injected and displaced fluid. We find there are only two fixed points, the Eden and the diffusion-limited aggregation (DLA) points. The Eden point, which corresponds to a compact cluster with nonfractal surface, is stable in all directions, while the DLA fixed point is a saddle point. Hence if the viscosity of the injected fluid is not zero, the system must eventually cross over to a compact cluster. We also calculate the crossover exponent φ and crossover radius R×, and discuss possible experimental measurements.

  5. Evaluating the Texas Woman's University Distance Education Program: A Case Study

    Directory of Open Access Journals (Sweden)

    Mary E. Cissell

    1999-01-01

    Full Text Available During a session of the April 1999 Annual Conference of the Texas Distance Learning Association (TxDLA, the authors employed a case study of evaluating the Texas Woman's University distance education program to stimulate discussion among conference participants. This approach was highly successful, resulting in enthusiastic sharing of knowledge, concerns, and strategies related to evaluation of distance education programs provided by colleges and universities. It also stimulated a broader discussion of issues and concerns related to the challenges for successfully implementing distance education programs. Both the case study presented during the TxDLA Annual Conference and a summary of the dialog among conference participants appear here.

  6. Summary Report on Potential Antideficiency Act Violations Resulting From DoD Purchases Made Through Non-DoD Agencies (FY 2004 Through FY 2007)

    Science.gov (United States)

    2008-04-25

    identified material internal control weaknesses as defined by DoD Instruction 5010.40, “Managers’ Internal Control ( MIC ) Program Procedures,” January 4...cases were reviewed and completed in 30 days. Overall, OUSD(C)/CFO personnel reported *96 DOI cases: Army 37,DLA 4, Navy 20, AF 25, DSCA 9, TMA 1...QOL 1, DLA 6, JPRA 4, STRATCOM 1, DMDC 3, DSCA 9, TMA 1, DIA 5, USACE 2 Potential ADA Status Summary As of 3/20/08 FY 2007 145892258640Total IA 1

  7. Loglines. May-June 2013

    Science.gov (United States)

    2013-06-01

    effective logistics leader around the world, we prove that not only is our commitment firm in our long-standing warfighter support, but we are...DLA Energy awarded the contract to a Greek firm that supplied the fuels. Fuel pumping at the origin finished Dec. 28 as DLA Energy Europe and Africa...Magazine’s Unit of the Year award in recognition of the JLOC’s efforts during and after Hurricane Sandy “The retrograde from Afghanistan is one of the

  8. 32 CFR 634.29 - Traffic accident investigation reports.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Traffic accident investigation reports. 634.29... records. Installation law enforcement officials will record traffic accident investigations on Service/DLA... traffic accident investigation reports pertaining to accidents investigated by military police that...

  9. Focused Logistics: Putting Agility in Agile Logistics

    Science.gov (United States)

    2011-05-19

    list, ahead of companies like American Express, DuPont and Coca Cola; Supports nearly 1,900 weapon systems; DLA manages eight supply chains and...maneuver units and cumbersome logistics tail that executed and supported operations during the 1st Gulf War. The initial sustainment concept in

  10. 78 FR 68028 - National Defense Stockpile Market Impact Committee Request for Public Comments on the Potential...

    Science.gov (United States)

    2013-11-13

    ... the proposed Fiscal Year 2015 National Defense Stockpile Annual Materials Plan. The role of the Market... Act) (50 U.S.C. 98, et seq.), the Department of Defense's Defense Logistics Agency (DLA), as National... be available for public inspection and copying. Anyone submitting business confidential...

  11. 76 FR 58463 - National Defense Stockpile Market Impact Committee Request for Public Comments on the Potential...

    Science.gov (United States)

    2011-09-21

    ... disposal levels of materials for the Fiscal Year (FY) 2013 Annual Materials Plan. The role of the MIC is to... of Economic and Business Affairs, Office of International Energy and Commodity Policy, Washington, DC..., the Defense Logistics Agency (DLA) lists the proposed quantities for the FY 2013 Annual Materials...

  12. Element Abundances in a Gas-rich Galaxy at z = 5: Clues to the Early Chemical Enrichment of Galaxies

    Science.gov (United States)

    Morrison, Sean; Kulkarni, Varsha P.; Som, Debopam; DeMarcy, Bryan; Quiret, Samuel; Péroux, Celine

    2016-10-01

    Element abundances in high-redshift quasar absorbers offer excellent probes of the chemical enrichment of distant galaxies, and can constrain models for population III and early population II stars. Recent observations indicate that the sub-damped Lyα (sub-DLA) absorbers are more metal-rich than DLA absorbers at redshifts 0 4.7. However, only three DLAs at z > 4.5 and no sub-DLAs at z > 3.5 have “dust-free” metallicity measurements of undepleted elements. We report the first quasar sub-DLA metallicity measurement at z > 3.5, from detections of undepleted elements in high-resolution data for a sub-DLA at z = 5.0. We obtain fairly robust abundances of C, O, Si, and Fe, using lines outside the Lyα forest. This absorber is metal-poor, with [O/H] = ‑2.00 ± 0.12, which is ≳4σ below the level expected from extrapolation of the trend for z Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation.

  13. Supply Chain Modeling: Downstream Risk Assessment Methodology (DRAM) Demonstration of Capability

    Science.gov (United States)

    2015-04-01

    This work was done for Defense Logistics Agency Strategic Materials (DLA SM) to provide the capability to analyze supply chains of strategic and...of Defense for Acquisition, Technology and Logistics , 2013). 9 3. Supply Chain Modeling... Logistics , 2013. Kouvelis, Panos, Lingxiu Dong, Onur Boyabatli, and Rong Li. Handbook of Integrated Risk Management in Global Supply Chains Hoboken, NJ

  14. 76 FR 20341 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2011-04-12

    ... Liaison Officer, Department of Defense. S190.24 System name: Biography File (May 26, 2009, 74 FR 24831....24 System name: Biography File. System location: Headquarters, Defense Logistics Agency (DLA), Public... of the Secretary Privacy Act of 1974; Systems of Records AGENCY: Defense Logistics Agency,...

  15. 78 FR 21600 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2013-04-11

    ... System name: DLA Drug-Free Workplace Program Records (May 20, 2010; 75 FR 28242) Reason: Records are... notice OPM/Govt-10, entitled ``Employee Medical File System Records'' last published in the Federal... of the Secretary Privacy Act of 1974; System of Records AGENCY: Defense Logistics Agency, DoD....

  16. Adding dispositions to create pedagogy-based Learning Analytics

    NARCIS (Netherlands)

    Tempelaar, Dirk; Rienties, Bart; Nguyen, Quan

    This empirical study aims to demonstrate how Dispositional Learning Analytics (DLA) can provide a strong connection between Learning Analytics (LA) and pedagogy. Where LA based models typically do well in predicting course performance or student drop-out, they lack actionable data in order to easily

  17. EPA, State of Hawaii negotiate final settlement with U.S. Navy to upgrade Red Hill storage tanks

    Science.gov (United States)

    HONOLULU - Following a 50 day public comment period, the U.S. Environmental Protection Agency and the Hawaii Department of Health (DOH) announced the final agreement with the U.S. Navy and the Defense Logistics Agency (DLA) that requires the military to t

  18. 41 CFR 101-26.602-2 - Procurement of packaged petroleum products.

    Science.gov (United States)

    2010-07-01

    ..., from the Commander, Defense Logistics Services Center, Attn: DLSC-T, Battle Creek, Mich. 49016... provisions of the Defense Logistics Agency (DLA) local purchase policy contained in paragraph (b) of this... economical method of supply. A determination will be based on recognition of excessive costs (procurement...

  19. Adding dispositions to create pedagogy-based Learning Analytics

    NARCIS (Netherlands)

    Tempelaar, Dirk; Rienties, Bart; Nguyen, Quan

    2017-01-01

    This empirical study aims to demonstrate how Dispositional Learning Analytics (DLA) can provide a strong connection between Learning Analytics (LA) and pedagogy. Where LA based models typically do well in predicting course performance or student drop-out, they lack actionable data in order to easily

  20. 32 CFR 34.12 - Payment.

    Science.gov (United States)

    2010-07-01

    ... Program Management § 34.12 Payment. (a) Methods available. Payment methods for awards with for-profit... Administration Services Components,” DLAH 4105.4, which can be obtained from either: Defense Logistics Agency...-6220; or the Defense Contract Management Command home page at http://www.dcmc.dcrb.dla.mil. 2...

  1. 77 FR 17461 - Proposed Reinstatement; Comment Request

    Science.gov (United States)

    2012-03-26

    ... Agency, ATTN: U.S./Canada Joint Certification Office, DLA Logistics Information Service-LFT, Attn...- 5464. Title; Associated Form; and OMB Number: Militarily Critical Technical Data Agreement, DD Form... certifying enterprises or individuals to have access to DoD export-controlled militarily critical...

  2. Binocularity in the little owl, Athene noctua. I. Anatomical investigation of the thalamo-Wulst pathway.

    Science.gov (United States)

    Bagnoli, P; Fontanesi, G; Casini, G; Porciatti, V

    1990-01-01

    The efferent projections from the visual thalamus to the Wulst were studied in the little owl, Athene noctua. Cells of origin were identified by retrograde labeling after injections of wheat-germ-agglutinin-conjugated horseradish peroxidase into the Wulst. The labeled-cell distribution was correlated with the distribution of anterogradely labeled retinal terminals as revealed by intraocular injections of horseradish peroxidase. The results demonstrated a bilateral thalamofugal visual pathway ascending from the nucleus dorsolateralis anterior thalami (DLA). Projections from the visual thalamus to the Wulst showed a specific and orderly pattern, and retrogradely labeled cells of DLA were distributed equally, in a complementary fashion, on both sides of the brain, with a small region of overlap. Retinal termination fields in DLA largely overlapped relay neurons projecting to either Wulst, although the overlap was not complete. Despite differences in the organization of avian and mammalian visual pathways, which reflect their separate evolutionary origins, similarities between the DLA in the little owl and the lateral geniculate nucleus in mammals suggest that, during evolution similar selective pressures for binocularity led to a similar morphological organization.

  3. In vivo evaluation of lipid-based formulations for oral delivery of apomorphine and its diester prodrugs

    DEFF Research Database (Denmark)

    Borkar, Nrupa Nitin; Holm, René; Yang, Mingshi;

    2016-01-01

    in 1:3 and 4:1 ratio, respectively. Tmax of diesters was significantly increased (p≤0.05) compared to apomorphine in o/w emulsion, suggesting that esterification yielded prolonged drug absorption. Cmax, AUC and the relative bioavailability of apomorphine after DLA-SEDDS administration was higher (p≤0...

  4. Air Force Sustainment Center Logistics and Sustainment Enterprise 2040. Version 2.0

    Science.gov (United States)

    2016-04-15

    forecasting accuracy, 100% visibility of all inventories, discrepant materials handling, rapid manufacture or innovative supply of parts to...Accurate Parts Forecasting Agile Local Manufacturing 3-D Reprocurement Packages 448 SCMW/DLA AFRL/RX/RQ SCMEG 3. Safe...and processes High fidelity WS simulations for val/ver/test/training Technology driven cross complex collaboration/ innovation AFSC/EN AFRL

  5. Nitrogen Abundances in Damped Ly-alpha Absorbers

    CERN Document Server

    Zafar, Tayyaba; Molaro, Paolo; Peroux, Celine; D'Odorico, Valentina; Vladilo, Giovanni

    2014-01-01

    Nitrogen is thought to have both primary and secondary origins depending on whether the seed carbon and oxygen are produced by the star itself (primary) or already present in the interstellar medium (secondary) from which star forms. DLA and sub-DLA systems with typical metallicities of -3.0DLA/sub-DLA data from the literature with estimates available of nitrogen and alpha-elements. This yields a total of 98 systems, i.e. the largest nitrogen abundance sample investigated so far. In agreement with previous studies, we indeed find a bimodal [N/alpha] behaviour: three-quarter systems show a mean value of [N/alpha]=-0.87 with a scatter of 0.21 dex and one-quarter shows ratios clustered at [N/alpha]=-1.43 with a lower dispersion of 0.13 dex. The high [N/alph...

  6. Asymptotical small-x behaviour of the spin structure functions $g_1$ and $g_2$

    CERN Document Server

    Ermolaev, B I

    1997-01-01

    We show that for small x and in the double logarithmic approximation (DLA) g_2 can be expressed through derivative of g_1 with respect to logarithm of the QCD coupling. Therefore the small-x behavior of the both structure functions is similar. The analytical expression for flavor nonsinglet structure function g_1 is presented and its asymptotical behaviour is calculated.

  7. Loglines. January-February 2013

    Science.gov (United States)

    2013-02-01

    efforts. “I often say that nobody knows logis- tics better than we do, and DLA proved it time and again over the last few weeks,” he wrote...Forward Matt Hendricks, talking about the influence his father, a former Marine, had on his decision to go on holiday USO tour to Afghanistan. “We’re

  8. First Detection of NaI D lines in High-Redshift Damped Lyman-alpha Systems

    CERN Document Server

    Kondo, S; Gässler, W; Hayano, Y; Iye, M; Kamata, Y; Kanzawa, T; Kobayashi, N; Minowa, Y; Nedachi, K; Oya, S; Pyo, T S; Saint-Jacques, D; Takami, H; Takato, N; Terada, H; Tokunaga, A; Tsujimoto, T; Churchill, Christopher W.; Gaessler, Wolfgang; Hayano, Yutaka; Iye, Masanori; Kamata, Yukiko; Kanzawa, Tomio; Kobayashi, Naoto; Kondo, Sohei; Minowa, Yosuke; Nedachi, Ko; Oya, Shin; Pyo, Tae-Soo; Takami, Hideki; Takato, Naruhisa; Terada, Hiroshi; Tokunaga, Alan; Tsujimoto, Takuji

    2006-01-01

    A Near-infrared (1.18-1.35 micron) high-resolution spectrum of the gravitationally-lensed QSO APM 08279+5255 was obtained with the IRCS mounted on the Subaru Telescope using the AO system. We detected strong NaI D 5891,5897 doublet absorption in high-redshift DLAs at z=1.062 and 1.181, confirming the presence of NaI, which was first reported for the rest-frame UV NaI 3303.3,3303.9 doublet by Petitjean et al. This is the first detection of NaI D absorption in a high-redshift (z>1) DLA. In addition, we detected a new NaI component in the z=1.062 DLA and four new components in the z=1.181 DLA. Using an empirical relationship between NaI and HI column density, we found that all "components" have large HI column density, so that each component is classified as DLA absorption. We also detected strong NaI D absorption associated with a MgII system at z=1.173. Because no other metal absorption lines were detected in this system at the velocity of the NaI absorption in previously reported optical spectra (observed 3.6...

  9. LogLines. September-October 2009

    Science.gov (United States)

    2009-10-01

    and fuel. — Photo by Marine Sgt. Pete Thibodeau 32 www.dla.mil T he harshest logistics environment on earth: That’s how Navy Cmdr. Trent Kalp...bases and small combat operating posts in south- ern Afghanistan during the summer. — Photo by Marine Sgt. Pete Thibodeau Ar m y Sg t. 1s t C la ss

  10. Loglines. January-February 2015

    Science.gov (United States)

    2015-02-01

    saline , protective gloves and utility aprons. Even DLA Disposition Services played a role in the early weeks of OUA by adding countries in western...headquartered in Washington, D.C., on a multi-day business development forum in Niger in early September before the Defense Department’s support to the “We

  11. 76 FR 12078 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2011-03-04

    .... System manager(s) and address: Director, DLA Human Resources Center-Military, Military Personnel and... INFORMATION: The Defense Logistics Agency systems of records notices subject to the Privacy Act of 1974, (5 U... FURTHER INFORMATION CONTACT address above. The proposed system reports, as required by 5 U.S.C. 552a...

  12. ARN Supply Chain Management System for OCIE

    Science.gov (United States)

    2006-12-30

    Module (IRM), Clothing Initial Issue Point ( CIIP ); Supply Chain Management; Virtual Item Manager/Wholesale Local; Quality Logistics Management...DLA successfully assumed retail inventory at five Army Clothing Initial Issue Points ( CIIPs ), two United Stated Marine Corps Recruit Depots (MCRDs...system provides a “local” capability to manage wholesale inventory assets located at the CIIP including receipt and inventory adjustment processing

  13. Nanotechnology for the Solid Waste Reduction of Military Food Packaging

    Science.gov (United States)

    2016-06-01

    Environmental Protection Agency ESTCP Environmental Security Technology Certification Program FEST Food Engineering and Science Team FOC Force Operating ... Engineering Program DLA Defense Logistics Agency DoD Department of Defense EQBR Environmental Quality Basic Research EPA United States...each case inspected by NSRDEC engineers . The focus was on examining the food quality and packaging integrity of the prototype and control systems

  14. Additive Effectiveness Investigations in Alternative Fuels

    Science.gov (United States)

    2014-05-01

    Acid Methyl Ester (FAME, aka Biodiesel). Alternatives for the kerosene range are primarily designed for use in jet fuel and, thus, are hydrocarbons...Paraffinic Kerosene ............................................................................. 2 2.1.2 FAME (Biodiesel...DCN Derived Cetane Number by IQT DiEGME Di Ethylene Glycol Methyl Ether DLA-Energy Defense Logistics Agency, Energy Group DTBP Di Tertiary Butyl

  15. A deep search for 21-cm absorption in high redshift damped Lyman-alpha systems

    NARCIS (Netherlands)

    Kanekar, N; Chengalur, JN

    2003-01-01

    We present deep GMRT 21-cm absorption spectra of 10 damped Lyman-alpha systems (DLAs), of which 8 are at redshifts zgreater than or similar to1.3. HI absorption was detected in only one DLA, the z=0.5318 absorber toward PKS 1629+12. This absorber has been identified with a luminous spiral galaxy; th

  16. Cultural Resources in the Southern Lake Erie Basin: A Predictive Study.

    Science.gov (United States)

    1981-01-01

    Eudora : Schooner. Wrecked at;Dunkirk in 1851. 133 tons. Built in Charleston, OH, in 1843. H-14 245. 5Dla+ Golden Gate: Sidewheel steamer. Burned at Erie...tradition in Michigan: A distribu- tional analysis. Michigan Archaeologist 9:21-24. 1963b The Welti Site: A multicomponent site in southeastern

  17. A quasar reddened by a sub-parsec sized, metal-rich and dusty cloud in a damped Lyman-alpha absorber at z=2.13

    CERN Document Server

    Krogager, J -K; Noterdaeme, P; Zafar, T; Møller, P; Ledoux, C; Krühler, T; Stockton, A

    2015-01-01

    We present a detailed analysis of a red quasar at z=2.32 with an intervening damped Lyman-alpha absorber (DLA) at z=2.13. Using high quality data from the X-shooter spectrograph at ESO Very Large Telescope we find that the absorber has a metallicity consistent with Solar. We observe strong C I and H$_2$ absorption indicating a cold, dense absorbing medium. Partial coverage effects are observed in the C I lines, from which we infer a covering fraction of $27 \\pm 6$ % and a physical diameter of the cloud of 0.1 pc. From the covering fraction and size, we estimate the size of the background quasar's broad line region. We search for emission from the DLA counterpart in optical and near-infrared imaging. No emission is observed in the optical data. However, we see tentative evidence for a counterpart in the H and K' band images. The DLA shows high depletion (as probed by [Fe/Zn]=-1.22) indicating that significant amounts of dust must be present in the DLA. By fitting the spectrum with various dust reddened quasar ...

  18. VizieR Online Data Catalog: XQ-100 survey neutral gas (Sanchez-Ramirez+, 2016)

    Science.gov (United States)

    Sanchez-Ramirez, R.; Ellison, S. L.; Prochaska, J. X.; Berg, T. A. M.; Lopez, S.; D'Odorico, V.; Becker, G. D.; Christensen, L.; Cupani, G.; Denney, K. D.; Paris, I.; Worseck, G.; Gorosabel, J.

    2016-10-01

    The XQ-100 survey is an ESO Large Program (ESO ID 189.A-0424, P.I. S. Lopez) which obtained X-shooter spectra of 100 3.53.5 QSOs. This sample has been combined, after exhaustive checking for duplications and errors, with a literature sample of DLA surveys spanning the last ~20 years. (2 data files).

  19. Application of Advanced Manufacturing Techniques to Forged Surgical Instruments.

    Science.gov (United States)

    1987-08-01

    PR Cameron Station Alexandria, ’i,’ 2304-610( A Contract DLA 900.-34-C-1508 Approved for public rele ; "etriLbutlon Unlimited A Department of Defense...respect to this program, ASTMI F921 "Standard Definition of Terms Relatino to Hemostatic Forceps" notes "...that the box lock construction defined in

  20. 76 FR 72391 - Defense Logistics Agency Revised Regulation 1000.22, Environmental Considerations in Defense...

    Science.gov (United States)

    2011-11-23

    ... Logistics Agency Revised Regulation 1000.22, Environmental Considerations in Defense Logistics Agency Actions AGENCY: Defense Logistics Agency, Department of Defense. ACTION: Revised Defense Logistics Agency Regulation (DLAR) 1000.22. SUMMARY: On May 18, 2011, the Defense Logistics Agency (DLA) published a Notice of...

  1. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY83, Part 1 (Adamsville, Alabama - Ferndale, Michigan).

    Science.gov (United States)

    1983-01-01

    DLA OCE KINDER RANBER LAKE CITY ARKANSAS 43 43 43 43 CAIS0N BENCOR JV LAKE VILLAGE ARKANSAS 1,020 1,020 FOROICE COISTRUCTION CC LAKE VILLAGE ARKANSAS...220 DESIGN MARKETING INTL CORP WYOMING ILLINOIS 42 42 419 92 29 298 AURORA CORO & CABLE CO YORKVILLE ILLINOIS 1,968 1,218 750 FRIGITRONICS OF CONN INC

  2. Heat Exchange in the System Mould – Riser – Ambient. Part II: Surface Heat Emission from Open Riser to Ambient

    Directory of Open Access Journals (Sweden)

    Krajewski P.K.

    2013-12-01

    Full Text Available Przedmiotem artykułu jest wymiana ciepła w systemie odlew - nadlew - otoczenie. Celem badan było wyznaczenie temperaturowej zależności współczynnika wymiany ciepła z odkrytej, nieizolowanej powierzchni nadlewu do otoczenia. Bada- nia wykonano dla odlewu staliwnego z odkrytym nadlewem. dla zakresu temperatury powierzchni nadlewu 1000-1500*0. Na podstawie wykonanych badań stwierdzono, iż współczynnik emisji ciepła z nieizolowanej powierzchni nadlewu do otoczenia zmienia swą wartość w badanym zakresie temperatury o około 50%, tj. od około 0.26 - 0.30 dla metalu w stanie ciekłym do około 0.42 - 0.46 dla metalu w stanie stałym, w pobliżu temperatury solidus. Powyższy szeroki zakres zmian emisyjno- ści powinien być uwzględniany w budowanym modelach symulacji procesu krzepnięcia i projektowania systemów zasilania krzepnących odlewów.

  3. The Neutral Hydrogen Cosmological Mass Density at z=5

    CERN Document Server

    Crighton, Neil H M; Prochaska, J Xavier; Worseck, Gábor; Rafelski, Marc; Becker, George D; Ellison, Sara L; Fumagalli, Michele; Lopez, Sebastian; Meiksin, Avery; O'Meara, John M

    2015-01-01

    We present the largest homogeneous survey of $z>4.4$ damped Lyman-$\\alpha$ systems (DLAs) using the spectra of 163 QSOs that comprise the Giant Gemini GMOS (GGG) survey. With this survey we make the most precise high-redshift measurement of the cosmological mass density of neutral hydrogen, $\\Omega_{\\rm HI}$. At such high redshift important systematic uncertainties in the identification of DLAs are produced by strong intergalactic medium absorption and QSO continuum placement. These can cause spurious DLA detections, result in real DLAs being missed, or bias the inferred DLA column density distribution. We correct for these effects using a combination of mock and higher-resolution spectra, and show that for the GGG DLA sample the uncertainties introduced are smaller than the statistical errors on $\\Omega_{\\rm HI}$. We find $\\Omega_{\\rm HI}=0.98^{+0.20}_{-0.18}\\times10^{-3}$ at $\\langle z\\rangle=4.9$, assuming a 20% contribution from lower column density systems below the DLA threshold. By comparing to literat...

  4. Unveiling the Secrets of Metallicity and Massive Star Formation Using DLAs Along Gamma-Ray Bursts

    Science.gov (United States)

    Cucchiara, A.; Fumagalli, M.; Rafelski, M.; Kocevski, D.; Prochaska, J. X.; Cooke, R. J.; Becker, G. D.

    2015-01-01

    We present the largest, publicly available, sample of Damped Lyman-alpha systems (DLAs) along Swift discovered Gamma-ray Bursts (GRB) line of sights in order to investigate the environmental properties of long GRB hosts in the z = 1.8 - 6 redshift range. Compared with the most recent quasar DLAs sample (QSO-DLA), our analysis shows that GRB-DLAs probe a more metal enriched environment at z approximately greater than 3, up to [X/H] approximately -0.5. In the z = 2 - 3 redshift range, despite the large number of lower limits, there are hints that the two populations may be more similar (only at 90% significance level) than at higher redshifts. Also, at high-z, the GRB-DLA average metallicity seems to decline at a shallower rate than the QSO-DLAs: GRB-DLA hosts may be polluted with metals at least as far as approximately 2 kpc from the GRB explosion site, probably due to previous star-formation episodes and/or supernovae explosions. This shallow metallicity trend, extended now up to z approximately 5, confirms previous results that GRB hosts are star-forming and have, on average, higher metallicity than the general QSO-DLA population. Finally, our host metallicity measurements are broadly consistent with the predictions derived from the hypothesis of two channels of GRB progenitors, one of which is mildly affected by a metallicity bias, although more data are needed to constrain the models at z approximately greater than 4.

  5. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 2 (2620-4540).

    Science.gov (United States)

    1984-01-01

    AIRCRAFT 26 NEW ENGLAND TUBE & MACHINE VERMONT USAF MISC ENGINE ACCESSORIES - AIRCRAFT s0 NORTHROP CORPORATION CALIFORNIA USAF MISC ENGINE ACCESSORIES...OHIO DLA BEARINGS ANTIFRICTION UNMOUNTED 80 TOR- FRYE INC NEW HAMPSH ARMY BEARINGS ANTIFRICTION UNMOUNTED 66 USAF BEARINGS ANTIFRICTION UNMOUNTED 237

  6. A Candidate for an Intrinsic Dusty Absorber with a Metal-rich Damped Lyα Absorption Line System in the Quasar J170542.91+354340.2

    Science.gov (United States)

    Pan, Xiang; Zhou, Hongyan; Ge, Jian; Jiang, Peng; Yang, Bin; Lu, Honglin; Ji, Tuo; Zhang, Shaohua; Shi, Xiheng

    2017-02-01

    We present a detailed analysis of the unusual damped Lyα absorption line system (DLA) toward the quasar SDSS J170542.91+354340.2 at a redshift of 2, previously reported by Noterdaeme et al. as one of the very few CO absorbers known to date at high z. This DLA is exceptional in that: (1) its extinction curve is similar to peculiar Milky Way sightlines penetrating star formation regions; (2) its absorption components are redshifted at a speed of several hundred km s‑1 compared to broad Balmer emission lines; (3) its gas-phase metallicity is super-solar as evaluated from more than 30 absorption lines; (4) detection of residual flux in the DLA trough and variability of {{C}} {{IV}} absorption is possible. Based on these facts, we argue that this dusty DLA is a good candidate for an intrinsic quasar 2175 Å absorber, and can originate from star formation regions of the quasar’s host galaxy. We discuss in detail the gas and dust properties, and the dust depletion. Follow-up observations, such as spectropolarimetry and optical/infrared spectroscopy, will help to confirm the system’s intrinsic nature and to explore how dust grains behave in the extreme environments proximate to quasars.

  7. USMC Aviation Maintenance and Repair Cost for the H-1 Upgrade

    Science.gov (United States)

    2012-03-01

    Agency DCN Design Change Notice DLA Defense Logistics Agency DLIS Defense Logistics Information Service DoD Department of Defense DPD Data...Data Product Deliverables ( DPDs )  Contract Data Requirements Lists (CDRL) (Provisioning Statement of Work [PSOW] Project Team, 2008, p. 5) For

  8. Dielectric laser accelerators

    Science.gov (United States)

    England, R. Joel; Noble, Robert J.; Bane, Karl; Dowell, David H.; Ng, Cho-Kuen; Spencer, James E.; Tantawi, Sami; Wu, Ziran; Byer, Robert L.; Peralta, Edgar; Soong, Ken; Chang, Chia-Ming; Montazeri, Behnam; Wolf, Stephen J.; Cowan, Benjamin; Dawson, Jay; Gai, Wei; Hommelhoff, Peter; Huang, Yen-Chieh; Jing, Chunguang; McGuinness, Christopher; Palmer, Robert B.; Naranjo, Brian; Rosenzweig, James; Travish, Gil; Mizrahi, Amit; Schachter, Levi; Sears, Christopher; Werner, Gregory R.; Yoder, Rodney B.

    2014-10-01

    The use of infrared lasers to power optical-scale lithographically fabricated particle accelerators is a developing area of research that has garnered increasing interest in recent years. The physics and technology of this approach is reviewed, which is referred to as dielectric laser acceleration (DLA). In the DLA scheme operating at typical laser pulse lengths of 0.1 to 1 ps, the laser damage fluences for robust dielectric materials correspond to peak surface electric fields in the GV /m regime. The corresponding accelerating field enhancement represents a potential reduction in active length of the accelerator between 1 and 2 orders of magnitude. Power sources for DLA-based accelerators (lasers) are less costly than microwave sources (klystrons) for equivalent average power levels due to wider availability and private sector investment. Because of the high laser-to-particle coupling efficiency, required pulse energies are consistent with tabletop microJoule class lasers. Combined with the very high (MHz) repetition rates these lasers can provide, the DLA approach appears promising for a variety of applications, including future high-energy physics colliders, compact light sources, and portable medical scanners and radiative therapy machines.

  9. 41 CFR 101-26.602-5 - Procurement of natural gas from the wellhead and other supply sources.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Procurement of natural... Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS... Government, agency requirements may be satisfied through the Defense Logistics Agency (DLA). Arrangements...

  10. 32 CFR 1285.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ...(j) of this part. (4) Gather cost estimates when requested. (5) Ensure costs for processing each... with DLA-XAM prior to signature by the PSE director. Forward a copy of the final response and cost... record is maintained of all FOIA requests for logistical data (data on magnetic tape extracted from any...

  11. 32 CFR Appendix D to Part 516 - Department of Defense Directive 7050.5, Coordination of Remedies for Fraud and Corruption Related...

    Science.gov (United States)

    2010-07-01

    ... defects (or cost of correction). j. Refusal to accept nonconforming goods. k. Revocation of acceptance. l. Denial of claims submitted by contractors. m. Disallowance of contract costs. n. Removal of the... Defense a. DD Form 350 Report.1 b. Defense Logistics Agency's (DLA) “Contract Administration Defense...

  12. Pentagon otsib Eestist kaupa / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2010-01-01

    Pentagoni logistikatugi Defence Logistic Agency (DLA) pöördus Kaitsetööstuse Liidu poole selgitamaks välja, kas Eesti ettevõtetelt oleks võimalik osta Afganistanis sõdivatele vägedele köögivilja, joogivett ja ehitusmaterjale

  13. The neutral hydrogen cosmological mass density at z = 5

    Science.gov (United States)

    Crighton, Neil H. M.; Murphy, Michael T.; Prochaska, J. Xavier; Worseck, Gábor; Rafelski, Marc; Becker, George D.; Ellison, Sara L.; Fumagalli, Michele; Lopez, Sebastian; Meiksin, Avery; O'Meara, John M.

    2015-09-01

    We present the largest homogeneous survey of z > 4.4 damped Lyα systems (DLAs) using the spectra of 163 QSOs that comprise the Giant Gemini GMOS (GGG) survey. With this survey we make the most precise high-redshift measurement of the cosmological mass density of neutral hydrogen, Ω_{H I}. At such high redshift, important systematic uncertainties in the identification of DLAs are produced by strong intergalactic medium absorption and QSO continuum placement. These can cause spurious DLA detections, result in real DLAs being missed or bias the inferred DLA column density distribution. We correct for these effects using a combination of mock and higher resolution spectra, and show that for the GGG DLA sample the uncertainties introduced are smaller than the statistical errors on Ω_{H I}. We find Ω _{H I}=0.98^{+0.20}_{-0.18}× 10^{-3} at = 4.9, assuming a 20 per cent contribution from lower column density systems below the DLA threshold. By comparing to literature measurements at lower redshifts, we show that Ω_{H I} can be described by the functional form Ω _{H I}(z)∝ (1+z)^{0.4}. This gradual decrease from z = 5 to 0 is consistent with the bulk of H I gas being a transitory phase fuelling star formation, which is continually replenished by more highly ionized gas from the intergalactic medium and from recycled galactic winds.

  14. Measuring distributed leadership agency in a hospital context

    DEFF Research Database (Denmark)

    Jønsson, Thomas; Unterrainer, Christine; Jeppesen, Hans Jeppe;

    2016-01-01

    in management. As theoretically predicted, DLA is positively related to self-efficacy, job-satisfaction and innovative behaviour. Chief physicians, permanent employees and employee representatives scored higher on the scale than the rest of their respective counterparts. Practice implications: The survey offers...

  15. Supply Chain Synchronization: Improving Distribution Velocity to the Theatre

    Science.gov (United States)

    2009-06-01

    task in itself. To take a supply chain wide approach often involves considerable compromise and lots of elbow grease. The current AMC and DLA...jointvision/jvpub2.htm Accessed 9 March 2009. Lambert, Douglas M. Supply Chain Mangement : Processes, Partnerships, Performance. Jacksonville: The

  16. Production of d-lactate from sugarcane bagasse and corn stover hydrolysates using metabolic engineered Escherichia coli strains.

    Science.gov (United States)

    Utrilla, José; Vargas-Tah, Alejandra; Trujillo-Martínez, Berenice; Gosset, Guillermo; Martinez, Alfredo

    2016-11-01

    In this study, the lactogenic Escherichia coli strain JU15 was used and modified to produce d-lactate (d-LA) from plant hydrolysates with a minimal nutrient addition in pH controlled fermenters. Results showed that strain JU15 produces d-LA with high yield and productivity in laboratory simulated hydrolysate media and actual sugar cane bagasse hemicellulosic hydrolysate. Strain JU15 showed sequential carbon source utilization and acetic acid production. The l-lactic and acetic acid production pathways were deleted in JU15, resulting strain AV03 (JU15 ΔpoxB, ΔackA-pta, ΔmgsA), which showed simultaneous consumption of glucose and xylose and no acetic acid production in the simulated hydrolysate. The d-LA yield from hydrolysate sugars was close to 0.95gD-LA/gsugars in all cases. Our results show that d-LA can be produced from plant hydrolysates in simple batch fermentation processes with a high productivity using engineered E. coli strains at fermenter scales from 0.2 up to 10L. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Competition Issues and Inherently Governmental Functions Performed by Contractor Employees on Contracts to Supply Fuel to U.S. Troops in Iraq

    Science.gov (United States)

    2011-03-15

    storage, and testing costs. lOTC proVided several reasons for its offer bein well above DLA · In order to further analyze [QTC’s $2.10 unit price, the...ln fact, prior to 2004, the Pcntaeon had imported fUel directly lhrouah Iordlll without bein & roquircd to obtain a letter of authorization from the

  18. Pentagon otsib Eestist kaupa / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2010-01-01

    Pentagoni logistikatugi Defence Logistic Agency (DLA) pöördus Kaitsetööstuse Liidu poole selgitamaks välja, kas Eesti ettevõtetelt oleks võimalik osta Afganistanis sõdivatele vägedele köögivilja, joogivett ja ehitusmaterjale

  19. Continental Atlas of Poland for Automobilists – the first road atlas in the independent Poland

    Directory of Open Access Journals (Sweden)

    Rutkowski Jan

    2015-07-01

    Full Text Available The 90th anniversary of the appearance of Atlas Polski Continental dla automobilistów (Continental Atlas of Poland for Automobilists published by Continental Caoutchouc Compagnie Ltd Warsaw is nearing. The Atlas was the first publication of its kind after Poland had regained its independence in 1918.

  20. Forecasting Demand for Weapon System Items

    Science.gov (United States)

    1994-07-01

    level at quarter n. SL(n) was set using the Presutti- Trepp model that DLA currently uses. Forecast error is required by the model to set the safety level...of inventory investment versus response time, we varied the safety level by changing the "lambda factor" or backorder cost used in the Presutti- Trepp

  1. Defense Logistics: DOD Has Addressed Most Reporting Requirements and Continues to Refine Its Asset Visibility Strategy

    Science.gov (United States)

    2015-12-01

    Abbreviations AIT Automatic Identification Technology CONOPS Concept of Operations DLA Defense Logistics Agency DOD Department of...RFID Capability (Navy) Establish an automated information system with automatic identification and data-capture capabilities to improve logistics ...Defense Authorization Act for Fiscal Year 2014, Pub. L. No. 113-66, § 326 (Dec. 26, 2013). 6DOD uses Automatic Identification Technology (AIT

  2. Exploring the Impact of Students' Learning Approach on Collaborative Group Modeling of Blood Circulation

    Science.gov (United States)

    Lee, Shinyoung; Kang, Eunhee; Kim, Heui-Baik

    2015-01-01

    This study aimed to explore the effect on group dynamics of statements associated with deep learning approaches (DLA) and their contribution to cognitive collaboration and model development during group modeling of blood circulation. A group was selected for an in-depth analysis of collaborative group modeling. This group constructed a model in a…

  3. DOE Hydrogen & Fuel Cell Overview

    Science.gov (United States)

    2011-01-13

    Technologies Program eere.energy.gov BMW Manufacturing site. Courtesy of Waste Management World ona power supp y 9 Additional vehicle fuel source...commercial demand • HEB, Whole Foods, Coca Cola, Sysco Nestle FedEx BMW etc , , , , ¾DLA Demonstrations helped enable Codes and Standard approval of

  4. High performance linear algebra algorithms: An introduction

    DEFF Research Database (Denmark)

    Gustavson, F.G.; Wasniewski, Jerzy

    2006-01-01

    his Mini-Symposium consisted of two back to back sessions, each consisting of five presentations, held on the afternoon of Monday, June 21, 2004. A major theme of both sessions was novel data structures for the matrices of dense linear algebra, DLA. Talks one to four of session one all centered...

  5. Department of Defense Logistics Roadmap 2008. Volume 2

    Science.gov (United States)

    2008-07-01

    storage, and distribution functions for tires, packaged petroleum/ oil and lubricant products (POL), and compressed gasses. Responsibility for all vendor...of systems: - DLA’s EBS - DDC’s DSS - DAAS-C Files - Spreadsheets from Service Supply Systems - pRFID systems - SESAME - IPO - JRIMM Collaboration

  6. 32 CFR 1288.2 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Policy. 1288.2 Section 1288.2 National Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS REGISTRATION OF... period of 3 years from the year and month of issue. (d) Activities will use DLA Form 1454, Vehicle...

  7. 32 CFR 1285.5 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS DEFENSE LOGISTICS AGENCY FREEDOM OF INFORMATION ACT PROGRAM § 1285.5 Procedures. (a) FOIA channels. If DLA personnel... in the description, the requester category, and the issue of fees. FOIA managers will notify...

  8. 32 CFR 145.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    .... (a) The Secretaries of the Military Departments and the Director, Defense Logistics Agency (DLA... or otherwise, on all issues concerning cooperation with the OSC. This authority extends to: (1... Counsel of the Defense Logistics Agency shall have the same authority for their respective Components as...

  9. 76 FR 76954 - Notice of Amendment No. 004 to the Solicitation for Cooperative Agreement Applications (SCAA...

    Science.gov (United States)

    2011-12-09

    ... Applications (SCAA) Issued on July 7, 2010 AGENCY: Defense Logistics Agency, Department of Defense (DoD... Logistics Agency (DLA) executes the Department of Defense (DoD) Procurement Technical Assistance Program by... already received a base period award in FY 2011 under the amended solicitation. As of the issue date of...

  10. 32 CFR Appendix A to Part 323 - Instructions for Preparation of System Notices

    Science.gov (United States)

    2010-07-01

    ... DEFENSE (CONTINUED) PRIVACY PROGRAM DEFENSE LOGISTICS AGENCY PRIVACY PROGRAM Pt. 323, App. A Appendix A to... Copies may be obtained from the Defense Logistics Agency, ATTN: DSS-CV, 8725 John J. Kingman Road, Suite... establishing DLA as well as the Secretary of Defense authority to issue the directive. For example, ‘Pursuant...

  11. 32 CFR 1285.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS DEFENSE LOGISTICS AGENCY FREEDOM OF INFORMATION ACT PROGRAM § 1285.3 Definitions. The following terms and meanings... issue a “no record” determination. These include the Directors (or equivalent) of HQ DLA Primary Staff...

  12. Characterization of partial resistance to black spot disease of Rosa spp.

    Science.gov (United States)

    Black spot disease (BSD) is one of the most serious diseases of garden roses. Both complete (vertical) resistance and partial (horizontal) resistance have been identified in 16 rose genotypes using two laboratory assays, the detached leaf assay (DLA) and the whole plant inoculation (WPI) approaches...

  13. Defense Base Realignment and Closure Account for the Defense Personnel Support Center, the Defense Clothing Factory, and the Naval Aviation Depot Pensacola

    Science.gov (United States)

    1996-11-25

    outplacement center. Additionally, adjusting accounting entries must be reviewed for accuracy once Defense Contract Management District North Central is...that the Office of Executive Director, Human Resources, issue guidance for outplacement services to future BRAC activities scheduled for closure...Management concurred and stated that the DLA Civilian Personnel Support Office is developing an agency outplacement guide. 15 Appendix C. Background of

  14. 32 CFR 1285.2 - Policy.

    Science.gov (United States)

    2010-07-01

    ... timely information concerning DLA activities, records requested through public information channels by news media representatives that would not be withheld if requested under the FOIA should be released upon request. Prompt responses to requests for information from news media representatives should...

  15. Loglines. July-August 2014

    Science.gov (United States)

    2014-08-01

    behaviors by making it convenient for them. By increasing their access to fresh fruits and vegetables and making it available right in front of them...the post restaurant manager in he said. In the year since DLA Distribution’s Eastern Distribution Center in New Cumberland, Pennsylvania, started

  16. Ryzyko zdrowotne związane ze spożywaniem wody pitnej ze studni kopanych na przykładzie gminy Chmielnik

    Directory of Open Access Journals (Sweden)

    Natalia Żurek

    2016-12-01

    Full Text Available Wstęp. W Polsce znaczny odsetek populacji pozyskuje wodę pitną ze studni kopanych, podatnych na zanieczyszczenia przemysłowe i rolnicze. Woda pochodząca z tzw. prywatnych ujęć wodnych, zgodnie z polskim prawodawstwem, nie podlega jednak ustawowej kontroli, a jej spo- żywanie naraża konsumentów na negatywne skutki zdrowotne. Celem pracy było oszacowanie wybranych parametrów fizykochemicznych wody pitnej ze studni kopanych oraz odniesienie uzyskanych wyników do norm ujętych w rozporządzeniu ministra zdrowia. Materiał i metody. W przeprowadzonych analizach 36 próbek wody studziennej z terenu gminy Chmielnik, zawartość azotanów (III i jonu amonowego badano za pomocą fotometru, odczyn i przewodność elektrolityczną miernikiem wieloparametrowym, mętność za pomocą turbidymetru, zaś stężenie chlorków oznaczono metodą miareczkową. Wyniki. Dla badanych parametrów chemicznych, tj. azotanów (III, chlorków i jonu amonowego nie stwierdzono przekroczeń dopuszczalnych norm, podobnie jak dla parametru fizycznego, tj. przewodności elektrolitycznej. Ponadnormatywne wartości odnotowano natomiast dla dwóch parametrów fizycznych, tj. odczynu (2 próbki i mętności (33 próbki. Wnioski. Wodę z badanych studni kopanych można określić jako bezpieczną dla konsumentów pod względem badanych parametrów chemicznych, dla których spodziewano się przekroczeń dopuszczalnych norm w związku z terminem poboru. Problem ponadnormatywnych wartości mętności dla większości kontrolowanych studni może być rozwiązany poprzez wprowadzenie prostych metod uzdatniania, natomiast wprowadzenie regularnych badań wszystkich parametrów jakości wody pitnej pozwoliłoby ustalić, czy przekroczone normy dla odczynu wiążą się z niedopuszczalnymi stężeniami wskaźników chemicznych, które nie były badane w niniejszej pracy.

  17. Występowanie, swoistość i krzyżowa reaktywność przeciwciał antybakteryjnych (Yersinia spp., Salmonella Enteritidis, Chlamydia trachomatis, Borrelia burgdorferi oraz ich znaczenie w diagnostyce niesklasyfikowanych zapaleń stawów

    Directory of Open Access Journals (Sweden)

    Jakub Ząbek

    2011-02-01

    Full Text Available Diagnostyka serologiczna niesklasyfikowanych zapaleń stawówo podejrzewanej etiologii infekcyjnej jest często uważana za podstawowąz uwagi na opóźnione objawy kliniczne w stosunku dowystąpienia infekcji. W prezentowanej pracy przedstawiono wynikibadań przeprowadzonych na 4830 surowicach pacjentów (w tymok. 53% dzieci i młodzieży, hospitalizowanych w 2009 r. w 4 od -działach klinicznych Instytutu Reumatologii w Warszawie.W badaniach zastosowano metodę immunoenzymatyczną (ELISA,a w przypadku konieczności potwierdzenia obecności przeciwciałdla Y. enterocolitica (u dzieci i B. burgdorferi – metodę immunoblotting(Western-blotting.Analizując uzyskane wyniki, stwierdzono podwyższony poziomprzeciwciał dla Yersinia spp. – w 35,3% surowic, dla S. Enteritidis –w 13%, Ch. trachomatis – w 10,6%, B. burgdorferi – w 14,7% (tab. I.Przeanalizowano występowanie przeciwciał poszczególnych klasw aspekcie ich przydatności diagnostycznej w określaniu infekcji.Szczególną uwagę zwracano na częste współwystępowanie w tejsamej surowicy przeciwciał dla kilku drobnoustrojów (w tychsamych klasach – w 56,8%, w różnych klasach – 20,7% (tab. III, IV.Potwierdzono obecność swoistych przeciwciał klasy IgA dla Yersiniaspp. w 60,8%, a klasy IgG – w 86,7%. Podobne badania nadswoistością przeciwciał dla B. burgdorferi wykazały ich potwierdzalnośćw 82,2% dla klasy IgG oraz w 45,9% dla klasy IgM (tab. II.Dodatkowo dokonano szczegółowej analizy częstości występowania przeciwciał dla swoistych antygenów Y. enterocolitica i B. burgdorferi(ryc. 1, 2.Diagnostyka serologiczna niesklasyfikowanych zapaleń stawówo podejrzewanej etiologii bakteryjnej: Yersinia spp., S. Enteritidis,Ch. trachomatis, B. burgdorferi, jest przydatna z racji opóźnionychobjawów klinicznych, jednakże obarczona wieloma trudnościamiinterpretacyjnymi, wynikającymi z:• częstego wykrywania przeciwciał w jednej klasie, zwłaszcza IgG,które nie

  18. Discovery of the most metal-poor damped Lyman-α system

    Science.gov (United States)

    Cooke, Ryan J.; Pettini, Max; Steidel, Charles C.

    2017-01-01

    We report the discovery and analysis of the most metal-poor damped Lyman-α (DLA) system currently known, based on observations made with the Keck HIRES spectrograph. The metal paucity of this system has only permitted the determination of three element abundances: [C/H] =-3.43 ± 0.06, [O/H] =-3.05 ± 0.05, and [Si/H] =-3.21 ± 0.05, as well as an upper limit on the abundance of iron: [Fe/H] ≤-2.81. This DLA is among the most carbon-poor environment currently known with detectable metals. By comparing the abundance pattern of this DLA to detailed models of metal-free nucleosynthesis, we find that the chemistry of the gas is consistent with the yields of a 20.5 M⊙ metal-free star that ended its life as a core-collapse supernova; the abundances we measure are inconsistent with the yields of pair-instability supernovae. Such a tight constraint on the mass of the progenitor Population III star is afforded by the well-determined C/O ratio, which we show depends almost monotonically on the progenitor mass when the kinetic energy of the supernova explosion is Eexp ≳ 1.5 × 1051 erg. We find that the DLA presented here has just crossed the critical `transition discriminant' threshold, rendering the DLA gas now suitable for low mass star formation. We also discuss the chemistry of this system in the context of recent models that suggest some of the most metal-poor DLAs are the precursors of the `first galaxies', and are the antecedents of the ultra-faint dwarf galaxies.

  19. WYKORZYSTANIE ODNAWIALNYCH ŹRÓDEŁ ENERGII I CIEPŁA ODPADOWEGO W NISKOTEMPERATUROWYM SYSTEMIE OGRZEWCZO-CHŁODZĄCYM HALI DRUKARNI

    Directory of Open Access Journals (Sweden)

    Wojciech BIALIK

    Full Text Available W pracy przedstawiono nowoczesny system ogrzewania hali drukarni oraz pomieszczeń biurowych i socjalnych. Został on zaprezentowany na dwóch schematach oraz omówiony w pierwszej części artykułu. Układ wykorzystuje pompy ciepła ciecz-ciecz oraz powietrze ciecz. Dla pomp ciecz-ciecz dolnym źródłem jest pionowy wymiennik gruntowy składający się z 13 otworów o głębokości 100 m. W opisywanym rozwiązaniu zastosowano także poziomy gruntowy wymiennik ciepła do ogrzewania czerpanego z otoczenia powietrza wentylacyjnego płynącego następnie do rekuperatorów pomieszczeń biurowych i socjalnych. Gruntowe wymienniki ciepła w trakcie ich budowy zostały zaprezentowane na jednym z rysunków. Pomieszczenia biurowe i socjalne ogrzewane lub schładzane są medium płynącym w matach umieszczonych w ścianach oraz w wybranych częściach podłogi. Dla ograniczenia strat ciepła związanych z wentylacją w instalacji zastosowano trzy układy rekuperacji (osobno dla pomieszczeń biurowych, socjalnych i hali drukarskiej. Poprawne działanie systemu zobrazowano w postaci wykresu zmian temperatur we wspomnianych pomieszczeniach. Dla największej centrali wentylacyjnej zamieszczono też przebieg temperatur strumieni powietrza dla wybranych dni. W podsumowaniu zawarto wnioski płynące z dotychczasowej eksploatacji oraz plany dalszego rozwoju systemu.

  20. From Exoplanets to Quasars: Detection of Potential Damped Lyα Absorbing Galaxies Using Angular Differential Imaging

    Science.gov (United States)

    Johnson-Groh, Mara; Marois, Christian; Ellison, Sara L.

    2016-11-01

    The advantages of angular differential imaging (ADI) have been previously untested in imaging the host galaxies of damped Lyα (DLA) systems. In this pilot study, we present the first application of ADI to directly image the host galaxy of the DLA seen toward the quasar J1431+3952. K-band imaging of the field surrounding J1431+3952 was obtained on the Gemini North telescope with an adaptive optics system and a laser guide star. We computed a sensitivity curve that demonstrates the sensitivity of our observations as a function of K-band magnitude, impact parameter and DLA angular size. For an impact parameter of 0.″5 (3.4 kpc at the redshift of the absorber) our mass sensitivity is log (M {}\\star /M {}⊙ ) ˜ 9.2 and drops to ˜9.0 at separations beyond ˜6 kpc for the smallest size model galaxy. Three candidate galaxies are identified within 5″. Stellar masses were computed from the K-band photometry yielding values of log (M {}\\star /M {}⊙ ) ˜ 9.9, 9.7 and 11.1 respectively. The likely identification of the absorbing galaxy is discussed, and we conclude that the galaxy with the largest impact parameter and highest stellar mass is unlikely to be the host, based on its inconsistency with the N(HI) impact parameter relation and inconsistent photometric redshift. While we cannot distinguish between the remaining two candidates as the DLA host, we note that, despite the low spin temperature and relatively high metallicity of the DLA, the host does not appear to be a particularly luminous (high-mass) galaxy.

  1. Directly Imaging Damped Ly-Alpha Galaxies at Redshifts Greater Than 2. III: The Star Formation Rates of Neutral Gas Reservoirs at Redshifts of Approximately 2.7

    Science.gov (United States)

    Fumagalli, Michele; OMeara, John M.; Prochaska, J. Xavier; Rafelski, Marc; Kanekar, Nissim

    2014-01-01

    We present results from a survey designed to probe the star formation properties of 32 damped Ly alpha systems (DLAs) at redshifts of approximately 2.7. By using the "double-DLA" technique that eliminates the glare of the bright background quasars, we directly measure the rest-frame FUV flux from DLAs and their neighbouring galaxies. At the position of the absorbing gas, we place stringent constraints on the unobscured star formation rates (SFRs) of DLAs to 2 sigma limits of psi less than 0.09-0.27 solar mass yr(exp -1), corresponding to SFR surface densities sigma(sub sfr) less than 10(exp -2.6)-10(exp -1.5) solar mass yr(exp -1) kpc(exp -2). The implications of these limits for the star formation law, metal enrichment, and cooling rates of DLAs are examined. By studying the distribution of impact parameters as a function of SFRs for all the galaxies detected around these DLAs, we place new direct constraints on the bright end of the UV luminosity function of DLA hosts. We find that less than or equal to 13% of the hosts have psi greater than or equal to 2 solar mass yr(exp -1) at impact parameters b(sub dla) less than or equal to (psi/solar mass yr(exp -1))(exp 0.8) + 6 kpc, differently from current samples of confirmed DLA galaxies. Our observations also disfavor a scenario in which the majority of DLAs arise from bright LBGs at distances 20 less than or equal to b(sub dla) less than 100 kpc. These new findings corroborate a picture in which DLAs do not originate from highly star forming systems that are coincident with the absorbers, and instead suggest that DLAs are associated with faint, possibly isolated, star-forming galaxies. Potential shortcomings of this scenario and future strategies for further investigation are discussed.

  2. A glimpse at quasar host galaxy far-UV emission using damped Lyα's as natural coronagraphs

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Zheng; Fan, Xiaohui; Wang, Ran; McGreer, Ian, E-mail: caize@arizona.edu [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Noterdaeme, Pasquier; Finley, Hayley; Petitjean, Patrick [Institut d' Astrophysique de Paris, CNRS-UPMC, UMR7095, 98bis bd Arago, F-75014 Paris (France); Carithers, Bill [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA (United States); Bian, Fuyan [Research School of Astronomy and Astrophysics, Australian National University, Canberra, Weston Creek, ACT, 2611 (Australia); Miralda-Escudé, Jordi [Institució Catalana de Recerca i Estudis Avançats, Barcelona (Spain); Pâris, Isabelle [Departamento de Astronomia, Universidad de Chile, Casilla 36-D, Santiago (Chile); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Zakamska, Nadia L. [Department of Physics and Astronomy, Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218 (United States); Ge, Jian [Department of Astronomy, University of Florida, Gainesville, FL (United States); Slosar, Anze [Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2014-10-01

    In merger-driven models of massive galaxy evolution, the luminous quasar phase is expected to be accompanied by vigorous star formation in quasar host galaxies. In this paper, we use high column density damped Lyα (DLA) systems along quasar sight lines as natural coronagraphs to directly study the far-UV (FUV) radiation from the host galaxies of luminous background quasars. We have stacked the spectra of ∼2000 DLA systems (N {sub H} {sub I} > 10{sup 20.6} cm{sup –2}) with a median absorption redshift (z) = 2.6 selected from quasars observed in the SDSS-III Baryon Oscillation Spectroscopic Survey. We detect residual flux in the dark troughs of the composite DLA spectra. The level of this residual flux significantly exceeds systematic errors in the Sloan Digital Sky Survey fiber sky subtraction; furthermore, the residual flux is strongly correlated with the continuum luminosity of the background quasar, while uncorrelated with DLA column density or metallicity. We conclude that the flux could be associated with the average FUV radiation from the background quasar host galaxies (with medium redshift (z) = 3.1) that is not blocked by the intervening DLA. Assuming that all of the detected flux originates from quasar hosts, for the highest quasar luminosity bin ((L) = 2.5 × 10{sup 13} L {sub ☉}), the host galaxy has an FUV intensity of 1.5 ± 0.2 × 10{sup 40} erg s{sup –1} Å{sup –1}; this corresponds to an unobscured UV star formation rate of 9 M {sub ☉} yr{sup –1}.

  3. Preoperative preparation of high-risk, specifically hyperimmunized canine renal allograft recipients with total-lymphoid irradiation and cyclosporine

    Energy Technology Data Exchange (ETDEWEB)

    Rapaport, F.T.; Meek, A.G.; Arnold, A.N.; Miura, S.; Hayashi, R.; Strober, S.

    1987-08-01

    Hyperimmunized subjects are a particularly high-risk and rapidly growing group in the patient population awaiting renal transplantation. In a search for methods designed to ameliorate the prognosis in such cases, dogs of defined DLA genotype were sensitized with DLA incompatible skin allografts and injections of buffy coat. Each recipient was challenged with a renal allograft bearing the same DLA incompatibilities. Five dogs received kidney transplants, without any other treatment, and rejected their transplants at 2.5, 4, 5, 6, and 6.5 days, respectively. Another four dogs were given a 9-11-week course (1760 +/- 35 cGy) of total-lymphoid irradiation (TLI), followed by rabbit antithymocyte globulin (ATG); these animals rejected their renal allografts at 7, 8, 14, and 17 days, respectively. Five other dogs were treated with TLI and received cyclosporine (CsA) and methylprednisolone (MPd) daily until graft rejection. Their renal allografts survived for 7.5, 8.5, 20, 62, and 227 days, respectively. Renal allografts placed in normal recipients under the same conditions of donor-recipient DLA incompatibility had a mean survival time of 12.4 days (range: 10-18 days). At the time of transplantation, the specific anti-DLA antibody titers in the recipients were 81 to 243 in the untreated dogs; 27 to 81 in the TLI-ATG-treated group, and 3 to 243 in the TLI-CsA/MPd-treated group. The titers fell within 24-48 hr after renal transplantation, to 3 to 81 in the untreated sensitized dogs; they were 3 to 9 in the TLI-ATG-treated group, and were 9 to 243 in the TLI-CsA/MPd treated group. The cytotoxic antibody titers reached postoperative peaks of 6500 to 200,000 in the untreated dogs; 729 to 6500 in the TLI-ATG-treated dogs, and 243 to 6500 in the TLI-CsA/MPd-treated recipients.

  4. The EU-Georgia Association Agreement: An Instrument To Support The Development Of Georgia Or Lip Service? / Układ Stowarzyszeniowy Ue – Gruzja: Instrument Wsparcia Rozwoju Gruzji Czy Deklaracja Bez Pokrycia?

    Directory of Open Access Journals (Sweden)

    Kawecka-Wyrzykowska Elżbieta

    2015-06-01

    Full Text Available 1 września 2014 r. wszedł w życie (częściowo układ stowarzyszeniowy między UE i Gruzją. Jego główną część stanowi „Umowa o pogłębionej i całościowej strefie wolnego handlu”, która przewiduje pełną liberalizację handlu wyrobami przemysłowymi i znaczącą redukcję barier w handlu rolnym. Istotna część umowy jest poświęcona eliminacji regulacyjnych barier dla handlu (np. standardów technicznych. Umowa przewiduje też stopniową i częściową liberalizację handlu usługami, jak też szybką i głęboką eliminację barier w zakresie przepływów kapitałowych. Liberalizacja przepływu pracowników ma bardzo ograniczony zakres. Postanowienia układu stowarzyszeniowego UE-Gruzja są podobne do Układów europejskich podpisanych wcześniej przez państwa Europy Środkowej i Wschodniej, jakkolwiek istotne są też różnice. Oczekuje się, że układ stowarzyszeniowy przyniesie wiele korzyści Gruzji, w tym (a stabilizację jej systemu ekonomicznego i prawnego, czyniąc go w efekcie bardziej przewidywalnym dla inwestorów oraz bardziej przyjaznym dla przedsiębiorców; (b zbliżenie wielu przepisów do tych, które obowiązują w UE, co rozszerzy rynek dla gruzińskich towarów i usług; (c lepsze wdrożenie przepisów ważnych dla biznesu. Krótkookresowe korzyści wynikające z liberalizacji handlu będą skromne dla Gruzji, częściowo z uwagi na otwarty dostęp do jej rynku już przed wejściem Układu w życie. Implementacja Układu będzie się też wiązać z kosztami dostosowawczymi, które są zazwyczaj nieuniknioną metodą wzrostu eksportu na wielki rynek UE.

  5. Identification of novel genetic risk loci in Maltese dogs with necrotizing meningoencephalitis and evidence of a shared genetic risk across toy dog breeds.

    Science.gov (United States)

    Schrauwen, Isabelle; Barber, Renee M; Schatzberg, Scott J; Siniard, Ashley L; Corneveaux, Jason J; Porter, Brian F; Vernau, Karen M; Keesler, Rebekah I; Matiasek, Kaspar; Flegel, Thomas; Miller, Andrew D; Southard, Teresa; Mariani, Christopher L; Johnson, Gayle C; Huentelman, Matthew J

    2014-01-01

    Necrotizing meningoencephalitis (NME) affects toy and small breed dogs causing progressive, often fatal, inflammation and necrosis in the brain. Genetic risk loci for NME previously were identified in pug dogs, particularly associated with the dog leukocyte antigen (DLA) class II complex on chromosome 12, but have not been investigated in other susceptible breeds. We sought to evaluate Maltese and Chihuahua dogs, in addition to pug dogs, to identify novel or shared genetic risk factors for NME development. Genome-wide association testing of single nucleotide polymorphisms (SNPs) in Maltese dogs with NME identified 2 regions of genome-wide significance on chromosomes 4 (chr4:74522353T>A, p = 8.1×10-7) and 15 (chr15:53338796A>G, p = 1.5×10-7). Haplotype analysis and fine-mapping suggests that ILR7 and FBXW7, respectively, both important for regulation of immune system function, could be the underlying associated genes. Further evaluation of these regions and the previously identified DLA II locus across all three breeds, revealed an enrichment of nominal significant SNPs associated with chromosome 15 in pug dogs and DLA II in Maltese and Chihuahua dogs. Meta-analysis confirmed effect sizes the same direction in all three breeds for both the chromosome 15 and DLA II loci (p = 8.6×10-11 and p = 2.5×10-7, respectively). This suggests a shared genetic background exists between all breeds and confers susceptibility to NME, but effect sizes might be different among breeds. In conclusion, we identified the first genetic risk factors for NME development in the Maltese, chromosome 4 and chromosome 15, and provide evidence for a shared genetic risk between breeds associated with chromosome 15 and DLA II. Last, DLA II and IL7R both have been implicated in human inflammatory diseases of the central nervous system such as multiple sclerosis, suggesting that similar pharmacotherapeutic targets across species should be investigated.

  6. Evaluation of chromogenic medium and direct latex agglutination test for detection of group B streptococcus in vaginal specimens from pregnant women in Lebanon and Kuwait.

    Science.gov (United States)

    Ghaddar, Nahed; Alfouzan, Wadha; Anastasiadis, Elie; Al Jiser, Tamima; Itani, Saad Eddine; Dernaika, Racha; Eid, Toufic; Ghaddar, Ali; Charafeddine, Adib; Dhar, Rita; El Hajj, Hiba

    2014-10-01

    This study was undertaken to evaluate chromogenic medium and a direct latex agglutination test (DLA) for detection of Group B Streptococcus (GBS) in the vaginal specimens of pregnant women, and to ascertain the prevalence of GBS in this population in Kuwait and Lebanon. Vaginal swabs, collected from women at 35-37 weeks of gestation, were cultured on 5 % sheep blood agar (SBA), colistin nalidixic acid agar (CNA), Strept B Select chromogenic agar (SBS) as well as Lim enrichment broth in 168 cases in Lebanon while only SBA was used for 1391 samples in Kuwait. In addition, vaginal samples from 102 GBS-positive and 20 GBS-negative women near the time of delivery were collected in Kuwait for evaluation of the DLA test. During the study period, the prevalence of GBS colonization was determined to be 20.7 % (288/1391) in Kuwait while 18.4 % (31) of 168 pregnant women in Lebanon had vaginal cultures positive for GBS. By direct plating of vaginal swabs on the three media used, the isolation rates of GBS were 51.6, 64.5 and 77.4 % on SBA, CNA and SBS, respectively, which increased to 90.35, 93.1 and 96.8 %, respectively, following subculture in Lim broth after 18 h of incubation. The sensitivity of the DLA test was found to be dependent on the density of GBS colonization, resulting in 100 % sensitivity and 100 % specificity for heavy (>10(2) c.f.u. per swab) and moderately heavy (50-100 c.f.u. per swab) growth of GBS. However, for vaginal specimens yielding <50 c.f.u. per swab, the sensitivity, specificity, positive and negative predictive values of the DLA test were 100, 55.5, 63.6 and 100 %, respectively. In conclusion, a chromogenic agar, such as SBS, and a DLA test can be used for rapid detection of GBS in pregnant women. The DLA test, in particular, could prove to be a useful tool for immediate detection of GBS in women near delivery so that intrapartum antibiotic prophylaxis can be initiated.

  7. Diamond field emitter array cathodes and possibilities of employing additive manufacturing for dielectric laser accelerating structures

    Science.gov (United States)

    Simakov, Evgenya I.; Andrews, Heather L.; Herman, Matthew J.; Hubbard, Kevin M.; Weis, Eric

    2017-03-01

    Demonstration of a stand-alone practical dielectric laser accelerator (DLA) requires innovation in two major critical components: high-current ultra-low-emittance cathodes and efficient laser accelerator structures. LANL develops two technologies that in our opinion are applicable to the novel DLA architectures: diamond field emitter array (DFEA) cathodes and additive manufacturing of photonic band-gap (PBG) structures. This paper discusses the results of testing of DFEA cathodes in the field-emission regime and the possibilities for their operation in the photoemission regime, and compares their emission characteristics to the specific needs of DLAs. We also describe recent advances in additive manufacturing of dielectric woodpile structures using a Nanoscribe direct laser-writing device capable of maskless lithography and additive manufacturing, and the development of novel infrared dielectric materials compatible with additive manufacturing.

  8. The use of NRCS synthetic unit hydrograph and Wackermann conceptual model in the simulation of a flood wave in an uncontrolled catchment/ Zastosowanie syntetycznego hydrogramu jednostkowego NRCS oraz konceptualnego modelu Wackermana do symulacji fali wezbraniowej w zlewni niekontrolowanej

    Directory of Open Access Journals (Sweden)

    Pietrusiewicz Izabela

    2014-12-01

    Full Text Available W pracy przedstawiono wyniki analiz z wykorzystaniem dwóch modeli - konceptualnego modelu Wackermana oraz syntetycznego hydrogramu jednostkowego NRCS-UH - do określenia przepływów w zlewni rzeki Słonka, znajdującej się na obszarze Polski. Wybrane modele charakteryzują się łatwością określenia danych wejściowych do modelu, co jest istotne w aspekcie obliczeń inżynierskich. Obliczenia wykonano dla przepływów o prawdopodobieństwie wystąpienia przekroczenia wynoszącym: 0,5%, 1%, 2%, 5%, 10%, 20% i 50 dla różnych poziomów uwilgotnienia zlewni.

  9. Modeling of Mechanical Influence of Double-Beam Laser on Single-Crystalline Silicon

    Directory of Open Access Journals (Sweden)

    Shalupaev S.V.

    2013-12-01

    Full Text Available W pracy przedstawiono wyniki modelowania metoda elementów skonczonych termorozszczepiania krystalicznego krzemu przy pomocy wiazek laserowych. Analizowano przypadek działania dwóch wiazek laserowych o długosci fali 0,808 μm i 1,06 μm. Obliczenia pól termosprezystych, formowanych w krystalicznym waflu krystalicznym, prowadzono jako efekt kolejnych działan dwuwiazkowego ogrzewania laserowego i chłodzenia dla orientacji (100, (110, (111 krystalicznego krzemu. Modelowanie prowadzone było dla wiazek o przekroju kolistym oraz w kształcie litery U. Otrzymane wyniki moga byc wykorzystane do optymalizacji precyzyjnego ciecia laserem wafli krzemowych.

  10. Diamond field emitter array cathodes and possibilities for employing additive manufacturing for dielectric laser accelerating structures

    Energy Technology Data Exchange (ETDEWEB)

    Simakov, Evgenya Ivanovna [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Andrews, Heather Lynn [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Herman, Matthew Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hubbard, Kevin Mark [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Weis, Eric [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-20

    These are slides for a presentation at Stanford University. The outline is as follows: Motivation: customers for compact accelerators, LANL's technologies for laser acceleration, DFEA cathodes, and additive manufacturing of micron-size structures. Among the stated conclusions are the following: preliminary study identified DFEA cathodes as promising sources for DLAs--high beam current and small emittance; additive manufacturing with Nanoscribe Professional GT can produce structures with the right scale features for a DLA operating at micron wavelengths (fabrication tolerances need to be studied, DLAs require new materials). Future plans include DLA experiment with a beam produced by the DFEA cathode with field emission, demonstration of photoemission from DFEAs, and new structures to print and test.

  11. Co ze mną zrobisz, kiedy mnie zobaczysz? Percepcja jako wyszukiwanie ofert (affordances w otoczeniu

    Directory of Open Access Journals (Sweden)

    Andrzej Klawiter

    2012-12-01

    Full Text Available Współczesne próby łączenia percepcji z działaniem czerpią z Gibsonowskiej koncepcji ofert (affordances. Tekst szkicuje pojęciowe podstawy tej koncepcji pokazując, jak pojęcie oferty wpisuje się w teorię percepcji, rozumianej jako aktywne szukanie ustrukturowanej informacji, mogącej usprawnić działanie organizmu w otoczeniu. Napomyka też o pewnej paraleli filozoficznej (filozofia narzędzia Martina Heideggera oraz o tym, że intuicje kryjące się za pojęciem oferty były bardziej inspirujące dla kognitywistów, neuronaukowców czy robotyków niż dla psychologów zajmujących się percepcją.

  12. Sprayed microspheres of poly(lactic acid) obtained with calcium compounds; Microesferas aspergidas de poli(acido latico) obtidos com compostos de calcio

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, Raquel P.; Picciani, Paulo H. de Souza; Dias, Marcos L., E-mail: raquelpires@ima.ufrj.br [Instituto de Macromoleculas - Universidade Federal do Rio de Janeiro - UFRJ, Rio de Janeiro, RJ (Brazil)

    2011-07-01

    In this work PLLA and PDLA were synthesized using calcium methoxide (Ca(OMe){sub 2}) as initiator. This compound shows good activity in the bulk polymerization of L-lactide (LLA) and D-lactide (DLA) producing polymers with average molecular weight up to 22,300 g/mol, but with microstructure containing a significant amount of estereoerros, as revealed by {sup 13} C NMR. Block copolymers containing blocks of L-and D-lactic acid were also prepared, using the method of sequential addition of LLA and DLA in an attempt to obtain stereo complexes. Analyses of scanning electron microscopy (SEM) revealed that the polymers obtained with catalysts of calcium produced PLA microspheres with diameters of around 5 {mu}m via electro spray technique. (author)

  13. Wybrane problemy ustalania wartościw sprawozdaniach finansowych przedsiębiorstw

    Directory of Open Access Journals (Sweden)

    Kazimierz Sawicki

    2009-12-01

    Full Text Available W artykule przedstawiono niektóre problemy pomiaru i wyceny w rachunkowości zarówno pozycji bilansu, jak i procesów gospodarczych. Opisano podstawowe modele tradycyjne i współczesne metody wyceny. Podjęto próbę oceny przydatności poszczególnych metod wyceny, zwłaszcza na podstawie wartości godziwej, dla dużych, średnich i małych jednostek. Zdaniem autora, wiarygodność informacji finansowych dla zarządu i użytkowników zewnętrznych może być wątpliwa, jeżeli w wysokim stopniu opiera się na estymacji przyszłości, która zawsze jest niepewna.

  14. Anti-tumour activity of Ruta graveolens extract.

    Science.gov (United States)

    Preethi, K C; Kuttan, Girija; Kuttan, Ramadasan

    2006-01-01

    An extract of Ruta graveolens was found to be cytotoxic to Dalton's lymphoma ascites (DLA), Ehrlich ascites carcinoma (EAC) and L929 cells in culture (IC100=16 mg/ml) and also to increase the lifespan of tumour bearing animals. The extract further decreased solid tumours developing from DLA and EAC cells when given simultaneously with elongation of the lifespan of tumour-bearing animals. A homeopathic preparation of Ruta graveolens (200 c) was equally effective. Neither was effective for reducing already developed tumours. The Ruta graveolens extract was found to scavenge hydroxyl radicals and inhibit lipid peroxidation at low concentrations. However, at higher concentrations the extract acted as a prooxidant as inhibition of lipid peroxidation and scavenging of hydroxyl radical was minimal. These data indicates that the prooxidant activity of Ruta graveolens may be responsible for the cytocidal action of the extract and its ability to produce tumour reduction.

  15. Fractal Aggregation Under Rotation

    Institute of Scientific and Technical Information of China (English)

    WU Feng-Min; WU Li-Li; LU Hang-Jun; LI Qiao-Wen; YE Gao-Xiang

    2004-01-01

    By means of the Monte Carlo simulation, a fractal growth model is introduced to describe diffusion-limited aggregation (DLA) under rotation. Patterns which are different from the classical DLA model are observed and the fractal dimension of such clusters is calculated. It is found that the pattern of the clusters and their fractal dimension depend strongly on the rotation velocity of the diffusing particle. Our results indicate the transition from fractal to non-fractal behavior of growing cluster with increasing rotation velocity, i.e. for small enough angular velocity ω the fractal dimension decreases with increasing ω, but then, with increasing rotation velocity, the fractal dimension increases and the cluster becomes compact and tends to non-fractal.

  16. Fractal Aggregation Under Rotation

    Institute of Scientific and Technical Information of China (English)

    WUFeng-Min; WULi-Li; LUHang-Jun; LIQiao-Wen; YEGao-Xiang

    2004-01-01

    By means of the Monte Carlo simulation, a fractal growth model is introduced to describe diffusion-limited aggregation (DLA) under rotation. Patterns which are different from the classical DLA model are observed and the fractal dimension of such clusters is calculated. It is found that the pattern of the clusters and their fractal dimension depend strongly on the rotation velocity of the diffusing particle. Our results indicate the transition from fractal to non-fractal behavior of growing cluster with increasing rotation velocity, i.e. for small enough angular velocity ω; thefractal dimension decreases with increasing ω;, but then, with increasing rotation velocity, the fractal dimension increases and the cluster becomes compact and tends to non-fractal.

  17. Estimation of direct laser acceleration in laser wakefield accelerators using particle-in-cell simulations

    CERN Document Server

    Shaw, J L; Marsh, K A; Tsung, F S; Mori, W B; Joshi, C

    2015-01-01

    Many current laser wakefield acceleration (LWFA) experiments are carried out in a regime where the laser pulse length is on the order of or longer than the wake wavelength and where ionization injection is employed to inject electrons into the wake. In these experiments, the trapped electrons will co-propagate with the longitudinal wakefield and the transverse laser field. In this scenario, the electrons can gain a significant amount of energy from both the direct laser acceleration (DLA) mechanism as well as the usual LWFA mechanism. Particle-in-cell (PIC) codes are frequently used to discern the relative contribution of these two mechanisms. However, if the longitudinal resolution used in the PIC simulations is inadequate, it can produce numerical heating that can overestimate the transverse motion, which is important in determining the energy gain due to DLA. We have therefore carried out a systematic study of this LWFA regime by varying the longitudinal resolution of PIC simulations from the standard, bes...

  18. Morphological Changes in Growth Phenomena of Bacterial Colony Patterns

    Science.gov (United States)

    Ohgiwari, Masahiro; Matsushita, Mitsugu; Matsuyama, Tohey

    1992-03-01

    We have investigated the morphological change in colonies of bacteria called Bacillus subtilis. Patterns of colonies grown on the surface of thin agar plates were found to change drastically through the variation of environmental conditions; concentrations of nutrient Cn and agar Ca in the agar medium. They were classified into five types; DLA-like, Eden-like, DBM-like, intermediate and homogeneously spreading. The active movement of individual bacterial cells was seen in expanding periphery of a colony at intermediate and low Ca (soft agar medium). Such bacterial cell movements are found to induce the shift from DLA- and Eden-like patterns to those found for softer agar medium. Physical implication of the pattern changes is discussed.

  19. Impact of diffusion limited aggregates of impurities on nematic ordering

    Science.gov (United States)

    Harkai, S.; Ambrožič, M.; Kralj, S.

    2017-02-01

    We study the impact of random bond-type disorder on two-dimensional (2D) orientational ordering of nematic liquid crystal (LC) configurations. The lattice Lebwohl-Lasher pseudospin model is used to model orientational ordering perturbed by frozen-in rod-like impurities of concentration p exhibiting the isotropic orientational probability distribution. The impurities are either (i) randomly spatially distributed or (ii) form diffusion limited aggregation (DLA)-type patterns characterized by the fractal dimensions df, where we consider cases df ∼ 1.7 and df ∼ 1.9. The degree of orientational ordering is quantified in terms of the orientational pair correlation function G(r) . Simulations reveal that the DLA pattern imposed disorder has a significantly weaker impact for a given concentration of impurities. Furthermore, if samples are quenched from the isotropic LC phase, then the fractal dimension is relatively strongly imprinted on quantitative characteristics of G(r) .

  20. Directly imaging damped Ly-alpha galaxies at z>2. II: Imaging and spectroscopic observations of 32 quasar fields

    CERN Document Server

    Fumagalli, Michele; Prochaska, J Xavier; Kanekar, Nissim; Wolfe, Arthur M

    2014-01-01

    Damped Ly-alpha absorbers (DLAs) are a well-studied class of absorption line systems, and yet the properties of their host galaxies remain largely unknown. To investigate the origin of these systems, we have conducted an imaging survey of 32 quasar fields with intervening DLAs between z~1.9-3.8, leveraging a technique that allows us to image galaxies at any small angular separation from the background quasars. In this paper, we present the properties of the targeted DLA sample, new imaging observations of the quasar fields, and the analysis of new and archival spectra of the background quasars. In a companion paper we use these data to obtain an unbiased census of the DLA host galaxy population(s) and to directly measure the in-situ star formation rates of gas-rich galaxies at z>2.

  1. The spin temperature of high-redshift damped Lyman-$\\alpha$ systems

    CERN Document Server

    Kanekar, N; Smette, A; Ellison, S L; Ryan-Weber, E V; Momjian, E; Briggs, F H; Lane, W M; Chengalur, J N; Delafosse, T; Grave, J; Jacobsen, D; de Bruyn, A G

    2013-01-01

    We report results from a programme aimed at investigating the temperature of neutral gas in high-redshift damped Lyman-$\\alpha$ absorbers (DLAs). This involved (1) HI 21cm absorption studies of a large DLA sample, (2) VLBI studies to measure the low-frequency quasar core fractions, and (3) optical/ultraviolet spectroscopy to determine DLA metallicities and velocity widths. Including literature data, our sample consists of 37 DLAs with estimates of the spin temperature $T_s$ and the covering factor. We find a strong $4\\sigma$) difference between the $T_s$ distributions in high-z (z>2.4) and low-z (z1 sub-sample. Since z>1 DLAs have angular diameter distances comparable to or larger than those of the background quasars, they have similar efficiency in covering the quasars. Low covering factors in high-z DLAs thus cannot account for the observed redshift evolution in spin temperatures. (Abstract abridged.)

  2. Renormalization group for viscous fingering with chemical dissolution

    Science.gov (United States)

    Nagatani, Takashi; Lee, Jysoo; Stanley, H. Eugene

    1991-02-01

    We study the evolution of patterns formed by injecting a reactive fluid with viscosity μ into a two-dimensional porous medium filled with a nonreactive fluid of unit viscosity. We treat the ``mass-transfer limit,'' in which the time scale of the chemical reaction between the injected fluid and the porous media is much faster than the time scale of reactant transport. We formulate a three-parameter position-space renormalization group and find two crossovers: (1) from the first diffusion-limited-aggregation (DLA) to the Eden point-due to finite viscosity, and (2) from the Eden to the second DLA point-due to chemical dissolution. We also calculate the crossover exponent and the crossover radius.

  3. Crossover and thermodynamic representation in the extended η model for fractal growth

    Science.gov (United States)

    Nagatani, Takashi; Stanley, H. Eugene

    1990-10-01

    The η model for the dielectric breakdown is extended to the case where double power laws apply. It is shown that a crossover phenomenon between the diffusion-limited aggregation (DLA) fractal and the η fractal occurs in the extended η model. Through the use of the dimensional analysis, a dimensionless parameter is found to govern the crossover. It is shown that when η1 the inverse crossover from the η fractal to the DLA fractal appears. It is also shown that the crossover radius is controlled by changing the applied field. The global flow diagram in the two-parameter space is obtained by using a two-parameter position-space renormalization-group approach. The crossover exponent and the crossover radius are calculated. The crossover phenomenon is described in terms of a thermodynamic representation of the two-phase equilibrium.

  4. Lipophilic prodrugs of apomorphine I: Preparation, characterisation, and in vitro enzymatic hydrolysis in biorelevant media

    DEFF Research Database (Denmark)

    Borkar, Nrupa Nitin; Li, Boyang; Holm, René;

    2015-01-01

    in biorelevant media before and after incorporating them into self-emulsifying drug delivery systems (SEDDS) for oral delivery. Two apomorphine diester prodrugs were synthesised: dilauroyl apomorphine (DLA) and dipalmitoyl apomorphine (DPA). The in vitro enzymatic hydrolysis of diesters was performed using...... biorelevant media with pancreatin to catalyse the diester degradation. The synthesised and purified diesters were found to be free from reactants as impurities confirmed by LC/MS and NMR. DLA and DPA were degraded into corresponding monoesters and free apomorphine within 5 min after adding pancreatin, leaving...... about 4% and 28% of the intact diester, respectively. The incorporation of the diesters into SEDDS reduced the enzymatic degradation of diesters. In addition, the chain length of diester and the type of oil used in formulations affected diester hydrolysis. The lipophilic apomorphine diesters were...

  5. Moving mesh cosmology: properties of neutral hydrogen in absorption

    CERN Document Server

    Bird, Simeon; Sijacki, Debora; Zaldarriaga, Matias; Springel, Volker; Hernquist, Lars

    2012-01-01

    We examine the distribution of neutral hydrogen in cosmological simulations carried out with the new moving-mesh code AREPO and compare it with the corresponding GADGET simulations based on the smoothed particle hydrodynamics (SPH) technique. The two codes use identical gravity solvers and baryonic physics implementations, but very different methods for solving the Euler equations, allowing us to assess how numerical effects associated with the hydro-solver impact the results of simulations. Here we focus on an analysis of the neutral gas, as detected in quasar absorption lines. We find that the high column density regime probed by Damped Lyman-alpha (DLA) and Lyman Limit Systems (LLS) exhibits significant differences between the codes. GADGET produces spurious artefacts in large halos in the form of gaseous clumps, boosting the LLS cross-section. Furthermore, it forms halos with denser central baryonic cores than AREPO, which leads to a substantially greater DLA cross-section from smaller halos. AREPO thus p...

  6. Learned dictionaries for sparse image representation: properties and results

    Science.gov (United States)

    Skretting, Karl; Engan, Kjersti

    2011-09-01

    Sparse representation of images using learned dictionaries have been shown to work well for applications like image denoising, impainting, image compression, etc. In this paper dictionary properties are reviewed from a theoretical approach, and experimental results for learned dictionaries are presented. The main dictionary properties are the upper and lower frame (dictionary) bounds, and (mutual) coherence properties based on the angle between dictionary atoms. Both l0 sparsity and l1 sparsity are considered by using a matching pursuit method, order recursive matching Pursuit (ORMP), and a basis pursuit method, i.e. LARS or Lasso. For dictionary learning the following methods are considered: Iterative least squares (ILS-DLA or MOD), recursive least squares (RLS-DLA), K-SVD and online dictionary learning (ODL). Finally, it is shown how these properties relate to an image compression example.

  7. From meso-Lactide to Isotactic Polylactide: Epimerization by B/N Lewis Pairs and Kinetic Resolution by Organic Catalysts.

    Science.gov (United States)

    Zhu, Jian-Bo; Chen, Eugene Y-X

    2015-10-07

    B/N Lewis pairs have been discovered to catalyze rapid epimerization of meso-lactide (LA) or LA diastereomers quantitatively into rac-LA. The obtained rac-LA is kinetically polymerized into poly(L-lactide) and optically resolved D-LA, with a high stereoselectivity k(L)/k(D) of 53 and an ee of 91% at 50.6% monomer conversion, by newly designed bifunctional chiral catalyst 4 that incorporates three key elements (β-isocupreidine core, thiourea functionality, and chiral BINAM) into a single organic molecule. The epimerization and enantioselective polymerization can be coupled into a one-pot process for transforming meso-LA directly into poly(L-lactide) and D-LA.

  8. Community Project for Accelerator Science and Simulation (ComPASS)

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, Christopher [Univ. of Texas, Austin, TX (United States); Carey, Varis [Univ. of Texas, Austin, TX (United States)

    2016-10-12

    After concluding our initial exercise (solving a simplified statistical inverse problem with unknown parameter laser intensity) of coupling Vorpal and our parallel statistical library QUESO, we shifted the application focus to DLA. Our efforts focused on developing a Gaussian process (GP) emulator within QUESO for efficient optimization of power couplers within woodpiles. The smaller simulation size (compared with LPA) allows for sufficient “training runs” to develop a reasonable GP statistical emulator for a parameter space of moderate dimension.

  9. The Silent Revolution within NATO Logistics: A Study in Afghanistan Fuel and Future Applications

    Science.gov (United States)

    2012-12-01

    have put it over again. We got no gas because, to suit Monty, the First Army must get most of it…31 Much like the war in Afghanistan, fuel supply and...closure. With the exception of unleaded gasoline (F-67), ISAFs data reveals that fuel quantities actually increased during the Pakistan blockade. Even with...effectiveness of the contracts used to provide fuel to their fielded forces. DLA Energy can provide a gallon of gas to its customers for less than any

  10. Department of Defense Operational Energy Strategy: A Content Analysis of Energy Literature from 1973-2014

    Science.gov (United States)

    2014-03-27

    Dangerous Delusions of “Energy Independence”, states that none of the alternative or renewable energy sources now being hyped— corn ethanol , cellulosic...of energy within the Federal government, specifically as it relates to petroleum- related products (gasoline, diesel, and JP8…), it has been directed...since FY2000 ...................................................... 20 Figure 2.6 DLA-E: Fuel Product Purchased since FY2000

  11. Object/Shape Recognition Technology: An Assessment of the Feasibility of Implementation at Defense Logistics Agency Disposition Services

    Science.gov (United States)

    2015-02-25

    IV.  ANALYSIS OF THE CURRENT PROPERTY PROCESS AT DEFENSE LOGISTICS AGENCY DISPOSITION SERVICES AND MATURITY ASSESSMENT OF OBJECT/SHAPE RECOGNITION...implement full automation with optical sorting and data mining that included sensors, laser, object/shape recognition technology on conveyor belt...the current state of object/shape recognition technology and assess the feasibility of implementing it at DLA DS. C. RESEARCH QUESTIONS, SCOPE AND

  12. A genetic assessment of the English bulldog

    OpenAIRE

    Niels C Pedersen; Pooch, Ashley S.; Liu, Hongwei

    2016-01-01

    Background This study examines genetic diversity among 102 registered English Bulldogs used for breeding based on maternal and paternal haplotypes, allele frequencies in 33 highly polymorphic short tandem repeat (STR) loci on 25 chromosomes, STR-linked dog leukocyte antigen (DLA) class I and II haplotypes, and the number and size of genome-wide runs of homozygosity (ROH) determined from high density SNP arrays. The objective was to assess whether the breed retains enough genetic diversity to ...

  13. 优秀译文选登

    Institute of Scientific and Technical Information of China (English)

    戴易

    2007-01-01

    @@ 埃米·舒尔曼 DLA Piper Rudnick Gray Cary律师事务所合伙人 做一个有强制力、有条理的人,同时要知人善任. 许多成功女性之所以能够成功,就是因为她们极有强制力、格外有条理而且扎实肯干.

  14. FAR 13.5 Acquisition Streamlining: Observations and Recommendations for the Defense Logistics Agency

    Science.gov (United States)

    2011-04-01

    revenues of nearly $41 billion that would put DLA in the top 60 of the Fortune 500 list, ahead of companies like American Express, DuPont and Coca ... Cola . • Employs about 27,000 civilian and military employees. • Supports nearly 1,900 weapon systems. • Manages eight supply chains and nearly 5...contracts, it would promote cost control and eliminate the need for future contract actions. Although DLA’s Bidboard System has multiple ways for vendors to

  15. Acquisition: Contract With Reliant Energy Solutions East

    Science.gov (United States)

    2005-01-28

    misstatement of its trading volumes, revenues, and expenses. See Appendix C for a timeline of critical events including the regulatory actions, the...data, its operational capacity and scope of operations, financial information, affidavits of tax compliance, and verification of financial and other...and the Department of the Air Force had the largest financial interest in contracts with RESE, and DLA deferred the case to the Air Force on July 13

  16. Soldier-Portable Battery Supply: Foreign Dependence and Policy Options

    Science.gov (United States)

    2014-01-01

    manufacture within Asia represents too great a supply-chain risk and thus the current policy should be changed . How this Study Was conducted The RAND...private firm, the Sociedad Quimica y Minera (SQM) de Chile. Across the border in Bolivia, the Salar de Uyuni, which is the largest salt flat in the...manufactured cells, compared with the cur- rent batteries containing Asian-manufactured cells. This would require a change from the current DLA practice of

  17. Defense Inventory: Further Analysis and Enhanced Metrics Could Improve Service Supply and Depot Operations

    Science.gov (United States)

    2016-06-01

    to be used up beyond recovery or repair—and provides these items to the services when requisitioned in support of approximately 2,400 weapon...distribution functions for depot maintenance operations varies across the services . For example, the Air Force and DLA have agreed to a local recovery ...DEFENSE INVENTORY Further Analysis and Enhanced Metrics Could Improve Service Supply and Depot Operations Report

  18. Defense Logistics Agency Aviation Can Improve its Processes to Obtain Restitution From Contractors That Provide Defective Spare Parts

    Science.gov (United States)

    2016-02-23

    identify inventory items in the DoD supply system. 8 The $12.3 million represents the projected value of the defective parts that were not replaced or...the contractor incorrectly manufactured all 100 parts and the contractor agreed to replace them if returned. To properly account for all 100... value for each part. Finding DODIG-2016-052 │ 11 Process to Return Defective Parts to Contractors for Replacement Was Not Effective DLA Aviation

  19. Improvements Needed in the Defense Logistics Agencys Evaluation of Fair and Reasonable Prices for C130 Aircraft Spare Parts (Redacted)

    Science.gov (United States)

    2015-11-16

    of Defense that supports the warfighter; promotes accountability , integrity, and efficiency; advises the Secretary of Defense and Congress; and...years. The legacy C-130H was replaced with the C-130J model, which has significant advances in avionics and performance. According to the DLA...indefinite-quantity, indefinite-delivery contract is firm-fixed price with an estimated base-period value of $60.2 million. The contract’s total

  20. Total Quality Management Implementation Plan: Defense Depot, Ogden

    Science.gov (United States)

    1989-07-01

    NUMBERS Total Quality Management Implementation Plan Defense Depot Ogden 6. AUTHOR(S) 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 8. PERFORMING...PAGES TQM ( Total Quality Management ), Continuous Process Improvement, Depot Operations, Process Action Teams 16. PRICE CODE 17. SECURITY...034 A Message From The Commander On Total Quality Management i fully support the DLA aoproacii to Total Quality Management . As stated by General

  1. Total Quality Management Office for Contracting Integrity Implementation Plan

    Science.gov (United States)

    1989-07-01

    REPORT______ANDDATESCOVERED 4. TITLE AND SUBTITLE S. FUNDING NUMBERS Total Quality Management Office for Contracting Integrity Implementatiun Plan 6. AUTHOR(S) 7...01-280-5500 Standard Form 298 (Rev. 2-89) P’,croed 1:, ANSI Std 3J9-16 29d. 102 4 TOTAL QUALITY MANAGEMENT OFFICE FOR CONTRACTING INTEGRITY...IMPLEMENTATION PLAN According to the Total Quality Management (TQM) Master Plan, each PSE head, supported by Working Groups, will implement the HQ DLA Master

  2. Participation of knowledge workers at the implementation of projects in Polish enterprises

    Directory of Open Access Journals (Sweden)

    Igielski Michał

    2014-05-01

    Full Text Available Dla krajów współczesnego świata, funkcjonujących w gospodarce globalnej, coraz bardziej ulotna staje się wizja kontynuowania dotychczasowych założeń gospodarczych w oparciu o założenia związane z dotychczasowym funkcjonowaniem. Wyjściem z takiego impasu może okazać się dla wielu przedsiębiorstw wejście na drogę trwałego rozwoju poprzez tworzenie struktur organizacyjnych bardziej elastycznych na wahania rynkowe, w oparciu o wysoko wyspecjalizowany kapitał ludzki. Przedsiębiorstwa powinny dążyć zatem do gospodarki opartej na wiedzy. Hierarchiczne organizacje o wysmukłej strukturze są zastępowane przez struktury zadaniowe oparte na zespołach projektowych, co zwiększa znaczenie konkretnej grupy pracowników, którzy stają się także stopniowo pracownikami wiedzy i odgrywają co raz ważniejszą rolę w budowaniu pozycji konkurencyjnej przedsiębiorstwa. Prowadzi to także do konieczności zmiany zachowań pracodawców w stosunku do pracowników, gdyż od nich zależy coraz więcej - ich wiedza to cenny kapitał dla firmy. Trzeba zatem stworzyć im takie warunki, by mogli z jednej strony wiedzą się dzielić, a z drugiej dążyć do tworzenie nowej wiedzy użytecznej dla firmy.

  3. Bibliography of Leishmania and Leishmanial Diseases. Volume 1

    Science.gov (United States)

    1980-06-01

    G. E. &BARRIENTOS, L. P. (1948/i) Umn caso FbNARYOVA, Kh. S. (1966/i) Epidemil- atipico de leishmaniose cutgneo- ology of zoonosis cutaneous leishma...mucosa (espundia). Mem. Inst. niasis. 2. ’Distribution of convales- Oswaldo Cruz, 46(2):415-418. cents and patients with zoonosis cuta- neous...July8. 950) Arh. F, P’dla . (1968A) ObservationsJuly 8, 1950). Arch. Fr. Pedlat. on a zoonosis ; Leishmaniasls in .-- 2 j:224. British Honduras". J

  4. Other Defense Organizations and Defense Finance and Accounting Service Controls Over High-Risk Transactions Were Not Effective

    Science.gov (United States)

    2016-03-28

    either an unmatched disbursement or a negative unliquidated obligation. Unmatched disbursements are disbursements recorded in the accounting system ...ledger that reflects the available budgetary spending authority of Federal agencies. Collections and disbursements by agencies increase or decrease the...With Treasury Accounts,” March 29, 2012. 5 This amount excludes Foreign Military Sales . Introduction DODIG-2016-064 │ 3 • DLA provides consumable

  5. Suspension and Debarment: DOD Has Active Referral Processes, but Action Needed to Promote Transparency

    Science.gov (United States)

    2012-09-01

    SDO). Full-time: 2 attorneys. 3 staff support (interns, 1 dual- hatted as paralegal ) Department of the Army The Army’s suspension and debarment...determinations with other federal agencies. Full-time: 5 attorneys, 1 paralegal Defense Logistics Agency (DLA) DLA’s suspension and debarment...1 paralegal Department of the Navy (DON) The DON’s suspension and debarment program is part of the Acquisition Integrity Office within the

  6. Defense Logistics Agency Did Not Fully Implement the Business Enterprise Architecture Procure-to-Pay Business Process in the Enterprise Business System

    Science.gov (United States)

    2014-10-28

    receipt and acceptance document. The “Payment – Negative Payable ” transactions caused abnormal account balances. The DoD FMR, volume 4, chapter 9... Accounts Payable ” required an accounts payable be recorded (credit balance) when ordered goods were received and accepted. Payment of the invoice...acceptable, DLA had significant abnormal balances in general ledger account code 2110.0200 ( Accounts Payable ). Specifically, as of September 30, 2013

  7. Defense Logistics Agency Disposition Services Needs to Improve Demilitarization Program Self-Assessment Evaluations - Redacted

    Science.gov (United States)

    2016-12-20

    from reoccurring. In another example, for the March 30, 2015, self-assessment protocol “CPU [ central processing units ]/Laptops,”23 CDD Tucson personnel...the protocol required CDD personnel to review 23 Protocol ensures that CDD received only central processing units /laptops that had properly prepared...features from DoD property. 2 DLA Disposition Services operates three Centralized Demilitarization Divisions; the Tucson, Arizona, location processed

  8. Headquarters Air Force Material Command Customer Relationship Study

    Science.gov (United States)

    2006-03-01

    customers can be segmented, the basic approaches or methods are illustrated below in Figure 11. Figure 11. Basic Segmentation Approaches ( Luna ...certain business process changes by segment ( Luna , 2005). The Defense Logistics Agency (DLA), a public sector organization has also embraced...AFB OH, September 1993. Bendapudi, Neeli and Robert P. Leone . “How to Lose Your Star Performer Without Losing Customers, Too,” Harvard Business

  9. TACOM LCMC Visibility and Communication (VisCom) Overview

    Science.gov (United States)

    2012-08-13

    Statement A. Approved for public release. Report Documentation Page Form ApprovedOMB No. 0704-0188 Public reporting burden for the collection of...12 19a. NAME OF RESPONSIBLE PERSON a. REPORT unclassified b. ABSTRACT unclassified c. THIS PAGE unclassified Standard Form 298 (Rev. 8-98...Detroit Chamber SAE Business Card/Trade Show Web Portal DLA 12:26 !!IC 11-< Jct -11 26JUL12 UNCLASSIFIED Tony Mitek IBET TL, TARDEC 7

  10. Driving Innovation to Support the Warfighter: Additive Manufacturing Initiatives Within the Defense Logistics Agency

    Science.gov (United States)

    2016-12-01

    43 Defense AT&L: November-December 2016 Driving Innovation to Support the Warfighter Additive Manufacturing Initiatives Within the Defense...AM) in the commercial sector, but it is also intense for the Defense Logistics Agency (DLA), which hopes to capitalize on the promise of innovation ...to improve readiness and sup- port to the military. As it tracks AM through the Gartner Hype Cycle, which depicts phases that innovations move

  11. Ćwiczenia z narastającym oporem w usprawnianiu pacjentów z reumatoidalnym zapaleniem stawów leczonych operacyjnie

    Directory of Open Access Journals (Sweden)

    Agnieszka Prusinowska

    2010-08-01

    Full Text Available W artykule przedstawiono formę ćwiczeń czynnych oporowychwykorzystywanych do usprawniania pacjentów z rozpoznaniemreumatoidalnego zapalenia stawów po typowych zabiegach ortopedycznychw obrębie narządu ruchu. Forma ćwiczeń umożliwiausprawnianie pacjenta zarówno w warunkach klinicznych, jaki domowych. Jest atrakcyjna dla pacjenta, nie wymaga zakupu drogiegoi często skomplikowanego w obsłudze sprzętu.

  12. Defense Logistics Agency’s Warstopper Program

    Science.gov (United States)

    2007-08-15

    Support ($11.7 million), and Construction and Equipment ($3.3 million) contracts. We did not examine Warstopper funding related to contracts for...protection barrier consisting of a prefabricated, multicellular system made of a welded steel-wire mesh, heavily galvanized, with a nonwoven geotextile...chamber. DLA decided to fund the construction of an additional Nesatron chamber with the option to sell it to the contractor at fair market value at

  13. Changes Are Needed to the Army Contract with Sikorsky to Use Existing DoD Inventory and Control Costs at the Corpus Christi Army Depot

    Science.gov (United States)

    2011-11-03

    Enterprise Business System GAO Government Accountability Office IFS Industrial Finance System LMP Logistics...contingency stock for requirements outside the CCAD/Sikorsky contract. 6 The DoD EMALL is a full-service eCommerce site, which strives to be the single...Program (LMP), and DLA used the Enterprise Business System (EBS) to manage their inventories. Sikorsky’s warehouse manager, Derco Aerospace, used

  14. Industry Study, Weapons Industry, Spring 2009

    Science.gov (United States)

    2009-01-01

    Agencies Sdn. Bhd.; Malaysia Aircraft Inspection, Repair, and Overhaul Depot; Malaysia American Malaysian Chamber of Commerce; Malaysia Samsung Techwin...Defense Energy Support Center (DESC). DESC is one of four Inventory Control Points of DLA and is the DOD’s Executive Agent for all bulk petroleum...need for Service personnel to serve in positions as Item and Inventory Managers, as Buyers, as Contracting Officers, as Quality Assurance

  15. Defense Logistics Agency Could Improve Its Oversight of the Maintenance, Repair, and Operations Prime Vendor Contract for Korea (Redacted)

    Science.gov (United States)

    2012-10-19

    not adequately review and approve deli very orders with airfreight charges. DLA Troop Support C&E contract management officials stated that...Directorate personnel wi ll identify, ana lyze, and evaluate deli very orders issued after May I0, 20 J0, where the cl istribution fee exceeded the contra cl...orAS for the deli very orders. In accordance with the FAR adequate competition provisions, we verified that the contracting onicer ensured that the

  16. Loglines. January-February 2014

    Science.gov (United States)

    2014-02-01

    Document Services print plant or a DLA Disposition Services Cracked sidewalks , like this one at Letterkenney Army Depot in Chambersburg, Pa., are...bring engineers in to look at these buildings from foundation to roof to determine what needs to be replaced or repaired, like the electrical system...or all the electrical systems that may need repair. Then we can proceed to contracts to get them repaired to make sure that the buildings are kept

  17. Supply Chain: Wake Up; It is Critical to Military Success

    Science.gov (United States)

    2015-04-13

    its analysis of the DOD’s global supply chain to the operational/ strategic level. For the purposes of this research, this paper will consider two...the Logistics Metric Analysis Reporting System (LMARS); and second, the Strategic Distribution Database. DLA transmits data from these systems to...criteria generated a total composite score. Gartner’s 25 top supply chains are included at figure 3-1. 1 Apple 10 The Coca Cola Co. 19 Qualcomm

  18. Promoting Freight Carrier EDI Participation with the Defense Finance and Accounting Service - Indianapolis Center

    Science.gov (United States)

    1993-07-01

    of the Defense Logistics Agency (DLA) and three Army regional data centers known as Multifunctional Information Processing Activities (MIPAs) that...environment (now 49 mainframe computers at 22 different locations) into four regional data centers known as Multifunctional Information Processing...15.4 5 0.1 Yes (LGAQ) Freightways Yellow Freight 676 14.1 0 0 Yes System G. I. Trucking 512 10.7 0 0 Yes Danzas - Northern 485 10.1 0 0 No Air Condor

  19. 36 new, high-probability, damped Lyα absorbers at redshift 0.42 < z < 0.70

    Science.gov (United States)

    Turnshek, David A.; Monier, Eric M.; Rao, Sandhya M.; Hamilton, Timothy S.; Sardane, Gendith M.; Held, Ryan

    2015-05-01

    Quasar damped Lyα (DLA) absorption-line systems with redshifts z systems fall in the UV and are rarely found in blind UV spectroscopic surveys. Therefore, it has been difficult to compile a moderate-sized sample of UV DLAs in any narrow cosmic time interval. However, DLAs are easy to identify in low-resolution spectra because they have large absorption rest equivalent widths. We have performed an efficient strong-Mg II-selected survey for UV DLAs at redshifts z = [0.42, 0.70] using Hubble Space Telescope's low-resolution ACS-HRC-PR200L prism. This redshift interval covers ˜1.8 Gyr in cosmic time, i.e. t ≈ [7.2, 9.0] Gyr after the big bang. A total of 96 strong Mg II absorption-line systems identified in Sloan Digital Sky Survey spectra were successfully observed with the prism at the predicted UV wavelengths of Lyα absorption. We found that 35 of the 96 systems had a significant probability of being DLAs. One additional observed system could be a very high N_{H I} DLA (N_{H I} ˜ 2× 10^{22} atoms cm-2 or possibly higher), but since very high N_{H I} systems are extremely rare, it would be unusual for this system to be a DLA given the size of our sample. Here we present information on our prism sample, including our best estimates of N_{H I} and errors for the 36 systems fitted with DLA profiles. This list is valuable for future follow-up studies of low-redshift DLAs in a small redshift interval, although such work would clearly benefit from improved UV spectroscopy to more accurately determine their neutral hydrogen column densities.

  20. Effects of Phaseolus vulgaris QTL in controlling host-bacteria interactions under two levels of nitrogen fertilization

    Directory of Open Access Journals (Sweden)

    Souza Alessandra A.

    2000-01-01

    Full Text Available Molecular markers were used to estimate the effect of mineral nitrogen on the phenotypic expression of quantitative trait loci (QTL controlling the number of Rhizobium nodules (NN and resistance to Xanthomonas axonopodis pv. phaseoli in the common bean. Recombinant inbred lines derived from a BAT-93 x Jalo EEP558 cross were grown in a greenhouse in the absence or presence (5 mM NH4NO3 of nitrogen. Resistance to Xanthomonas was assessed as diseased leaf area (DLA and the number of nodules was obtained by direct counting. Analyses of variance were used to detect significant associations between 85 marker loci from 12 linkage groups (LG and quantitative traits. In the absence of nitrogen, 15 and 11 markers, distributed over 7 and 5 LG, showed a significant association with NN and DLA, respectively. The combined percentage of phenotypic variance explained by the marker-loci and QTL associations was 34% for NN and 42% for DLA. In the presence of nitrogen, there were only five significant associations for NN and eight for DLA, which explained 28 and 26% of the total phenotypic variance, respectively. The effects of some QTL were detected only at a certain level of nitrogen. The contribution of parental alleles at two NN QTL was dependent on the level of nitrogen. Four QTL were associated with both the number of Rhizobium nodules and resistance to Xanthomonas, suggesting a common genetic control of responses to bacterial infections in the common bean. Despite the dramatic environmental interactions noted with some QTL, in other cases the phenotypic effects were not affected by the amount of nitrogen. The stability of the latter QTL may be relevant when breeding cultivars adapted to variable soil fertility.

  1. Defense Supplier Base: DOD Should Leverage Ongoing Initiatives in Developing Its Program to Mitigate Risk of Counterfeit Parts

    Science.gov (United States)

    2010-03-01

    materials ranging from titanium used in aircraft engine mounts to Kevlar used in body armor plates. The following illustrates the examples of counterfeit...found that they were wired with the wrong material. Upon discovery , the parts were segregated and did not enter the supply stream. Counterfeit...took ownership of them. Body armor DLA procured non- Kevlar material that was misrepresented as Kevlar and discovered the discrepancy during testing

  2. Monitoring and analysis of technology transfer and intellectual property regimes and their use results of a study carried out on behalf of the European Commission (DG Research)

    CERN Document Server

    Van Eecke, Patrick; Bolger, P; Truyens, M

    2008-01-01

    This report presents the results of a three-year study commissioned by the European Commission (DG Research) regarding the monitoring, analysis and use of technology transfer and intellectual property regimes in the European Union. This study was organised in the context of the 6th Framework Programme for R&D, and was jointly carried out by law firms Mason Hayes+Curran (Dublin) and DLA Piper (Brussels).

  3. Consolidation Needed for Procurements of DoD H-60 Helicopter Spare Parts (REDACTED)

    Science.gov (United States)

    2016-10-12

    Secretary referred to the draft report language that stated DLA certified that DoD completed all actions related to BRAC 2005 Recommendation 176 in...consolidation occurred because the Office of the Under Secretary of Defense for Acquisition , Technology, and Logistics did not ensure that the Army, Navy...We recommend that the Under Secretary of Defense for Acquisition , Technology, and Logistics perform a cost-benefit analysis to determine whether the

  4. The Effect of Violations of the Constant Demand Assumption on the Defense Logistic Agency Requirements Model

    Science.gov (United States)

    1994-09-01

    Pipeline stock is calculated by forecasting the projected requirements due to transportation time and counting out the amount of stock needed to cover...the "lead time" delay. Time needed for the transportation of an order is referred to as the lead time. "Lead time is the amount of time between the...Defenae Logistica Agency The Defense Logistics Agency (DLA) is an agency of the Department of Defense. "The National Security Act (NSA) established

  5. Defense Logistics Agency Disposition Services Afghanistan Disposal Process Needed Improvement

    Science.gov (United States)

    2013-11-08

    quantity, demilitarization ( DEMIL ) code, and national stock number. The inspection of property decides the course for further processing. The...generating activity is expected to obtain the correct DEMIL code from the Inventory Control Point and enter that code on the Disposal Turn-In Document1... DEMIL code, supply condition code, and unit price. Figure 1. Property Staged at DLA DS Bagram Introduction DODIG-2014-007 │ 3 Disposition Guidance

  6. Integrating the Department of Defense Supply Chain

    Science.gov (United States)

    2012-01-01

    Consulting), Martha McIntyre, Stephen Rodman, Kimbra Covert, Maritza Guevara, Joel Edgeman, and Richard Davenport. At DLA Distribution, Rear Admiral...service to mainte- nance returned back to immediate issues from tactical SSAs, the spike in serviceable returns in late 2008 (graph 16) raises the...activities and directly support field customers primarily with respect to the items produced at the mainte- nance activities collocated with the FDP. When an

  7. Loglines. September - October 2010

    Science.gov (United States)

    2010-10-01

    like eBay , often have family members apply for new codes, McLaughlin said. Researchers with LMI, a government consulting group, are working with DLA...the military, getting custom metalcast parts to fix vehicles and weapon systems hasn’t always been simple. A local, small-scale metalcasting shop ...that,” he said. The Defense Casting Suppliers Data- base is an online directory of companies that have the capability and experience to produce

  8. First Destination Transportation and Packaging Initiative (FDTPI), Task Orders 0025 and 0033

    Science.gov (United States)

    2014-01-31

    FDTPI) is a transformational logistics R&D program to reduce the acquisition cost of goods purchased by DLA by 1) First Destination Transportation...FDT) converting inbound freight for new procurement goods from Free On Board (FOB) Destination (supplier purchased and controlled transportation) to FOB...program will reduce the cost of goods purchased by converting inbound freight for new procurement goods from Free On Board (FOB) Destination

  9. The Mean Metal-line Absorption Spectrum of Damped Lyα Systems in BOSS

    Science.gov (United States)

    Mas-Ribas, Lluís; Miralda-Escudé, Jordi; Pérez-Ràfols, Ignasi; Arinyo-i-Prats, Andreu; Noterdaeme, Pasquier; Petitjean, Patrick; Schneider, Donald P.; York, Donald G.; Ge, Jian

    2017-09-01

    We study the mean absorption spectrum of the Damped Lyα (DLA) population at z ˜ 2.6 by stacking normalized, rest-frame-shifted spectra of ˜27,000 DLA systems from the DR12 of the Baryon Oscillation Spectroscopic Survey (BOSS)/SDSS-III. We measure the equivalent widths of 50 individual metal absorption lines in five intervals of DLA hydrogen column density, five intervals of DLA redshift, and overall mean equivalent widths for an additional 13 absorption features from groups of strongly blended lines. The mean equivalent width of low-ionization lines increases with N H i , whereas for high-ionization lines the increase is much weaker. The mean metal line equivalent widths decrease by a factor ˜1.1-1.5 from z ˜ 2.1 to z ˜ 3.5, with small or no differences between low- and high-ionization species. We develop a theoretical model, inspired by the presence of multiple absorption components observed in high-resolution spectra, to infer mean metal column densities from the equivalent widths of partially saturated metal lines. We apply this model to 14 low-ionization species and to Al iii, S iii, Si iii, C iv, Si iv, N v, and O vi. We use an approximate derivation for separating the equivalent width contributions of several lines to blended absorption features, and infer mean equivalent widths and column densities from lines of the additional species N i, Zn ii, C ii*, Fe iii, and S iv. Several of these mean column densities of metal lines in DLAs are obtained for the first time; their values generally agree with measurements of individual DLAs from high-resolution, high signal-to-noise ratio spectra when they are available.

  10. Symbol RFID Technology to be Deployed at United States Defense Logistics Agency’s Distribution Centers Worldwide

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Symbol Technologies, Inc., The Enterprise Mobility Company, today announced that it had been selected by ODIN technologies, the leader in the physics of RFID testing, software and deployment, to support its recent contract win with the United States Defense Logistics Agency (DLA), the United States Department of Defense’s (DoD) logistics combat support agency that provides supplies and services to America’s military forces worldwide.

  11. Evaluation of New European Technologies for Future Avionics

    Science.gov (United States)

    Poupat, Jean-Luc; Chevalier, Laurent; Monchaux, David; Le Meur, Patrick

    2014-08-01

    With the support of CNES DLA as operator, and Airbus DS Space System as architect, Airbus DS Electronics in Elancourt has developed a modular platform to evaluate new technologies for future avionics.This paper presents the Avionic-X project that has initiated this development, the modular platform itself and the status on this activity performed on this evaluation platform which has allowed the use of European technologies such as ARM processing cores or TTEthernet communication bus.

  12. Modelowa analiza rynkow pracy o roznej strukturze instytucjonalnej

    OpenAIRE

    Maciej Bukowski; Piotr Lewandowski; Pawel Kowal

    2011-01-01

    Przedmiotem analiz empirycznych i teoretycznych zawartych w niniejszej pracy sa makroekonomiczne i instytucjonalne determinanty zmian na rynkach pracy panstw OECD, analizowane przez pryzmat modelu poszukiwan i dynamicznego ujêcia rynku pracy. Rozdzial 1 poswiecony zostal analizie porownawczej rynkow pracy UE-15 i USA, a takze umiejscowieniu na tym tle zjawisk charakterystycznych dla transformujacej sie gospodarki Polski. Autorzy stawiaja teze, ze przestrzen roznic w zachowaniu sie zatrudnieni...

  13. Independent Review of the Defense Logistics Agencys Roles and Missions

    Science.gov (United States)

    2014-12-01

    to as “Peak” items. In these last two categories (NextGen and Peak), DLA employs algorithms and statistical analyses designed to make the most...and local governments, and to other organizations, before being offered for sale at auction or destroyed as scrap. Disposition Services has played a...decisions (also known as emergency buys), and (2) make changes to inventory and stocking decisions being set by the algorithms in EBS. As an example

  14. Defense Organization Officials Did Not Consistently Comply With Requirements for Assessing Contractor Performance

    Science.gov (United States)

    2017-02-01

    Performance ii │ DODIG-2017-052 (Project No. D2016-D000CF-0165.000) Recommendations We recommend that Defense organization officials develop and implement...Directors, DISA and DLA, should develop and implement organization -wide procedures that identify specific timeframes and steps for CPARS officials to...that the contracting or requiring office should establish procedures to implement CPARS across the organization including developing training

  15. An Analysis of the Defense Logistics Agency’s Forward Stocking Initiatives at Albany and Barstow Distribution Depots and the Impact on Logistics Response Time

    Science.gov (United States)

    2016-12-01

    RESPONSE TIME GRADUATE RESEARCH PAPER Broderick S. Morris, Captain, USAF AFIT-ENS-MS-16-D-047 DEPARTMENT OF THE AIR FORCE AIR UNIVERSITY AIR FORCE...AT ALBANY AND BARSTOW DISTRIBUTION DEPOTS AND THE IMPACT ON LOGISTICS RESPONSE TIME GRADUATE RESEARCH PAPER Presented to the Faculty Department...the customers at Marine Corps Logistics Bases Albany and Barstow, where DLA depots are co-located with the retail mission. This research does not

  16. Increasing Competition for Spares Within AFLC (Air Force Logistics Command).

    Science.gov (United States)

    1984-05-13

    Quarterly IMSS -11*, Procurement Method/Procurement Method Suffix Codes (RCS: DLA(Q)1739-11(S)). From this report we prepared a PMC Suffix Code Distribu...suggested that data and data rights were the primary- impediments to increasing competition. This conclusion was supported by-the IMSS -11 report. Review of...which shows the cost of completing an incomplete or illegible data package by the ALC. 5.12.1 Introduction Our review of the IMSS -11 Procurement Method

  17. Computed MISTR Requirement Changes and Parts Support - Analysis of a Mismatch.

    Science.gov (United States)

    1980-06-09

    the increased requirement of any item in the sample. Fourth, the D062 transaction register used by the ALCs EOQ IMSs to control their assets will be...checked and telephone calls to the appropriate Defense Logistics Agency (DLA) IMSs will be made to see if the MISTR item requirement changes (pen or...EOQ parts shortage. Those items that reflect pen or pencil reduction in require- ment will be searched for EOQ parts surpluses through the EOQ IMSs . It

  18. Applying Best Practices to Military Commercial-Derivative Aircraft Engine Sustainment: Assessment of Using Parts Manufacturer Approval (PMA) Parts and Designated Engineering Representative (DER) Repairs

    Science.gov (United States)

    2016-01-01

    use of alter- nate part and repair sourcing would have required gathering and ana - lyzing data in several steps, shown below. In practice, we were...Parts and Repairs 47 DER repair parts lists from private-sector companies. We then ana - lyzed DLA distribution center data for quantities of NIINs...PMA Parts and DER Repairs Kendall, Frank , Under Secretary of Defense, Acquisition, Technology, and Logistics, “Better Buying Power: Guidance for

  19. Environmental Assessment KC-46A Depot Maintenance Activation, Tinker Air Force Base, Oklahoma. Volume 1

    Science.gov (United States)

    2014-03-01

    Materiel Command (AFMC), whose mission is to sustain weapons system readiness to generate airpower for America . 1.2 BACKGROUND AND DECISION HISTORY The...assigned to the AFMC, whose mission is to sustain weapons system readiness to generate airpower for America . Tinker Field was established in 1941 as a...adjacent to the BNSF Railyard and DLA Infill site (Hellgren and Bogosian 2009). Reptiles and Amphibians Forty-eight species of reptiles and amphibians

  20. Dog leucocyte antigen class II diversity and relationships among indigenous dogs of the island nations of Indonesia (Bali), Australia and New Guinea.

    Science.gov (United States)

    Runstadler, J A; Angles, J M; Pedersen, N C

    2006-11-01

    The genetic polymorphism at the dog leucocyte antigen (DLA) class II loci DQA1, DQB1 and DRB1 was studied in a large genetically diverse population of feral and wild-type dogs from the large island nations of Indonesia (Bali), Australia and New Guinea (Bali street dog, dingo and New Guinea singing dog, respectively). Sequence-based typing (SBT) of the hypervariable region of DLA-DRB1, -DQA1 and -DQB1 alleles was used to determine genetic diversity. No new DQA1 alleles were recognized among the three dog populations, but five novel DLA-DRB1 and 2 novel DLA-DQB1 allele sequences were detected. Additional unknown alleles were postulated to exist in Bali street dogs, as indicated by the large percentage of individuals (15%-33%) that had indeterminate DRB1, DQA1 and DQB1 alleles by SBT. All three groups of dogs possessed alleles that were relatively uncommon in conventional purebreds. The New Guinea singing dog and dingo shared alleles that were not present in the Bali street dogs. These findings suggested that the dingo was more closely related to indigenous dogs from New Guinea. Feral dog populations, in particular large ones such as that of Bali, show genetic diversity that existed prior to phenotypic selection for breeds originating from their respective regions. This diversity needs to be identified and maintained in the face of progressive Westernization. These populations deserve further study as potential model populations for the evolution of major histocompatibility complex alleles, for the study of canine genetic diversity, for the development of dog breeds and for studies on the comigration of ancestral human and dog populations.

  1. Hubble Space Telescope Observations of Sub-Damped Lyman-alpha Absorbers at z < 0.5, and Implications for Galaxy Chemical Evolution

    CERN Document Server

    Som, Debopam; Meiring, Joseph; York, Donald G; Péroux, Celine; Lauroesch, James T; Aller, Monique C; Khare, Pushpa

    2015-01-01

    We report observations of four sub-damped Lyman-alpha (sub-DLA) quasar absorbers at z<0.5 obtained with the Hubble Space Telescope Cosmic Origins Spectrograph. We measure the available neutrals or ions of C, N, O, Si, P, S, Ar, Mn, Fe, and/or Ni. Our data have doubled the sub-DLA metallicity samples at z<0.5 and improved constraints on sub-DLA chemical evolution. All four of our sub-DLAs are consistent with near-solar or super-solar metallicities and relatively modest ionization corrections; observations of more lines and detailed modeling will help to verify this. Combining our data with measurements from the literature, we confirm previous suggestions that the N(HI)-weighted mean metallicity of sub-DLAs exceeds that of DLAs at all redshifts studied, even after making ionization corrections for sub-DLAs. The absorber toward PHL 1598 shows significant dust depletion. The absorbers toward PHL 1226 and PKS 0439-433 show the S/P ratio consistent with solar, i.e., they lack a profound odd-even effect. The a...

  2. Antitumor and immunopotentiating activity of polysaccharide PST001 isolated from the seed kernel of Tamarindus indica: an in vivo study in mice.

    Science.gov (United States)

    Aravind, S R; Joseph, Manu M; Varghese, Sheeja; Balaram, Prabha; Sreelekha, T T

    2012-01-01

    Antitumor activity of polysaccharide PST001 isolated from the seed kernel of Tamarindus indica was evaluated using different cancer cell lines. Human cancer cell lines A549, KB, and MCF-7 and murine cancer cell lines DLA and EAC were treated with PST001 and cell growth inhibition was assessed by MTT assay. In vivo studies were carried out for toxicity, tumor reduction and immunomodulation. The respective IC(50) of PST001 in A549, KB, and DLA was at 80.72, 190.99, and 91.14 μg/mL. Significant tumor reduction was obtained in both DLA and EAC tumors on treatment with PST001 which was more prominent when PST001 was administered with CTX/5-fluorouracil. Increase in total WBC, CD4(+) T-cell population, and bone marrow cellularity suggested strong immunomodulatory activity for this compound. No significant abnormality was observed in toxicity studies. Thus the results of the present study suggest that PST001 has immunomodulatory and tumor inhibitory activities and has the potential to be developed as an anticancer agent and immunomodulator either as a sole agent or as an adjuvant to other chemotherapeutic drugs.

  3. Atomic data for Zn II - Improving Spectral Diagnostics of Chemical Evolution in High-redshift Galaxies

    CERN Document Server

    Kisielius, Romas; Ferland, Gary J; Bogdanovich, Pavel; Som, Debopam; Lykins, Matt L

    2015-01-01

    Damped Lyman-alpha (DLA) and sub-DLA absorbers in quasar spectra provide the most sensitive tools for measuring element abundances of distant galaxies. Estimation of abundances from absorption lines depends sensitively on the accuracy of the atomic data used. We have started a project to produce new atomic spectroscopic parameters for optical/UV spectral lines using state-of-the-art computer codes employing very broad configuration interaction basis. Here we report our results for Zn II, an ion used widely in studies of the interstellar medium (ISM) as well as DLA/sub-DLAs. We report new calculations of many energy levels of Zn II, and the line strengths of the resulting radiative transitions. Our calculations use the configuration interaction approach within a numerical Hartree-Fock framework. We use both non-relativistic and quasi-relativistic one-electron radial orbitals. We have incorporated the results of these atomic calculations into the plasma simulation code Cloudy, and applied them to a lab plasma a...

  4. Improved Asymmetric Cipher Based on Matrix Power Function with Provable Security

    Directory of Open Access Journals (Sweden)

    Eligijus Sakalauskas

    2017-01-01

    Full Text Available The improved version of the author’s previously declared asymmetric cipher protocol based on matrix power function (MPF is presented. Proposed modification avoids discrete logarithm attack (DLA which could be applied to the previously declared protocol. This attack allows us to transform the initial system of MPF equations to so-called matrix multivariate quadratic (MMQ system of equations, which is a system representing a subclass of multivariate quadratic (MQ systems of equations. We are making a conjecture that avoidance of DLA in protocol, presented here, should increase its security, since an attempt to solve the initial system of MPF equations would appear to be no less complex than solving the system of MMQ equations. No algorithms are known to solve such a system of equations. Security parameters and their secure values are defined. Security analysis against chosen plaintext attack (CPA and chosen ciphertext attack (CCA is presented. Measures taken to prevent DLA attack increase the security of this protocol with respect to the previously declated protocol.

  5. Teologia ekonomiczna, rządzenie i neoliberalizm. Lekcje z "Królestwa i Chwały"

    Directory of Open Access Journals (Sweden)

    German Eduardo Primera

    2015-04-01

    Full Text Available Celem artykułu jest sprawdzenie Agambenowskich badań w obszarze teologii ekonomicznej w celu podkreślenia ich znaczenia dla krytyki współczesnej polityki neoliberalnej. W pierwszej części autor przedstawia podsumowanie głównych tez zawartych w książce Królestwo i chwała. W szczególności skupia się zarówno na ujęciu oikonomii we wczesnochrześcijańskich debatach na boską trójcą, jak i jej związku z prowidencjalnym paradygmatem rządzenia. Następnie pokazuje, jak ta genealogia oikonomii może być przydatna dla politycznej analizy teraźniejszości. Stanowi to jednocześnie odpowiedź na niektóre z zarzutów postawionych Królestwu i chwale przez Alberta Toscano. W końcowej części autor podsumowuje swoje rozważania, pokazując szczególne znaczenie prac Agambena dla badań nad polityczną racjonalnością neoliberalizmu.

  6. A coronagraphic absorbing cloud reveals the narrow-line region and extended Lyman-$\\alpha$ emission of QSO J0823+0529

    CERN Document Server

    Fathivavsari, Hassan; Noterdaeme, Pasquier; Pâris, Isabelle; Finley, Hayley; López, Sebastian; Srianand, Raghunathan; Sánchez, Paula

    2015-01-01

    We report long-slit spectroscopic observations of the quasar SDSS J082303.22+052907.6 ($z_{\\rm CIV}$$\\sim$3.1875), whose Broad Line Region (BLR) is partly eclipsed by a strong damped Lyman-$\\alpha$ (DLA; log$N$(HI)=21.7) cloud. This allows us to study the Narrow Line Region (NLR) of the quasar and the Lyman-$\\alpha$ emission from the host galaxy. Using CLOUDY models that explain the presence of strong NV and PV absorption together with the detection of SiII$^*$ and OI$^{**}$ absorption in the DLA, we show that the density and the distance of the cloud to the quasar are in the ranges 180 $$ $r_0$ $>$230 pc, respectively. Sizes of the neutral($\\sim$2-9pc) and highly ionized phases ($\\sim$3-80pc) are consistent with the partial coverage of the CIV broad line region by the CIV absorption from the DLA (covering factor of $\\sim$0.85). We show that the residuals are consistent with emission from the NLR with CIV/Lyman-$\\alpha$ ratios varying from 0 to 0.29 through the profile. Remarkably, we detect extended Lyman-$\\...

  7. Monte Carlo Simulation of CO Oxidation Reaction on Fractal Surface%分形表面上CO氧化反应的蒙特卡罗模拟

    Institute of Scientific and Technical Information of China (English)

    曾健青; 张镜澄; 钟炳

    1999-01-01

    The CO oxidation reaction on DLA fractal surface has been studied in detail by Monte Carlo method.It was found that (1) when only adsorption and surface reaction were considered the O atoms and CO molecules on surface would self-organize after a reation period,which greatly decreased the touching chance among different reactant molecules and consequently decreased the reaction rate.Furthermore,O atoms tended to be adsorbed at the center or the inner area of DLA surface while CO molecules could exist only at the exterior; (2) the clusters of O atoms could be cut off by vacant active sites after the introduction of CO diffusion on surface,which would further give rise to accelerateion of the reaction rate;(3) when the reversible adsorption of CO was introduced O atoms and CO molecules could adsorb evenly on the whole DLA surface and then the reaction would be speeded up greatly,which suggested that for a good catalyst the adsorbing strength should be moderate.

  8. Mathematical Foundations of Limit Criterion for Anisotropic Materials

    Directory of Open Access Journals (Sweden)

    Ostrovvska-Maciejewska J.

    2013-12-01

    Full Text Available Artykuł przedstawia nową propozycję kryterium stanu granicznego dla anizotropowych ciał stałych wykazujących różną wytrzymałość przy rozciąganiu i ściskaniu. Propozycja ta opiera się na koncepcji energetycznie ortogonalnych rozkładów stanu naprężenia zaproponowanej przez Rychlewskiego. Pomysł wykorzystania zależnych od stanu naprężenia parametrów określających wpływ konkretnych form naprężenia na całkowitą miarę wytężenia materiału po raz pierwszy został przedstawiony przez Burzyńskiego. W pracy omówione są obydwie koncepcje. Przedstawione jest ogólne sformułowanie nowego warunku granicznego, jak również jego specyfikacja dla wybranych symetrii sprężystych. Kryterium to zostało porównane z niektórymi innymi spośród znanych kryteriów granicznych dla ciał anizotropowych. Przedstawiono ogólną metodologię pozyskiwania danych wymaganych do specyfikacji kryterium.

  9. Galaxy Group at z=0.3 Associated with the Damped Lyman Alpha System Towards Quasar Q1127-145

    CERN Document Server

    Kacprzak, G G; Churchill, C W

    2010-01-01

    We performed a spectroscopic galaxy survey, complete to $m_{F814W}\\leq20.3$ ($L_B>0.15L_B^{\\star}$ at z=0.3), within 100x100'' of the quasar Q1127-145 ($z_{em}=1.18$). The VLT/UVES quasar spectrum contains three $z_{abs}<0.33$ MgII absorption systems. We obtained eight new galaxy redshifts, adding to the four previously known, and galaxy star formation rates (SFRs) and metallicities were computed where possible. A strong MgII system [$W_r(2796)=1.8$A], which is a known damped Ly$\\alpha$ absorber (DLA), had three previously identified galaxies; we found two additional galaxies associated with this system. These five galaxies form a group with diverse properties, such as a luminosity range of $0.04\\leq L_B\\leq0.63 L_B^{\\star}$, an impact parameter range of $17\\leq D \\leq 241$ kpc and velocity dispersion of $\\sigma$=115 km/s. The DLA group galaxy redshifts span beyond the 350 km/s velocity spread of the metallic absorption lines of the DLA itself. The two brightest group galaxies have SFRs of $\\sim$few $M_{\\o...

  10. Conditions For The Development Of Polish Agriculture In The Context Of Globalization And European Integration / Uwarunkowania Rozwoju Polskiego Rolnictwa W Warunkach Globalizacji I Integracji Europejskiej

    Directory of Open Access Journals (Sweden)

    Dworak Edyta

    2015-06-01

    Full Text Available Współczesne badania nad świadczeniami (usługami ekosystemów (środowiska potwierdzają rangę i znaczenie środowiska przyrodniczego i jego zasobów dla kształtowania dobrobytu człowieka. Szczególnie mocno akcentują ochronę żywych zasobów przyrody dla zachowania bioróżnorodności, która jest niezbędna dla utrzymania podstawowych procesów ekologicznych oraz zapewnienie trwałości użytkowania tychże zasobów. W efekcie ochrona bioróżnorodności to nie tylko problem przyrodniczy, ale również problem ekonomiczny i społeczny, dobrobytu i jakości życia. Zatem różnorodność biologiczna jest niezbędnym warunkiem zapewnienia bezpieczeństwa ekologicznego zachowania ciągłości procesów przyrodniczych, warunków i jakości życia oraz potencjału gospodarczego.

  11. Necrotizing meningoencephalitis of Pug dogs associates with dog leukocyte antigen class II and resembles acute variant forms of multiple sclerosis.

    Science.gov (United States)

    Greer, K A; Wong, A K; Liu, H; Famula, T R; Pedersen, N C; Ruhe, A; Wallace, M; Neff, M W

    2010-08-01

    Necrotizing meningoencephalitis (NME) is a disorder of Pug Dogs that appears to have an immune etiology and high heritability based on population studies. The present study was undertaken to identify a genetic basis for the disease. A genome-wide association scan with single tandem repeat (STR) markers showed a single strong association near the dog leukocyte antigen (DLA) complex on CFA12. Fine resolution mapping with 27 STR markers on CFA12 further narrowed association to the region containing DLA-DRB1, -DQA1 and, -DQB1 genes. Sequencing confirmed that affected dogs were more likely to be homozygous for specific alleles at each locus and that these alleles were linked, forming a single high risk haplotype. The strong DLA class II association of NME in Pug Dogs resembles that of human multiple sclerosis (MS). Like MS, NME appears to have an autoimmune basis, involves genetic and nongenetic factors, has a relatively low incidence, is more frequent in females than males, and is associated with a vascularly orientated nonsuppurative inflammation. However, NME of Pug Dogs is more aggressive in disease course than classical human MS, appears to be relatively earlier in onset, and involves necrosis rather than demyelination as the central pathobiologic feature. Thus, Pug Dog encephalitis (PDE) shares clinical features with the less common acute variant forms of MS. Accordingly, NME of Pug Dogs may represent a naturally occurring canine model of certain idiopathic inflammatory disorders of the human central nervous system.

  12. From Exoplanets to Quasars: Detection of Potential Damped Lyman Alpha Absorbing Galaxies Using Angular Differential Imaging

    CERN Document Server

    Johnson-Groh, Mara; Ellison, Sara L

    2016-01-01

    The advantages of angular differential imaging (ADI) has been previously untested in imaging the host galaxies of damped Lyman alpha (DLA) systems. In this pilot study, we present the first application of ADI to directly imaging the host galaxy of the DLA seen towards the quasar J1431+3952. K-band imaging of the field surrounding J1431+3952 was obtained on the Gemini North telescope with the adaptive optics system and a laser guide star. We computed a sensitivity curve that demonstrates the sensitivity of our observations as a function of K-band magnitude, impact parameter and DLA angular size. For an impact parameter of 0.5" (3.4 kpc at the redshift of the absorber) our mass sensitivity is log (M_star/M_sun) ~ 9.2 and drops to ~ 9.0 at separations beyond ~ 6 kpc for the smallest size model galaxy. Three candidate galaxies are identified within 5". Stellar masses were computed from the K-band photometry yielding values of log (M_star/M_sun) ~ 9.9, 9.7 and 11.1 respectively. The likely identification of the ab...

  13. Development of a 20-MeV Dielectric-Loaded Accelerator Test Facility

    CERN Document Server

    Gold, Steven H; Gai, Wei; Hu, Yuan; Jing, Chunguang; Kinkead, Allen; Konecny, Richard; Lin, Y; Nantista, Christopher D; Power, John G; Tang, C; Tantawi, Sami G

    2006-01-01

    This paper will describe a joint project by the Naval Research Laboratory (NRL) and Argonne National Laboratory (ANL), in collaboration with the Stanford Linear Accelerator Center (SLAC), to develop a dielectric-loaded accelerator (DLA) test facility powered by the high-power 11.424-GHz magnicon that was developed by NRL and Omega-P, Inc. The magnicon can presently produce 25 MW of output power in a 250-ns pulse at 10 Hz, and efforts are in progress to increase this to 50 MW.* The facility will include a 5-MeV electron injector being developed by the Accelerator Laboratory of Tsinghua University in Beijing, China. The DLA test structures are being developed by ANL, and some have undergone testing at NRL at gradients up to ~8 MV/m.** SLAC is developing a means to combine the two magnicon output arms, and to drive an injector and accelerator with separate control of the power ratio and relative phase. The installation and testing of the first dielectric-loaded test accelerator, including injector, DLA structure...

  14. Statistical properties of damped Lyman-alpha systems from Sloan Digital Sky Survey DR12

    Science.gov (United States)

    Bird, Simeon; Garnett, Roman; Ho, Shirley

    2017-04-01

    We present new estimates for the statistical properties of damped Lyman-α absorbers (DLAs). We compute the column density distribution function at z > 2, the line density, dN/dX, and the neutral hydrogen density, ΩDLA. Our estimates are derived from the DLA catalogue of Garnett et al. (2016), which uses the Sloan Digital Sky Survey III Data Release 12 (SDSS-III DR12) quasar spectroscopic survey. This catalogue provides a probability that a given spectrum contains a DLA. It allows us to use even the noisiest data without biasing our results and thus substantially increases our sample size. We measure a non-zero column density distribution function at 95 per cent confidence for all column densities N_H I 4. We show that our results are insensitive to the signal-to-noise ratio of the spectra, but that there is a residual dependence on quasar redshift for z < 2.5, which may be due to remaining systematics in our analysis.

  15. Application of a Preisach Hysteresis Model to the Evaluation of PMN-PT Ceramics Properties

    Directory of Open Access Journals (Sweden)

    Wawrzała P.

    2013-12-01

    Full Text Available Praca przedstawia rozszerzoną, relatywnie nową, iteracyjną metodę uzyskiwania klasycznego rozkładu Preisacha z po- jedynczej, nasyconej pętli histerezy. Jako materiał do badań i analizy wybrano ceramiczny roztwór stały (1-xPb(Mg1/3Nb2/3O3-xPbTiO3 (x = 0 do 0.40. Uzyskano matry ce rozkładów Preisacha dla ceramik (l-.tPMN-.rPT w funkcji zawartości PT oraz w funkcji temperatury dla wybranego składu z obszaru morfotropowego. Ponadto, zaproponowano matematyczny model dla dystrybucji Preisacha i wyznaczono parametry rozkładu. Porównano typowe współczynniki możliwe do uzyskania bezpośrednio z pętli histerezy z współczynnikami wynikającymi z analitycznego modelu Preisacha.

  16. On the selection of damped Lyman alpha systems using MgII absorption at 2

    CERN Document Server

    Berg, T A M; Prochaska, J X; Sanchez-Ramirez, R; Lopez, S; D'Odorico, V; Becker, G; Christensen, L; Cupani, G; Denney, K; Worseck, G

    2016-01-01

    The XQ-100 survey provides optical and near infrared coverage of 36 blindly selected, intervening damped Lyman alpha systems (DLAs) at 2 < z < 4, simultaneously covering the MgII doublet at 2796A, 2803A, and the Ly-alpha transition. Using the XQ-100 DLA sample, we investigate the completeness of selecting DLA absorbers based on their MgII rest-frame equivalent width (W2796) at these redshifts. Of the 29 DLAs with clean MgII profiles, we find that six (20% of DLAs) have W2796 < 0.6A. The DLA incidence rate of W2796 < 0.6A absorbers is a factor of ~5 higher than what is seen in z~1 samples, indicating a potential evolution in the MgII properties of DLAs with redshift. All of the W2796 < 0.6A DLAs have low metallicities (-2.5 < [M/H] < -1.7), small velocity widths (v90 < 50 km/s), and tend to have relatively low N(HI). We demonstrate that the exclusion of these low W2796 DLAs results in a higher mean N(HI) which in turn leads to a ~7% increase in the cosmological gas density of HI of DLAs...

  17. Long terminal repeat sequences from virulent and attenuated equine infectious anemia virus demonstrate distinct promoter activities.

    Science.gov (United States)

    Zhou, Tao; Yuan, Xiu-Fang; Hou, Shao-Hua; Tu, Ya-Bin; Peng, Jin-Mei; Wen, Jian-Xin; Qiu, Hua-Ji; Wu, Dong-Lai; Chen, Huan-Chun; Wang, Xiao-Jun; Tong, Guang-Zhi

    2007-09-01

    In the early 1970s, the Chinese Equine Infectious Anemia Virus (EIAV) vaccine, EIAV(DLA), was developed through successive passages of a wild-type virulent virus (EIAV(L)) in donkeys in vivo and then in donkey macrophages in vitro. EIAV attenuation and cell tropism adaptation are associated with changes in both envelope and long terminal repeat (LTR). However, specific LTR changes during Chinese EIAV attenuation have not been demonstrated. In this study, we compared LTR sequences from both virulent and attenuated EIAV strains and documented the diversities of LTR sequence from in vivo and in vitro infections. We found that EIAV LTRs of virulent strains were homologous, while EIAV vaccine have variable LTRs. Interestingly, experimental inoculation of EIAV(DLA) into a horse resulted in a restriction of the LTR variation. Furthermore, LTRs from EIAV(DLA) showed higher Tat transactivated activity than LTRs from virulent strains. By using chimeric clones of wild-type LTR and vaccine LTR, the main difference of activity was mapped to the changes of R region, rather than U3 region.

  18. The Rapid Decline in Metallicity of Damped Ly-$\\alpha$ Systems at $z\\sim5$

    CERN Document Server

    Rafelski, Marc; Fumagalli, Michele; Wolfe, Arthur M; Prochaska, J Xavier

    2013-01-01

    We present evidence that the cosmological mean metallicity of neutral atomic hydrogen gas shows a sudden decrease at $z>4.7$ down to $=-2.03^{+0.09}_{-0.11}$, which is $6\\sigma$ deviant from that predicted by a linear fit to the data at lower redshifts. This measurement is made possible by the chemical abundance measurements of 8 new damped Ly-$\\alpha$ (DLA) systems at $z>4.7$ observed with the Echellette Spectrograph and Imager on the Keck II telescope, doubling the number of measurements at $z>4.7$ to 16. The sudden decrease in metallicity is possibly due to the lower ultra-violet radiation field and higher density at high redshift increasing the neutral fraction of gas inside halos, such as cold flows. This would result in a new population of presumably lower metallicity DLAs, with an increased contribution to the DLA population at higher redshifts resulting in a reduced mean metallicity. While the comoving metal mass density of DLAs, $\\rho_{\\rm metals}(z)_{\\rm DLA}$, is flat out to $z\\sim4.3$, there is ev...

  19. Unveiling the Secrets of Metallicity and Massive Star Formation Using DLAs along Gamma-ray Bursts

    CERN Document Server

    Cucchiara, A; Rafelski, M; Kocevski, D; Prochaska, J X; Cooke, R J; Becker, G D

    2014-01-01

    We present the largest, publicly available, sample of Damped Lyman-$\\alpha$ systems (DLAs) along Gamma-ray Bursts (GRB) line of sights in order to investigate the environmental properties of long GRBs in the $z=1.8-6$ redshift range. Compared with the most recent quasar DLAs sample (QSO-DLA), our analysis shows that GRB-DLAs probe a more metal enriched environment at $z\\gtrsim3$, up to $[X/H]\\sim-0.5$. In the $z=2-3$ redshift range, despite the large number of lower limits, there are hints that the two populations may be more similar (only at 90\\% significance level). Also at \\hiz, the GRB-DLA average metallicity seems to decline at a shallower rate than the QSO-DLAs: GRB-DLA hosts may be polluted with metals at least as far as $\\sim 2$kpc from the GRB explosion site, probably due to previous star-formation episodes and/or supernovae explosions. This shallow metallicity trend, extended now up to $z\\sim5$, confirms previous results that GRB hosts are star-forming and have, on average, higher metallicity than t...

  20. Ekspansja muzeów w Europie Środkowej?

    Directory of Open Access Journals (Sweden)

    Jagodzińska, Katarzyna

    2015-06-01

    Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

  1. Major histocompatibility complex class II alleles and haplotypes associated with non-suppurative meningoencephalitis in greyhounds.

    Science.gov (United States)

    Shiel, R E; Kennedy, L J; Nolan, C M; Mooney, C T; Callanan, J J

    2014-09-01

    Non-suppurative meningoencephalitis is a breed-restricted canine neuroinflammatory disorder affecting young greyhounds in Ireland. A genetic risk factor is suspected because of the development of disease in multiple siblings and an inability to identify a causative infectious agent. The aim of this study was to examine potential associations between dog leucocyte antigen (DLA) class II haplotype and the presence of the disease. DLA three locus haplotypes were determined in 31 dogs with non-suppurative meningoencephalitis and in 115 healthy control dogs using sequence-based typing (SBT) methods. All dogs were unrelated at the parental level. Two haplotypes (DRB1*01802/DQA1*00101/DQB1*00802 and DRB1*01501/DQA1*00601/DQB1*02201) were significantly (P = 0.0099 and 0.037) associated with the presence of meningoencephalitis, with odds ratios (95% confidence interval) of 5.531 (1.168-26.19) and 3.736 (1.446-9.652), respectively. These results confirm that there is an association between DLA class II haplotype and greyhound meningoencephalitis, suggesting an immunogenetic risk factor for the development of the disease. Greyhound meningoencephalitis may be a suitable model for human neuroinflammatory diseases with an immunogenetic component. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. Element Abundances in a Gas-rich Galaxy at z = 5: Clues to the Early Chemical Enrichment of Galaxies

    CERN Document Server

    Morrison, Sean; Som, Debopam; DeMarcy, Bryan; Quiret, Samuel; Peroux, Celine

    2016-01-01

    Element abundances in high-redshift quasar absorbers offer excellent probes of the chemical enrichment of distant galaxies, and can constrain models for population III and early population II stars. Recent observations indicate that the sub-damped Lyman-alpha (sub-DLA) absorbers are more metal-rich than the damped Lyman-alpha (DLA) absorbers at redshifts 0$$4.7. However, only 3 DLAs at $z$$>$4.5 and no sub-DLAs at $z$$>$3.5 have "dust-free" metallicity measurements of undepleted elements. We report the first measurement of element abundances in a sub-DLA at $z$=5.0, using Keck HIRES and ESI data. We obtain fairly robust abundances of C, O, Si, and Fe, using lines outside the Lyman-alpha forest. We find this absorber to be metal-poor, with [O/H]=$-2.02$$\\pm$0.12, which is $>$5$\\sigma$ below the level expected from an extrapolation of the trend for $z$$<$3.5 sub-DLAs. The C/O ratio is $1.7^{+0.4}_{-0.3}$ times lower than in the Sun. More strikingly, Si/O is $3.0^{+0.6}_{-0.5}$ times lower than in the Sun, wh...

  3. C IV absorption in damped and sub-damped Lyman-alpha systems: correlations with metallicity and implications for galactic winds at z~2-3

    CERN Document Server

    Fox, Andrew J; Petitjean, Patrick; Srianand, Raghunathan

    2007-01-01

    We present a study of C IV absorption in a sample of 63 damped Lyman-alpha (DLA) systems and 11 sub-DLAs in the redshift range 1.75DLA C IV and sub-DLA C IV. In 25 DLAs and 4 sub-DLAs, covering 2.5 dex in [Z/H], we directly observe C IV moving above the escape speed, where v...

  4. The First Observations of Low-Redshift Damped Lyman-{\\alpha} Systems with the Cosmic Origins Spectrograph: Chemical Abundances and Affiliated Galaxies

    CERN Document Server

    Battisti, A J; Tripp, T M; Prochaska, J X; Werk, J K; Jenkins, E B; Lehner, N; Tumlinson, J; Thom, C

    2011-01-01

    We present Cosmic Origins Spectrograph (COS) measurements of metal abundances in eight 0.083 < zabs < 0.321 damped Lyman-{\\alpha} (DLA) and sub-damped Ly{\\alpha} absorption systems serendipitously discovered in the COS-Halos survey. We find that these systems show a large range in metallicities, with -1.10 < [Z/H] < 0.31, similar to the spread found at higher redshifts. These low-redshift systems on average have subsolar metallicities, but do show a rise in metallicity over cosmic time when compared to higher-redshift systems. Utilizing our sources and those in the literature, we find the average sub-DLA metallicity is higher than the average DLA metallicity at all redshifts. Nitrogen is underabundant with respect to {\\alpha}-group elements in all but perhaps one of the absorbers. In some cases, [N/{\\alpha}] is significantly below the lowest nitrogen measurements in nearby galaxies; the nitrogen abundances are more similar to those observed in high-redshift DLAs. Systems for which depletion patter...

  5. The Evolution of Damped Lyman-alpha Absorbers: Metallicities and Star Formation Rates

    CERN Document Server

    Kulkarni, V P; Lauroesch, J T; Fall, S M; Khare, P; Woodgate, B E; Palunas, P; Meiring, J; Thatte, D G; Welty, D E; Truran, J W; Kulkarni, Varsha P.; York, Donald G.; Lauroesch, James T.; Khare, Pushpa; Woodgate, Bruce E.; Palunas, Povilas; Meiring, Joseph; Thatte, Deepashri G.; Welty, Daniel E.; Truran, James W.

    2005-01-01

    The damped Lyman-alpha (DLA) and sub-DLA quasar absorption lines provide powerful probes of the evolution of metals, gas, and stars in galaxies. One major obstacle in trying to understand the evolution of DLAs and sub-DLAs has been the small number of metallicity measurements at z < 1.5, an epoch spanning \\~70 % of the cosmic history. In recent surveys with the Hubble Space Telescope and Multiple Mirror Telescope, we have doubled the DLA Zn sample at z < 1.5. Combining our results with those at higher redshifts from the literature, we find that the global mean metallicity of DLAs does not rise to the solar value at low redshifts. These surprising results appear to contradict the near-solar mean metallicity observed for nearby (z ~ 0) galaxies and the predictions of cosmic chemical evolution models based on the global star formation history. Finally, we discuss direct constraints on the star formation rates (SFRs) in the absorber galaxies from our deep Fabry-Perot Ly-alpha imaging study and other emissio...

  6. Detection of Allelic Variation for Puroindoline Alleles in CIMMYT Germplasm Developed from Synthetic Wheat Crossing with Common Wheats%CIMMYT人工合成小麦与普通小麦杂交后代籽粒硬度puroindoline基因等位变异检测

    Institute of Scientific and Technical Information of China (English)

    陈锋; 夏先春; 王德森; MortenLillemo; 何中虎

    2006-01-01

    [目的]山羊草与硬粒小麦杂交培育的人工合成小麦已广泛应用于国内外小麦品种改良,研究人工合成小麦与普通小麦杂交后代的籽粒硬度变异类型,有助于提高育种效率.[方法]以来自CIMMYT的176份人工合成小麦与普通小麦杂交后代为材料,采用单籽粒谷物硬度测试仪、特异引物的PCR扩增和改进的SDS-PAGE凝胶电泳对其SKCS硬度及其基因型进行了研究.[结果]硬质基因型均为Pina-Dlb/Pinb-Dla类型,软质基因型有Pina-Dla/Pinb-Dla、Pina-Dlj/Pinb-Dli、Pina-Dla/Pinb-Dli和Pina-Dlc/Pinb-Dlh等4种类型.其中Pina-Dlj/Pinb-Dli是最常见的突变类型,占软质麦总数的49.1%.不同puroindoline类型的硬度比较表明,Pina-Dlb/Pinb-Dla与其它类型间差异均达1%显著水平.在软质基因型中,Pina-Dlc/Pinb-Dlh和Pina-Dla/Pinb-Dli类型硬度相对较高,与Pina-Dlj/Pinb-Dli和Pina-Dla/Pinb-Dla的籽粒硬度差异达5%显著水平.另外,Pina-Dla/pinb-Dli的千粒重和粒径也显著高于其它变异类型.[结论]本试验发现了多种普通小麦中未曾发现过的puroindoline基因型,且硬度数值间存在显著差异,为人工合成小麦在品种改良中的应用和我国从CIMMYT引种提供了依据,同时也有助于puroindoline基因的多态性研究.

  7. Dog leukocyte antigen class II-associated genetic risk testing for immune disorders of dogs: simplified approaches using Pug dog necrotizing meningoencephalitis as a model.

    Science.gov (United States)

    Pedersen, Niels; Liu, Hongwei; Millon, Lee; Greer, Kimberly

    2011-01-01

    A significantly increased risk for a number of autoimmune and infectious diseases in purebred and mixed-breed dogs has been associated with certain alleles or allele combinations of the dog leukocyte antigen (DLA) class II complex containing the DRB1, DQA1, and DQB1 genes. The exact level of risk depends on the specific disease, the alleles in question, and whether alleles exist in a homozygous or heterozygous state. The gold standard for identifying high-risk alleles and their zygosity has involved direct sequencing of the exon 2 regions of each of the 3 genes. However, sequencing and identification of specific alleles at each of the 3 loci are relatively expensive and sequencing techniques are not ideal for additional parentage or identity determination. However, it is often possible to get the same information from sequencing only 1 gene given the small number of possible alleles at each locus in purebred dogs, extensive homozygosity, and tendency for disease-causing alleles at each of the 3 loci to be strongly linked to each other into haplotypes. Therefore, genetic testing in purebred dogs with immune diseases can be often simplified by sequencing alleles at 1 rather than 3 loci. Further simplification of genetic tests for canine immune diseases can be achieved by the use of alternative genetic markers in the DLA class II region that are also strongly linked with the disease genotype. These markers consist of either simple tandem repeats or single nucleotide polymorphisms that are also in strong linkage with specific DLA class II genotypes and/or haplotypes. The current study uses necrotizing meningoencephalitis of Pug dogs as a paradigm to assess simple alternative genetic tests for disease risk. It was possible to attain identical necrotizing meningoencephalitis risk assessments to 3-locus DLA class II sequencing by sequencing only the DQB1 gene, using 3 DLA class II-linked simple tandem repeat markers, or with a small single nucleotide polymorphism array

  8. The Effectiveness of Organic Pollutants Removal in Constructed Wetland with Horizontal Sub-Surface Flow / Efektywność Usuwania Zanieczyszczeń Organicznych W Oczyszczalni Hydrofitowej

    Science.gov (United States)

    Jakubaszek, Anita; Sadecka, Zofia

    2015-03-01

    This paper presents the results of the research work related to the removal efficiency from wastewater organic pollutants and suspended solids at HSSF (horizontal subsurface flow) constructed wetland. The average effectiveness defined as loss of value COD in wastewater has reached 77%, for BOD5 - 80% and TOC - 82%. The effect of seasonal temperature changes and the period of plant vegetation and rest on the effectiveness of wastewater treatment were also analyzed. The results of the presented research showed a decrease in the efficiency of removing organic pollutants from wastewater and suspended solids in the autumn and winter. During the vegetation the object in Małyszyn has been characterized by the effectiveness of wastewater treatment at the level of 78% for COD, 82% for BOD5, and in the non-vegetation period the effectiveness has decreased up to 75% for COD and 74% for BOD5. During the plants growth the total suspension was removed in 88%, whereas during the plants rest efficiency of removing lowered to 69%. W pracy przedstawiono wyniki badań dotyczące efektywności usuwania ze ścieków zanieczyszczeń organicznych w oczyszczalni hydrofitowej. Średnia skuteczność oczyszczania wyrażona jako obniżenie wartości ChZT w ściekach była na poziomie 77%, dla BZT5 80%, a dla OWO 82%. Analizowano również wpływ sezonowych zmian temperatury oraz okresu wegetacji i spoczynku roślin na skuteczność oczyszczania ścieków. Wyniki badań wykazały obniżenie efektywności usuwania zanieczyszczeń organicznych ze ścieków wyrażonych przez ChZT i BZT5 oraz zawiesiny ogólnej w okresie jesienno-zimowym. W okresie wegetacyjnym obiekt w Małyszynie charakteryzował się efektywnością oczyszczania ścieków na poziomie: 78% dla ChZT, 82% dla BZT5, a w sezonie pozawegetacyjnym skuteczność uległa obniżeniu do 75% w przypadku ChZT oraz 74% dla BZT5. Zawiesina ogólna w okresie wegetacji trzciny usuwana była w 88%, a w okresie powegetacyjnym w 69%.

  9. Análise da demanda metabólica e ventilatória durante a execução de atividades de vida diária em indivíduos com doença pulmonar obstrutiva crônica Análisis de la demanda metabólica y ventilatoria durante la ejecución de actividades de vida diaria en individuos con enfermedad pulmonar obstructiva crónica Analysis of metabolic and ventilatory demand during the execution of daily life activities in individuals with chronic obstructive pulmonary disease

    Directory of Open Access Journals (Sweden)

    Eloisa Maria Gatti Regueiro

    2006-02-01

    Full Text Available Indivíduos com Doença Pulmonar Obstrutiva Crônica (DPOC relatam como principais sintomas a fadiga e dispnéia aos mínimos esforços envolvidos nas Atividades de Vida Diária (AVD. Baseados nesse contexto, o objetivo deste estudo foi analisar e comparar indivíduos com DPOC (VEF1Individuos con Enfermedad Pulmonar Obstructiva Crónica (EPOC relatan como principales síntomas la fatiga y disnea como resultado de los mínimos esfuerzos realizados para Actividades de Vida Diaria (AVD. Basados en este contexto, el objetivo de este estudio fue analizar y comparar individuos con DPOC - Grupo 1(G1 y individuos sanos - Grupo 2 (G2 durante la realización de cinco AVD: cambiar lámpara (L, elevar peso (P, barrer (B, escalar grada (D y caminar en cinta mecánica (C en los siguientes aspectos: reserva metabólica (RM y ventilatoria (RV, de frecuencia cardiaca (RFC, oxigenación y sensación de disnea (SD. Para el G1, hubo disminución significativa de la RM con relación al reposo (R en las 5 AVD (Friedman ANOVA; pIndividuals with Chronic Obstructive Pulmonary Disease (COPD report that fatigue and dyspnea are the main symptoms experienced as a result of efforts made during the realization of daily life activities (DLA. Based on this context, this study aimed to analyze and compare individuals with COPD (FEV1<60%, classified as Group 1 (G1 and healthy individuals, classified as Group 2 (G2, during the execution of five DLA. The chosen DLA were: changing a light bulb (L; lifting a weight (LW; sweeping (S; climbing steps (CA and walking on a treadmill (WT. The following variables were monitored during these activities: metabolic (MR and ventilatory reserve (VR; heart rate reserve (HRR; oxygenation and sensation of dyspnea (SD. For G1, there was a significant decrease in the MR compared with resting (R for each of the five DLA (Friedman ANOVA; p<0.05. For G2, differences were found for LW, S, CA and WT. Between the groups, there was a difference for WT (Mann

  10. The effect of genetic bottlenecks and inbreeding on the incidence of two major autoimmune diseases in standard poodles, sebaceous adenitis and Addison's disease.

    Science.gov (United States)

    Pedersen, Niels C; Brucker, Lynn; Tessier, Natalie Green; Liu, Hongwei; Penedo, Maria Cecilia T; Hughes, Shayne; Oberbauer, Anita; Sacks, Ben

    2015-01-01

    Sebaceous adenitis (SA) and Addison's disease (AD) increased rapidly in incidence among Standard Poodles after the mid-twentieth century. Previous attempts to identify specific genetic causes using genome wide association studies and interrogation of the dog leukocyte antigen (DLA) region have been non-productive. However, such studies led us to hypothesize that positive selection for desired phenotypic traits that arose in the mid-twentieth century led to intense inbreeding and the inadvertent amplification of AD and SA associated traits. This hypothesis was tested with genetic studies of 761 Standard, Miniature, and Miniature/Standard Poodle crosses from the USA, Canada and Europe, coupled with extensive pedigree analysis of thousands more dogs. Genome-wide diversity across the world-wide population was measured using a panel of 33 short tandem repeat (STR) loci. Allele frequency data were also used to determine the internal relatedness of individual dogs within the population as a whole. Assays based on linkage between STR genomic loci and DLA genes were used to identify class I and II haplotypes and disease associations. Genetic diversity statistics based on genomic STR markers indicated that Standard Poodles from North America and Europe were closely related and reasonably diverse across the breed. However, genetic diversity statistics, internal relatedness, principal coordinate analysis, and DLA haplotype frequencies showed a marked imbalance with 30 % of the diversity in 70 % of the dogs. Standard Poodles with SA and AD were strongly linked to this inbred population, with dogs suffering with SA being the most inbred. No single strong association was found between STR defined DLA class I or II haplotypes and SA or AD in the breed as a whole, although certain haplotypes present in a minority of the population appeared to confer moderate degrees of risk or protection against either or both diseases. Dogs possessing minor DLA class I haplotypes were half as

  11. Dielectric-Lined High-Gradient Accelerator Structure

    Energy Technology Data Exchange (ETDEWEB)

    Jay L. Hirshfield

    2012-04-24

    Rectangular particle accelerator structures with internal planar dielectric elements have been studied, with a view towards devising structures with lower surface fields for a given accelerating field, as compared with structures without dielectrics. Success with this concept is expected to allow operation at higher accelerating gradients than otherwise on account of reduced breakdown probabilities. The project involves studies of RF breakdown on amorphous dielectrics in test cavities that could enable high-gradient structures to be built for a future multi-TeV collider. The aim is to determine what the limits are for RF fields at the surfaces of selected dielectrics, and the resulting acceleration gradient that could be achieved in a working structure. The dielectric of principal interest in this study is artificial CVD diamond, on account of its advertised high breakdown field ({approx}2 GV/m for dc), low loss tangent, and high thermal conductivity. Experimental studies at mm-wavelengths on materials and structures for achieving high acceleration gradient were based on the availability of the 34.3 GHz third-harmonic magnicon amplifier developed by Omega-P, and installed at the Yale University Beam Physics Laboratory. Peak power from the magnicon was measured to be about 20 MW in 0.5 {micro}s pulses, with a gain of 54 dB. Experiments for studying RF high-field effects on CVD diamond samples failed to show any evidence after more than 10{sup 5} RF pulses of RF breakdown up to a tangential surface field strength of 153 MV/m; studies at higher fields were not possible due to a degradation in magnicon performance. A rebuild of the tube is underway at this writing. Computed performance for a dielectric-loaded rectangular accelerator structure (DLA) shows highly competitive properties, as compared with an existing all-metal structure. For example, comparisons were made of a DLA structure having two planar CVD diamond elements with a all-metal CERN structure HDS

  12. Digital teaching file. Concept, implementation, and experiences in a university setting; Digitales Lehrarchiv. Konzept, Implementation und Erfahrungen im universitaeren Umfeld

    Energy Technology Data Exchange (ETDEWEB)

    Trumm, C.; Wirth, S.; Treitl, M.; Lucke, A.; Kuettner, B.; Pander, E.; Clevert, D.-A.; Glaser, C.; Reiser, M. [Klinikum Grosshadern der Ludwig-Maximilians-Universitaet Muenchen, Institut fuer Klinische Radiologie (Germany); Dugas, M. [Ludwig-Maximilians-Universitaet Muenchen, Institut fuer Medizinische Informationsverarbeitung, Biometrie und Epidemiologie (Germany)

    2005-08-01

    mittlerweile die sog. ''Workflowintegration'' der Verbreitung radiologischer Lehrfaelle innerhalb einer Institution (Intranet) oder im World Wide Web (Internet). Ein digitales Lehrarchiv (DLA) sollte mehrere Grundfunktionen erfuellen: Import von verschiedenen digitalen Bildquellen und -formaten, Editieren von importierten Bildern, einheitliche Fallklassifizierung, Qualitaetskontrolle (Peer Review), kontrollierter Zugang von Mitarbeitern/externen Benutzern sowie eine effiziente Retrievalstrategie. Das Bildformat PNG (Portable Network Graphics) ist fuer den Einsatz in DLA durch vollen Pixelsupport, 2D-Interlacing, Gammakorrektur und verlustfreie Kompression besonders geeignet. Der ACR-Code (American College of Radiology) eignet sich aufgrund seiner hierarchischen Struktur als Klassifizierungssystem fuer DLA. In zahlreichen Publikationen werden radiologische Anwendungen von Computer-Based Training (CBT) beschrieben, von der Ergaenzung traditioneller Lernmethoden bis zur zertifizierten Fortbildung ueber das WWW. Die Attraktivitaet einer CBT-Applikation kann durch Einbindung graphischer oder interaktiver Elemente erhoeht werden, erschwert jedoch die Workflowintegration der taeglichen Falleingabe in ein DLA. Unser DLA wurde mit etablierten Internetinstrumenten erstellt und in eine heterogene PACS-/RIS-Umgebung (PACS: Picture Archiving and Communication System, RIS: Radiologisches Informationsystem) integriert. Es ermoeglicht einen einfachen Bildtransfer (DICOM{sub S}end; DICOM: Digital Imaging and Communication in Medicine) vom radiologischen Befundarbeitsplatz und im Intranet des Universitaetsklinikums einen zeit- und ortsunabhaengigen Zugriff auf die Lehrarchivapplikation ueber Standardwebbrowser. Ein DLA bildet einen kleinen, aber wichtigen Baustein einer Gesamtstrategie von ''knowledge management'' in einem radiologischen Institut. (orig.)

  13. The ESO UVES Advanced Data Products quasar sample - V. Identifying the galaxy counterpart to the sub-damped Lyα system towards Q 2239-2949

    Science.gov (United States)

    Zafar, Tayyaba; Møller, Palle; Péroux, Céline; Quiret, Samuel; Fynbo, Johan P. U.; Ledoux, Cédric; Deharveng, Jean-Michel

    2017-02-01

    Gas flows in and out of galaxies are one of the key unknowns in today's galaxy evolution studies. Because gas flows carry mass, energy, and metals, they are believed to be closely connected to the star formation history of galaxies. Most of these processes take place in the circum-galactic medium (CGM) which remains challenging to observe in emission. A powerful tool to study the CGM gas is offered by combining observations of the gas traced by absorption lines in quasar spectra with detection of the stellar component of the same absorbing-galaxy. To this end, we have targeted the zabs = 1.825 sub-damped Lyα absorber (sub-DLA) towards the zem = 2.102 quasar 2dF J 223941.8-294955 (hereafter Q 2239-2949) with the ESO VLT/X-Shooter spectrograph. Our aim is to investigate the relation between its properties in emission and in absorption. The derived metallicity of the sub-DLA with log N(H I) = 19.84 ± 0.14 cm-2 is [M/H] > -0.75. Using the Voigt profile optical depth method, we measure Δv90(Fe II) = 64 km s-1. The sub-DLA galaxy counterpart is located at an impact parameter of 2{^''.}4 ± 0{^''.}2 (20.8 ± 1.7 kpc at z = 1.825). We have detected Lyα and marginal [O II] emissions. The mean measured flux of the Lyα line is FLy α ∼ 5.7 × 10-18 erg s-1 cm-2 Å-1, corresponding to a dust uncorrected SFR of ∼0.13 M⊙ yr-1.

  14. The use of Weibull Statistics to Quantify Property Variability in Fe-3Mn-0.8C Sinter-Hardened Structurally Inhomogeneous Steels

    Directory of Open Access Journals (Sweden)

    Cias A.

    2013-12-01

    Full Text Available Aby uzyskać trzy warianty spiekanej stali Fe-3Mn-0.8C wytworzono mieszanki proszków: niskowęglowego żelazoman- ganu. grafitu oraz proszków żelaza firmy Hóganiis: gąbczastego - NC100.24 i rozpylanych - ABC 100.30 oraz ASC 100.29. Z proszków tych zostały sprasowane, przy ciśnieniu 660MPa. kształtki próbek wytrzymałościowych przeznaczonych do wykonania prób rozciągania i zginania, spieczone następnie w półhermetycznych pojemnikach, w czasie 1 godziny, w suchym azocie lub wodorze, w temperaturze 1120 lub 1250°C, po czym chłodzone z szybkością 64°C/mia Zbadano wytrzymałość na rozciąganie i zginanie otrzymanych próbek przy zastosowaniu statystyki Weibulla. W artykule zaprezentowano wyniki badań mających na celu wykorzystanie i ocenę testów zgodności dla dwu- i trzyparametrowych rozkładów Weibulla. Badania podjęto z powodu rozbieżności publikowanych krytycznych wartości testów zgodności dla dwuparametrowego rozkładu Weibulla oraz ogólnego braku testów zgodności dla trzy parametrów ego rozkładu Weibulla. w odniesieniu do własności stali wytworzonych techniką metalurgii proszków.

  15. Kontrola wewnętrzna w jednostkach realizującychzadania publiczne – przegląd zalecanych praktyk

    Directory of Open Access Journals (Sweden)

    Joanna Dyczkowska

    2009-06-01

    Full Text Available Międzynarodowa Organizacja Najwyższych Organów Kontroli (INTOSAI wydała w 2004 roku dokument zawierający wytyczne w zakresie tworzenia systemów kontroli wewnętrznej w jednostkach sektora publicznego. Wraz z raportami COSO oraz standardami opracowanymi przez Dyrekcję Generalną do spraw Budżetu Komisji Europejskiej akt ten stał się podstawą dla sporządzenia polskich standardów kontroli wewnętrznej w jednostkach realizujących zadania publiczne. Mając na uwadze dokument INTOSAI oraz inne źródła literaturowe, w niniejszym artykule przedstawiono rekomendacje dla tworzenia systemów kontroli wewnętrznej w jednostkach realizujących zadania publiczne. W jego pierwszej części opisano istotę kontroli wewnętrznej. W sposób kompleksowy uwydatniono jej cele, wskazano osoby odpowiedzialne za jej sprawowanie oraz zakres ich odpowiedzialności, zasygnalizowano też potencjalne źródła zagrożeń dla efektywności systemu kontroli wewnętrznej. W drugiej części przedstawiono poszczególne elementy systemu kontroli wewnętrznej, a więc jej środowisko, zarządzanie ryzykiem, działania kontrolne, przepływ informacji i komunikację oraz monitoring. Zaprezentowano również przykładowe zestawy pytań wspomagających audytora wewnętrznego w badaniu systemu kontroli wewnętrznej w jednostce realizującej zadania publiczne.

  16. Influence of ceria nanoparticles on chemical structure and properties of segmented polyesters

    Energy Technology Data Exchange (ETDEWEB)

    El Fray, M., E-mail: mirfray@zut.edu.pl [West Pomeranian University of Technology, Szczecin, Polymer Institute, Division of Biomaterials and Microbiological Technologies, Al. Piastów 45, 70-311 Szczecin (Poland); Strzalkowska, D. [West Pomeranian University of Technology, Szczecin, Polymer Institute, Division of Biomaterials and Microbiological Technologies, Al. Piastów 45, 70-311 Szczecin (Poland); Mandoli, C. [International Research Center for Materials Nanoarchitectonics (MANA), National Institute for Materials Science (NIMS), 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Pagliari, F.; Di Nardo, P. [Laboratory of Molecular and Cellular Cardiology, Department of Internal Medicine, University of Rome “Tor Vergata”, Rome 00133 (Italy); Traversa, E. [International Research Center for Materials Nanoarchitectonics (MANA), National Institute for Materials Science (NIMS), 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan)

    2015-08-01

    In this work, we present new nanocomposite materials derived from segmented copolyesters, comprising ethylene terephthalate (PET) segments and dimerized linoleic acid (DLA), and nanometric cerium oxide particles (CeO{sub 2}). Nanoparticles were incorporated in situ during polycondensation in various concentrations, from 0.1 up to 0.6 wt.%. It was found that preparation of nanocomposites in situ, during polycondensation, had no significant influence on changes in segmental composition as determined from {sup 1}H and {sup 13}C, as well as 2D NMR. Thermal analysis and calculated degree of crystallinity showed that increasing concentration of ceria nanoparticles lead to an increase in mass content of PET crystallites in hard segments. The XRD investigations also showed an increased intensity of characteristic signals with increasing ceria concentration. Simultaneously, the incorporation of CeO{sub 2} led to an increase in tensile strength and elongation at break, indicating a reinforcing and plasticizing effect of ceria nanoparticles. However, the modulus at 10% strain decreased with increasing amount of nanoparticles. The in vitro culture of human cardiac progenitor cells (hCPCs) on the new materials indicated a homogenous cell displacement across the samples after 5 days with no signs of cytotoxicity, indicating good biocompatibility in vitro of CeO{sub 2}-based nanocomposites and a potential for biomedical applications. - Highlights: • Successful preparation of nanocomposites containing Ce0{sub 2} in PET–DLA was carried out. • CeO{sub 2} increased crystallinity and enhanced mechanical properties of nanocomposites. • The PET–DLA nanocomposites supported adhesion and growth of hCPCs.

  17. MHC class II polymorphism is associated with a canine SLE-related disease complex.

    Science.gov (United States)

    Wilbe, Maria; Jokinen, Päivi; Hermanrud, Christina; Kennedy, Lorna J; Strandberg, Erling; Hansson-Hamlin, Helene; Lohi, Hannes; Andersson, Göran

    2009-08-01

    Nova Scotia duck tolling retrievers are predisposed to a SLE-related disease complex including immune-mediated rheumatic disease (IMRD) and steroid-responsive meningitis-arteritis (SRMA). IMRD involves symptoms that resemble those seen in systemic autoimmune rheumatic diseases, such as systemic lupus erythematosus, SLE, or SLE-related diseases, in humans. This disease complex involves persistent lameness, stiffness, mainly after resting, and palpable pain from several joints of extremities. The majority of affected dogs display antinuclear autoantibody (ANA)-reactivity. SRMA is manifested in young dogs with high fever and neck stiffness and can be treated with corticosteroids. We have investigated the possible role of MHC class II as a genetic risk factor in IMRD and SRMA etiology. We performed sequence-based typing of the DLA-DRB1, -DQA1, and -DQB1 class II loci in a total of 176 dogs including 51 IMRD (33 ANA-positive), 49 SRMA cases, and 78 healthy controls (two dogs were both IMRD- and SRMA-affected). Homozygosity for the risk haplotype DRB1*00601/DQA1*005011/DQB1*02001 increased the risk for IMRD (OR = 4.9; ANA-positive IMRD: OR = 7.2) compared with all other genotypes. There was a general heterozygote advantage, homozygotes had OR = 4.4 (ANA-positive IMRD: OR = 8.9) compared with all heterozygotes. The risk haplotype contains the five amino acid epitope RARAA, known as the shared epitope for rheumatoid arthritis. No association was observed for SRMA. We conclude that DLA class II is a highly significant genetic risk factor for ANA-positive IMRD. The results indicate narrow diversity of DLA II haplotypes and identify an IMRD-related risk haplotype, which becomes highly significant in homozygous dogs.

  18. Design pattern mining using distributed learning automata and DNA sequence alignment.

    Directory of Open Access Journals (Sweden)

    Mansour Esmaeilpour

    Full Text Available CONTEXT: Over the last decade, design patterns have been used extensively to generate reusable solutions to frequently encountered problems in software engineering and object oriented programming. A design pattern is a repeatable software design solution that provides a template for solving various instances of a general problem. OBJECTIVE: This paper describes a new method for pattern mining, isolating design patterns and relationship between them; and a related tool, DLA-DNA for all implemented pattern and all projects used for evaluation. DLA-DNA achieves acceptable precision and recall instead of other evaluated tools based on distributed learning automata (DLA and deoxyribonucleic acid (DNA sequences alignment. METHOD: The proposed method mines structural design patterns in the object oriented source code and extracts the strong and weak relationships between them, enabling analyzers and programmers to determine the dependency rate of each object, component, and other section of the code for parameter passing and modular programming. The proposed model can detect design patterns better that available other tools those are Pinot, PTIDEJ and DPJF; and the strengths of their relationships. RESULTS: The result demonstrate that whenever the source code is build standard and non-standard, based on the design patterns, then the result of the proposed method is near to DPJF and better that Pinot and PTIDEJ. The proposed model is tested on the several source codes and is compared with other related models and available tools those the results show the precision and recall of the proposed method, averagely 20% and 9.6% are more than Pinot, 27% and 31% are more than PTIDEJ and 3.3% and 2% are more than DPJF respectively. CONCLUSION: The primary idea of the proposed method is organized in two following steps: the first step, elemental design patterns are identified, while at the second step, is composed to recognize actual design patterns.

  19. Chemical abundances of the damped Lyman α systems in the XQ-100 survey

    Science.gov (United States)

    Berg, T. A. M.; Ellison, S. L.; Sánchez-Ramírez, R.; Prochaska, J. X.; Lopez, S.; D'Odorico, V.; Becker, G.; Christensen, L.; Cupani, G.; Denney, K.; Worseck, G.

    2016-12-01

    The XQ-100 survey has provided high signal-noise spectra of 100 redshift 3-4.5 quasars with the X-Shooter spectrograph. The metal abundances for 13 elements in the 41 damped Ly α systems (DLAs) identified in the XQ-100 sample are presented, and an investigation into abundances of a variety of DLA classes is conducted. The XQ-100 DLA sample contains five DLAs within 5000 km s-1 of their host quasar (proximate DLAs; PDLAs) as well as three sightlines which contain two DLAs within 10 000 km s-1 of each other along the same line of sight (multiple DLAs; MDLAs). Combined with previous observations in the literature, we demonstrate that PDLAs with log N(H I) systems with similar redshift and N(H I)], whilst higher [S/H] and [Si/H] are seen in PDLAs with log N(H I) > 21.0. These abundance discrepancies are independent of their line-of-sight velocity separation from the host quasar, and the velocity width of the metal lines (v90). Contrary to previous studies, MDLAs show no difference in [α/Fe] relative to single DLAs matched in metallicity and redshift. In addition, we present follow-up UVES data of J0034+1639, a sightline containing three DLAs, including a metal-poor DLA with [Fe/H] = -2.82 (the third lowest [Fe/H] in DLAs identified to date) at zabs = 4.25. Lastly we study the dust-corrected [Zn/Fe], emphasizing that near-IR coverage of X-Shooter provides unprecedented access to Mg II, Ca II and Ti II lines (at redshifts 3-4) to provide additional evidence for subsolar [Zn/Fe] ratio in DLAs.

  20. METALLICITY EVOLUTION OF DAMPED Ly{alpha} SYSTEMS OUT TO z {approx} 5

    Energy Technology Data Exchange (ETDEWEB)

    Rafelski, Marc [Infrared Processing and Analysis Center, Caltech, Pasadena, CA 91125 (United States); Wolfe, Arthur M.; Neeleman, Marcel; Mendez, Alexander J. [Department of Physics and Center for Astrophysics and Space Sciences, UCSD, La Jolla, CA 92093 (United States); Prochaska, J. Xavier [Department of Astronomy and Astrophysics, UCO/Lick Observatory, 1156 High Street, University of California, Santa Cruz, CA 95064 (United States)

    2012-08-20

    We present chemical abundance measurements for 47 damped Ly{alpha} (DLA) systems, 30 at z > 4, observed with the Echellette Spectrograph and Imager and the High Resolution Echelle Spectrometer on the Keck telescopes. H I column densities of the DLAs are measured with Voigt profile fits to the Ly{alpha} profiles, and we find an increased number of false DLA identifications with Sloan Digital Sky Survey at z > 4 due to the increased density of the Ly{alpha} forest. Ionic column densities are determined using the apparent optical depth method, and we combine our new metallicity measurements with 195 from previous surveys to determine the evolution of the cosmic metallicity of neutral gas. We find the metallicity of DLAs decreases with increasing redshift, improving the significance of the trend and extending it to higher redshifts, with a linear fit of -0.22 {+-} 0.03 dex per unit redshift from z = 0.09-5.06. The metallicity 'floor' of Almost-Equal-To 1/600 solar continues out to z {approx} 5, despite our sensitivity for finding DLAs with much lower metallicities. However, this floor is not statistically different from a steep tail to the distribution. We also find that the intrinsic scatter of metallicity among DLAs of {approx}0.5 dex continues out to z {approx} 5. In addition, the metallicity distribution and the {alpha}/Fe ratios of z > 2 DLAs are consistent with being drawn from the same parent population with those of halo stars. It is therefore possible that the halo stars in the Milky Way formed out of gas that commonly exhibits DLA absorption at z > 2.

  1. THE RAPID DECLINE IN METALLICITY OF DAMPED Lyα SYSTEMS AT z ∼ 5

    Energy Technology Data Exchange (ETDEWEB)

    Rafelski, Marc [Infrared Processing and Analysis Center, Caltech, Pasadena, CA 91125 (United States); Neeleman, Marcel; Wolfe, Arthur M. [Department of Physics and Center for Astrophysics and Space Sciences, University of California, San Diego, La Jolla, CA 92093 (United States); Fumagalli, Michele [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Prochaska, J. Xavier [Department of Astronomy and Astrophysics, UCO/Lick Observatory, 1156 High Street, University of California, Santa Cruz, CA 95064 (United States)

    2014-02-20

    We present evidence that the cosmological mean metallicity of neutral atomic hydrogen gas shows a sudden decrease at z > 4.7 down to 〈Z〉=−2.03{sub −0.11}{sup +0.09}, which is 6σ deviant from that predicted by a linear fit to the data at lower redshifts. This measurement is made possible by the chemical abundance measurements of eight new damped Lyα (DLA) systems at z > 4.7 observed with the Echellette Spectrograph and Imager on the Keck II Telescope, doubling the number of measurements at z > 4.7 to 16. Possible explanations for this sudden decrease in metallicity include a change in the physical processes that enrich the neutral gas within disks, or an increase of the covering factor of neutral gas outside disks due to a lower ultraviolet radiation field and higher density at high redshift. The later possibility would result in a new population of presumably lower metallicity DLAs, with an increased contribution to the DLA population at higher redshifts resulting in a reduced mean metallicity. Furthermore, we provide evidence of a possible decrease at z > 4.7 in the comoving metal mass density of DLAs, ρ{sub metals}(z){sub DLA}, which is flat out to z ∼ 4.3. Such a decrease is expected, as otherwise most of the metals from star-forming galaxies would reside in DLAs by z ∼ 6. While the metallicity is decreasing at high redshift, the contribution of DLAs to the total metal budget of the universe increases with redshift, with DLAs at z ∼ 4.3 accounting for ∼20% as many metals as produced by Lyman break galaxies.

  2. Role of phospholipids in drug-LDL bindings as studied by high-performance frontal analysis/capillary electrophoresis.

    Science.gov (United States)

    Kuroda, Yukihiro; Watanabe, Yoshinori; Shibukawa, Akimasa; Nakagawa, Terumichi

    2003-01-15

    The binding study between basic drugs ((S)-verapamil (VER) and (S)-propranolol (PRO)) and phospholipid liposomes was performed by using high-performance frontal analysis/capillary electrophoresis (HPFA/CE) in order to investigate the effect of oxidative modification of low-density lipoprotein (LDL) upon drug-binding affinity from molecule-based viewpoint. 1-Palmitoyl-2-oleoyl-phosphatidylcholine (POPC, 16:0, 18:1), 1-palmitoyl-2-linoleoyl-phosphatidylcholine (PLPC, 16:0, 18:2), dilauloyl-phosphatidylcholine (DLaPC, 12:0, 12:0), 1-palmitoyl-2-oleoyl-phosphatidyl-glycerol (POPG, 16:0, 18:1), and 1-palmitoyl-sn-glycero-3-phosphocholine (monoPPC, 16:0) were used to prepare the model liposomes. At physiological pH (pH 7.4), the model liposome prepared from POPG+POPC had negative net charges, while the total net charge of the other model liposomes (POPC liposome, PLPC liposome, DLaPC liposome, and monoPPC+POPC liposome) was zero. The drug and the model liposome mixed solutions were subjected to HPFA/CE, and the total binding affinities (nK) were calculated. The nK values of VER and PRO to POPG+POPC liposome were more than six and 10 times higher than those of other liposomes, respectively. On the other hand, the nK values of the model drugs to POPC liposome, PLPC liposome, DLaPC liposome and monoPPC+POPC liposome showed small differences less than twice. These results indicate that the electrostatic interaction plays an important effect on drug-liposome binding, and suggest that the increase in the negative charge of LDL phospholipids gives more significant effect on the drug-binding affinity of the basic drugs than the acyl-chain structure.

  3. Remoción del lubricante adicionado al hierro pulvimetalúrgico, con plasma de la descarga luminiscente anormal

    Directory of Open Access Journals (Sweden)

    Pedro Vicente Rodríguez-Fonseca

    2016-01-01

    Full Text Available Se emplea el plasma de la descarga luminiscente anormal DLA en la remoción del lubricante de compactos de hierro pulvimetalúrgico en atmósfera de hidrógeno, con el fin de establecer las condiciones óptimas del ciclo térmico en la configuración catódica para mantener las propiedades ofrecidas del hierro. Para la preparación de las mezclas se utiliza un mezclador rotatorio. El material se conforma con presión uniaxial en matriz cilíndrica, calculando su densidad y porosidad. Con TGA y DSC se estudian la descomposición térmica y la eliminación del lubricante; luego, se realizan los ciclos de remoción en la DLA. Con TGA se monitorea el estado de remoción del lubricante de cada ciclo en la DLA. Se caracterizan los compactos en verde y los del proceso de remoción con microscopia óptica y SEM. Se halló una adecuada remoción en la configuración catódica a 400 °C durante 10 minutos, removiéndose la totalidad de lubricante. El ciclo propuesto conviene en aplicaciones industriales por las altas tasas de calentamiento alcanzadas con reducción del consumo de energía, así como de la necesaria en mantener la descarga, referidas a los hornos resistivos utilizados.

  4. Design Pattern Mining Using Distributed Learning Automata and DNA Sequence Alignment

    Science.gov (United States)

    Esmaeilpour, Mansour; Naderifar, Vahideh; Shukur, Zarina

    2014-01-01

    Context Over the last decade, design patterns have been used extensively to generate reusable solutions to frequently encountered problems in software engineering and object oriented programming. A design pattern is a repeatable software design solution that provides a template for solving various instances of a general problem. Objective This paper describes a new method for pattern mining, isolating design patterns and relationship between them; and a related tool, DLA-DNA for all implemented pattern and all projects used for evaluation. DLA-DNA achieves acceptable precision and recall instead of other evaluated tools based on distributed learning automata (DLA) and deoxyribonucleic acid (DNA) sequences alignment. Method The proposed method mines structural design patterns in the object oriented source code and extracts the strong and weak relationships between them, enabling analyzers and programmers to determine the dependency rate of each object, component, and other section of the code for parameter passing and modular programming. The proposed model can detect design patterns better that available other tools those are Pinot, PTIDEJ and DPJF; and the strengths of their relationships. Results The result demonstrate that whenever the source code is build standard and non-standard, based on the design patterns, then the result of the proposed method is near to DPJF and better that Pinot and PTIDEJ. The proposed model is tested on the several source codes and is compared with other related models and available tools those the results show the precision and recall of the proposed method, averagely 20% and 9.6% are more than Pinot, 27% and 31% are more than PTIDEJ and 3.3% and 2% are more than DPJF respectively. Conclusion The primary idea of the proposed method is organized in two following steps: the first step, elemental design patterns are identified, while at the second step, is composed to recognize actual design patterns. PMID:25243670

  5. The impact of chronic idiopathic urticaria on quality of life in korean patients.

    Science.gov (United States)

    Kang, Min Ju; Kim, Hei Sung; Kim, Hyung Ok; Park, Young Min

    2009-08-01

    Chronic idiopathic urticaria (CIU) is a relatively common disease, and yet not much is known about the causative factors or its pathophysiology, which makes it difficult to cure. Due to its chronic nature, many patients have significantly reduced quality of life (QOL). The purpose of this study was to assess the impact of CIU on QOL of Korean patients, and to determine whether a relationship exists between QOL and the severity of disease. One hundred sixty three patients with CIU, who first visited our out-patient clinic between August 2005 and July 2007, were asked to complete two questionnaires: one designed to assess the clinical features of their disease; the other on the influences of CIU on their daily lives. QOL was divided into six categories: mental status (MS), daily living activities (DLA), leisure activities (LA), self-perception (SP), treatment-induced restrictions (TIR), and social functions (SF). All of the QOL scores were recalibrated to a 0~100 scale, with 100 indicating the worst QOL, and 0 the best. THE AVERAGE QOL SCORES OBTAINED FROM THE QUESTIONNAIRE WERE AS FOLLOWS: SP (13.1+/-4.6), DLA (12.0+/-4.3), MS (10.3+/-3.3), SF (8.5+/-3.4), LA (6.1+/-3.0), and TIR (5.5+/-2.6). SP was the domain that was most affected; TIR the least. There were positive correlations between pairs of the six different QOL categories (pQOL. TIR was significantly affected in longer term CIU cases (pMS, DLA, SF, and SR scores did not correlate with disease duration. Disease severity was found to have a significant impact on SP, MS, SF, and LA (pQOL in Korean patients. Therefore, it is important to recognize the effects CIU can have on QOL and consider them in evaluating the response to treatment.

  6. Renovation and Modernization of Residential Structures in Gliwice Based on Survey of the Environment Built from the Years 1848-2014 / Renowacja I Modernizacja Struktury Mieszkaniowej W Gliwicach Na Podstawie Badań Ankietowych Środowiska Zbudowanego Z Lat 1848-2014

    Directory of Open Access Journals (Sweden)

    Cibis Jerzy

    2015-03-01

    Full Text Available Przedmiotem badania przeprowadzonego w latach 2013-2014 są zmiany zachodzące w substancji mieszkaniowej Gliwic w odniesieniu do dwu zasadniczych kwestii: jak przebiegała transformacja istniejących zasobów mieszkaniowych, jakim zmianom została ona poddana w czasie eksploatacji. Zakres zmian w obrębie mieszkania ilustruje wszelkie pozytywne i negatywne rozwiązania charakterystyczne dla każdego z badanych okresów. W doborze techniki badawczej zdecydowano się na formę badania ankietowego. Dane ilościowe zebrane podczas badań ankietowych są podstawą do budowania wniosków i tez z pogrupowanych i opracowanych cech charakterystycznych dla badanych zbiorów. Wyniki badań pozwalają wskazać prawidłowości dotyczące zakresu dokonywanych zmian w poszczególnych okresach i - pośrednio - dają przesłanki do oceny środowiska zbudowanego pod kątem spełnienia oczekiwań i potrzeb mieszkańców. Analiza przedstawionych założeń zwraca również uwagę na cykle życia mieszkania, jako elementu pierwotnego ulegającego transformacji podczas adaptacji, modernizacji i przebudowy środowiska mieszkaniowego do zmieniających się w czasie potrzeb użytkowych. Zakres wprowadzonych przez nich zmian w obrębie mieszkania pozwala ocenić trafność rozwiązań funkcjonalno-przestrzennych, technicznych i technologicznych, charakterystycznych dla okresu, w którym powstały.

  7. OCZYSZCZAJĄC DRZWI PERCEPCJI. SZKIC O IDEI IMAGINACJIW ROMANTYZMIE, KONTRKULTURZEI NEW AGE

    Directory of Open Access Journals (Sweden)

    Andrzej Kasperek

    2013-12-01

    Full Text Available Główną tezą, którą przedstawiam w swoim artykule, jest twierdzenie o wyjątkowej roli idei imaginacji w rozwoju romantycznej duchowości, której kontynuację stanowi duchowość kontrkultury oraz New Age (o istnieniu związ­ków między romantyzmem i New Age pisali między innymi Hans Sebald, Paul Heelas czy Wouter Hanegraaff. Na znaczenie idei imaginacji dla romantyzmu zwracał szczególną uwagę Renę Wellek. Traktuję romantyzm jako okres, w którym dokonała się daleko idąca reinterpretacja zachodniej tradycji ezoterycznej, w tym także idei imaginacji, którą Antoine Faivre zalicza do centralnych idei zachodniej tradycji ezoterycznej. W artykule poddaję krótkiej charakterystyce romantyczne rozumienie imaginacji, głównie odwołując się do twórczości Williama Blake'a. Szczególną uwagę zwracam na znaczenie Blake'a dla kontrkultury oraz New Age. Na jego twórczość powoływali się „prorocy" kontrkultury: Aldous Huxley czy Theodore Roszak, a nazwa tak ważnego dla kontrkultury zespołu muzycznego „The Doors" zaczerpnięta została z utworu Huxleya Drzwi percepcji. Śledząc losy idei imaginacji w kontrkulturze oraz New Age, zwracam zarazem uwagę na proces banalizacji, któremu została poddana ta idea, wprowadzona w obszar popkultury.

  8. Dynamics of dimethylsulphoniopropionate and dimethylsulphide under different CO2 concentrations during a mesocosm experiment

    Directory of Open Access Journals (Sweden)

    C. LeQuéré

    2008-03-01

    Full Text Available The potential impact of seawater acidification on the concentrations of dimethylsulfide (DMS and dimethylsulfoniopropionate (DMSP, and the activity of the enzyme DMSP-lyase was investigated during a pelagic ecosystem CO2 enrichment experiment (PeECE III in spring 2005. Natural phytoplankton blooms were studied for 24 days under present, double and triple partial pressures of CO2 (pCO2; pH=8.3, 8.0, 7.8 in triplicate 25 m3 enclosures. The results indicate similar DMSP concentrations and DMSP-lyase activity (DLA patterns for all treatments. Hence, DMSP and DLA do not seem to have been affected by the CO2 treatment. In contrast, DMS concentrations showed small but statistically significant differences in the temporal development of the low versus the high CO2 treatments. The low pCO2 enclosures had higher DMS concentrations during the first 10 days, after which the levels decreased earlier and more rapidly than in the other treatments. Integrated over the whole study period, DMS concentrations were not significantly different from those of the double and triple pCO2 treatments. Pigment and flow-cytometric data indicate that phytoplanktonic populations were generally similar between the treatments, suggesting a certain resilience of the marine ecosystem under study to the induced pH changes, which is reflected in DMSP and DLA. However, there were significant differences in bacterial community structure and the abundance of one group of viruses infecting nanoeukaryotic algae. The amount of DMS accumulated per total DMSP or chlorophyll-a differed significantly between the present and future scenarios, suggesting that the pathways for DMS production or bacterial DMS consumption were affected by seawater pH. A comparison with previous work (PeECE II suggests that DMS concentrations do not respond consistently to pelagic ecosystem CO2 enrichment experiments.

  9. Structure and Mechanical Properties of AlMg4.5 And AlMg4.5Mn Wires Extruded by Kobo Method

    Directory of Open Access Journals (Sweden)

    Jaskowski M.

    2014-06-01

    Full Text Available W pracy badano wpływ liczby operacji wyciskania metodą KoBo (z identycznym sumarycznym stopniem przerobu λ = 100 na strukturę, własności mechaniczne i charakterystyki umocnieniowe drutów ze stopów AlMg4.5 i AlMg4.5Mn (AA5083. Stwierdzono, że wyciskanie jednooperacyjne prowadzi w przypadku obu stopów do formowania struktury typowej dla materia- łów zrekrystalizowanych. podczas gdy zastosowanie dwuoperacyjnego wyciskania skutkuje utworzeniem struktury włóknistej o charakterze „mieszanym”, tzn. zawierającej zarówno obszary, w których dominowały procesy intensywnego zdrowienia, jak i rekrystalizacji. W konsekwencji własności wytrzymałościowe tych ostatnich są zdecydowanie wyższe zarówno po wyciskaniu, jak i po późniejszym walcowaniu na zimno. We wszystkich przypadkach na krzywych rozciągania drutów obserwowano sko- kowe oscylacje naprężenia, charakterystyczne dla efektu Portevin - LeChatelier (P-L. W nielicznych próbach rozciągania efekt P-L poprzedzała niestateczność płynięcia plastycznego typowa dla występowania pasma LUdersa. Charakterystyki umocnienia wywołane procesem walcowania wykazywały przebieg monotonicznie rosnący.

  10. Człowiek jako aktor na scenie życia. Teorie G.H. Meada i E. Goffmana a narracyjne gry fabularne

    OpenAIRE

    Ćwiklińska-Surdyk, Dorota; Surdyk, Augustyn

    2012-01-01

    Celem niniejszego artykułu jest wykazanie, iż teoria interakcjonizmu symbolicznego George’a Herberta Meada oraz teoria perspektywy dramaturgicznej Ervinga Goffmana mogą znaleźć zastosowanie w analizie narracyjnych gier fabularnych (ang. role-playing games) poprzez wspólne dla tych teorii koncepcje przyjmowania ról społecznych w interakcjach międzyludzkich. Po zestawieniu zrębów obu teorii ze zjawiskiem narracyjnych gier fabularnych autorzy wskazują na takie cechy tych ostatnich, które mogłyby...

  11. Reklama telewizyjna adresowana do dzieci i jej wpływ na decyzje konsumenckie rodziców

    OpenAIRE

    Aranin, Arleta

    2011-01-01

    Niniejsza praca magisterska obejmuje zespół zagadnień dotyczących Kindermarketingu w szczególności reklamy telewizyjnej adresowanej do dzieci. Reklama telewizyjna potraktowana została jako specyficzny komunikat perswazyjny nastawiony na pozyskiwanie dzieci dla celów marketingowych, w szczególności w celu wywierania wpływu na decyzje zakupowe rodziców. Celem przeprowadzonych w ramach pracy badań była analiza wpływu reklam na postawy, preferencje produktowe oraz wybory konsumenckie dzieci i rod...

  12. Influence of bioremediation stimulators in soil on development of oat seedlings (Avena sativa and their aminopeptidase activity / Wpływ pozostałości substancji ropopochodnych w glebie na rozwój owsa i aktywność aminopeptydazową

    Directory of Open Access Journals (Sweden)

    Pawełczak Małgorzata

    2015-03-01

    Full Text Available Dobór technik bioremediacji jest bardzo ważny w oczyszczaniu gleby skażonej substancjami ropopochodnymi, która ma być wykorzystywanej rolniczo. Prezentowane wyniki wskazują, że na rozwój siewek owsa większy wpływ ma stosowana metoda bioremediacji niż poziom zanieczyszczenia węglowodorami. Z zastosowanych technik najbardziej przyjazne dla wegetacji owsa były te, w których wykorzystywano szczepionkę drożdżową

  13. Konkursy plastyczne forma promocji biblioteki

    Directory of Open Access Journals (Sweden)

    Folga Agnieszka

    2012-06-01

    Full Text Available Biblioteka Główna Uniwersytetu Pedagogicznego w Krakowie w celu promocji instytucji rozszerza zakres działań między innymi poprzez organizację konkursów plastycznych dla dzieci w wieku przedszkolnym, wczesnoszkolnym i szkolnym. W artykule omówiono konkursy plastyczne, które były zorganizowane w bibliotece. Przedstawiono etapy realizacji konkursu oraz ich przebieg. Dodatkowo poruszono kwestie wpływu podejmowanych działań na wizerunek biblioteki.

  14. Analysis and synthesis of distributed-lumped-active networks by digital computer

    Science.gov (United States)

    1973-01-01

    The use of digital computational techniques in the analysis and synthesis of DLA (distributed lumped active) networks is considered. This class of networks consists of three distinct types of elements, namely, distributed elements (modeled by partial differential equations), lumped elements (modeled by algebraic relations and ordinary differential equations), and active elements (modeled by algebraic relations). Such a characterization is applicable to a broad class of circuits, especially including those usually referred to as linear integrated circuits, since the fabrication techniques for such circuits readily produce elements which may be modeled as distributed, as well as the more conventional lumped and active ones.

  15. Loglines. March - April 2010

    Science.gov (United States)

    2010-04-01

    A B L I N G O P E R A T I O N A L E X C E L L E N C E 12 www.dla.mil Smart Buys Story by Beth Reece T om Rosenthal is not an impulsive shopper ...Transfer and Donation Branch. Participating schools must apply online and arrange property pickup. Military units turning in excess equip- ment can also...worth a thousand words,then Defense Logistics Agency cus-tomers should be learning volumes soon when some new commercials begin appearing online and

  16. Zakład Medycyny Sądowej w Bielsku-Białej

    Directory of Open Access Journals (Sweden)

    Jerzy Brzyski

    2014-10-01

    Full Text Available Zakład Medycyny Sądowej w Bielsku-Białej został utworzony w 1978 roku. Podstawą dla jego utworzenia i wpisania w strukturę Wojewódzkiego Szpitala Zespolonego były wytyczne Ministra Zdrowia i Opieki Społecznej z dnia 15.06.1978 roku w sprawie organizacji i zadań komórek medycyny sądowej (Dz.U. MZiOS Nr 11, poz 28.

  17. DoD Electronic Data Interchange (EDI) Convention: ASC X12 Transaction Set 860 Purchase Order Change (Version 003010)

    Science.gov (United States)

    1993-01-01

    Logistics Management Institute REPORT NUMBER 6400 Goldsboro Road LMI-DL203LN21 Bethesda, MD 20817-5886 9. SPONSORING/ MONITORING AGENCY NAME(S) AND...ADDRESS(ES) 10. SPONSORING/ MONITORING DoD Executive Agent for EC/EDI/PLUS AGENCY REPORT NUMBER Defense Logistics Agency DLA-ZIE, Cameron Station Alexandria...POC05 must be present. 2. If POC07 is present, then POC06 is required. 3. If POC08 is present, then POC09 is required. 4. If POC1 0 is present, then POCI

  18. Naval Aviation Costs: Targeting Operations and Support

    Science.gov (United States)

    2013-12-01

    17 Defense AT&L: November–December 2013 Naval Aviation Costs Targeting Operations and Support Capt. Robert Farmer n Capt. Keith Nixon n Capt...ONR Maj. Gen. Murray, TECOM Brig. Gen. Jansson, DLA Aviation SES Gilpin , DASN (Air) SES Stiller, DASN (Ships) SES Zangardi, DASN (C4I) *NAE Air... Robert Brown Training/Training Supt 6.7.6 – Lorie Nace Support Equipment 6.7.7 – Bruce Wilhelm Industrial Business Ops 6.8D – Roy Harris Tech Dir

  19. A Search For Organic Molecules in Intermediate Redshift DLAs

    CERN Document Server

    Lawton, B; Ellison, S L; Churchill, C W; Johnson, R A; Snow, T P; Lawton, Brandon; York, Brian; Ellison, Sara L.; Churchill, Christopher W.; Johnson, Rachel A.; Snow, Theodore P.

    2005-01-01

    There has been a renewed interest in searching for diffuse interstellar bands (DIBs) due to their probable connection to organic molecules and, thus, their possible link to life in the Universe. Our group is undertaking an extensive search for DIBs in DLAs via QSO absorption-line systems. Six of our DLA targets are presented here. Our equivalent width (EW) limits for the 5780 DIB line strongly suggests that DIB abundance is below the Milky Way expected value or that metallicity plays a large role in DIB strengths.

  20. Apomorphine and its esters

    DEFF Research Database (Denmark)

    Borkar, Nrupa; Chen, Zhizhong; Saaby, Lasse

    2016-01-01

    Oral delivery of apomorphine via prodrug principle may be a potential treatment for Parkinson's disease. The purpose of this study was to investigate the transport and stability of apomorphine and its esters across Caco-2 cell monolayer and their affinity towards chylomicrons. Apomorphine...... cells. Molecular dynamics (MD) simulations were performed to understand the stability of the esters on a molecular level. The affinity of the compounds towards plasma derived chylomicrons was assessed. The A-B transport of intact DLA was about 150 times lower than the transport of apomorphine...

  1. Dyskurs edukacyjny w nauczaniu języka angielskiego dzieci przedszkolnych: studium etnograficzne

    OpenAIRE

    2011-01-01

    Wydział Neofilologii: Instytut Filologii Angielskiej Rozprawa doktorska dotyczy dyskursu edukacyjnego w nauczaniu języka angielskiego dzieci w wieku przedszkolnym i składa się z sześciu rozdziałów. Trzy pierwsze rozdziały mają charakter teoretyczny, dwa kolejne stanowią część empiryczną pracy. Ostatni rozdział zawiera wnioski z przeprowadzonych przez autorkę rozprawy badań oraz implikacje dla dydaktyki języka obcego na poziomie przedszkolnym oraz wczesnoszkolnym. W części teoretycznej pra...

  2. Intercultural Teaching of Music at School as a Form of Dialogue and Meeting of Youth from Neighbouring Countries: Poland, Germany and Ukraine

    OpenAIRE

    Chaciński, Jarosław

    2012-01-01

    W niniejszym artykule, autor omawia najważniejsze założenia własnego programu dydaktyczno – wychowawczego „Czterech kultur muzycznych” (polskiej, niemieckiej, ukraińskiej i żydowskiej), który został skonstruowany dla młodzieży w wieku gimnazjalnym w Polsce, Niemczech i na Ukrainie jako cykl lekcji muzyki. Program ten stanowi próbę adaptacji dwóch ważnych orientacji europejskiej edukacji muzycznej. Pierwszą z nich jest edukacja oparta na kanonie kultury narodowej, druga zaś opiera się na ...

  3. Hiszpański Gombrowicza. Ricardo Piglia, „Pisarz jako czytelnik”, tł. E. Kobyłecka-Piwońska

    OpenAIRE

    Kobyłecka-Piwońska, Ewa; Piglia, Ricardo

    2015-01-01

    Niniejszy fragment jest drugą i ostatnią częścią eseju Ricarda Piglii „Pisarz jako czytelnik”. Autor kontynuuje rozważania na temat odczytu „Przeciw poetom” Gom-browicza oraz jego konsekwencji dla definiowania literackości. Piglia ustanawia również analogie pomiędzy obiegiem poezji a obiegiem pieniądza. This is the second and final part of Ricardo Piglia’s essay, “Writer as Reader”. The author continues his reflections on Gombrowicz’s essay “Przeciw poetom” (“Against Poets”) and its implic...

  4. Mathematical Model and Simulator of Rotor With Vibrating Blades Model / Matematyczny I Symulator Stopnia Wirnikowego Z Drgającymi Łopatkami

    Directory of Open Access Journals (Sweden)

    Wachłaczenko Michał

    2014-12-01

    Full Text Available Tematem publikacji jest opis modelu matematycznego ułopatkowanej tarczy stopnia wirującego silnika odrzutowego. Poprawnie stworzony model matematyczny wirnika pozwala na stworzenie modelu symulacyjnego, który może posłużyć do generowania danych tip-timing. Przede wszystkim jest on potrzebny do badania odpowiedzi łopatek wieńca wirnikowego na wymuszenie w postaci zmian prędkości obrotowej silnika. Pozwala to na określenie warunków pracy silnika odrzutowego, dla których mogło by nastąpić jego uszkodzenie

  5. Europe Report, Science and Technology, FRG Government Proposal for 1987 Research Budget Examined

    Science.gov (United States)

    2007-11-02

    DEBTKBUYION STATEMENT A Approv«d fat public ««is«»«* DlaMbaikMii Unlimltad ^PEGIED s 19980128 032 FBIS FOREIGN BROADCAST INFORMATION SERVICE REPRODUCED...as biotechnology and information technology, or in which present research problems require governmental support, such as in research on forest damage...Promotion of economy-] ’l’Hütj’ij’W" witHi’iü*’.i.Ji]jj!j!i related tecnology J ’ IT 2&3 lins«* direct to: 1982: 394 percent, l;r ’’^."l

  6. Phase transition of the microvascular network architecture in human pathologies.

    Science.gov (United States)

    Bianciardi, Giorgio; Traversi, Claudio; Cattaneo, Ruggero; De Felice, Claudia; Monaco, Annalisa; Tosi, Gianmarco; Parrini, Stefano; Latini, Giuseppe

    2012-01-01

    We have investigated the microvascular pattern in acquired or genetic diseases in humans. The lower gingival and vestibular oral mucosa, as well as the optic nerve head, was chosen to characterize the vascular pattern complexity due to the simple accessibility and visibility Local fractal dimensions, fractal dimension of the minimum path and Lempel-Ziv complexity have been used as operational numerical tools to characterize the microvascular networks. In the normal healthy subjects microvascular networks show nonlinear values corresponding to the complexity of a diffusion limited aggregation (DLA) model, while in several acquired or genetic diseases they are approaching the ones of an invasion percolation model.

  7. Use of Defense Logistics Agency Excess Parts for High Mobility Multipurpose Wheeled Vehicle Depot Repairs Will Reduce Costs

    Science.gov (United States)

    2013-04-25

    76,437 25.61 28 251 6,428 167 4,277 2530011856714 PISTON, DISC BRAKE 2,343 20,910 7.75 130 1,466 11,362 1,076 8,339 2530014732724 CYLINDER...reviewed the HMMWV recapitalization performance-based agreement, the business case analysis , the ILP acquisition plan, contract SP0750-06-D-9711, and...inventory balances from the DLA Office of Operations Research and Resource Analysis for HMMWV repair parts on the ILP contract; a list of repair

  8. Hiszpański Gombrowicza. Ricardo Piglia, „Pisarz jako czytelnik”, tł. E. Kobyłecka-Piwońska

    OpenAIRE

    Kobyłecka-Piwońska, Ewa; Piglia, Ricardo

    2015-01-01

    Niniejszy fragment jest drugą i ostatnią częścią eseju Ricarda Piglii „Pisarz jako czytelnik”. Autor kontynuuje rozważania na temat odczytu „Przeciw poetom” Gom-browicza oraz jego konsekwencji dla definiowania literackości. Piglia ustanawia również analogie pomiędzy obiegiem poezji a obiegiem pieniądza. This is the second and final part of Ricardo Piglia’s essay, “Writer as Reader”. The author continues his reflections on Gombrowicz’s essay “Przeciw poetom” (“Against Poets”) and its implic...

  9. Antioxidant properties of selected culinary spices / Antyoksydacyjne właściwości wybranych przypraw

    Directory of Open Access Journals (Sweden)

    Słowianek Marta

    2016-03-01

    Full Text Available Wstęp: Przyprawy dodawane do żywności wzbogacają jej walory smakowe i zapachowe, niektóre z nich mogą także wydłużać jej czas przechowywania dzięki obecności związków o aktywności przeciwutleniającej. Cel: Celem pracy było zbadanie 28 przypraw dostępnych na rynku pod kątem całkowitej zawartości polifenoli i aktywności przeciwutleniającej. Metody: Do oceny całkowitej zawartości związków fenolowych zastosowano metodę Folina- Ciocalteau. Aktywność antyoksydacyjną ekstraktów oznaczono metodą z użyciem rodnika DPPH. Wyniki: Otrzymane wyniki wykazują, że większość analizowanych przypraw jest bogata w związki fenolowe i posiada wysoką aktywność antyoksydacyjną. Całkowita zawartość polifenoli w przyprawach oscylowała od 0,9 do 155,1 mg GAE/g z najniższą wartością odnotowaną dla sezamu i najwyższą dla cynamonu. Zdolność do wygaszania rodnika DPPH wyrażona w procentach była zróżnicowana i wahała się w zakresie od 4,1% dla sezamu do 94,9% dla goździków. Odnotowano umiarkowaną korelację (r=0,63, p<0,05 pomiędzy aktywnością antyoksydacyjną i zawartością polifenoli ogółem, co dowodzi, że związki fenolowe są ważnymi, antyoksydacyjnymi składnikami w badanych przyprawach. Wnioski: Prowadzone badania wykazują, że wiele przypraw może służyć jako naturalne konserwanty żywności i jednocześnie ma korzystny wpływ na nasze zdrowie.

  10. Hygiene Condition of Water Use and Sanitation Facilities at Urban Slums: Analysis of Port City Chittagong, Bangladesh / Wyposażenie Sanitarne W Slamsach Miejskich - Analiza Na Podstawie Miasta Portowego Chittagong, Bangladesh

    Directory of Open Access Journals (Sweden)

    Muhit I. B.

    2015-03-01

    Full Text Available Obszary takie jak rozwój gospodarczy, bariery społeczne, standard życia i zdrowie, ściśle związane są ze stanem wyposażenia sanitarnego. W artykule dokonano analizy warunków sanitarnych związanych z zaopatrzeniem w wodę i odprowadzeniem ścieków dla społeczności o niskich dochodach w obszarze Chittagong City Corporation. Dane zostały zebrane podczas ankietowych badań terenowych, rozmów z mieszkańcami, z bazy Chittagong City Corporation, Power Development Board i WASA.

  11. Implications of AM for the Navy Supply Chain

    Science.gov (United States)

    2016-12-01

    Performance-Based Logis- tics ( PBL ) efforts in which the government pays a vendor to maintain a level of readiness, not for individual procurement or...Customer ERP NAVSUP WSS & DLA PoM O-Site Post Process Vendor Key Info Item Cash 63 Defense AT&L: November-December 2016 provisions for PBLs , but...contract based on a pre-determined amount of parts. Plus, that is very difficult to do outside of a cost type— PBL construct. At the end of each fiscal

  12. Characteristic of Carbon Nanotubes Modified with Cobalt, Copper and Bromine

    Directory of Open Access Journals (Sweden)

    Zygoń P.

    2014-06-01

    Full Text Available W pracy przedstawiono wyniki badań nanorurek węglowych w stanie surowym, po oczyszczeniu jak również po modyfikacji. Zostały przyłączone grupy funkcyjne oraz nanocząstki metali, pochodzące od siarczanu kobaltu, octanu miedzi i mieszaniny bromowodoru z bromem. Dla takich nanorurek przeprowadzono badania powierzchni na mikroskopie sił atomowych (AFM, badania rentgenograficzne (analiza składu fazowego, określenie wielkości krystalitów oraz badania spektroskopowe Raniana.

  13. Vademecum organizatora turystyki niepełnosprawnych

    OpenAIRE

    2007-01-01

    Publikacja jest wynikiem realizacji w latach 2006-07 projektu pt. „Opracowanie i wprowadzenie nowych metod szkoleniowych w sektorze turystycznym – Turystyka dla wszystkich przy udziale specjalistów przeszkolonych w diadach” w ramach programu Leonardo da Vinci. W przedsięwzięciu wzięło udział 12 podmiotów (instytucji pozarządowych, stowarzyszeń, ośrodków badawczych, uczelni) z 8 krajów europejskich (Belgii, Grecji, Hiszpanii, Niemiec, Polski, Rumunii, Szwecji i Włoch). Głównym celem projektu b...

  14. Complex trace element effects of source mixing-fractional crystallization composite processes in Kalaan granodiorite pluton along Wulungu tectonic belt,northern Xinjiang

    Institute of Scientific and Technical Information of China (English)

    刘伟; A.Masuda

    1995-01-01

    Mixing-fractional crystallization composite processes generate 6 complex patterns,which aresynthesized into 3 models,on C21/C31-C11/C31 ratio correlation plots of trace eleroents E1,E2,E3 according totheir relative incompatibility.Three of the six effects are clearly displayed on ratio-ratio correlation plots oftrace elements in the Kalaan granodiorite pluton,indicative of a source mixing-fractional crystallization compositeprocess.The overlying lithospheric mantle was modified by the subduction of oceanic plate during Palaeozoic.The incompatibility order of the 7 concerned trace elements is DTaDLa

  15. Loglines. March - April 2011

    Science.gov (United States)

    2011-04-01

    ett y O ffi ce r 3 rd C las s S co tt Pi ttm an A Sailor pours fuel purchased by Defense Logistics Agency Energy into the gas tank of an aircraft...agency’s culture and look for areas that can be improved, Lippert-Jensen said. DLA uses the Denison Culture Model , which measures four traits of culture...to make those goals and visions happen,” he said. DLA’s overall average score for the culture traits has steadily risen since the Denison model was

  16. Complete Sequence of Proviral DNA of Equine Infectious Anemia Virus Strain L

    Institute of Scientific and Technical Information of China (English)

    LIU Hong-quan; WANG Liu; YANG Zhi-biao; KONG Xian-gang; TONG Guang-Zhi

    2002-01-01

    Equine infectious anemia virus strain L (EIAV-L) is the parental virulent virus of equine infectious anemia donkey leukocyte attenuated vaccine (DLA EIAV ). In this study, peripheral blood leukocytes(PBL) were collected from a horse infected with EIAV-L. The PBL DNAs were extracted. The EIAV-L proviral DNA was amplified in four parts covering the entire proviral genomic sequence by polymerase chain reaction (PCR). Each of the four parts was cloned into the plasmid pBluescript SK, and the recombinant plasmids were designated as p2.8, p2.4, p3.1, and p1.2 respectively. After identification with restriction digestion, the inserts within the four plasmids were sequenced. The complete nucleotide sequence of EIAV-L provirus was determined by analyzing each of the four parts and connecting them as a whole. The genome of EIAV-L is 8235 bp in length, and G + C content is 38%. The comparison analysis by the computer software DNASIS showed that the sequence of EIAV-L shares 98.4% and 96.9% identities with that of D-A EIAV and DLA EIAV respectively. The high homology between these strains showed that they were genetically related.The homology between EIAV-L and D-A EIAV is higher than that between EIAV-L and DLA EIAV, and this is consistent with the derivation progress of DLA EIAV. At both ends of EIAV-L provirus, there is an identical long terminal repeat (LTR) sequence of 316bp in length. The LTR consists of U3, R, and U5 regions. The genome of EIAV-L provirus has three long open reading frames(ORF) corresponding to gag, pol and env genes respectively. The gag gene is 1200bp and located at position 613-1912nt. The pol gene is 3402bp and located at position 1708-5109nt. There is a termination codon within the env dividing it into two parts,env1 of 699bp (position 5305-6003nt)and env2 of 1827bp (position 6073-7899nt). The provirus has three additional small ORFs: S1, S2 and S3 with sizes of 153bp (position 5113-5265nt), 204bp (position 5279-5482nt) and 402bp ( position 7245

  17. PROPOSAL OF THE IMPLEMENTATION OF THE QFD METHOD TO IMPROVE THE WELDING PROCESS IN THE CHOSEN, REALLY EXISTING COMPANY X

    OpenAIRE

    2012-01-01

    W publikacji przedstawiono analizę i ocenę wybranych aspektów funkcjonowania przedsiębiorstwa X, dokonano selekcji możliwej do zastosowania metody projakościowej oraz przeprowadzono tę metodę krok po kroku dla obserwacji jej przebiegu i sprawdzenia, czy przyniesie wymierne korzyści firmie. The paper presents an analysis and evaluation of selected aspects of the enterprise X, there is shown the selection of the method of pro-quality, which is possible to apply and this method was carried ou...

  18. Issues Regarding Information Safety in Digital Network of Railway Radio Communications / Zagadnienia Bezpieczeństwa Informacyjnego w Sieci Cyfrowej Radiołączności Kolejowej

    Directory of Open Access Journals (Sweden)

    Siergiejczyk Mirosław

    2015-09-01

    Full Text Available W referacie przestawiono architekturę oraz ważniejsze funkcje i usługi systemu cyfrowej telefonii komórkowej GSM-R. System GSM-R jest to system wykorzystywany dla potrzeb wspomagania zarządzania i sterowania w transporcie kolejowym. Szczególną uwagę zwrócono na wybrane problemy związane z bezpieczeństwem teleinformatycznym usług realizowanych z wykorzystaniem systemu GSM-R.

  19. Escitalopram w leczeniu zaburzeń psychicznych chorych w podeszłym wieku

    Directory of Open Access Journals (Sweden)

    Tomasz Sobów

    2015-07-01

    Full Text Available Farmakoterapia zaburzeń psychicznych u chorych w podeszłym wieku jest często trudna i ograniczona powszechniejszym niż u młodszych chorych występowaniem objawów niepożądanych, interakcji lekowych oraz koniecznością brania pod uwagę współchorobowości, nie tylko psychiatrycznej, ale przede wszystkim – somatycznej. Te aspekty, razem z wieloczynnikową patogenezą zaburzeń i znaczną w wielu badaniach odpowiedzią placebo, prowadzą do względnie niższych wskaźników efektywności klinicznej leczenia. Właściwy wybór leku, uwzględniający jego skuteczność i bezpieczeństwo, jest zatem kluczowy dla sukcesu terapii. Escitalopram to obiecujący lek dla starszych chorych. Jego znaczna selektywność farmakodynamiczna, korzystny profil farmakokinetyczny, w tym stosunkowo niewielki potencjał wchodzenia w interakcje lekowe, oraz dość rzadkie wywoływanie poważnych objawów ubocznych spowodowały – wraz z zadowalającymi wynikami badań klinicznych – częste i z korzyścią dla pacjentów stosowanie escitalopramu w zaburzeniach nastroju (także w tzw. organicznych i zaburzeniach lękowych, a ostatnio jako leku korygującego zaburzenia zachowania towarzyszące otępieniu, takie jak pobudzenie, agresja czy psychoza. Dodatkowym ważnym aspektem stosowania escitalopramu jest łatwość podawania (jedna dawka na dobę oraz dostępność postaci w kroplach, która może być szczególnie użyteczna dla chorych z problemami w połykaniu, przyjmujących wiele leków, karmionych poprzez gastrostomię czy z zaburzeniami funkcji poznawczych.

  20. The Navy Biofuel Initiative Under the Defense Production Act

    Science.gov (United States)

    2012-06-22

    the end of 2012, and “Great Green Fleet” by 2016 fueled in part with a 50/50 blend of hydrotreated renewable jet fuel (biofuel). The Navy proposes to...Osprey, and the MH-60S Seahawk to operate on HRJ-5, a 50/50 blend of hydrotreated renewable fuel (HRJ) and conventional JP-5.5 Hydrotreated refers...propellant ranged from $1.55 to $2.87 per gallon.14 In 2009, DLA awarded small contracts for hydrotreated renewable fuel (HRJ-5 jet fuel) that ranged in