WorldWideScience

Sample records for dla amerykanskiego przemyslu

  1. Efekty kształcenia dla kursu : "Wychowanie patriotyczne dla nauczycieli historii"

    OpenAIRE

    Tytko, Marek Mariusz

    2014-01-01

    1. Celem artykułu jest pokazanie projektowanych efektów kształcenia dla kursu uniwersyteckiego dotyczącego wychowania patriotycznego dla nauczycieli historii. 2. Metodologia. Autor używał historiograficznej metodą analizy, analizy logicznej oraz obserwacji uczestniczącej. 3. Główne wyniki analizy. Autor opisał podstawowe informacje na temat proponowanego kursu pt. Wychowanie patriotyczne dla nauczycieli historii. Podał kompletny zestaw celów kształcenia, którymi są: A) dostarczenie wiedzy (te...

  2. DLA Forward Stocking

    National Research Council Canada - National Science Library

    Flory, John

    2007-01-01

    .... This study evaluates the feasibility of forward stocking in terms of DoD savings. The performance of DLA's criteria is evaluated and a new criteria using a cost and demand threshold is proposed...

  3. 76 FR 22681 - Defense Logistics Agency (DLA) Address Directory

    Science.gov (United States)

    2011-04-22

    ... DEPARTMENT OF DEFENSE Office of the Secretary Defense Logistics Agency (DLA) Address Directory AGENCY: Department of Defense. ACTION: Notice. SUMMARY: The Defense Logistics Agency (DLA) is updating... Directory: Defense Logistics Agency Headquarters, Andrew T. McNamara Building, 8725 John J. Kingman Road...

  4. Additive Manufacturing: Which DLA-Managed Legacy Parts are Potential AM Candidates

    Science.gov (United States)

    2016-07-01

    R G ADDITIVE MANUFACTURING : WHICH DLA-MANAGED LEGACY PARTS ARE POTENTIAL AM CANDIDATES? REPORT DL501T1 J UL Y 2016...L Y 2 0 1 6 ADDITIVE MANUFACTURING : WHICH DLA-MANAGED LEGACY PARTS ARE POTENTIAL AM CANDIDATES? REPORT DL501T1 Thomas K . Pa rk s...DESIGNATED BY OTHER OFFICIAL DOCUMENTATION. LMI © 2016. ALL RIGHTS RESERVED. iii Additive Manufacturing : Which DLA-Managed Legacy Parts Are

  5. 32 CFR Appendix A to Part 1285 - Gaining Access to DLA Records

    Science.gov (United States)

    2010-07-01

    ... you have detailed information which would help reduce the search time involved, please include it in... item intelligence data to the Military Departments and other authorized customers. b. Defense... national emergency. f. DLA Systems Automation Center (DSAC). Develops and maintains DLA's automated and...

  6. Środowisko programowe Microstation dla celów GIS

    OpenAIRE

    Kunz, Mieczysław

    2001-01-01

    Praca przedstawia środowisko programowe MicroStation – historię jego rozwoju, strukturę oraz opisuje wybrane aplikacje dla zastosowań GIS/SIT. Na Wydziale BiNoZ UMK jest on stosowany do tworzenia map i systemów GIS dla wybranych obszarów Borów Tucholskich i Kujaw. Paper presents the MicroStation software – the history of its evolution, structure and description of the extension for GIS/SIT applications. Its applied for the map creation and GIS for selected region of Bory Tucholskie and K...

  7. Characterization of class II alpha genes and DLA-D region allelic associations in the dog.

    Science.gov (United States)

    Sarmiento, U M; Storb, R F

    1988-10-01

    Human major histocompatibility complex (HLA) cDNA probes were used to analyze the restriction fragment length polymorphism (RFLP) of the alpha genes of the DLA-D region in dogs. Genomic DNA from peripheral blood leucocytes of 23 unrelated DLA-D homozygous dogs representing nine DLA-D types (defined by mixed leucocyte reaction) was digested with restriction enzymes (BamHI, EcoRI, Hind III, Pvu II, Taq I, Rsa I, Msp I, Pst I and Bgl II), separated by agarose gel electrophoresis and transferred onto Biotrace membrane. The Southern blots were successively hybridized with radiolabelled HLA cDNA probes corresponding to DQ, DP, DZ and DR alpha genes. Clear evidence was obtained for the canine homologues of DQ and DR alpha genes with simple bi- or tri-allelic polymorphism respectively. Evidence for a single, nonpolymorphic DP alpha gene was also obtained. However, the presence of a DZ alpha gene could not be clearly demonstrated in canine genomic DNA. This report extends our previous RFLP analysis documenting polymorphism of DLA class II beta genes in the same panel of homozygous typing cell dogs, and provides the basis for DLA-D genotyping at a population level. This study also characterizes the RFLP-defined preferential allelic associations across the DLA-D region in nine different homozygous typing cell specificities.

  8. 75 FR 43944 - Membership of the Defense Logistics Agency (DLA) Senior Executive Service (SES) Performance...

    Science.gov (United States)

    2010-07-27

    ... CONTACT: Ms. Lisa Novajosky, SES Program Manager, DLA Human Resources (J-14), Defense Logistics Agency... DEPARTMENT OF DEFENSE Defense Logistics Agency Membership of the Defense Logistics Agency (DLA... management of the SES cadre. DATES: Effective Date: September 16, 2010. ADDRESSES: Defense Logistics Agency...

  9. Characterization of the Canine MHC Class I DLA-88*50101 Peptide Binding Motif as a Prerequisite for Canine T Cell Immunotherapy.

    Directory of Open Access Journals (Sweden)

    Sharon M Barth

    Full Text Available There are limitations in pre-clinical settings using mice as a basis for clinical development in humans. In cancer, similarities exist between humans and dogs; thus, the dog patient can be a link in the transition from laboratory research on mouse models to clinical trials in humans. Knowledge of the peptides presented on MHC molecules is fundamental for the development of highly specific T cell-based immunotherapies. This information is available for human MHC molecules but is absent for the canine MHC. In the present study, we characterized the binding motif of dog leukocyte antigen (DLA class I allele DLA-88*50101, using human C1R and K562 transfected cells expressing the DLA-88*50101 heavy chain. MHC class I immunoaffinity-purification revealed 3720 DLA-88*50101 derived peptides, which enabled the determination of major anchor positions. The characterized binding motif of DLA-88*50101 was similar to HLA-A*02:01. Peptide binding analyses on HLA-A*02:01 and DLA-88*50101 via flow cytometry showed weak binding of DLA-88*50101 derived peptides to HLA-A*02:01, and vice versa. Our results present for the first time a detailed peptide binding motif of the canine MHC class I allelic product DLA-88*50101. These data support the goal of establishing dogs as a suitable animal model for the evaluation and development of T cell-based cancer immunotherapies, benefiting both dog and human patients.

  10. Durability Evolution of RC Bridge under Coupling Action of Chloride Corrosion and Carbonization Based on DLA Model

    Directory of Open Access Journals (Sweden)

    Haoxiang He

    2015-01-01

    Full Text Available Chloride attack and carbonization are the main factors which affect the durability of concrete structures, and the respective theoretical models are systematically established. However, the quantitative analysis and models about the coupling effect of chloride attack and carbonization are less, so the precision and level of durability analysis of reinforced concrete are restricted. Diffusion-limited aggregation (DLA model can finely simulate the process of gas diffusion and condensation with randomness and fractal characteristics, which is suitable for revealing the durability evolution process of the chloride attack, carbonization, and the coupling action in concrete. Based on the principle of DLA, considering the factors such as diffusion depth, concrete properties, and exposure conditions which influence the characteristics of chloride diffusion and carbonization, as well as the coupling effect, an integrated DLA model is established. The concentration of carbon dioxide and chloride at any time and any location can be obtained and dynamically displayed based on the DLA model. The performance predict method for concrete and steel bars considering fatigue effect is presented based on DLA, according to the demand for bridge durability analysis. Numerical examples show that the method can dynamically and intensively simulate the durability evolution process of reinforced concrete bridge.

  11. 32 CFR 621.1 - Loan of Army/Defense Logistics Agency (DLA) owned property for use at national and State...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true Loan of Army/Defense Logistics Agency (DLA) owned... of Army/Defense Logistics Agency (DLA) owned property for use at national and State conventions. (a... and facilities on loan. (iv) Costs of packaging, packing, transportation and handling from source of...

  12. Navy Additive Manufacturing: Policy Analysis for Future DLA Material Support

    Science.gov (United States)

    2014-12-01

    of the requirements for the degree of MASTER OF BUSINESS ADMINISTRATION from the NAVAL POSTGRADUATE SCHOOL December 2014 Author...15 3. Vat Photopolymerization...................................................................16 4. Jetting...this: how should DLA best support AM efforts in the Navy in order for the Navy to achieve its goals using 3D printing? What is the most cost

  13. Breed differences in development of anti-insulin antibodies in diabetic dogs and investigation of the role of dog leukocyte antigen (DLA) genes.

    Science.gov (United States)

    Holder, Angela L; Kennedy, Lorna J; Ollier, William E R; Catchpole, Brian

    2015-10-15

    Administration of insulin for treatment of diabetes mellitus in dogs can stimulate an immune response, with a proportion of animals developing anti-insulin antibodies (AIA). For an IgG antibody response to occur, this would require B cell presentation of insulin peptides by major histocompatibility complex (MHC) class II molecules, encoded by dog leukocyte antigen (DLA) genes, in order to receive T-cell help for class switching. DLA genes are highly polymorphic in the dog population and vary from breed to breed. The aim of the present study was to evaluate AIA reactivity in diabetic dogs of different breeds and to investigate whether DLA genes influence AIA status. Indirect ELISA was used to determine serological reactivity to insulin in diabetic dogs, treated with either a porcine or bovine insulin preparation. DLA haplotypes for diabetic dogs were determined by sequence-based typing of DLA-DRB1, -DQA1 and -DQB1 loci. Significantly greater insulin reactivity was seen in treated diabetic dogs (n=942) compared with non-diabetic dogs (n=100). Relatively few newly diagnosed diabetic dogs (3/109) were found to be AIA positive, although this provides evidence that insulin autoantibodies might be involved in the pathogenesis of the disease in some cases. Of the diabetic dogs treated with a bovine insulin preparation, 52.3% (182/348) were AIA positive, compared with 12.6% (75/594) of dogs treated with a porcine insulin preparation, suggesting that bovine insulin is more immunogenic. Breeds such as dachshund, Cairn terrier, miniature schnauzer and Tibetan terrier were more likely to develop AIA, whereas cocker spaniels were less likely to develop AIA, compared with crossbreed dogs. In diabetic dogs, DLA haplotype DRB1*0015--DQA1*006--DQB1*023 was associated with being AIA positive, whereas the haplotype DLA-DRB1*006--DQA1*005--DQB1*007 showed an association with being AIA negative. These research findings suggest that DLA genes influence AIA responses in treated diabetic

  14. Followup Audit: DLA Officials Took Appropriate Actions to Address Concerns With Repair Parts for the High Mobility Multipurpose Wheeled Vehicle

    Science.gov (United States)

    2016-04-29

    Followup Audit : DLA Officials Took Appropriate Actions to Address Concerns With Repair Parts for the High Mobility Multipurpose Wheeled Vehicle A P R I L...Results in Brief Followup Audit : DLA Officials Took Appropriate Actions to Address Concerns With Repair Parts for the High Mobility Multipurpose Wheeled...and Maritime Paid Too Much for High Mobility Multipurpose Wheeled Vehicle Repair Parts,” (HMMWV) was issued on April 4, 2014. The audit

  15. The canine MHC class Ia allele DLA-88*508:01 presents diverse self- and canine distemper virus-origin peptides of varying length that have a conserved binding motif.

    Science.gov (United States)

    Ross, Peter; Nemec, Paige S; Kapatos, Alexander; Miller, Keith R; Holmes, Jennifer C; Suter, Steven E; Buntzman, Adam S; Soderblom, Erik J; Collins, Edward J; Hess, Paul R

    2018-03-01

    Ideally, CD8+ T-cell responses against virally infected or malignant cells are defined at the level of the specific peptide and restricting MHC class I element, a determination not yet made in the dog. To advance the discovery of canine CTL epitopes, we sought to determine whether a putative classical MHC class Ia gene, Dog Leukocyte Antigen (DLA)-88, presents peptides from a viral pathogen, canine distemper virus (CDV). To investigate this possibility, DLA-88*508:01, an allele prevalent in Golden Retrievers, was expressed as a FLAG-tagged construct in canine histiocytic cells to allow affinity purification of peptide-DLA-88 complexes and subsequent elution of bound peptides. Pattern analysis of self peptide sequences, which were determined by liquid chromatography-tandem mass spectrometry (LC-MS/MS), permitted binding preferences to be inferred. DLA-88*508:01 binds peptides that are 9-to-12 amino acids in length, with a modest preference for 9- and 11-mers. Hydrophobic residues are favored at positions 2 and 3, as are K, R or F residues at the C-terminus. Testing motif-matched and -unmatched synthetic peptides via peptide-MHC surface stabilization assay using a DLA-88*508:01-transfected, TAP-deficient RMA-S line supported these conclusions. With CDV infection, 22 viral peptides ranging from 9-to-12 residues in length were identified in DLA-88*508:01 eluates by LC-MS/MS. Combined motif analysis and surface stabilization assay data suggested that 11 of these 22 peptides, derived from CDV hemagglutinin, large polymerase, matrix, nucleocapsid, and V proteins, were processed and presented, and thus, potential targets of anti-viral CTL in DLA-88*508:01-bearing dogs. The presentation of diverse self and viral peptides indicates that DLA-88 is a classical MHC class Ia gene. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. The Total Quality Management Implementation Plan of the DLA Office of Comptroller

    Science.gov (United States)

    1989-06-01

    throughout the private and public sectors . Since embracing the concept in March 1988, the Office of the Secretary of Defense has directed all Defense...those in the Military Departments and private sector . The establishment of the DLA Finance Center in Columbus, Ohio, will promote standardization of...process and customer. o Worksite amenities and Quality of Worklife elements. o Adoption of incentive programs under which employees share the

  17. Ganoderma lucidum total triterpenes attenuate DLA induced ascites and EAC induced solid tumours in Swiss albino mice.

    Science.gov (United States)

    Smina, T P; Mathew, J; Janardhanan, K K

    2016-04-30

    G. lucidum total triterpenes were assessed for its apoptosis-inducing and anti-tumour activities. The ability of the total triterpenes to induce apoptosis was evaluated in Dalton's lymphoma ascites (DLA) and Ehrlich's ascites carcinoma (EAC) cell lines. Total triterpenes were found to be highly cytotoxic to DLA and EAC cell lines with IC50 values 5 ± 0.32 and 7.9 ± 0.2 µg/ml respectively. Total triterpenes induced apoptosis in both cell lines which is evident from the DNA fragmentation assay. Anti-tumour activity was accessed using DLA induced solid and EAC induced ascites tumour models in Swiss albino mice. Administration of 10, 50 and 100 mg/kg b. wt. total triterpenes showed 11.86, 27.27 and 40.57% increase in life span of animals in ascites tumour model. Treatment with 10, 50 and 100 mg/kg b. wt. total triterpenes exhibited 76.86, 85.01 and 91.03% inhibition in tumour volume and 67.96, 72.38 and 77.90% inhibition in tumour weight respectively in the solid tumour model. The study reveals the significant dose-dependent anti-tumour activity of total triterpenes in both models. Total triterpenes were more active against the solid tumour than the ascites tumour. The anti-oxidant potential and ability to induce cell-specific apoptosis could be contributing to its anti-tumour activities.

  18. 78 FR 64493 - Juneau Hydropower, Inc.; Notice of Subsequent Draft License Application (DLA) and Draft...

    Science.gov (United States)

    2013-10-29

    ... Hydropower, Inc.; Notice of Subsequent Draft License Application (DLA) and Draft Preliminary Draft... Hydropower, Inc. e. Name of Project: Sweetheart Lake Hydroelectric Project. f. Location: At the confluence of..., Business Manager, Juneau Hydropower, Inc., P.O. Box 22775, Juneau, AK 99802; 907-789-2775, email: duff...

  19. 76 FR 38117 - Notice of Intent To Prepare an Environmental Assessment Regarding DLA Energy's Mobility Fuel...

    Science.gov (United States)

    2011-06-29

    ... refined petroleum products are fungible, it is anticipated that these petroleum products produced from... ground products such as heating oil, diesel and gasoline. Although DLA Energy is the largest federal... military specification fuel is produced in the same refineries by the same methods as other commercial...

  20. DLA Class II Alleles Are Associated with Risk for Canine Symmetrical Lupoid Onychodystropy (SLO)

    Science.gov (United States)

    Wilbe, Maria; Ziener, Martine Lund; Aronsson, Anita; Harlos, Charlotte; Sundberg, Katarina; Norberg, Elin; Andersson, Lisa; Lindblad-Toh, Kerstin; Hedhammar, Åke; Andersson, Göran; Lingaas, Frode

    2010-01-01

    Symmetrical lupoid onychodystrophy (SLO) is an immune-mediated disease in dogs affecting the claws with a suggested autoimmune aethiology. Sequence-based genotyping of the polymorphic exon 2 from DLA-DRB1, -DQA1, and -DQB1 class II loci were performed in a total of 98 SLO Gordon setter cases and 98 healthy controls. A risk haplotype (DRB1*01801/DQA1*00101/DQB1*00802) was present in 53% of cases and 34% of controls and conferred an elevated risk of developing SLO with an odds ratio (OR) of 2.1. When dogs homozygous for the risk haplotype were compared to all dogs not carrying the haplotype the OR was 5.4. However, a stronger protective haplotype (DRB1*02001/DQA1*00401/DQB1*01303, OR = 0.03, 1/OR = 33) was present in 16.8% of controls, but only in a single case (0.5%). The effect of the protective haplotype was clearly stronger than the risk haplotype, since 11.2% of the controls were heterozygous for the risk and protective haplotypes, whereas this combination was absent from cases. When the dogs with the protective haplotype were excluded, an OR of 2.5 was obtained when dogs homozygous for the risk haplotype were compared to those heterozygous for the risk haplotype, suggesting a co-dominant effect of the risk haplotype. In smaller sample sizes of the bearded collie and giant schnauzer breeds we found the same or similar haplotypes, sharing the same DQA1 allele, over-represented among the cases suggesting that the risk is associated primarily with DLA-DQ. We obtained conclusive results that DLA class II is significantly associated with risk of developing SLO in Gordon setters, thus supporting that SLO is an immune-mediated disease. Further studies of SLO in dogs may provide important insight into immune privilege of the nail apparatus and also knowledge about a number of inflammatory disorders of the nail apparatus like lichen planus, psoriasis, alopecia areata and onycholysis. PMID:20808798

  1. DLA class II alleles are associated with risk for canine symmetrical lupoid onychodystrophy [corrected](SLO.

    Directory of Open Access Journals (Sweden)

    Maria Wilbe

    Full Text Available Symmetrical lupoid onychodystrophy (SLO is an immune-mediated disease in dogs affecting the claws with a suggested autoimmune aethiology. Sequence-based genotyping of the polymorphic exon 2 from DLA-DRB1, -DQA1, and -DQB1 class II loci were performed in a total of 98 SLO Gordon setter cases and 98 healthy controls. A risk haplotype (DRB1*01801/DQA1*00101/DQB1*00802 was present in 53% of cases and 34% of controls and conferred an elevated risk of developing SLO with an odds ratio (OR of 2.1. When dogs homozygous for the risk haplotype were compared to all dogs not carrying the haplotype the OR was 5.4. However, a stronger protective haplotype (DRB1*02001/DQA1*00401/DQB1*01303, OR = 0.03, 1/OR = 33 was present in 16.8% of controls, but only in a single case (0.5%. The effect of the protective haplotype was clearly stronger than the risk haplotype, since 11.2% of the controls were heterozygous for the risk and protective haplotypes, whereas this combination was absent from cases. When the dogs with the protective haplotype were excluded, an OR of 2.5 was obtained when dogs homozygous for the risk haplotype were compared to those heterozygous for the risk haplotype, suggesting a co-dominant effect of the risk haplotype. In smaller sample sizes of the bearded collie and giant schnauzer breeds we found the same or similar haplotypes, sharing the same DQA1 allele, over-represented among the cases suggesting that the risk is associated primarily with DLA-DQ. We obtained conclusive results that DLA class II is significantly associated with risk of developing SLO in Gordon setters, thus supporting that SLO is an immune-mediated disease. Further studies of SLO in dogs may provide important insight into immune privilege of the nail apparatus and also knowledge about a number of inflammatory disorders of the nail apparatus like lichen planus, psoriasis, alopecia areata and onycholysis.

  2. Demontaż systemu oświaty czy jego przemiana? Analiza Paktu dla edukacji Związku Nauczycielstwa Polskiego

    Directory of Open Access Journals (Sweden)

    Danuta Uryga

    2013-03-01

    Full Text Available Artykuł dotyczy dyskusji na temat szkolnictwa publicznego, toczącej się z udziałem Związku Nauczycielstwa Polskiego, który w 2011 r. ujął swoje stanowisko w dokumencie programowym Pakt dla edukacji. Kontekstem tej dyskusji są trudności, jakich doświadcza oświata samorządowa, a przede wszystkim zróżnicowanie poziomu nakładów na edukację i towarzyszące mu zjawiska likwidacji szkół oraz przekazywania ich innym podmiotom. Dokument przedstawiony przez ZNP odnosi się do tych zagadnień, zawiera przy tym zarówno szczegółowe postulaty zmian, jak i ogólne wizje rozwoju oświaty. Artykuł przybliża treść Paktu dla edukacji, szczególną uwagę poświęca zaś zawartemu w nim wizerunkowi oświaty publicznej i jego politycznemu wymiarowi.

  3. Coal/Biomass-to-Liquids Demonstration Testing for DLA Energy: Report on Project Tests, Evaluations, and Recommendations

    Science.gov (United States)

    2015-08-20

    Report January 2010-August 2015 Coal/ Biomass -to-Liquids Demonstration Testing for DLA Energy Report on Project Tests, Evaluations, and...produced commercially from coal and biomass mixtures while meeting the requirements of Section 526, which requires that GHG emissions from...gasification equipment, coals, and biomass used, and reports and analyzes the test results. Additionally, the team worked with DOE NETL to conduct

  4. OTRZYMYWANIE CIENKICH WARSTW ABSORBERA CIGS METODĄ ROZPYLANIA MAGNETRONOWEGO DLA ZASTOSOWAŃ FOTOWOLTAICZNYCH

    Directory of Open Access Journals (Sweden)

    Sławomir GUŁKOWSKI

    w cienkowarstwowych ogniwach słonecznych. Metoda rozpylania magnetronowego jest efektywną metodą produkcji cienkich warstw CIGS. Proces nanoszenia warstw można podzielić na dwie zasadnicze części: pierwsza to tworzenie prekursora CIG, tj. nanoszenie warstw metalicznych miedzi, galu i indu w odpowiednich proporcjach. Etap drugi to krystalizacja absorbera CIGS w wyniku procesu wygrzewania prekursora w obecności selenu. W artykule skupiono się na opracowaniu odpowiednich proporcji poszczególnych pierwiastków wchodzących w skład prekursora. Przebadano następujące konfiguracje nanoszenia poszczególnych warstw absorbera: CuGa/In oraz CuGa/In/Cu. Poszczególne warstwy naniesione zostały na podłoże molibdenowe, stanowiące tylny kontakt ogniwa budowanego na bazie absorbera CIGS. Warstwa molibdenu została przebadana metodą czteroostrzową w celu znalezienia zależności rezystywności od grubości warstwy. Przeprowadzono analizę składu pierwiastkowego warstwy za pomocą skaningowego mikroskopu elektronowego wyposażonego w system EDS. Dla każdej z otrzymanych warstw określono atomowe współczynniki proporcji występowania miedzi oraz galu w składzie warstwy. Na podstawie otrzymanych wyników badań dokonano optymalizacji parametrów technologicznych procesu takich jak: moc katody, ciśnienie oraz czas procesu, a także temperatura. Znaleziono zależności grubości warstw w funkcji czasu nanoszenia dla ustalonych warunków ciśnienia i mocy. Grubości poszczególnych warstw określono na podstawie badań profilometrycznych. W oparciu o opracowane parametry wykonane warstwy prekursora poddawane są obróbce termicznej w celu uzyskania absorbera CIGS.

  5. Pomiędzy. Dwie ojczyzny w pismach dla polskojęzycznych dzieci żydowskich w II Rzeczypospolitej

    Directory of Open Access Journals (Sweden)

    Anna Landau-Czajka

    2017-12-01

    Full Text Available In Between. Two Home Countries in the Polish Language Press for Jewish Children in the Second Polish Republic In the interwar period in Poland the big Polish-language Jewish journals (Chwila, Nowy Dziennik and Nasz Przegląd published supplements for children. Two of them (Chwilka and Dzienniczek dla Dzieci i Młodzieży [Diary for children and young people] were typical magazines for children. The third, the Mały Przegląd [Little review], led initially by Janusz Korczak, became the tribune of its youngest readers. Its content was composed of letters, reports and interviews by young correspondents. All these magazines were directed to children of the accultured Jews, readers of Polish-language Zionist press. It would seem, therefore, that their educational ideals should be similar. How were the patriotic values shown to the Jewish children from the acculturated Zionist families, familiar with Polish culture better than average Jewish children, but raised in cult of Palestine and the return to Eretz? What should be told to the children, if they were to be educated as good patriots? And patriots of what country? How to explain Palestinian patriotism to children who have never seen their country, lived in Poland and spoke Polish? And at the same time – how to explain the Polish patriotism to children who live in a country with a constantly growing anti-Semitism, of which they are only the marginalized, second-class citizens. As a result, the two dailies, almost identical in their views, have supplements presenting a surprisingly different approach to patriotism. The article was based on an analysis of all vintages of Dzienniczek and Mały Przegląd.   Pomiędzy. Dwie ojczyzny w pismach dla polskojęzycznych dzieci żydowskich w II Rzeczypospolitej W okresie międzywojennym wielkie polskojęzyczne dzienniki żydowskie – „Chwila”, „Nowy Dziennik” i „Nasz Przegląd” wydawały dodatki dla dzieci. Dwa pierwsze, „Chwilka” i

  6. An attempt of using soil grain size in calculating the capacity of water unavailable to plants / Próba wykorzystania uziarnienia gleby do obliczania zawartości wody niedostępnej dla roślin

    Directory of Open Access Journals (Sweden)

    Brogowski Zygmunt

    2015-03-01

    Full Text Available Celem pracy była próba znalezienia możliwości obliczenia ilości wody niedostępnej dla roślin na podstawie uziarnienia gleb. Frakcje o średnicach <0,02 mm gromadzą od 90,1 do 98,8% całkowitej ilości wody niedostępnej dla roślin, a frakcja iłu koloidalnego (<0,002 mm zatrzymuje od 52,1 do 80,1% tej wody. Gromadzenie wody we frakcjach <0,02 mm znacząco zależy od ich składu mineralogicznego. Obecność we frakcjach illitu, chlorytu oraz kaolinitu powoduje zmniejszenie ilości wody niedostępnej nawet o 40% w stosunku do frakcji zbudowanych ze smektytów, wermikulitów oraz próchnicy. Ze względu na duże zróżnicowanie ilości wody niedostępnej dla roślin w poszczególnych frakcjach granulometrycznych <0,02 mm wynikaj¹ce ze zróżnicowania mineralogicznego tych frakcji nie udało się wyprowadzić współczynników pozwalających na obliczenie ilościowe w glebach wody niedostępnej dla roślin wiązanej w mikroporach <0,2 μm.

  7. ANALIZA EKSPLOATACYJNA INSTALACJI SŁONECZNEJ PRACUJĄCEJ NA POTRZEBY PRZYGOTOWANIA C.W.U. DLA BUDYNKU WIELORODZINNEGO

    Directory of Open Access Journals (Sweden)

    Bożena BABIARZ

    Full Text Available Celem niniejszej pracy jest przeprowadzenie analizy instalacji słonecznych pod kątem eksploatacyjnym. Zasadniczą część opracowania stanowi analiza istniejącej od 2005 r. instalacji słonecznej pracującej dla potrzeb przygotowania ciepłej wody użytkowej dla mieszkańców budynku wielorodzinnego. W pracy wykorzystano rzeczywiste dane eksploatacyjne z dziesięciu lat działania instalacji, udostępnione przez Spółdzielnię Mieszkaniową „ZODIAK” w Rzeszowie. Przeanalizowano koszty przygotowania ciepłej wody użytkowej oraz koszty serwisowe instalacji. Na koszty eksploatacyjne instalacji słonecznych składają się m.in.: koszty zużycia i przygotowania c.w.u., koszty zużycia energii elektrycznej przez pompy obiegowe instalacji słonecznych, oraz koszty serwisowania instalacji. Na podstawie niniejszej analizy można wysnuć szereg wniosków możliwych do wykorzystania w analizach techniczno-finansowych na etapie projektowania inwestycji w odnawialne źródła energii. Przeprowadzona analiza wykazała, iż instalacja słoneczna w znacznym stopniu obniża koszty przygotowania ciepłej wody użytkowej. Koszt przygotowania 1 m3 ciepłej wody użytkowej w analizowanym budynku wielorodzinnym w 2015 r. przy udziale instalacji słonecznej stanowił 67% kosztów podgrzewu ciepłej wody w budynku o podobnej kubaturze wykorzystującym ciepło z miejskiej sieci ciepłowniczej. Pompy obiegowe zastosowane w instalacjach słonecznych charakteryzują się stosunkowo małym zużyciem energii elektrycznej. Koszty serwisowe instalacji są niewielkie i zależą od wielkości instalacji, jej lokalizacji oraz budowy.

  8. BADANIA NAD TECHNOLOGIĄ OTRZYMYWANIA CIENKICH WARSTW EMITERA METODĄ ROZPYLANIA MAGNETRONOWEGO DLA ZASTOSOWAŃ W OGNIWACH CIGS

    Directory of Open Access Journals (Sweden)

    Justyna PIETRASZEK

    Full Text Available Cienkowarstwowe ogniwa fotowoltaiczne wykonane na bazie struktury CIGS (mieszaniny pierwiastków miedzi, indu, galu oraz selenu należą do II generacji ogniw fotowoltaicznych. Wykazują one efektywność na poziomie zbliżonym do ogniw I generacji, lecz ze względu na niższe zużycie materiału, coraz częściej wypierają z rynku ogniwa krzemowe Artykuł przedstawia rezultaty badań dotyczących sposobu otrzymywania warstwy buforowej CdS (siarczku kadmu, zastosowanej w cienkowarstwowych ogniwach fotowoltaicznych typu CIGS. Przyjęto dwa rozwiązania technologii nanoszenia: warstwa okna CdS uzyskana metodą rozpylenia magnetronowego oraz warstwa okna CdS uzyskana metodą kąpieli chemicznej (CBD– Chemical Bath Deposition. Struktura ta powinna posiadać odpowiednią wielkość przerwy energetycznej, która pozwali na większą absorpcję fotonów, a także wymaga się, aby była cienka (mniej niż 100 nm i jednolita. Warstwy CdS zostały nałożone przez osadzanie w kąpieli chemicznej CBD na szklanych podłożach pokrytych Mo/CIGS (naniesione warstwy metodą sputteringu magnetronowego. Uzyskano dzięki temu warstwę emitera o grubości 80 nm po czasie osadzania 35 minut. Dla porównania warstwy CdS zostały nałożone poprzez sputtering magnetronowy na podłożu Mo/CIGS, uzyskanym tą samą metodą. Następnie oba rozwiązania zostały przebadane pod względem morfologii powierzchni na elektronowym mikroskopie skaningowym, jak również przeprowadzono analizy składu pierwiastkowego warstw. Zarówno jedna, jak i druga metoda prowadzi do otrzymania warstwy emitera CdS dla zastosowań w ogniwach CIGS.

  9. Bezpieczne formy aktywności fizycznej dla kobiet w ciąży = Secure forms of physical activity for pregnant women

    OpenAIRE

    Urtnowska, Katarzyna; Bułatowicz, Irena; Ludwikowski, Grzegorz; Zukow, Walery

    2016-01-01

    Urtnowska Katarzyna, Bułatowicz Irena, Ludwikowski Grzegorz, Zukow Walery. Bezpieczne formy aktywności fizycznej dla kobiet w ciąży = Secure forms of physical activity for pregnant women. Journal of Education, Health and Sport. 2016;6(5):291-297. eISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.51894 http://ojs.ukw.edu.pl/index.php/johs/article/view/3526 The journal has had 7 points in Ministry of Science and Higher Education parametric evaluation. Part B item 755 (23...

  10. Korzyści karmienia piersią dla matki

    Directory of Open Access Journals (Sweden)

    Magdalena Gibas-Dorna

    2012-12-01

    Full Text Available Powszechnie wiadomo, że karmienie piersią pozytywnie wpływa na zdrowie dziecka oraz jego rozwój intelek‑ tualny. światowa Organizacja Zdrowia (World Health Organization, WHO zaleca rozpoczęcie karmienia piersią od pierwszej godziny po porodzie i jego kontynuację przez okres co najmniej 6 miesięcy, a w miarę urozmaicania diety dziecka rekomenduje utrzymanie tego sposobu żywienia mniej więcej do 2. roku życia, traktując mleko matki jako najlepszy jakościowo pokarm uzupełniający. Coraz częściej podkreśla się protek‑ cyjną rolę karmienia naturalnego w rozwoju różnych chorób u matek oraz potencjalne skutki unikania prze‑ dłużonej laktacji. Wydaje się, że korzyści dla matki mają charakter wczesny (podczas połogu oraz długofa‑ lowy. Tuż po porodzie karmienie piersią przyspiesza obkurczanie macicy, zapobiega nadmiernej utracie krwi, chroni przed niedokrwistością z niedoboru żelaza, przeciwdziała wystąpieniu depresji poporodowej, umacnia więź matka – dziecko oraz poprawia zaburzoną w tym okresie jakość snu. Korzyści długofalowe wiążą się z obniżeniem ryzyka wystąpienia niektórych chorób nowotworowych (rak sutka, rak endometrium, rak jajni‑ ka, chorób sercowo‑naczyniowych (choroba niedokrwienna serca, nadciśnienie tętnicze, zaburzeń metabo‑ licznych (cukrzyca, nietolerancja glukozy, otyłość, hiperlipidemia, hiperinsulinemia, reumatoidalnego zapa‑ lenia stawów czy osteoporozy. Przedłużenie okresu laktacji i karmienia piersią ma również wymierną korzyść ekonomiczną i stanowi darmową naturalną antykoncepcję. Poniższa praca podsumowuje aktualny stan wie‑ dzy na temat wpływu karmienia piersią na zdrowie matek karmiących.

  11. Associations between gastric dilatation-volvulus in Great Danes and specific alleles of the canine immune-system genes DLA88, DRB1, and TLR5.

    Science.gov (United States)

    Harkey, Michael A; Villagran, Alexandra M; Venkataraman, Gopalakrishnan M; Leisenring, Wendy M; Hullar, Meredith A J; Torok-Storb, Beverly J

    2017-08-01

    OBJECTIVE To determine whether specific alleles of candidate genes of the major histocompatibility complex (MHC) and innate immune system were associated with gastric dilatation-volvulus (GDV) in Great Danes. ANIMALS 42 healthy Great Danes (control group) and 39 Great Danes with ≥ 1 GDV episode. PROCEDURES Variable regions of the 2 most polymorphic MHC genes (DLA88 and DRB1) were amplified and sequenced from the dogs in each group. Similarly, regions of 3 genes associated with the innate immune system (TLR5, NOD2, and ATG16L1), which have been linked to inflammatory bowel disease, were amplified and sequenced. Alleles were evaluated for associations with GDV, controlling for age and dog family. RESULTS Specific alleles of genes DLA88, DRB1, and TLR5 were significantly associated with GDV. One allele of each gene had an OR > 2 in the unadjusted univariate analyses and retained a hazard ratio > 2 after controlling for temperament, age, and familial association in the multivariate analysis. CONCLUSIONS AND CLINICAL RELEVANCE The 3 GDV-associated alleles identified in this study may serve as diagnostic markers for identification of Great Danes at risk for GDV. Additional research is needed to determine whether other dog breeds have the same genetic associations. These findings also provided a new target for research into the etiology of, and potential treatments for, GDV in dogs.

  12.  Znaczenie dorobku naukowego Profesor Elżbiety Burzym dla rozwoju nauki i praktyki rachunkowości w Polsce

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2014-04-01

    Full Text Available  Celem artykułu jest przypomnienie znaczenia dorobku naukowego Profesor Elżbiety Burzym dla rozwo-ju teorii rachunkowości, badań naukowych w tej dyscyplinie oraz praktyki rachunkowości w Polsce. Przedmiotem artykułu są definicje, tezy, poglądy i koncepcje teoretyczne systemu rachunkowości oraz systemu rachunku kosztów formułowane przez Profesor Burzym, które stanowią znaczący wkład w rozwój teorii rachunkowości w Polsce. W artykule objaśniono na przykładzie z literatury skutki roz-wiązywania problemów rachunkowości z perspektywy proceduralno-formalnej, a nie merytorycznej, która dominowała w opracowaniach naukowych Profesor Burzym.

  13. Koncepcja pomiaru i taksonomii zaburzeń behawioralnych i emocjonalnych Thomasa Achenbacha oraz ważne dla niej dane fenotypowe i genetyczne

    Directory of Open Access Journals (Sweden)

    Ewa Zasępa

    2011-06-01

    Full Text Available W artykule omówiona została koncepcja Thomasa Achenbacha dotycząca pomiaru i taksonomii zaburzeń behawioralnych oraz emocjonalnych. Nosi ona nazwę Systemu Pomiaru Opartego na Empirii. Inaczej podejście to nazywane jest też „z dołu do góry”. Zgodnie z nim kryteria diagnostyczne poszczególnych kategorii chorób i zaburzeń psychicznych wyprowadza się w oparciu o badanie dużych prób reprezentatywnych dla danej populacji. Powstałe w ten sposób nozologie służą do identyfikacji nowych przypadków. Podejście to jest inne niż paradygmat DSM, który określany jest „z góry do dołu”. Mierzone zgodnie z paradygmatem „z dołu do góry” zachowania problemowe można przedstawić na nastę- pujących poziomach: poziom pierwszy to specyficzne rodzaje problemów reprezentowane przez poszczególne itemy, poziom drugi – wyodrębnionych 8 skal zachowań problemowych (Lęk/Depresja, Wycofywanie się, Skargi Somatyczne, Zaburzenia Myślenia, Zaburzenia Uwagi, Zachowania Agresywne, Łamanie Norm, Natręctwa, poziom trzeci – 2 grupy zachowań problemowych: Zachowania Internalizacyjne i Zachowania Eksternalizacyjne, poziom czwarty – ogólny poziom zachowań problemowych, będący sumą wszystkich przeżywanych problemów. W artykule zostały przedstawione również wyniki badań, które potwierdzają koncepcję Achenbacha, to znaczy omówiono fenotypowe i genetyczne dane ważne dla tej koncepcji. Dane fenotypowe wskazują na to, że wyróżnione skale zachowań problemowych stanowią rzeczywiście odrębne syndromy, z kolei dane drugiego rodzaju – że syndromy te w dużym stopniu są uwarunkowane genetycznie. Mniejszy wpływ na ich rozwój ma środowisko wspólne bądź specyficzne.

  14. Wielokryterialna ocena różnych wariantów lokalizacji ujęcia wód podziemnych dla oczyszczalni ścieków w Częstochowie

    Directory of Open Access Journals (Sweden)

    Łukasz Kaczmarek

    2015-03-01

    Full Text Available Działalność przemysłowa wpływa bezpośrednio na środowisko. Przykładem tego jest wpływ ujęć wód podziemnych na warunki hydrogeologiczne. Kluczowym elementem tego zagadnienia jest wybór optymalnej lokalizacji projektowanego ujęcia. Przedstawiany artykuł opisuje wielokryterialną ocenę różnych wariantów lokalizacji ujęcia wód podziemnych. Woda z projektowanego ujęcia będzie dostarczana do oczysz­czalni ścieków w Częstochowie do celów technologicznych. W celu zaprojektowania odpowiedniej studni głębinowej spełniającej określone wymagania przeprowadzono ob­liczenia analityczne m.in. promienia leja depresji i głębokości depresji, izochromy 25 lat oraz ustalono wytyczne dla projektu studni. Wykonano również wykres zwierciadła wód podziemnych podczas interakcji z ujęciem. Rezultatem wyżej wymienionych obliczeń było określenie zasięgu leja depresji oraz wybór wariantu budowy dwóch studni w ra­mach jednego ujęcia wód podziemnych. Dzięki wykonanej analizie zweryfikowano moż­liwości wspomagania procesu podejmowania szybkich i racjonalnych decyzji dla dużych obszarów, gdzie występuje wiele czynników wpływu na wydajność studni głębinowej.

  15. Gruźlica – od diagnostyki do leczenia według standardów dla krajów Unii Europejskiej

    Directory of Open Access Journals (Sweden)

    Iwona Grzelewska-Rzymowska

    2013-09-01

    Full Text Available Autorzy przedstawiają dane epidemiologiczne odnoszące się do gruźlicy w niektórych krajach, w tym w Polsce. Gruźlica ciągle pozostaje priorytetowym wyzwaniem dla zdrowia publicznego. Obecnie stosowana chemioterapia jest skuteczna, ale długotrwała i kompleksowa. Poważny problem stanowią szczepy Mycobacterium tuberculosis oporne na leki przeciwprątkowe, szczególnie szczepy oporne na wiele leków (MDR-TB i te o rozszerzonej opor‑ ności (XDR-TB, oraz zakażenia HIV wśród chorych na gruźlicę. W październiku 2011 roku zostały sfinalizowane standardy dotyczące gruźlicy dla krajów Unii Europejskiej (European Union Standards for Tuberculosis Care, ESTC. Dokument ten pozostaje w zgodzie z definicjami i rekomendacjami WHO. ESTC składają się z czterech sekcji: diagnozowanie, leczenie, HIV i choroby współistniejące, zdrowie publiczne, które korespondują z Między‑ narodowymi Standardami Opieki nad Chorymi na Gruźlicę (ISTC z 2009 roku. W 2013 roku zostały opubliko‑ wane polskie rekomendacje. Autorzy komentują wszystkie odnoszące się do gruźlicy rekomendacje. Przedstawio‑ no objawy kliniczne gruźlicy i wybrane problemy gruźlicy utajonej (latent tuberculosis. Próbki wydzieliny oskrzelowej powinny być poddane badaniu mikroskopowemu, hodowli i testom lekowraźliwości. WHO rekomen‑ duje szybki test molekularny, który należy wykonać w dniu bakteriologicznej diagnozy gruźlicy. Wszyscy chorzy (w tym osoby zakażone HIV, którzy nie byli wcześniej leczeni i u których nie występują czynniki ryzyka oporności na leki, powinni otrzymywać przez 2 miesiące izoniazyd, ryfampicynę, pirazynamid i etambutol, a przez 4 miesiące izoniazyd i ryfampicynę. Niektóre standardy odnoszą się do gruźlicy dziecięcej. Infekcja wywołana przez Mycobacterium tuberculosis powinna zostać wykryta za pomocą testu tuberkulinowego lub testu uwalniania interferonu gamma (IGRA. Dzieci poniżej 5. roku życia i osoby zaka

  16. Psylocybina jako alternatywny lek dla osób cierpiących na depresję

    Directory of Open Access Journals (Sweden)

    Karolina Dydak

    2016-09-01

    Full Text Available Psylocybina jest substancją psychodysleptyczną pochodzenia naturalnego, występuje w grzybach rodzaju Psilocybe. Psychodysleptyki są środkami psychoaktywnymi, które silnie wpływają na percepcję, nastrój i procesy poznawcze człowieka. Psychodeliczne działanie psylocybiny opiera się na pobudzaniu receptorów serotoninergicznych, co prowadzi do wzrostu stężenia serotoniny w mózgu oraz przyczynia się do intensyfikacji czynności sensomotorycznych i percepcyjnych. Skutkiem działania psylocybiny na ludzki organizm są różne zmiany w zachowaniu – często stany euforyczne, rozweselenie, poczucie lekkości i jedności z otaczającym światem. Dodatkowo psylocybina powoduje modyfikację percepcji nieudającą rzeczywistości, często błędnie określaną mianem halucynacji. Działanie psylocybiny można porównać do działania LSD (dietyloamidu kwasu D-lizergowego, jednak wielokrotnie osłabionego. Psylocybina znajduje się w wykazie środków odurzających w grupie I-P, czyli substancji bez zastosowań medycznych i o dużym potencjale nadużywania, które są wyłączone z obrotu farmaceutycznego i mogą być używane wyłącznie do badań naukowych. Jednak właściwości psylocybiny pozwalają rozważać jej wykorzystanie w lecznictwie. Do schorzeń, w których zastosowanie tej substancji przynosi wymierne efekty, należy depresja. Badania prowadzone na ochotnikach dowodzą, że psylocybina może być dobrą alternatywą dla dostępnych obecnie leków przeciwdepresyjnych – wykazano jej skuteczność i potwierdzono bardzo niską toksyczność.

  17. A cell-based MHC stabilization assay for the detection of peptide binding to the canine classical class I molecule, DLA-88.

    Science.gov (United States)

    Ross, Peter; Holmes, Jennifer C; Gojanovich, Gregory S; Hess, Paul R

    2012-12-15

    Identifying immunodominant CTL epitopes is essential for studying CD8+ T-cell responses in populations, but remains difficult, as peptides within antigens typically are too numerous for all to be synthesized and screened. Instead, to facilitate discovery, in silico scanning of proteins for sequences that match the motif, or binding preferences, of the restricting MHC class I allele - the largest determinant of immunodominance - can be used to predict likely candidates. The high false positive rate with this analysis ideally requires binding confirmation, which is obtained routinely by an assay using cell lines such as RMA-S that have defective transporter associated with antigen processing (TAP) machinery, and consequently, few surface class I molecules. The stabilization and resultant increased life-span of peptide-MHC complexes on the cell surface by the addition of true binders validates their identity. To determine whether a similar assay could be developed for dogs, we transfected a prevalent class I allele, DLA-88*50801, into RMA-S. In the BARC3 clone, the recombinant heavy chain was associated with murine β2-microglobulin, and importantly, could differentiate motif-matched and -mismatched peptides by surface MHC stabilization. This work demonstrates the potential to use RMA-S cells transfected with canine alleles as a tool for CTL epitope discovery in this species. Copyright © 2012 Elsevier B.V. All rights reserved.

  18. Organizacja pomocy psychologiczno-pedagogicznej dla uczniów z ADHD w polskim systemie oświatowym

    Directory of Open Access Journals (Sweden)

    Anna Borkowska

    2010-09-01

    Full Text Available Uczniowie z ADHD to dzieci o specjalnych potrzebach edukacyjnych, którym często sprawia trudność sprostanie wymaganiom szkolnym, co wynika ze specyfiki ich funkcjonowania. Wyrównywanie szans edukacyjnych tej grupy uczniów stanowi cel pomocy psychologiczno-pedagogicznej świadczonej w przedszkolu, szkole i placówce systemu oświaty. Pomoc psychologiczno-pedagogiczna powinna być świadczona jak najbliżej ucznia, tj. w szkole, do której uczęszcza uczeń, lub specjalistycznej placówce oświatowej, a za jej organizację odpowiada dyrektor szkoły lub placówki. Uczeń z ADHD może uzyskać pomoc na terenie szkoły w postaci zindywidualizowanej pracy na obowiązkowych zajęciach edukacyjnych oraz pracy korekcyjnej podczas dodatkowych zajęć specjalistycznych bądź na terenie poradni psychologiczno-pedagogicznej w ramach zajęć korekcyjno-kompensacyjnych, logopedycznych i terapeutycznych. Nauczyciele zobowiązani są do dostosowania treści, metod i organizacji nauczania do możliwości psychofizycznych ucznia z ADHD na podstawie opinii poradni psychologiczno-pedagogicznej. Uczeń, u którego wraz z ADHD zdiagnozowano współwystępowanie zaburzeń zachowania lub zagro- żenie niedostosowaniem społecznym, może otrzymać orzeczenie o potrzebie kształcenia specjalnego. Szkoła zobowiązana jest do opracowania dla niego indywidualnego programu edukacyjno-terapeutycznego zawierającego działania o charakterze resocjalizacyjnym lub socjoterapeutycznym. W przypadku dzieci z ADHD, u których stwierdzono nasilenie objawów zespołu hiperkinetycznego w stopniu uniemożliwiającym lub znacznie utrudniającym uczęszczanie do szkoły, możliwa jest realizacja obowiązku szkolnego w nauczaniu indywidualnym na podstawie orzeczenia o potrzebie indywidualnego nauczania.

  19. Dollar Summary of Federal Supply Classification and Service Category by Company, FY83, Part 3 (7025-9999).

    Science.gov (United States)

    1983-01-01

    NEW YORK ARMY KITCHEN HAND TOOLS AND UTENSILS 45 FSC TOTAL 235 7340 GEORGIA FACTORY FOR THE BLIND GEORGIA DLA CUTLERY AND FLATWARE 743 NATIONAL...INDUSTRIES FOR THE BLIND NEW JERSEY DLA CUTLERY AND FLATWARE 97 REEM 4 BARTON CORP MASS NAVY CUTLERY AND FLATWARE 52 FSC TOTAL- 892 DEPARTMENT OF DEFENSE...69,060 8945 ANDERSON CLAYTON & CO ILLINOIS DLA FOOD OILS AND FATS 387 TEXAS DLA FOOD OILS AND FATS 27 CONTRACTOR TOTAL 414 BUNGE EDIBLE OIL TENNESSEE DLA

  20. 40 CFR Table 2 to Subpart Kkkkk of... - Operating Limits

    Science.gov (United States)

    2010-07-01

    .... Kiln equipped with a DLA a. Maintain the average pressure drop across the DLA for each 3-hour block... sufficient amount of limestone in the limestone hopper, storage bin (located at the top of the DLA), and DLA at all times; maintain the limestone feeder setting at or above the level established during the...

  1. Defense Logistics Agency Did Not Fully Implement the Business Enterprise Architecture Procure-to-Pay Business Process in the Enterprise Business System

    Science.gov (United States)

    2014-10-28

    change. Enterprise Business System In August 2000, DLA began developing its Enterprise Resource Planning ( ERP ) system by initiating the Business...the EBS core system. EBS became the ERP system solution supporting DLA nonenergy commodity activities. DLA subsequently enhanced its EBS...capabilities by adding SAP software that supported DLA Enterprise Operational Accounting, real property, and inventory management functions. As part of the

  2. DISCOVERY OF A DAMPED Lyα ABSORBER AT z = 3.3 ALONG A GALAXY SIGHT-LINE IN THE SSA22 FIELD

    Energy Technology Data Exchange (ETDEWEB)

    Mawatari, K.; Inoue, A. K. [College of General Education, Osaka Sangyo University, 3-1-1, Nakagaito, Daito, Osaka, 574-8530 (Japan); Kousai, K.; Hayashino, T. [Research Center for Neutrino Science, General School of Science, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Cooke, R.; Prochaska, J. X. [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Yamada, T. [Astronomical Institute, Tohoku University, Aoba, Aramaki, Aoba-ku, Sendai, Miyagi, 980-8578 (Japan); Matsuda, Y., E-mail: mawatari@las.osaka-sandai.ac.jp [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan)

    2016-02-01

    Using galaxies as background light sources to map the Lyα absorption lines is a novel approach to study Damped Lyα Absorbers (DLAs). We report the discovery of an intervening z = 3.335 ± 0.007 DLA along a galaxy sight-line identified among 80 Lyman Break Galaxy (LBG) spectra obtained with our Very Large Telescope/Visible Multi-Object Spectrograph survey in the SSA22 field. The measured DLA neutral hydrogen (H i) column density is log(N{sub H} {sub i}/cm{sup −2}) = 21.68 ± 0.17. The DLA covering fraction over the extended background LBG is >70% (2σ), yielding a conservative constraint on the DLA area of ≳1 kpc{sup 2}. Our search for a counterpart galaxy hosting this DLA concludes that there is no counterpart galaxy with star formation rate larger than a few M{sub ⊙} yr{sup −1}, ruling out an unobscured violent star formation in the DLA gas cloud. We also rule out the possibility that the host galaxy of the DLA is a passive galaxy with M{sub *} ≳ 5 × 10{sup 10}M{sub ⊙} or a heavily dust-obscured galaxy with E(B − V) ≳ 2. The DLA may coincide with a large-scale overdensity of the spectroscopic LBGs. The occurrence rate of the DLA is compatible with that of DLAs found in QSO sight-lines.

  3. Loglines. May-June 2013

    Science.gov (United States)

    2013-06-01

    multinational exercise in and around the Hawaiian islands. — Photo by Navy Seaman Ryan J. Mayes 16 www.dla.mil Malaysia , Japan, the Netherlands...thoughts on the future of DLA Pacic. The full interview can be found in the online version of Loglines at http://www.dla.mil DLA Public...said. “But we have three buildings in the retail department averaging over 100,000 square feet each, and our people navigate to those locations and

  4. The Nation's Combat Logistics Support Agency

    Science.gov (United States)

    Services Doing Business With DLA Customer Support Business Operations Small Business Federal Contracting CENTCOM & SOCOM DLA Europe & Africa DLA Pacific History News Careers A graphic shows rows of cross -shaped gravestones in a cemetery with the words Heritage, History, Heroes over a partial American Flag

  5. 78 FR 17383 - Notice of Availability of Environmental Assessment and Draft Finding of No Significant Impact...

    Science.gov (United States)

    2013-03-21

    ... (truck, rail, and marine). DLA Energy's implementation of a systemic change to the use of commercial..., Terrestrial, and Cultural Resources--Transport and storage of fuel products is highly regulated. DLA Energy's... of Environmental Assessment and Draft Finding of No Significant Impact Regarding DLA Energy's...

  6. 48 CFR 52.211-2 - Availability of Specifications, Standards, and Data Item Descriptions Listed in the Acquisition...

    Science.gov (United States)

    2010-10-01

    ... ASSIST websites: (1) ASSIST (http://assist.daps.dla.mil); (2) Quick Search (http://assist.daps.dla.mil/quicksearch); (3) ASSISTdocs.com (http://assistdocs.com). (b) Documents not available from ASSIST may be... Wizard (http://assist.daps.dla.mil/wizard); (2) Phoning the DoDSSP Customer Service Desk (215) 697-2179...

  7. Microbiome Remodeling via the Montmorillonite Adsorption-Excretion Axis Prevents Obesity-related Metabolic Disorders

    Directory of Open Access Journals (Sweden)

    Pengfei Xu

    2017-02-01

    Full Text Available Obesity and its related metabolic disorders are closely correlated with gut dysbiosis. Montmorillonite is a common medicine used to treat diarrhea. We have previously found that dietary lipid adsorbent-montmorillonite (DLA-M has an unexpected role in preventing obesity. The aim of this study was to further investigate whether DLA-M regulates intestinal absorption and gut microbiota to prevent obesity-related metabolic disorders. Here, we show that DLA-M absorbs free fatty acids (FFA and endotoxins in vitro and in vivo. Moreover, the combination of fluorescent tracer technique and polarized light microscopy showed that DLA-M crystals immobilized BODIPY® FL C16 and FITC-LPS, respectively, in the digestive tract in situ. HFD-fed mice treated with DLA-M showed mild changes in the composition of the gut microbiota, particularly increases in short-chain fatty acids (SCFA-producing Blautia bacteria and decreases in endotoxin-producing Desulfovibrio bacteria, these changes were positively correlated with obesity and inflammation. Our results indicated that DLA-M immobilizes FFA and endotoxins in the digestive tract via the adsorption-excretion axis and DLA-M may potentially be used as a prebiotic to prevent intestinal dysbiosis and obesity-associated metabolic disorders in obese individuals.

  8. 40 CFR Table 6 to Subpart Kkkkk of... - Continuous Compliance With Emission Limitations and Work Practice Standards

    Science.gov (United States)

    2010-07-01

    ... pressure drop data according to § 63.8600(a); reducing the DLA pressure drop data to 3-hour block averages according to § 63.8600(a); maintaining the average pressure drop across the DLA for each 3-hour block period... the limestone hopper and storage bin (located at the top of the DLA) contain adequate limestone by...

  9. Restriction fragment length polymorphism of the major histocompatibility complex of the dog.

    Science.gov (United States)

    Sarmiento, U M; Storb, R F

    1988-01-01

    Human major histocompatibility complex (HLA) cDNA probes were used to analyze the restriction fragment length polymorphism (RFLP) of the DLA-D region in dogs. Genomic DNA from peripheral blood leucocytes of 23 unrelated DLA-D-homozygous dogs representing nine DLA-D types (defined by mixed leucocyte reaction) was digested with restriction enzymes (Bam HI, Eco RI, Hind III, Pvu II, Taq I, Rsa I, Msp I, Pst I, and Bgl II), separated by agarose gel electrophoresis, and transferred onto Biotrace membrane. The Southern blots were successively hybridized with radiolabeled HLA cDNA probes corresponding to DR, DQ, DP, and DO beta genes. The autoradiograms for all nine enzyme digests displayed multiple bands with the DRb, DQb, and DPb probes while the DOb probe hybridized with one to two bands. The RFLP patterns were highly polymorphic but consistent within each DLA-D type. Standard RFLP patterns were established for nine DLA-D types which could be discriminated from each other by using two enzymes (Rsa I and Pst I) and the HLA-DPb probe. Cluster analysis of the polymorphic restriction fragments detected by the DRb probe revealed four closely related supertypic groups or DLA-DR families: Dw3 + Dw4 + D1, Dw8 + D10, D7 + D16 + D9, and Dw1. This study provides the basis for DLA-D genotyping at a population level by RFLP analysis. These results also suggest that the genetic organization of the DLA-D region may closely resemble that of the HLA complex.

  10. 32 CFR Appendix A to Part 1288 - Decal Specifications

    Science.gov (United States)

    2010-07-01

    ... Specification L-5300A, 7 Jan 70, type I, class 4, reflectivity 1. 2. Colors: a. Background—Silver. b. DLA emblem... category a combination of letters and number(s) separated by the DLA emblem will be used. The number-letter.... Registration letters and numerals: 11/4 to 11/2 inches in height. c. DLA emblem letters: 11/2 inches to 13/4...

  11. Experimental signatures of direct-laser-acceleration-assisted laser wakefield acceleration

    Science.gov (United States)

    Shaw, J. L.; Lemos, N.; Marsh, K. A.; Froula, D. H.; Joshi, C.

    2018-04-01

    The direct laser acceleration (DLA) of electrons in a laser wakefield accelerator (LWFA) operating in the forced or quasi-blowout regimes has been investigated through experiment and simulation. When there is a significant overlap between the trapped electrons and the drive laser in a LWFA cavity, the resulting electrons can gain energy from both the LWFA and the DLA mechanisms. Experimental work investigates the properties of the electron beams produced in a LWFA with ionization injection by dispersing those beams in the direction perpendicular to the laser polarization. These electron beams show certain spectral features that are characteristic of DLA. These characteristic features are reproduced using particle-in-cell simulations, where particle tracking was used to elucidate the roles of LWFA and DLA to the energy gain of the electrons in this experimental regime and to demonstrate that such spectral features are definitive signatures of the presence of DLA in LWFA.

  12. Observation of multipactor suppression in a dielectric-loaded accelerating structure using an applied axial magnetic field

    International Nuclear Information System (INIS)

    Jing, C.; Konecny, R.; Antipov, S.; Chang, C.; Gold, S. H.; Schoessow, P.; Kanareykin, A.; Gai, W.

    2013-01-01

    Efforts by a number of institutions to develop a Dielectric-Loaded Accelerating (DLA) structure capable of supporting high gradient acceleration when driven by an external radio frequency source have been ongoing over the past decade. Single surface resonant multipactor has been previously identified as one of the major limitations on the practical application of DLA structures in electron accelerators. In this paper, we report the results of an experiment that demonstrated suppression of multipactor growth in an X-band DLA structure through the use of an applied axial magnetic field. This represents an advance toward the practical use of DLA structures in many accelerator applications

  13. Calculating the radiation characteristics of accelerated electrons in laser-plasma interactions

    International Nuclear Information System (INIS)

    Li, X. F.; Yu, Q.; Qu, J. F.; Kong, Q.; Gu, Y. J.; Ma, Y. Y.; Kawata, S.

    2016-01-01

    In this paper, we studied the characteristics of radiation emitted by electrons accelerated in a laser–plasma interaction by using the Lienard–Wiechert field. In the interaction of a laser pulse with a underdense plasma, electrons are accelerated by two mechanisms: direct laser acceleration (DLA) and laser wakefield acceleration (LWFA). At the beginning of the process, the DLA electrons emit most of the radiation, and the DLA electrons emit a much higher peak photon energy than the LWFA electrons. As the laser–plasma interaction progresses, the LWFA electrons become the major radiation emitter; however, even at this stage, the contribution from DLA electrons is significant, especially to the peak photon energy.

  14. Loglines. May-June 2014

    Science.gov (United States)

    2014-06-01

    Kathleen T. Rhem Editor: Jacob Boyer Layout/Design: Paul Henry Crank Writers: Beth Reece Sara Moore Amanda Neumann Loglines is prepared...www.logisticsinformationservice.dla.mil dla.tng@dla.mil Jake Logan , a maintenance employee from the U.S. Army Corps of Engineers’ Greers Ferry Project...of their expertise. “The Joint Petroleum Seminar is designed to gather joint petroleum Defense, both incoming and incumbent, and expose them to

  15. The large-scale cross-correlation of Damped Lyman alpha systems with the Lyman alpha forest: first measurements from BOSS

    Energy Technology Data Exchange (ETDEWEB)

    Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, 8057 Zurich (Switzerland); Miralda-Escudé, Jordi [Institució Catalana de Recerca i Estudis Avançats, Barcelona, Catalonia (Spain); Arnau, Eduard [Institut de Ciències del Cosmos (IEEC/UB), Barcelona, Catalonia (Spain); Carithers, Bill; Ross, Nicholas P.; White, Martin [Lawrence Berkeley National Laboratory, University of California Berkeley, Berkeley, California 94720 (United States); Lee, Khee-Gan [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117, Heidelberg (Germany); Noterdaeme, Pasquier; Pâris, Isabelle; Petitjean, Patrick; Rollinde, Emmanuel [Institut d' Astrophysique de Paris, Université Paris 6 et CNRS, 98bis blvd. Arago, 75014 Paris (France); Rich, James [CEA, Centre de Saclay, IRFU, 91191 Gif-sur-Yvette (France); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); York, Donald G., E-mail: font@physik.uzh.ch, E-mail: miralda@icc.ub.edu [Department of Astronomy and Astrophysics and The Fermi Institute, Chicago University, 5640 So. Ellis Ave., Chicago, IL 60637 (United States)

    2012-11-01

    We present the first measurement of the large-scale cross-correlation of Lyα forest absorption and Damped Lyman α systems (DLA), using the 9th Data Release of the Baryon Oscillation Spectroscopic Survey (BOSS). The cross-correlation is clearly detected on scales up to 40h{sup −1}Mpc and is well fitted by the linear theory prediction of the standard Cold Dark Matter model of structure formation with the expected redshift distortions, confirming its origin in the gravitational evolution of structure. The amplitude of the DLA-Lyα cross-correlation depends on only one free parameter, the bias factor of the DLA systems, once the Lyα forest bias factors are known from independent Lyα forest correlation measurements. We measure the DLA bias factor to be b{sub D} = (2.17±0.20)β{sub F}{sup 0.22}, where the Lyα forest redshift distortion parameter β{sub F} is expected to be above unity. This bias factor implies a typical host halo mass for DLAs that is much larger than expected in present DLA models, and is reproduced if the DLA cross section scales with halo mass as M{sub h}{sup α}, with α = 1.1±0.1 for β{sub F} = 1. Matching the observed DLA bias factor and rate of incidence requires that atomic gas remains extended in massive halos over larger areas than predicted in present simulations of galaxy formation, with typical DLA proper sizes larger than 20 kpc in host halos of masses ∼ 10{sup 12}M{sub ☉}. We infer that typical galaxies at z ≅ 2 to 3 are surrounded by systems of atomic clouds that are much more extended than the luminous parts of galaxies and contain ∼ 10% of the baryons in the host halo.

  16. Dielectric oil-based polymer actuator for improved thickness strain and breakdown voltage

    International Nuclear Information System (INIS)

    Cho, Min Sung; Yamamoto, Akio

    2016-01-01

    Dielectric elastomer actuators (DEAs) have been increasingly investigated as alternative actuators to conventional ones. However, DEAs suffer from high rates of premature failure. Therefore, this study proposes a dielectric oil-based polymer actuator, also called a Dielectric liquid actuator (DLA), to compensate for the drawbacks of DEAs. DLA was experimentally compared with conventional DEAs. Results showed that DLA successfully prevented thermal runaway at defects in the electrode and excessive thinning of the film, resulting in increased breakdown voltage. Consequently, premature failure was inhibited, and the performance was improved. The breakdown voltages of DLA and DEA were 6000 and 2000 V, respectively, and their maximum thickness strains were 49.5% and 37.5%, respectively

  17. Dielectric oil-based polymer actuator for improved thickness strain and breakdown voltage

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Min Sung; Yamamoto, Akio [Dept. of Precision Engineering, School of Engineering, The University of Tokyo, Tokyo (Japan)

    2016-09-15

    Dielectric elastomer actuators (DEAs) have been increasingly investigated as alternative actuators to conventional ones. However, DEAs suffer from high rates of premature failure. Therefore, this study proposes a dielectric oil-based polymer actuator, also called a Dielectric liquid actuator (DLA), to compensate for the drawbacks of DEAs. DLA was experimentally compared with conventional DEAs. Results showed that DLA successfully prevented thermal runaway at defects in the electrode and excessive thinning of the film, resulting in increased breakdown voltage. Consequently, premature failure was inhibited, and the performance was improved. The breakdown voltages of DLA and DEA were 6000 and 2000 V, respectively, and their maximum thickness strains were 49.5% and 37.5%, respectively.

  18. Loglines. November-December 2012

    Science.gov (United States)

    2012-12-01

    other experience and skills that are a good fit for a manager,” she said. Clay Henson, a former Army infantry- man, was one of the first service...new employees need to know that the agency provides? DLA supports warfighters. DLA provides clothing, medicine, meals , fuel and replacement parts for...first-strike ration is smaller and lighter than a meal , ready-to-eat. It is used by the U.S. Michael Tuttle and Nick Sistrun are writers for DLA

  19. Two separable functional domains of simian virus 40 large T antigen: carboxyl-terminal region of simian virus 40 large T antigen is required for efficient capsid protein synthesis.

    Science.gov (United States)

    Tornow, J; Polvino-Bodnar, M; Santangelo, G; Cole, C N

    1985-01-01

    The carboxyl-terminal portion of simian virus 40 large T antigen is essential for productive infection of CV-1 and CV-1p green monkey kidney cells. Mutant dlA2459, lacking 14 base pairs at 0.193 map units, was positive for viral DNA replication, but unable to form plaques in CV-1p cells (J. Tornow and C.N. Cole, J. Virol. 47:487-494, 1983). In this report, the defect of dlA2459 is further defined. Simian virus 40 late mRNAs were transcribed, polyadenylated, spliced, and transported in dlA2459-infected cells, but the level of capsid proteins produced in infected CV-1 green monkey kidney cells was extremely low. dlA2459 large T antigen lacks those residues known to be required for adenovirus helper function, and the block to productive infection by dlA2459 occurs at the same stage of infection as the block to productive adenovirus infection of CV-1 cells. These results suggest that the adenovirus helper function is required for productive infection by simian virus 40. Mutant dlA2459 was able to grow on the Vero and BSC-1 lines of African green monkey kidney cells. Additional mutants affecting the carboxyl-terminal portion of large T were prepared. Mutant inv2408 contains an inversion of the DNA between the BamHI and BclI sites (0.144 to 0.189 map units). This inversion causes transposition of the carboxyl-terminal 26 amino acids of large T antigen and the carboxyl-terminal 18 amino acids of VP1. This mutant was viable, even though the essential information absent from dlA2459 large T antigen has been transferred to the carboxyl terminus of VP1 of inv2408. The VP1 polypeptide carrying this carboxyl-terminal portion of large T could overcome the defect of dlA2459. This indicates that the carboxyl terminus of large T antigen is a separate and separable functional domain. Images PMID:2982029

  20. 76 FR 43990 - Procurement List; Proposed Additions and Deletions

    Science.gov (United States)

    2011-07-22

    ... Distribution. In 2010, the Defense Distribution Center (DDC) was renamed DLA Distribution. A process was also..., each distribution center that was part of the former DDC will be renamed as DLA Distribution, plus its...

  1. Distributed Leadership Agency and Its Relationship to Individual Autonomy and Occupational Self-Efficacy

    DEFF Research Database (Denmark)

    Unterrainer, Christine; Jeppesen, Hans Jeppe; Jønsson, Thomas Faurholt

    2017-01-01

    The purpose of the present study is the investigation of distributed leadership agency (DLA). DLA is an activity-based concept, which is defined as employees’ active participation in leadership tasks. By combining a descriptive and a normative approach DLA has the potential of real employee...... empowerment. It can protect from arbitrary managerial power and lead to employees’ personal development through sharing organizational resources, influencing leadership activities and joint decision making in companies. The study examines individually perceived autonomy as an antecedent and employees......-sectional as well as cross-lagged relationships and an autoregressive model for analyzing the half-longitudinal mediation. The results revealed a significant positive effect of DLA on employees’ occupational self-efficacy cross-sectionally at Time 1 (n = 117) and Time 2 (n = 67), as well as cross-lagged (n = 67...

  2. Results of the Defense Logistics Agency Strategic Supplier Alliance for Catalog Items

    National Research Council Canada - National Science Library

    2000-01-01

    ..., (in response to the reports) the Director, DLA and the Deputy Under Secretary of Defense (Acquisition Reform) chartered a rapid improvement team for the development of a new "Strategic Supplier Alliance" relationship between DLA and Allied Signal...

  3. Multipactor Physics, Acceleration, and Breakdown in Dielectric-Loaded Accelerating Structures

    International Nuclear Information System (INIS)

    Fischer, Richard P.; Gold, Steven H.

    2016-01-01

    The objective of this 3-year program is to study the physics issues associated with rf acceleration in dielectric-loaded accelerating (DLA) structures, with a focus on the key issue of multipactor loading, which has been found to cause very significant rf power loss in DLA structures whenever the rf pulsewidth exceeds the multipactor risetime (~10 ns). The experiments are carried out in the X-band magnicon laboratory at the Naval Research Laboratory (NRL) in collaboration with Argonne National Laboratory (ANL) and Euclid Techlabs LLC, who develop the test structures with support from the DoE SBIR program. There are two main elements in the research program: (1) high-power tests of DLA structures using the magnicon output (20 MW @11.4 GHz), and (2) tests of electron acceleration in DLA structures using relativistic electrons from a compact X-band accelerator. The work during this period has focused on a study of the use of an axial magnetic field to suppress multipactor in DLA structures, with several new high power tests carried out at NRL, and on preparation of the accelerator for the electron acceleration experiments.

  4. An extended fractal growth regime in the diffusion limited aggregation including edge diffusion

    Directory of Open Access Journals (Sweden)

    Aritra Ghosh

    2016-01-01

    Full Text Available We have investigated on-lattice diffusion limited aggregation (DLA involving edge diffusion and compared the results with the standard DLA model. For both cases, we observe the existence of a crossover from the fractal to the compact regime as a function of sticking coefficient. However, our modified DLA model including edge diffusion shows an extended fractal growth regime like an earlier theoretical result using realistic growth models and physical parameters [Zhang et al., Phys. Rev. Lett. 73 (1994 1829]. While the results of Zhang et al. showed the existence of the extended fractal growth regime only on triangular but not on square lattices, we find its existence on the square lattice. There is experimental evidence of this growth regime on a square lattice. The standard DLA model cannot characterize fractal morphology as the fractal dimension (Hausdorff dimension, DH is insensitive to morphology. It also predicts DH = DP (the perimeter dimension. For the usual fractal structures, observed in growth experiments on surfaces, the perimeter dimension can differ significantly (DH ≠ DP depending on the morphology. Our modified DLA model shows minor sensitivity to this difference.

  5. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 6 (7540-9999).

    Science.gov (United States)

    1984-01-01

    NEW YORK ARMY BOOKS AND PAMPHLETS D TH 52 BELL HELICOPTER/TEXTRON TEXAS ARMY BOOKS AND PAMPHLETS I ’’ h:D e 8 2 BENDER MATTHEW & CO INC 0 IST...689 DE ROSS! & SON CO INC NEW JERSEY DLA OUTERWEAR WOMENS 37 EDMONDS & WILLIAMS MFG CO ALABAMA NAVY OUTERWEAR WOMENS 66 DLA OUTERWEAR WOMENS 52 STATE...CORP UN KINGDOM 0ILA FUEL OILS 14 001 CUMBERLAND OIL COMPAN. MAINE DLA FUEL OILS 203 CURTIS D C INC VIRGINIA OLA FUEL OILS 8,10 DAHLEN FARMERS ELEV N

  6. In vivo evaluation of lipid-based formulations for oral delivery of apomorphine and its diester prodrugs

    DEFF Research Database (Denmark)

    Borkar, Nrupa Nitin; Holm, René; Yang, Mingshi

    2016-01-01

    .05) than after DLA-w/o administration, indicating that triglycerides and surfactants improved the oral absorption of DLA. Similarly, Cmax and AUC after dosing apomorphine-o/w were significantly higher (p≤0.05) than that of aqueous suspension. This suggested that lipids and lipolysis products possibly aided......In the present study, the differences in oral absorption of apomorphine and its diester prodrugs and the effect of lipid-based formulations on the absorption of apomorphine or its prodrugs were investigated. Apomorphine, dilauroyl apomorphine (DLA) and dipalmitoyl apomorphine (DPA) were orally...

  7. Oxygen in Steel WMD after Welding with Micro-Jet Cooling

    Directory of Open Access Journals (Sweden)

    Wegrzyn T.

    2013-12-01

    Full Text Available Dotychczas technologia mikrojetowa była stosowana tylko w spawalniczym procesie MIG, gdzie gazem osłonowym był argon. W artykule przedstawiono innowacyjną technologię spawania z chłodzeniem mikrojetowym. Podano informacje zarówno dla gazów, które mogą być wybrane dla spawania MIG/MAG i dla mikrojetowego procesu. Uzyskano informacje o wpływie doboru gazu mikrojetowego na strukturę metalograficzną stalowych spoin. Własności mechaniczne złącza podano w funkcji zawartości tlenu w stopiwie.

  8. Loglines. March - April 2011

    Science.gov (United States)

    2011-04-01

    Training have implemented an enterprisewide eLearn - ing policy, offering employees courses through a SkillSoft catalog in the DLA Learning Management...available, other training may then be requested, officials explained. DLA civilians and assigned military personnel can access SkillSoft eLearning

  9. 75 FR 25213 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2010-05-07

    ... requirements of DLA firefighters. To local fire departments for training or assistance in fire fighting... training and educational institutions.'' * * * * * S600.20 SYSTEM NAME: DLA Fire and Emergency Services.... CATEGORIES OF INDIVIDUALS COVERED BY THE SYSTEM: Individuals assigned fire and emergency services duties...

  10. Marsz dla zdrowia… seksualnego

    Directory of Open Access Journals (Sweden)

    Sylwia Skorupska

    2011-12-01

    Full Text Available Zaburzenia seksualne mogą wystąpić w każdym wieku i w każdym okresie aktywności seksualnej. W związkuz tym w ostatnich latach wzrosło zainteresowanie badaniami, które umożliwiają lepsze poznanie mechanizmówprowadzących do występowania zaburzeń seksualnych oraz sposobów radzenia sobie z nimi. Styl życiaw znaczący sposób oddziałuje na zachowanie funkcji seksualnych. Zwiększenie aktywności fizycznej jest czynnikiemograniczającym występowanie zaburzeń w sferze seksualnej zarówno w grupie mężczyzn, jak i w grupiekobiet.

  11. Loglines. May - June 2012

    Science.gov (United States)

    2012-06-01

    the military services used in current procedures or was not always available in the quantities needed to support contingencies, he said...domestic-preparedness units. A new directorate, hardware, was added to DLA Troop Support’s lineup of Maria Martins, a fabric worker at DLA Troop

  12. 2006 Land and Maritime Supply Chains Business Conference and Exhibition

    Science.gov (United States)

    2006-08-30

    Clifford G. Scott, SC, USN, Unit Chief, Electronics Division Ms. Arretta Griffi th, Procurement Support Assistant (OA) Ms. Shelly Jenkins, Customer Account...Business Systems Modernization............715 DLA - Casting and Forging.................................712 DLA - Defense Distribution Center (DDC...219 Kovatch Castings , Inc.....................................409 Lambda Supply Corp......................................103 Lockheed

  13. Simulation of the fluctuations of energy and charge deposited during e-beam exposure

    International Nuclear Information System (INIS)

    Borisov, S. S.; Zaitsev, S. I.; Grachev, E. A.

    2007-01-01

    The stochastic nature of an energy and charge deposition process is examined using a model based on discrete loss approximation (DLA). Deposited energy deviations computed using the continuous slowing down approximation (CSDA) and DLA are compared. It is shown that CSDA underestimates fluctuations in deposited energy

  14. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 5 (6630-7530).

    Science.gov (United States)

    1984-01-01

    08 DU PONT El DE NEMOURS AND CO NEW JERSEY ARMY GASES COMPRESSED AND LIQUEFIED 31 USAF GASES COMPRESSED AND LIQUEFIED 25 STATE TOTAL 56 FOREX CHEMICAL... FOREX CHEMICAL CORP NEW JERSEY DLA MISCELLANEOUS CHEMICAL SPECIALTIES 11l OASTON POWER TOOLS ARKANSAS DLA MISCELLANEOUS CHEMICAL SPECIALTIES 432

  15. Pattern of diffusion-limited aggregation on nonuniform substrate

    CERN Document Server

    Ouyang Wen Ze; Zou Xian Wu; Jin Zhun Zhi

    2003-01-01

    Pattern of diffusion-limited aggregation (DLA) on nonuniform substrate was investigated by computer simulations. The nonuniform substrates are represented by Leath percolations with the probability p. p stands for the degree of nonuniformity and takes values in the range p sub c<=p<=1, where p sub c is the threshold of percolation. The DLA cluster grows up on the Leath percolation substrate. The patterns of the DLA clusters appear asymmetrical and nonuniform, and the branches are relative few for the case p is close to p sub c. In addition, the pattern depends on the shape of substrate. As p increases from p sub c to 1, cluster changes to pure DLA gradually. Correspondingly, the fractal dimension increases from 1.46 to 1.68. Also, the random walks on Leath percolations through the range p sub c<=p<=1 were examined. Our simulations show the Honda-Toyoki-Matsushita relation is still reasonable for fractional dimensional systems.

  16. 78 FR 44931 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2013-07-25

    ...), as amended. This system will provide DLA installations with the ability to rapidly and effectively... Defense Privacy and Civil Liberties Web site at http://dpclo.defense.gov/privacy/SORNs/component/dla/index...: First name, last name, work email, work phone number, mobile phone number, short message service (SMS...

  17. 32 CFR 1290.9 - Forms and reports.

    Science.gov (United States)

    2010-07-01

    ... accountability for each ticket issued and stocks on hand. (2) DLA field activity Counsels will coordinate with...'s copy of the DD Form 1805 by the applicable issuing authority. (ii) List of minor offenses... filed at the Security Office or equivalent issuing authority. DLA Form 1454, Vehicle Registration/Driver...

  18. 76 FR 72691 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2011-11-25

    ... enable the Defense Finance and Accounting Service (DFAS) to distribute payments to DLA employees for... records are kept by the Defense Finance and Accounting Service (DFAS) 6 years and 3 months, and are then... DoD Components who receive accounting and financial management support from DLA under an...

  19. From "Sooo Excited!!!" to "So Proud": Using Language to Study Development

    Science.gov (United States)

    Kern, Margaret L.; Eichstaedt, Johannes C.; Schwartz, H. Andrew; Park, Gregory; Ungar, Lyle H.; Stillwell, David J.; Kosinski, Michal; Dziurzynski, Lukasz; Seligman, Martin E. P.

    2014-01-01

    We introduce a new method, "differential language analysis" (DLA), for studying human development in which computational linguistics are used to analyze the big data available through online social media in light of psychological theory. Our open vocabulary DLA approach finds words, phrases, and topics that distinguish groups of people…

  20. Wybrane Aspekty Zużywania Się Połączeń Wpustowych I Wielowypustowych W Procesie Eksploatacji

    Directory of Open Access Journals (Sweden)

    Gębura Andrzej

    2014-12-01

    Full Text Available W artykule przedstawiono wybrane wady połączeń wielowypustowych: mimośrodowości, przekoszenia, zwiększonych luzów. Przedstawiono znaczenie tych wad dla poprawności funkcjonowania całego zespołu napędowego. Zaprezentowano swoisty katalog tych wad w formie: wizualnego zużycia, pomiarów mechanicznych płaszczyzn przyporu, opisu matematycznego przebiegów dynamiki ruchu takiego połączenia, zobrazowań dla metod FAM-C i FDM-A. Zaznaczono skutki długotrwałej eksploatacji połączeń wielowypustowych o nadmiernym zużyciu dla bezpieczeństwa latania

  1. 40 CFR Table 2 to Subpart Jjjjj of... - Operating Limits

    Science.gov (United States)

    2010-07-01

    ... each 3-hour block period at or above the average pressure drop established during the performance test; andb. Maintain an adequate amount of limestone in the limestone hopper, storage bin (located at the top of the DLA), and DLA at all times; maintain the limestone feeder setting at or above the level...

  2. Defense Inventory: Further Analysis and Enhanced Metrics Could Improve Service Supply and Depot Operations

    Science.gov (United States)

    2016-06-01

    Managed Spare Parts at Service Industrial Sites by Supply Chain , Fiscal...Metrics and Inventory Stratification Reporting; and Defense Logistics Agency Instruction 4140.08, DLA Retail Supply Chain Materiel Management ...the retail supply system, which is typically managed by the services. As a retail inventory manager at industrial sites, DLA manages the supply

  3. Multifractal properties of diffusion-limited aggregates and random multiplicative processes

    International Nuclear Information System (INIS)

    Canessa, E.

    1991-04-01

    We consider the multifractal properties of irreversible diffusion-limited aggregation (DLA) from the point of view of the self-similarity of fluctuations in random multiplicative processes. In particular we analyse the breakdown of multifractal behaviour and phase transition associated with the negative moments of the growth probabilities in DLA. (author). 20 refs, 5 figs

  4. 40 CFR Table 5 to Subpart Jjjjj of... - Continuous Compliance With Emission Limits and Operating Limits

    Science.gov (United States)

    2010-07-01

    ... the DLA pressure drop data to 3-hour block averages according to § 63.8450(a); maintaining the average pressure drop across the DLA for each 3-hour block period at or above the average pressure drop established during the performance test; andii. Verifying that the limestone hopper and storage bin (located at the...

  5. Intracistronic complementation in the simian virus 40 A gene.

    Science.gov (United States)

    Tornow, J; Cole, C N

    1983-01-01

    A set of eight simian virus 40 mutants was constructed with lesions in the A gene, which encodes the large tumor (T) antigen. These mutants have small deletions (3-20 base pairs) at either 0.497, 0.288, or 0.243 map units. Mutants having both in-phase and frameshift mutations at each site were isolated. Neither plaque formation nor replication of the mutant DNAs could be detected after transfection of monkey kidney cells. Another nonviable mutant, dlA2459, had a 14-base-pair deletion at 0.193 map unit and was positive for viral DNA replication. Each of the eight mutants were tested for ability to form plaques after cotransfection with dlA2459 DNA. The four mutants that had in-phase deletions were able to complement dlA2459. The other four, which had frameshift deletions, did not. No plaques were formed after cotransfection of cells with any other pair of group A mutants. This suggests that the defect in dlA2459 defines a distinct functional domain of simian virus 40 T antigen. Images PMID:6312452

  6. 32 CFR 1280.5 - Procedures. 1

    Science.gov (United States)

    2010-07-01

    ... occurred. (c) Claims under the Federal Tort Claims Act arising from negligence of DLA military or civilian... occurred. (d) Tort claims in favor of the United States for damage to or loss or destruction of DLA... involved in an accident giving rise to a claim under the Federal Tort Claims Act, the claim will be handled...

  7. Molecular Emission from a Galaxy Associated with a z sim 2.2 Damped Ly$ Absorber

    DEFF Research Database (Denmark)

    Neeleman, M.; Kanekar, N.; Prochaska, J.~X.

    2018-01-01

    -ion metal absorption (sim40 km s$^‑1$) disfavors scenarios whereby the gas probed by the DLA shows bulk motion around the galaxy. We use Giant Metrewave Radio Telescope H I 21 cm absorption spectroscopy to find that the H I along the DLA sightline must be warm, with a stringent lower limit on the spin...

  8. Ryzyko zdrowotne związane ze spożywaniem wody pitnej ze studni kopanych na przykładzie gminy Chmielnik

    Directory of Open Access Journals (Sweden)

    Natalia Żurek

    2016-12-01

    Full Text Available Wstęp. W Polsce znaczny odsetek populacji pozyskuje wodę pitną ze studni kopanych, podatnych na zanieczyszczenia przemysłowe i rolnicze. Woda pochodząca z tzw. prywatnych ujęć wodnych, zgodnie z polskim prawodawstwem, nie podlega jednak ustawowej kontroli, a jej spo- żywanie naraża konsumentów na negatywne skutki zdrowotne. Celem pracy było oszacowanie wybranych parametrów fizykochemicznych wody pitnej ze studni kopanych oraz odniesienie uzyskanych wyników do norm ujętych w rozporządzeniu ministra zdrowia. Materiał i metody. W przeprowadzonych analizach 36 próbek wody studziennej z terenu gminy Chmielnik, zawartość azotanów (III i jonu amonowego badano za pomocą fotometru, odczyn i przewodność elektrolityczną miernikiem wieloparametrowym, mętność za pomocą turbidymetru, zaś stężenie chlorków oznaczono metodą miareczkową. Wyniki. Dla badanych parametrów chemicznych, tj. azotanów (III, chlorków i jonu amonowego nie stwierdzono przekroczeń dopuszczalnych norm, podobnie jak dla parametru fizycznego, tj. przewodności elektrolitycznej. Ponadnormatywne wartości odnotowano natomiast dla dwóch parametrów fizycznych, tj. odczynu (2 próbki i mętności (33 próbki. Wnioski. Wodę z badanych studni kopanych można określić jako bezpieczną dla konsumentów pod względem badanych parametrów chemicznych, dla których spodziewano się przekroczeń dopuszczalnych norm w związku z terminem poboru. Problem ponadnormatywnych wartości mętności dla większości kontrolowanych studni może być rozwiązany poprzez wprowadzenie prostych metod uzdatniania, natomiast wprowadzenie regularnych badań wszystkich parametrów jakości wody pitnej pozwoliłoby ustalić, czy przekroczone normy dla odczynu wiążą się z niedopuszczalnymi stężeniami wskaźników chemicznych, które nie były badane w niniejszej pracy.

  9. The UCSD HIRES/Keck I Damped Lyα Abundance Database. II. The Implications

    Science.gov (United States)

    Prochaska, Jason X.; Wolfe, Arthur M.

    2002-02-01

    We present a comprehensive analysis of the damped Lyα (DLA) abundance database presented in the first paper of this series. This database provides a homogeneous set of abundance measurements for many elements including Si, Cr, Ni, Zn, Fe, Al, S, Co, O, and Ar from 38 DLA systems with zabs>1.5. With little exception, these DLA systems exhibit very similar relative abundances. There is no significant correlation in X/Fe with [Fe/H] metallicity, and the dispersion in X/Fe is small at all metallicity. We search the database for trends indicative of dust depletion and in a few cases find strong evidence. Specifically, we identify a correlation between [Si/Ti] and [Zn/Fe] which is unambiguous evidence for depletion. Following Hou and colleagues, we present [X/Si] abundances against [Si/H]+logN(HI) and note trends of decreasing X/Si with increasing [Si/H]+logN(HI) which argue for dust depletion. Similarly, comparisons of [Si/Fe] and [Si/Cr] against [Si/H] indicate significant depletion at [Si/H]>-1 but suggest essentially dust-free damped systems at [Si/H]0.25 dex as [Zn/Fe]-->0 and that the [Si/Fe] values exhibit a plateau of ~0.3 dex at [Si/H]good agreement with our previous work, but we emphasize two differences: (1) the unweighted and N(H I)-weighted [Fe/H] mean metallicities now have similar values at all epochs except z>3.5, where small number statistics dominate the N(H I)-weighted mean; and (2) there is no evolution in the mean [Fe/H] metallicity from z=1.7 to 3.5 but possibly a marked drop at higher redshift. We conclude with a general discussion on the physical nature of the DLA systems. We stress the uniformity of the DLA chemical abundances which indicates that the protogalaxies identified with DLA systems have very similar enrichment histories, i.e., a nearly constant relative contribution from Type Ia and Type II supernovae. The DLA systems also show constant relative abundances within a given system, which places strict constraints on the mixing timescales

  10. Artemisia annua dried leaf tablets treated malaria resistant to ACT and i.v. artesunate: Case reports.

    Science.gov (United States)

    Daddy, Nsengiyumva Bati; Kalisya, Luc Malemo; Bagire, Pascal Gisenya; Watt, Robert L; Towler, Melissa J; Weathers, Pamela J

    2017-08-15

    Dried leaf Artemisia annua (DLA) has shown efficacy against Plasmodium sp. in rodent studies and in small clinical trials. Rodent malaria also showed resiliency against the evolution of artemisinin drug resistance. This is a case report of a last resort treatment of patients with severe malaria who were responding neither to artemisinin combination therapy (ACT) nor i.v. artesunate. Of many patients treated with ACTs and i.v. artesunate during the 6 mon study period, 18 did not respond and were subsequently treated with DLA Artemisia annua. Patients were given a dose of 0.5g DLA per os, twice daily for 5d. Total adult delivered dose of artemisinin was 55mg. Dose was reduced for body weight under 30kg. Clinical symptoms, e.g. fever, coma etc., and parasite levels in thick blood smears were tracked. Patients were declared cured and released from hospital when parasites were microscopically undetectable and clinical symptoms fully subsided. All patients were previously treated with Coartem® provided through Santé Rurale (SANRU) and following the regimen prescribed by WHO. Of 18 ACT-resistant severe malaria cases compassionately treated with DLA, all fully recovered. Of the 18, this report details two pediatric cases. Successful treatment of all 18 ACT-resistant cases suggests that DLA should be rapidly incorporated into the antimalarial regimen for Africa and possibly wherever else ACT resistance has emerged. Copyright © 2017. Published by Elsevier GmbH.

  11. Direct electron acceleration in plasma waveguides for compact high-repetition-rate x-ray sources

    International Nuclear Information System (INIS)

    Lin, M-W; Jovanovic, I

    2014-01-01

    Numerous applications in fundamental and applied research, security, and industry require robust, compact sources of x-rays, with a particular recent interest in monochromatic, spatially coherent, and ultrafast x-ray pulses in well-collimated beams. Such x-ray sources usually require production of high-quality electron beams from compact accelerators. Guiding a radially polarized laser pulse in a plasma waveguide has been proposed for realizing direct laser acceleration (DLA), where the electrons are accelerated by the axial electric field of a co-propagating laser pulse (Serafim et al 2000 IEEE Trans. Plasma Sci. 28 1190). A moderate laser peak power is required for DLA when compared to laser wakefield acceleration, thus offering the prospect for high repetition rate operation. By using a density-modulated plasma waveguide for DLA, the acceleration distance can be extended with pulse guiding, while the density-modulation with proper axial structure can realize the quasi-phase matching between the laser pulses and electrons for a net gain accumulation (York et al 2008 Phys. Rev. Lett. 100 195001; York et al 2008 J. Opt. Soc. Am. B 25 B137; Palastro et al 2008 Phys. Rev. E 77 036405). We describe the development and application of a test particle model and particle-in-cell model for DLA. Experimental setups designed for fabrication of optically tailored plasma waveguides via the ignitor-heater scheme, and for generation and characterization of radially polarized short pulses used to drive DLA, are presented. (paper)

  12. The demand for clean-fuel vehicles by Dutch local authorities. A stated choice analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hagen, P.

    2012-08-15

    Previous research showed that the era of cheap fossil fuels is over. Also, 23% of the worldwide emission of CO2 is produced by road transport. These problems demand a change in the propulsion of vehicles. Because the diffusion of clean-fuel vehicles is not happening at this moment, something has to change. Rogers' diffusion of innovation theory is used to state that a critical mass of vehicles is needed to stimulate the diffusion of these vehicles. Due to public procurement Dutch local authorities (DLA's) can help stimulating this diffusion. Unfortunately these DLA's are not purchasing clean-fuel vehicles yet. To gain insight in what is hampering the diffusion of these vehicles by DLA's, a discrete choice experiment was created about the preferences by these DLA's. Six vehicle attributes were used to describe each vehicle. The results showed that the initial purchase price and the amount of local emission were experienced as the most important attributes by DLA's, where initial purchase price has a negative influence and local emission a positive influence in the choice for a new vehicle. Next, fuel price, range and availability of the fuel were found evenly important. Fuel price had a negative influence and both range and availability of fuel had a positive influence on the choice for a new vehicle. Finally, time to refuel/recharge was found least important and also negatively influencing the choice.

  13. Measuring distributed leadership agency in a hospital context

    DEFF Research Database (Denmark)

    Jønsson, Thomas; Unterrainer, Christine; Jeppesen, Hans Jeppe

    2016-01-01

    and valid quantitative instrument that measures how much employees’ at all hierarchical levels are involved in concrete leadership activities in the hospital context. Taking a normative perspective we could show that Distributed Leadership – measured with the DLA-questionnaire – has positive effects......Purpose: The purpose of this study is to develop and validate an instrument that can measure Distributed Leadership as employees’ active participation in distributed leadership tasks. We designate this as the Distributed Leadership Agency (DLA). Methodology: Data were collected throughout all......, discriminant and convergent validity, and ANOVAs were applied to analyze group differences in DLA. Findings: The identified uni-dimensional questionnaire consists of seven items, as it is different from, but associated with, empowering leadership, organizational influence, attitude to participation and trust...

  14. Convergent validity test, construct validity test and external validity test of the David Liberman algorithm

    Directory of Open Access Journals (Sweden)

    David Maldavsky

    2013-08-01

    Full Text Available The author first exposes a complement of a previous test about convergent validity, then a construct validity test and finally an external validity test of the David Liberman algorithm.  The first part of the paper focused on a complementary aspect, the differential sensitivity of the DLA 1 in an external comparison (to other methods, and 2 in an internal comparison (between two ways of using the same method, the DLA.  The construct validity test exposes the concepts underlined to DLA, their operationalization and some corrections emerging from several empirical studies we carried out.  The external validity test examines the possibility of using the investigation of a single case and its relation with the investigation of a more extended sample.

  15. WYKORZYSTANIE ODNAWIALNYCH ŹRÓDEŁ ENERGII I CIEPŁA ODPADOWEGO W NISKOTEMPERATUROWYM SYSTEMIE OGRZEWCZO-CHŁODZĄCYM HALI DRUKARNI

    Directory of Open Access Journals (Sweden)

    Wojciech BIALIK

    Full Text Available W pracy przedstawiono nowoczesny system ogrzewania hali drukarni oraz pomieszczeń biurowych i socjalnych. Został on zaprezentowany na dwóch schematach oraz omówiony w pierwszej części artykułu. Układ wykorzystuje pompy ciepła ciecz-ciecz oraz powietrze ciecz. Dla pomp ciecz-ciecz dolnym źródłem jest pionowy wymiennik gruntowy składający się z 13 otworów o głębokości 100 m. W opisywanym rozwiązaniu zastosowano także poziomy gruntowy wymiennik ciepła do ogrzewania czerpanego z otoczenia powietrza wentylacyjnego płynącego następnie do rekuperatorów pomieszczeń biurowych i socjalnych. Gruntowe wymienniki ciepła w trakcie ich budowy zostały zaprezentowane na jednym z rysunków. Pomieszczenia biurowe i socjalne ogrzewane lub schładzane są medium płynącym w matach umieszczonych w ścianach oraz w wybranych częściach podłogi. Dla ograniczenia strat ciepła związanych z wentylacją w instalacji zastosowano trzy układy rekuperacji (osobno dla pomieszczeń biurowych, socjalnych i hali drukarskiej. Poprawne działanie systemu zobrazowano w postaci wykresu zmian temperatur we wspomnianych pomieszczeniach. Dla największej centrali wentylacyjnej zamieszczono też przebieg temperatur strumieni powietrza dla wybranych dni. W podsumowaniu zawarto wnioski płynące z dotychczasowej eksploatacji oraz plany dalszego rozwoju systemu.

  16. TRANSCOM-DLA: Roles and Responsibilities

    Science.gov (United States)

    2017-11-01

    Aviation Industrial Hardware Construction &  Equipment   36 Note: For the plot on the right, the underlying number of orders is likewise based on a...services to be provided by the fund, its management structure and how it will meet the following five criteria: 1. Defined organizational “outputs that... structure is working. o There would not be any efficiencies gained from reorganizing or consolidating the two organizations. o There are no functions

  17. E-learning wsparciem dla biblioteki

    Directory of Open Access Journals (Sweden)

    Kowalska Aneta

    2012-06-01

    Full Text Available The aim of the article is distance learning and its application in the Library of the Cracow University of Technology (CUT. Distance learning allows librarians to prepare professional workshops for different groups of users. Thanks to multimedia and interactive tools, e-courses become an attractive method of knowledge transfer and skills acquisition. The CUT Library takes part in the project “Politechnika XXI wieku” (CUT in the 21 century, co-financed by the European Union, and some of the courses are created within this framework. However, all e-courses are positioned on the CUT web-platform.

  18. Program Manager: The Journal of the Defense Systems Management College. Volume 12, Number 6, November-December 1983,

    Science.gov (United States)

    1983-12-01

    amendments to their annual appropriations acts (known as The most popular indices used are value added/employee the Maybank Amendment), had been prohibited...modification to the Maybank Amendment and measure the .rcal employment effects of increasing DLA contract awards in LSAs. To assure reasonably accurate...predictions of employment impacts due to the DLA Maybank Test, the U.S. Army Corps of Engineers Construction Engineering Research Laboratory developed

  19. Identification of novel genetic risk loci in Maltese dogs with necrotizing meningoencephalitis and evidence of a shared genetic risk across toy dog breeds.

    Directory of Open Access Journals (Sweden)

    Isabelle Schrauwen

    Full Text Available Necrotizing meningoencephalitis (NME affects toy and small breed dogs causing progressive, often fatal, inflammation and necrosis in the brain. Genetic risk loci for NME previously were identified in pug dogs, particularly associated with the dog leukocyte antigen (DLA class II complex on chromosome 12, but have not been investigated in other susceptible breeds. We sought to evaluate Maltese and Chihuahua dogs, in addition to pug dogs, to identify novel or shared genetic risk factors for NME development. Genome-wide association testing of single nucleotide polymorphisms (SNPs in Maltese dogs with NME identified 2 regions of genome-wide significance on chromosomes 4 (chr4:74522353T>A, p = 8.1×10-7 and 15 (chr15:53338796A>G, p = 1.5×10-7. Haplotype analysis and fine-mapping suggests that ILR7 and FBXW7, respectively, both important for regulation of immune system function, could be the underlying associated genes. Further evaluation of these regions and the previously identified DLA II locus across all three breeds, revealed an enrichment of nominal significant SNPs associated with chromosome 15 in pug dogs and DLA II in Maltese and Chihuahua dogs. Meta-analysis confirmed effect sizes the same direction in all three breeds for both the chromosome 15 and DLA II loci (p = 8.6×10-11 and p = 2.5×10-7, respectively. This suggests a shared genetic background exists between all breeds and confers susceptibility to NME, but effect sizes might be different among breeds. In conclusion, we identified the first genetic risk factors for NME development in the Maltese, chromosome 4 and chromosome 15, and provide evidence for a shared genetic risk between breeds associated with chromosome 15 and DLA II. Last, DLA II and IL7R both have been implicated in human inflammatory diseases of the central nervous system such as multiple sclerosis, suggesting that similar pharmacotherapeutic targets across species should be investigated.

  20. Identification of novel genetic risk loci in Maltese dogs with necrotizing meningoencephalitis and evidence of a shared genetic risk across toy dog breeds.

    Science.gov (United States)

    Schrauwen, Isabelle; Barber, Renee M; Schatzberg, Scott J; Siniard, Ashley L; Corneveaux, Jason J; Porter, Brian F; Vernau, Karen M; Keesler, Rebekah I; Matiasek, Kaspar; Flegel, Thomas; Miller, Andrew D; Southard, Teresa; Mariani, Christopher L; Johnson, Gayle C; Huentelman, Matthew J

    2014-01-01

    Necrotizing meningoencephalitis (NME) affects toy and small breed dogs causing progressive, often fatal, inflammation and necrosis in the brain. Genetic risk loci for NME previously were identified in pug dogs, particularly associated with the dog leukocyte antigen (DLA) class II complex on chromosome 12, but have not been investigated in other susceptible breeds. We sought to evaluate Maltese and Chihuahua dogs, in addition to pug dogs, to identify novel or shared genetic risk factors for NME development. Genome-wide association testing of single nucleotide polymorphisms (SNPs) in Maltese dogs with NME identified 2 regions of genome-wide significance on chromosomes 4 (chr4:74522353T>A, p = 8.1×10-7) and 15 (chr15:53338796A>G, p = 1.5×10-7). Haplotype analysis and fine-mapping suggests that ILR7 and FBXW7, respectively, both important for regulation of immune system function, could be the underlying associated genes. Further evaluation of these regions and the previously identified DLA II locus across all three breeds, revealed an enrichment of nominal significant SNPs associated with chromosome 15 in pug dogs and DLA II in Maltese and Chihuahua dogs. Meta-analysis confirmed effect sizes the same direction in all three breeds for both the chromosome 15 and DLA II loci (p = 8.6×10-11 and p = 2.5×10-7, respectively). This suggests a shared genetic background exists between all breeds and confers susceptibility to NME, but effect sizes might be different among breeds. In conclusion, we identified the first genetic risk factors for NME development in the Maltese, chromosome 4 and chromosome 15, and provide evidence for a shared genetic risk between breeds associated with chromosome 15 and DLA II. Last, DLA II and IL7R both have been implicated in human inflammatory diseases of the central nervous system such as multiple sclerosis, suggesting that similar pharmacotherapeutic targets across species should be investigated.

  1. Analiza parametrów geotechnicznych gruntów słabonośnych na przykładzie dokumentowania warunków budowy podłoża gruntowego dla inwestycji liniowej

    Directory of Open Access Journals (Sweden)

    Piotr Paprocki

    2016-10-01

    Full Text Available Kluczowe znaczenie dla bezpiecznego, a zarazem ekonomicznego zaprojektowania drogowej inwestycji liniowej mają informacje dotyczące obszaru i głębokości występowania gruntów słabonośnych, ich rodzaju (charakterystyki oraz wartości prawidłowo określonych parametrów odkształceniowych i wytrzymałościowych. W artykule przedstawiono analizy przeprowadzone w celu wyznaczenia wyprowadzonych wartości parametrów geotechnicznych słabonośnych gruntów organicznych, tj. torfów gytii i namułów, oraz korelacje ich cech fizycznych i mechanicznych występujących w podłożu projektowanej drogi ekspresowej S5 na odcinku Białe Błota – granica województw wielkopolskiego i kujawsko-pomorskiego. W analizie wykorzystano wartości parametrów geotechnicznych uzyskanych na podstawie badań terenowych (wiercenia, sondowania CPTU, sondowania sondą krzyżakową, badania dylatometrem Marchettiego oraz badań laboratoryjnych (badania w aparacie trójosiowym, testy edometryczne. W odniesieniu do badanych gruntów organicznych należy stwierdzić, że zawartość części organicznych ma istotny wpływ na inne cechy fizyczne gruntów, takie jak: wilgotność naturalna, gęstość objętościowa, oraz na parametry wytrzymałościowo-odkształceniowe i może być używana (obok rodzaju gruntu jako cecha charakteryzująca występujące w podłożu warstwy gruntów organicznych.

  2. D'' Layer Activation via Tidal Dissipation: A Link Between Non-Hydrostatic Ellipticity, Non-Chondritic Heat Flux, and Non-Plume Head Generation of Flood Basalts

    Science.gov (United States)

    Hager, B. H.; Mazarico, E.; Touma, J.; Wisdom, J.

    2003-12-01

    Quantitative understanding of Earth's heat budget has eluded a list of distinguished physicists and geochemists ranging from Lord Kelvin to Don L Anderson. The global heat flux is substantially greater than that generated by the estimated inventory of radioactive heat sources, so simple energy balance considerations demand an additional heat source. Secular cooling is commonly invoked to balance Earth's energy budget, but the required cooling rates are difficult to reconcile with both traditional convection calculations and petrologic estimates of ancient upper mantle temperatures. A non-geochemical heat source seems plausible. Indeed, Tuoma and Wisdom (Astron. J., 122, 2001) showed that tidal dissipation of rotational energy associated with resonant coupling could provide a substantial heat pulse to the CMB. D'' Layer Activation (DLA) by dumping of rotational energy could have important geodynamical consequences that we explore here. DLA could lead to a sudden (but modest) increase in the temperature of preexisting plumes, leading to a sudden increase in melt volume without the need for a troublesome plume head. The dissipation depends on non-hydrostatic CMB ellipticity, which itself is a result of mantle convection, leading to the possibility of an important feedback mechanism - DLA would lead to an increase in CMB ellipticity, further increasing the geodynamic importance of DLA.

  3. Analysis and evaluation of forecasting methods and tools to predict future demand for secondary chemical-biological configuration items

    OpenAIRE

    Ritchey, Chris D.

    2013-01-01

    Approved for public release; distribution is unlimited As the Engineering Support Activity (ESA) for numerous consumable Chemical Biological items managed by the Defense Logistics Agency (DLA), Edgewood Chemical Biological Center (ECBC) must be able to complete reviews of all procurement packages within 15 calendar days. With such little lead time, it would be very beneficial if ECBC had the ability to forecast when DLA procurement actions will occur. This thesis presents an evaluation of ...

  4. The EU-Georgia Association Agreement: An Instrument To Support The Development Of Georgia Or Lip Service? / Układ Stowarzyszeniowy Ue – Gruzja: Instrument Wsparcia Rozwoju Gruzji Czy Deklaracja Bez Pokrycia?

    Directory of Open Access Journals (Sweden)

    Kawecka-Wyrzykowska Elżbieta

    2015-06-01

    Full Text Available 1 września 2014 r. wszedł w życie (częściowo układ stowarzyszeniowy między UE i Gruzją. Jego główną część stanowi „Umowa o pogłębionej i całościowej strefie wolnego handlu”, która przewiduje pełną liberalizację handlu wyrobami przemysłowymi i znaczącą redukcję barier w handlu rolnym. Istotna część umowy jest poświęcona eliminacji regulacyjnych barier dla handlu (np. standardów technicznych. Umowa przewiduje też stopniową i częściową liberalizację handlu usługami, jak też szybką i głęboką eliminację barier w zakresie przepływów kapitałowych. Liberalizacja przepływu pracowników ma bardzo ograniczony zakres. Postanowienia układu stowarzyszeniowego UE-Gruzja są podobne do Układów europejskich podpisanych wcześniej przez państwa Europy Środkowej i Wschodniej, jakkolwiek istotne są też różnice. Oczekuje się, że układ stowarzyszeniowy przyniesie wiele korzyści Gruzji, w tym (a stabilizację jej systemu ekonomicznego i prawnego, czyniąc go w efekcie bardziej przewidywalnym dla inwestorów oraz bardziej przyjaznym dla przedsiębiorców; (b zbliżenie wielu przepisów do tych, które obowiązują w UE, co rozszerzy rynek dla gruzińskich towarów i usług; (c lepsze wdrożenie przepisów ważnych dla biznesu. Krótkookresowe korzyści wynikające z liberalizacji handlu będą skromne dla Gruzji, częściowo z uwagi na otwarty dostęp do jej rynku już przed wejściem Układu w życie. Implementacja Układu będzie się też wiązać z kosztami dostosowawczymi, które są zazwyczaj nieuniknioną metodą wzrostu eksportu na wielki rynek UE.

  5. Ekspansja muzeów w Europie Środkowej?

    Directory of Open Access Journals (Sweden)

    Jagodzińska, Katarzyna

    2015-06-01

    Full Text Available Przedmiotem artykułu są rozważania na temat specyfiki Europy Środkowej w zakresie kolekcji i muzeów sztuki współczesnej oraz możliwość stworzenia alternatywy regionalnej dla krajów zachodnich. Kontekstem dla tych rozważań jest ekspansjonistyczna polityka współczesnych muzeów, która w związku z licznymi nowymi inwestycjami – w szczególności Luwru, Fundacji Guggenheima, Ermitażu – budzi w świecie muzeologicznym różnorakie dylematy. Autorka omawia światowe "marki muzealne" inwestujące w Europie Środkowej, zastanawia się nad skutkami ekspansji tych "koncernów" dla kultury w regionie, wskazuje też na potencjał regionu, który można wykorzystać bez posiłkowania się nazwiskami światowych kolekcjonerów.

  6. Influence of High Pressure and High Temperature Hydrogen on Fracture Toughness of Ni-Containing Steels and Alloys

    Directory of Open Access Journals (Sweden)

    Balitskii Alexander

    2014-03-01

    Full Text Available W ramach przeprowadzonych badan okreslono wpływ wodoru na krótkotrwała wytrzymałosc i płasko-naprezeniowa ciagliwosc stali 10Cr15Ni27 oraz stopów niklu 04Cr16Ni56, 05Cr19Ni55 przy wielkosciach cisnienia do 35 MPa i zakresie temperatury od 293 do 773 K. Wpływ wodoru wysokiego cisnienia powoduje, ze wydłuzenie, plastycznosc, wytrzymałosc nisko cyklowa N i parametr odpornosci na pekanie Kc przyjmuja minimalne wartosci dla próbek stopu 04Cr16Ni56 przy cisnieniu wynoszacym 10 MPa, natomiast dla nasyconych wodorem próbek stali 10Cr15Ni27 i stopu 05Cr19Ni55 minimum wartosci tych parametrów wystepuje przy cisnieniu 15 MPa, dla koncentracji wodoru wynoszacej odpowiednio 15 i 19 wppm.

  7. Specific allogeneic unresponsiveness in irradiated dogs reconstituted with autologous bone marrow

    International Nuclear Information System (INIS)

    Rapaport, F.T.; Bachvaroff, R.J.; Akiyama, N.; Sato, T.; Ferrebee, J.W.

    1980-01-01

    Hemopoietic reconstitution of supralethally irradiated adult dogs of the Cooperstown colony with their own stored bone marrow can produce long-term unresponsiveness to DLA-identical kidney allografts with no need for any additional immunosuppression. Eleven of 18 kidneys transplanted 12 h after replacement of autologous marrow into irradiated recipients currently survive with normal function for as long as 1417 d; 8 of 13 organs transplanted 28 h after marrow replacement, and 8 of 13 organs transplanted 36 h after marrow injection, currently survive up to 502 d, with no further treatment. Alterations in the timing and sequence of each procedure decrease the incidence of unresponsiveness. Survival and function of the kidney allografts were not affected by the rejection of successive skin grafts from the kidney donor. Skin grafts from other DLA-identical donors and DLA-incompatible skin grafts were rejected by the same recipients in uniform fashion

  8. Preoperative preparation of high-risk, specifically hyperimmunized canine renal allograft recipients with total-lymphoid irradiation and cyclosporine

    International Nuclear Information System (INIS)

    Rapaport, F.T.; Meek, A.G.; Arnold, A.N.; Miura, S.; Hayashi, R.; Strober, S.

    1987-01-01

    Hyperimmunized subjects are a particularly high-risk and rapidly growing group in the patient population awaiting renal transplantation. In a search for methods designed to ameliorate the prognosis in such cases, dogs of defined DLA genotype were sensitized with DLA incompatible skin allografts and injections of buffy coat. Each recipient was challenged with a renal allograft bearing the same DLA incompatibilities. Five dogs received kidney transplants, without any other treatment, and rejected their transplants at 2.5, 4, 5, 6, and 6.5 days, respectively. Another four dogs were given a 9-11-week course (1760 +/- 35 cGy) of total-lymphoid irradiation (TLI), followed by rabbit antithymocyte globulin (ATG); these animals rejected their renal allografts at 7, 8, 14, and 17 days, respectively. Five other dogs were treated with TLI and received cyclosporine (CsA) and methylprednisolone (MPd) daily until graft rejection. Their renal allografts survived for 7.5, 8.5, 20, 62, and 227 days, respectively. Renal allografts placed in normal recipients under the same conditions of donor-recipient DLA incompatibility had a mean survival time of 12.4 days (range: 10-18 days). At the time of transplantation, the specific anti-DLA antibody titers in the recipients were 81 to 243 in the untreated dogs; 27 to 81 in the TLI-ATG-treated group, and 3 to 243 in the TLI-CsA/MPd-treated group. The titers fell within 24-48 hr after renal transplantation, to 3 to 81 in the untreated sensitized dogs; they were 3 to 9 in the TLI-ATG-treated group, and were 9 to 243 in the TLI-CsA/MPd treated group. The cytotoxic antibody titers reached postoperative peaks of 6500 to 200,000 in the untreated dogs; 729 to 6500 in the TLI-ATG-treated dogs, and 243 to 6500 in the TLI-CsA/MPd-treated recipients

  9. Development of a 20 MeV Dielectric-Loaded Test Accelerator

    International Nuclear Information System (INIS)

    Gold, Steven H.; Fliflet, Arne W.; Lombardi, Marcie; Kinkead, Allen K.; Gai, Wei; Power, John G.; Konecny, Richard; Long, Jidong; Jing, Chunguang; Tantawi, Sami G.; Nantista, Christopher D.; Bruce, Ralph W.; Lewis, David III

    2006-01-01

    This paper presents a progress report on a joint project by the Naval Research Laboratory (NRL) and Argonne National Laboratory (ANL), in collaboration with the Stanford Linear Accelerator Center (SLAC), to develop a dielectric-loaded test accelerator in the magnicon facility at NRL. The accelerator will be powered by an experimental 11.424-GHz magnicon amplifier that presently produces 25 MW of output power in a ∼250-ns pulse at up to 10 Hz. The accelerator will include a 5-MeV electron injector originally developed at the Tsinghua University in Beijing, China, and can incorporate DLA structures up to 0.5 m in length. The DLA structures are being developed by ANL, and shorter test structures fabricated from a variety of dielectric materials have undergone testing at NRL at gradients up to ∼8 MV/m. SLAC has developed components to distribute the power from the two magnicon output arms to the injector and to the DLA accelerating structure with separate control of the power ratio and relative phase. RWBruce Associates, Inc., working with NRL, has investigated means to join short ceramic sections into a continuous accelerator tube by a brazing process using an intense 83-GHz beam. The installation and testing of the first dielectric-loaded test accelerator, including injector, DLA test structure, and spectrometer, should take place within the next year

  10. Bezpieczne formy aktywności fizycznej dla kobiet w ciąży = Secure forms of physical activity for pregnant women

    Directory of Open Access Journals (Sweden)

    Katarzyna Urtnowska

    2016-05-01

    4Wydział Kultury Fizycznej, Zdrowia i Turystyki, Uniwersytet Kazimierza Wielkiego w Bydgoszczy           mgr Katarzyna Urtnowska1, dr n. med. Irena Bułatowicz2, dr hab. n. med. Grzegorz Ludwikowski3, dr hab. Walery Zukow4 1Uczestnik studiów dokotranckich z zakresu Nauk o Zdrowiu; Zakład Medycyny Rozdrodu i Andrologii, Collegium Medicum im. L. Rydygiera w Bydgoszczy Uniwersytet Mikołaja Kopernika w Toruniu 2Katedra Fizjoterapii - Zakład Fizjoterapii Klinicznej, Collegium Medicum im. L. Rydygiera w Bydgoszczy Uniwersytet Mikołaja Kopernika w Toruniu 3Zakład Medycyny Rozdrodu i Andrologii, Collegium Medicum im. L. Rydygiera w Bydgoszczy Uniwersytet Mikołaja Kopernika w Toruniu 4Wydział Kultury Fizycznej, Zdrowia i Turystyki, Uniwersytet Kazimierza Wielkiego w Bydgoszczy           Słowa kluczowe: ciąża, aktywność fizyczna, sport. Keywords: pregnancy, physical activity, sport.           Streszczenie Kobieta spodziewać się dziecka w dzisiejszych czasach ma wiele możliwości podjęcia bezpiecznej formy aktywności fizycznej. Z odrobiną racjonalnego podejścia może kontynuować uprawianie ulubionego sportu, lub uczestniczyć w zajęciach przygotowanych specjalnie dla ciężarnych. Aktywność fizyczna uprawiana regularnie w trakcie ciąży jest kluczowym czynnikiem wpływającym na zdrowie i samopoczucie matki. Ćwiczenia wpływają korzystnie na stan zdrowia poprzez zmniejszenie dolegliwości bólowych kręgosłupa, ogólną poprawę lub brak pogorszenia sprawności fizycznej, zapobieganie nadmiernemu przyrostowi masy ciała i poprawę samopoczucia ciężarnej. Dodatkowym, a zarazem najważniejszym efektem jest zwiększenie wydolności fizycznej niezbędnej do porodu siłami natury i skrócenie czasu jego przebiegu oraz czasu regeneracji organizmu w połogu, a co za tym idzie, szybszy powrót do formy sprzed ciąży.     Abstract A women expect a child a child today has a lot of possibilities for secure forms of physical activity. With

  11. PŁATNY URLOP DLA PORATOWANIA ZDROWIA

    OpenAIRE

    Kucharski, Piotr

    2007-01-01

    The paper analyses a paid health improvement leave taken under the binding rules in Poland, which apply to certain groups o f employees of public institutions. This leave, also known as a paid leave for health purposes, or convalescence leave, is regulated by special rules of some acts, and certain regulations based on those acts. The purpose of this leave is always the same and involves the need to refrain from work for the realisation of the recommended therapeutic treatment....

  12. Technical Support DLA Apparel Research Network

    National Research Council Canada - National Science Library

    Guthrie, Jeffrey

    2002-01-01

    The Defense Logistics Agency's Research and Development Enterprise Division established a network of universities, equipment suppliers, apparel manufacturers, industry consultants and software developers...

  13. Chemical Abundances in SFG and DLA

    OpenAIRE

    Schulte-Ladbeck, Regina E.; König, Brigitte; Cherinka, Brian

    2005-01-01

    We investigate the chemical abundances of local star-forming galaxies which cause Damped Lyman Alpha lines. A metallicity versus redshift diagram is constructed, on which the chemical abundances of low-redshift star-forming galaxy populations are compared with those of high-redshift Damped Lyman Alpha systems. We disucss two types of experiments on individual star-forming galaxies. In the first, the Damped Lyman Alpha line is created against an internal ultraviolet light source generated by a...

  14. DLA Energy Biofuel Feedstock Metrics Study

    Science.gov (United States)

    2012-12-11

    moderately/highly in- vasive  Metric 2: Genetically modified organism ( GMO ) hazard, Yes/No and Hazard Category  Metric 3: Species hybridization...4– biofuel distribution Stage # 5– biofuel use Metric 1: State inva- siveness ranking Yes Minimal Minimal No No Metric 2: GMO hazard Yes...may utilize GMO microbial or microalgae species across the applicable biofuel life cycles (stages 1–3). The following consequence Metrics 4–6 then

  15. Development of a 20 MeV Dielectric-Loaded Accelerator Test Facility

    International Nuclear Information System (INIS)

    Gold, Steven H.; Fliflet, Arne W.; Kinkead, Allen K.; Gai Wei; Power, John G.; Konecny, Richard; Jing Chunguang; Tantawi, Sami G.; Nantista, Christopher D.; Hu, Y.; Chen, H.; Tang, C.; Lin, Y.; Bruce, Ralph W.; Bruce, Robert L.; Lewis, David III

    2004-01-01

    This paper describes a joint project by the Naval Research Laboratory (NRL) and Argonne National Laboratory (ANL), in collaboration with the StanFord Linear Accelerator Center (SLAC), to develop a dielectric-loaded accelerator (DLA) test facility powered by a high-power 11.424-GHz magnicon amplifier. The magnicon can presently produce 25 MW of output power in a 250-ns pulse at 10 Hz, and efforts are in progress to increase this to 50 MW. The facility will include a 5 MeV electron injector being developed by the Accelerator Laboratory of Tsinghua University in Beijing, China. The DLA test structures are being developed by ANL, and some have undergone testing at NRL at gradients up to ∼8 MV/m. SLAC is developing a means to combine the two magnicon output arms, and to drive an injector and accelerator with separate control of the power ratio and relative phase. RWBruce Associates, Inc., working with NRL, is developing a means to join short ceramic sections into a continuous accelerator tube by ceramic brazing using an intense millimeter-wave beam. The installation and testing of the first dielectric-loaded test accelerator, including injector, DLA structure, and spectrometer, should take place within the next year. The facility will be used for testing DLA structures using a variety of materials and configurations, and also for testing other X-band accelerator concepts. The initial goal is to produce a compact 20 MeV dielectric-loaded test accelerator

  16. Unveiling the Secrets of Metallicity and Massive Star Formation Using DLAs Along Gamma-Ray Bursts

    Science.gov (United States)

    Cucchiara, A.; Fumagalli, M.; Rafelski, M.; Kocevski, D.; Prochaska, J. X.; Cooke, R. J.; Becker, G. D.

    2015-01-01

    We present the largest, publicly available, sample of Damped Lyman-alpha systems (DLAs) along Swift discovered Gamma-ray Bursts (GRB) line of sights in order to investigate the environmental properties of long GRB hosts in the z = 1.8 - 6 redshift range. Compared with the most recent quasar DLAs sample (QSO-DLA), our analysis shows that GRB-DLAs probe a more metal enriched environment at z approximately greater than 3, up to [X/H] approximately -0.5. In the z = 2 - 3 redshift range, despite the large number of lower limits, there are hints that the two populations may be more similar (only at 90% significance level) than at higher redshifts. Also, at high-z, the GRB-DLA average metallicity seems to decline at a shallower rate than the QSO-DLAs: GRB-DLA hosts may be polluted with metals at least as far as approximately 2 kpc from the GRB explosion site, probably due to previous star-formation episodes and/or supernovae explosions. This shallow metallicity trend, extended now up to z approximately 5, confirms previous results that GRB hosts are star-forming and have, on average, higher metallicity than the general QSO-DLA population. Finally, our host metallicity measurements are broadly consistent with the predictions derived from the hypothesis of two channels of GRB progenitors, one of which is mildly affected by a metallicity bias, although more data are needed to constrain the models at z approximately greater than 4.

  17. Realizacja „Programu zapobiegania zaburzeniom depresyjnym dla dzieci i młodzieży” w województwie łódzkim

    Directory of Open Access Journals (Sweden)

    Justyna Felcenloben

    2015-10-01

    Full Text Available Zaburzenia depresyjne stanowią istotny czynnik ryzyka zachowań samobójczych wśród nastolatków. Wykazano, że u młodocianych pacjentów po próbach samobójczych z rozpoznaną depresją występują określone czynniki ryzyka, w tym trudności szkolne i w relacjach z rówieśnikami. W programach prewencji samobójstw podkreśla się potrzebę wczesnego wykrywania zaburzeń depresyjnych i szybkiego wdrażania odpowiednich strategii terapeutycznych. Prezentowany w artykule „Program zapobiegania zaburzeniom depresyjnym dla dzieci i młodzieży” został opracowany w Departamencie Polityki Zdrowotnej Urzędu Marszałkowskiego Województwa Łódzkiego. Realizowany jest corocznie od 2010 roku przez podmioty wyłaniane w otwartych konkursach ofert. Główne cele Programu to zmniejszenie częstości występowania pełnoobjawowej depresji przez zidentyfikowanie u badanych dzieci czynników predysponujących do jej wystąpienia oraz redukcja tych czynników za sprawą zastosowanej interwencji, czyli uczestnictwa w zajęciach warsztatowych. Za cele szczegółowe autorzy uznali m.in. nabycie pożądanych umiejętności społecznych, nazywania i wyrażania odczuwanych emocji, poznanie technik radzenia sobie ze stresem, poprawę samooceny, a także podniesienie stanu wiedzy dzieci i ich rodzin na temat depresji, metod jej profilaktyki i leczenia, co może być szczególnie przydatne w przypadku pojawienia się lub nawrotu choroby. Analiza efektywności Programu obejmowała lata 2010–2013. Każdego roku Programem obejmowano ponad 0,5% populacji województwa łódzkiego w wieku 11–16 lat, łącznie w ciągu czterech lat przebadano ponad 2% populacji w tej grupie wiekowej. Do warsztatów terapeutycznych zakwalifikowano niemal co drugiego ucznia z ryzykiem depresji (20% nastolatków przebadanych w pierwszym etapie programu, u co piątego dziecka stwierdzono konieczność dalszej diagnostyki bądź terapii w poradni zdrowia

  18. Pośrednictwo Jakuba Kazimierza Rubinkowskiego w konserwacji i zakupie książek dla Elżbiety Sieniawskiej w końcu pierwszej ćwierci XVIII w.

    Directory of Open Access Journals (Sweden)

    Adam Kucharski

    2015-12-01

    Full Text Available Wielowymiarowa działalność toruńskiego rajcy i poczmistrza królewskiego Jakuba Kazimierza Rubinkowskiego zorientowana była głównie na prowadzenie agencji informacyjnej zajmującej się redagowaniem i kolportażem prasy rękopiśmiennej. Ważnym aspektem jego aktywności kulturalnej stało się również pośredniczenie w załatwianiu usług introligatorskich i kupnie książek dla hetmanowej wielkiej koronnej i kasztelanowej krakowskiej Elżbiety Sieniawskiej. Rubinkowski, szlachcic, a zarazem barokowy erudyta i zapalony bibliofil, był idealnym kandydatem do realizacji tych zadań. O jego przydatności decydowała silna pozycja Torunia na polskim rynku księgarskim gwarantująca możliwość nabywania poszukiwanych tomów ksiąg, zarówno krajowych, jak i zagranicznych autorów. Kwerenda księgarska obejmowała dzieła ojca Sieniawskiej, Stanisława Herakliusza Lubomirskiego, innych autorów polskich (również z obszaru Prus Królewskich, a także klasyków nowożytnej literatury europejskiej. Niemniej ważnym atutem Rubinkowskiego była również możliwość bezpośredniego kontaktu z toruńskim cechem mistrzów introligatorskich, co zapewniało Sieniawskiej sprawny proceder konserwacji i renowacji ksiąg, pochodzących głównie z jej biblioteki w Puławach. Rubinkowski, szczególnie w latach 1725–1726, wielokrotnie i skrupulatnie informował o zbliżających się aukcjach książek organizowanych w Toruniu, przyjmował księgi ekspediowane statkami z Puław oraz organizował transport powrotny z akupionych i odnowionych woluminów. W sumie w ciągu zaledwie dwóch lat przez jego ręce przewinęło się kilkaset książek, czyniąc go jednym z czołowych agentów księgarskich tego czasu w Rzeczypospolitej Obojga Narodów.

  19. Teologia ekonomiczna, rządzenie i neoliberalizm. Lekcje z "Królestwa i Chwały"

    Directory of Open Access Journals (Sweden)

    German Eduardo Primera

    2015-04-01

    Full Text Available Celem artykułu jest sprawdzenie Agambenowskich badań w obszarze teologii ekonomicznej w celu podkreślenia ich znaczenia dla krytyki współczesnej polityki neoliberalnej. W pierwszej części autor przedstawia podsumowanie głównych tez zawartych w książce Królestwo i chwała. W szczególności skupia się zarówno na ujęciu oikonomii we wczesnochrześcijańskich debatach na boską trójcą, jak i jej związku z prowidencjalnym paradygmatem rządzenia. Następnie pokazuje, jak ta genealogia oikonomii może być przydatna dla politycznej analizy teraźniejszości. Stanowi to jednocześnie odpowiedź na niektóre z zarzutów postawionych Królestwu i chwale przez Alberta Toscano. W końcowej części autor podsumowuje swoje rozważania, pokazując szczególne znaczenie prac Agambena dla badań nad polityczną racjonalnością neoliberalizmu.

  20. Improved Asymmetric Cipher Based on Matrix Power Function with Provable Security

    Directory of Open Access Journals (Sweden)

    Eligijus Sakalauskas

    2017-01-01

    Full Text Available The improved version of the author’s previously declared asymmetric cipher protocol based on matrix power function (MPF is presented. Proposed modification avoids discrete logarithm attack (DLA which could be applied to the previously declared protocol. This attack allows us to transform the initial system of MPF equations to so-called matrix multivariate quadratic (MMQ system of equations, which is a system representing a subclass of multivariate quadratic (MQ systems of equations. We are making a conjecture that avoidance of DLA in protocol, presented here, should increase its security, since an attempt to solve the initial system of MPF equations would appear to be no less complex than solving the system of MMQ equations. No algorithms are known to solve such a system of equations. Security parameters and their secure values are defined. Security analysis against chosen plaintext attack (CPA and chosen ciphertext attack (CCA is presented. Measures taken to prevent DLA attack increase the security of this protocol with respect to the previously declated protocol.

  1. Conditions For The Development Of Polish Agriculture In The Context Of Globalization And European Integration / Uwarunkowania Rozwoju Polskiego Rolnictwa W Warunkach Globalizacji I Integracji Europejskiej

    Directory of Open Access Journals (Sweden)

    Dworak Edyta

    2015-06-01

    Full Text Available Współczesne badania nad świadczeniami (usługami ekosystemów (środowiska potwierdzają rangę i znaczenie środowiska przyrodniczego i jego zasobów dla kształtowania dobrobytu człowieka. Szczególnie mocno akcentują ochronę żywych zasobów przyrody dla zachowania bioróżnorodności, która jest niezbędna dla utrzymania podstawowych procesów ekologicznych oraz zapewnienie trwałości użytkowania tychże zasobów. W efekcie ochrona bioróżnorodności to nie tylko problem przyrodniczy, ale również problem ekonomiczny i społeczny, dobrobytu i jakości życia. Zatem różnorodność biologiczna jest niezbędnym warunkiem zapewnienia bezpieczeństwa ekologicznego zachowania ciągłości procesów przyrodniczych, warunków i jakości życia oraz potencjału gospodarczego.

  2. Preliminary results on performance of new ultra-fast static positioning module – POZGEO-2 in areas outside the ASG-EUPOS network

    Directory of Open Access Journals (Sweden)

    Paziewski Jacek

    2014-06-01

    Full Text Available W pracy prezentowane są badania dotyczące dokładności i wiarygodności pozycji wyznaczanej z wykorzystaniem nowego modułu ultra-szybkiego pozycjonowania - POZGEO-2 opracowanego dla systemu ASG-EUPOS. Przedstawione testy obliczeniowe dotyczą szczególnego przypadku wyznaczania pozycji, gdy użytkownik znajduje się poza granicami sieci stacji referencyjnych. W takich warunkach wymagana jest ekstrapolacja sieciowych poprawek atmosferycznych. Wpływa to negatywnie na dokładność tych poprawek i może doprowadzić do sytuacji, w której wyznaczenie nieoznaczoności będzie niemożliwe. Prezentowane badania oparte są na pięciominutowych sesjach obserwacyjnych i pokazują, że poprawki mogą być ekstrapolowane dla obszarów położonych do około 35 km od granic sieci ASG-EUPOS. Oznacza to, że w praktyce precyzyjne pozycjonowanie ultra-szybkie z użyciem modułu POZGEO-2 może być zapewnione dla niemal całego obszaru Polski

  3. The effect of genetic bottlenecks and inbreeding on the incidence of two major autoimmune diseases in standard poodles, sebaceous adenitis and Addison's disease.

    Science.gov (United States)

    Pedersen, Niels C; Brucker, Lynn; Tessier, Natalie Green; Liu, Hongwei; Penedo, Maria Cecilia T; Hughes, Shayne; Oberbauer, Anita; Sacks, Ben

    2015-01-01

    Sebaceous adenitis (SA) and Addison's disease (AD) increased rapidly in incidence among Standard Poodles after the mid-twentieth century. Previous attempts to identify specific genetic causes using genome wide association studies and interrogation of the dog leukocyte antigen (DLA) region have been non-productive. However, such studies led us to hypothesize that positive selection for desired phenotypic traits that arose in the mid-twentieth century led to intense inbreeding and the inadvertent amplification of AD and SA associated traits. This hypothesis was tested with genetic studies of 761 Standard, Miniature, and Miniature/Standard Poodle crosses from the USA, Canada and Europe, coupled with extensive pedigree analysis of thousands more dogs. Genome-wide diversity across the world-wide population was measured using a panel of 33 short tandem repeat (STR) loci. Allele frequency data were also used to determine the internal relatedness of individual dogs within the population as a whole. Assays based on linkage between STR genomic loci and DLA genes were used to identify class I and II haplotypes and disease associations. Genetic diversity statistics based on genomic STR markers indicated that Standard Poodles from North America and Europe were closely related and reasonably diverse across the breed. However, genetic diversity statistics, internal relatedness, principal coordinate analysis, and DLA haplotype frequencies showed a marked imbalance with 30 % of the diversity in 70 % of the dogs. Standard Poodles with SA and AD were strongly linked to this inbred population, with dogs suffering with SA being the most inbred. No single strong association was found between STR defined DLA class I or II haplotypes and SA or AD in the breed as a whole, although certain haplotypes present in a minority of the population appeared to confer moderate degrees of risk or protection against either or both diseases. Dogs possessing minor DLA class I haplotypes were half as

  4. Measuring distributed leadership agency in a hospital context.

    Science.gov (United States)

    Jønsson, Thomas; Unterrainer, Christine; Jeppesen, Hans-Jeppe; Jain, Ajay Kumar

    2016-09-19

    Purpose The purpose of this paper is to develop and validate an instrument that can measure distributed leadership (DL) as employees' active participation in DL tasks. The authors designate this as the distributed leadership agency (DLA). Design/methodology/approach Data were collected throughout all departments and occupational groups at a merged centralized hospital setting in Denmark. A total of 1,774 employees from 24 hospital departments and 16 occupational groups completed our survey. Structural equation model and confirmatory factor analyses were applied to identify appropriate items and a test for measurement invariance, predictive, discriminant and convergent validity, and ANOVAs were applied to analyse group differences in DLA. Findings The identified unidimensional questionnaire consists of seven items, as it is different from, but associated with, empowering leadership, organizational influence, attitude to participation and trust in management. As theoretically predicted, DLA is positively related to self-efficacy, job satisfaction and innovative behaviour. Chief physicians, permanent employees and employee representatives scored higher on the scale than the rest of their respective counterparts. Practical implications The survey offers a method to assess a distribution of leadership agency in hospital organizations. Such assessment may provide a basis for organizational and leadership development. Originality/value The present study provides a reliable and valid quantitative instrument that measures how much employees at all hierarchical levels are involved in concrete leadership activities in the hospital context. Taking a normative perspective the authors could show that DL - measured with the DLA-questionnaire - has positive effects on employees' behaviour.

  5. Analytical Method of Designing and Selecting Take-Up Systems for Mining Belt Conveyors / Analityczna Metoda Projektowania i Doboru UKŁADÓW Napinania Dla GÓRNICZYCH PRZENOŚNIKÓW TAŚMOWYCH

    Science.gov (United States)

    Kulinowski, Piotr

    2013-12-01

    ężystości taśmy uwzględnianego w obliczeniach drogi napinania jest korygowana na podstawie zależności przedstawionej w niniejszym artykule. Zastępczy moduł sprężystości taśmy powinien być uwzględniony w algorytmie obliczania długości skokuwózka napinającego, szczególnie dla przenośników, których złożony profil trasy może przyczynić się do lokalnego zmniejszenia sił w taśmie. W kolejnej części artykułu przedstawiono metodę konstruowania charakterystyk statycznych urządzeń napinających taśmę (Jabłoński, 1988), które wykorzystano do opisu stosowanych układów napinania taśmy. Spośród stosowanych urządzeń napinających przedstawiono rozwiązania ze stałym położeniem bębna napinającego podczas pracy przenośnika - tzw. sztywne urządzenia napinające oraz ze zmiennym położeniem bębna napinającego w czasie pracy przenośnika - grawitacyjne, hydrauliczne, automatyczne i nadążne. Na diagramach opisujących charakterystykę napinania, poza wymaganą wartością siły w taśmie zbiegającej z bębna napędowego, przedstawiono spodziewany przebieg jej zmiany w funkcji momentu napędowego, charakterystyczny dla danego typu urządzenia napinającego taśmę (Kulinowski, 2012). Podsumowanie artykułu stanowi przedstawienie propozycji wykorzystania charakterystyk statycznych urządzeń napinających do oceny pracy ciernego, bębnowego układu napędowego przenośnika taśmowego. Przedstawiona w artykule metoda obliczeniowa została weryfikowana poprzez badania przemysłowe i realizacje wielu złożonych projektów przenośników taśmowych uzupełnionych analizą wyników badań symulacyjnych dynamiki pracy modeli urządzeń napinających taśmę (Kulinowski, 2012).

  6. On the mass-metallicity relation, velocity dispersion and gravitational well depth of GRB host galaxies

    DEFF Research Database (Denmark)

    Arabsalmani, Maryam; Møller, Palle; Fynbo, Johan P. U.

    2015-01-01

    -DLA samples and compare the measured stellar masses for the four hosts where stellar masses have been determined from SED fits. We find excellent agreement and conclude that, on basis of all available data and tests, long duration GRB-DLA hosts and intervening QSO-DLAs are consistent with being drawn from...... away from the metallicity in the centre of the galaxy, second the path of the sightline through different parts of the potential well of the dark matter halo will cause different velocity fields to be sampled. We report evidence suggesting that this second effect may have been detected....

  7. Gospodarka oparta na wiedzy w ujęciu regionalnym

    OpenAIRE

    Strożek, Piotr

    2015-01-01

    Gospodarka oparta na wiedzy (GOW) to niezwykle ważne i aktualne zagadnienie we współczesnej ekonomii, zarówno pod względem teoretycznym, jak i aplikacyjnym. Rozwój gospodarki opartej na wiedzy stał się priorytetowym wyzwaniem dla wielu krajów, w tym również dla Polski. Powszechnie wiadomo, że we współczesnym świecie rozwój społeczno-gospodarczy jest coraz bardziej uzależniony od intensyfikacji i dyfuzji wiedzy oraz kreowania i generowania innowacji. W pewien sposób takie działania narzuca pol...

  8. Can the Spatial Point Patterns of Animal Distributions Be Detected Using Sparse Samples? A Case Study of Four Soricomorpha (Mammalia) Species in Poland / Czy Przestrzenny Wzorzec Rozkładu Punktów W Dystrybucji Zwierząt Może Zostać Określony Na Podstawie Rzadkiego Próbkowania? Studium Przypadku Na Czterech Gatunkach Soricomorpha (Mammalia) Występujących W Polsce.

    OpenAIRE

    Chen Youhua

    2014-01-01

    W niniejszej pracy użyto funkcji K.-Ridley’a oraz alternatywnych modeli przestrzennego rozkładu punktów dla wyliczenia i porównania mieszanych danych o dystrybucji czterech gatunków ssaków występujących w Polsce, należących do Soricomorpha (Talpa europaea, Sorex araneus, Sorex minutus i Neomys fodiens) na podstawie prób o różnej wielkości. Następujące modele zostały dopasowane i porównane: homogeniczny proces Poissona (HPP) z niehomogenicznym procesem Poissona (1PP). Dla modeli 1PP zmiennymi ...

  9. The AGL equation from the dipole picture

    International Nuclear Information System (INIS)

    Gay Ducati, M.B.; Goncalves, V.P.

    1999-01-01

    The AGL equation includes all multiple pomeron exchanges in the double logarithmic approximation (DLA) limit, leading to a unitarized gluon distribution in the small x regime. This equation was originally obtained using the Glauber-Mueller approach. We demonstrate in this paper that the AGL equation and, consequently, the GLR equation, can also be obtained from the dipole picture in the double logarithmic limit, using an evolution equation, recently proposed, which includes all multiple pomeron exchanges in the leading logarithmic approximation. Our conclusion is that the AGL equation is a good candidate for a unitarized evolution equation at small x in the DLA limit

  10. Distributed leadership agency and innovative behaviour

    DEFF Research Database (Denmark)

    Ottsen, Christina L.; Jønsson, Thomas Faurholt; Kähler, Helena Grøn

    Distributed leadership agency (DLA) is a specific form of employee agency, in which employees participate actively in undertaking leadership tasks in different domains. The present study assumes a distributed leadership paradigm that focuses on employees as potential leadership agents per se. We ...... propose that this approach to leadership may provide a substantial understanding of employees’ engagement in innovation at work.......Distributed leadership agency (DLA) is a specific form of employee agency, in which employees participate actively in undertaking leadership tasks in different domains. The present study assumes a distributed leadership paradigm that focuses on employees as potential leadership agents per se. We...

  11. THE NATURE OF DAMPED Lyα SYSTEMS AND THEIR HOSTS IN THE STANDARD COLD DARK MATTER UNIVERSE

    International Nuclear Information System (INIS)

    Cen Renyue

    2012-01-01

    Using adaptive mesh refinement cosmological hydrodynamic simulations with a physically motivated supernova feedback prescription, we show that the standard cold dark matter model can account for extant observed properties of damped Lyα systems (DLAs). With detailed examination of DLAs identified for each redshift snapshot through ray tracing through the simulation volumes containing thousands of galaxies, we find the following: (1) While DLA hosts roughly trace the overall population of galaxies at all redshifts, they are always gas-rich and have tendencies of being slightly smaller and bluer. (2) The history of DLA evolution is cosmological in nature and reflects primarily the evolution of the underlying cosmic density, galaxy size, and galaxy interactions. With higher density and more interactions at high redshift the size of DLAs is a larger fraction of their virial radius. (3) The variety of DLAs at high redshift is richer with a large contribution coming from galactic aqueducts, created through close galaxy interactions. The portion of gaseous disks of galaxies where most stars reside makes a relatively small contribution to DLA incidence at z = 3-4. (4) The majority of DLAs arise in halos of mass M h = 10 10 -10 12 M ☉ at z = 1.6-4, as these galaxies dominate the overall population of galaxies then. At z = 3-4, 20%-30% of DLA hosts are Lyman break galaxies (LBGs), 10%-20% are due to galaxies more massive than LBGs, and 50%-70% are from smaller galaxies. (5) Galactic winds play an indispensable role in shaping the kinematic properties of DLAs. Specifically, the high velocity width DLAs are a mixture of those arising in high-mass, high velocity dispersion halos and those arising in smaller mass systems where cold gas clouds are entrained to high velocities by galactic winds. (6) In agreement with observations, we see a weak but noticeable evolution in DLA metallicity. The metallicity distribution centers at [Z/H] = –1.5 to –1 and spans more than three

  12. Dog leucocyte antigen class II diversity and relationships among indigenous dogs of the island nations of Indonesia (Bali), Australia and New Guinea.

    Science.gov (United States)

    Runstadler, J A; Angles, J M; Pedersen, N C

    2006-11-01

    The genetic polymorphism at the dog leucocyte antigen (DLA) class II loci DQA1, DQB1 and DRB1 was studied in a large genetically diverse population of feral and wild-type dogs from the large island nations of Indonesia (Bali), Australia and New Guinea (Bali street dog, dingo and New Guinea singing dog, respectively). Sequence-based typing (SBT) of the hypervariable region of DLA-DRB1, -DQA1 and -DQB1 alleles was used to determine genetic diversity. No new DQA1 alleles were recognized among the three dog populations, but five novel DLA-DRB1 and 2 novel DLA-DQB1 allele sequences were detected. Additional unknown alleles were postulated to exist in Bali street dogs, as indicated by the large percentage of individuals (15%-33%) that had indeterminate DRB1, DQA1 and DQB1 alleles by SBT. All three groups of dogs possessed alleles that were relatively uncommon in conventional purebreds. The New Guinea singing dog and dingo shared alleles that were not present in the Bali street dogs. These findings suggested that the dingo was more closely related to indigenous dogs from New Guinea. Feral dog populations, in particular large ones such as that of Bali, show genetic diversity that existed prior to phenotypic selection for breeds originating from their respective regions. This diversity needs to be identified and maintained in the face of progressive Westernization. These populations deserve further study as potential model populations for the evolution of major histocompatibility complex alleles, for the study of canine genetic diversity, for the development of dog breeds and for studies on the comigration of ancestral human and dog populations.

  13. Improvement of d-Lactic Acid Production in Saccharomyces cerevisiae Under Acidic Conditions by Evolutionary and Rational Metabolic Engineering.

    Science.gov (United States)

    Baek, Seung-Ho; Kwon, Eunice Y; Bae, Sang-Jeong; Cho, Bo-Ram; Kim, Seon-Young; Hahn, Ji-Sook

    2017-10-01

    Microbial lactic acid (LA) production under acidic fermentation conditions is favorable to reduce the production cost, but circumventing LA toxicity is a major challenge. A d-LA-producing Saccharomyces cerevisiae strain JHY5610 is generated by expressing d-lactate dehydrogenase gene (Lm. ldhA) from Leuconostoc mesenteroides, while deleting genes involved in ethanol production (ADH1, ADH2, ADH3, ADH4, and ADH5), glycerol production (GPD1 and GPD2), and degradation of d-LA (DLD1). Adaptive laboratory evolution of JHY5610 lead to a strain JHY5710 having higher LA tolerance and d-LA-production capability. Genome sequencing of JHY5710 reveal that SUR1 I245S mutation increases LA tolerance and d-LA-production, whereas a loss-of-function mutation of ERF2 only contributes to increasing d-LA production. Introduction of both SUR1 I245S and erf2Δ mutations into JHY5610 largely mimic the d-LA-production capability of JHY5710, suggesting that these two mutations, which could modulate sphingolipid production and protein palmitoylation, are mainly responsible for the improved d-LA production in JHY5710. JHY5710 is further improved by deleting PDC1 encoding pyruvate decarboxylase and additional integration of Lm. ldhA gene. The resulting strain JHY5730 produce up to 82.6 g L -1 of d-LA with a yield of 0.83 g g -1 glucose and a productivity of 1.50 g/(L · h) in fed-batch fermentation at pH 3.5. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Protective Effect of Zingiber officinale Against Dalton's Lymphoma Ascites Tumour by Regulating Inflammatory Mediator and Cytokines.

    Science.gov (United States)

    Rubila, Sundararaj; Ranganathan, Thottiam Vasudevan; Sakthivel, Kunnathur Murugesan

    2016-12-01

    The aim of the present investigation was to evaluate Zingiber officinale paste against Dalton's lymphoma ascites (DLA)-induced tumours in Swiss albino mice. Experimental animals received Z. officinale paste (low dose 100 mg/kg bw and high dose 500 mg/kg bw) orally for eight alternative days. Treatment with Z. officinale paste showed significant increase in haemoglobin level and decrease in aspartate amino transferase (AST), alanine aminotransferase (ALT), alkaline phosphatase (ALP) and gamma glutamyl transferase (γ-GT) level. Z. officinale paste reduced the inflammatory mediators and cytokine levels, such as inducible nitric oxide (iNOS), tumour necrosis factor level (TNF-α) and interleukin-1β (IL-1β). Treatment with Z. officinale paste also significantly increased the antioxidant enzyme level, such as superoxide dismutase (SOD), catalase (CAT), reduced glutathione (GSH) and glutathione transferase (GST), and decreased the lipid peroxidation. Treatment also increased the vitamin C and E levels in treated animals compared with the DLA-bearing host. Histopathological studies also confirmed the protective influence of Z. officinale paste against DLA. The present study suggested that Z. officinale paste could be used as natural spice and a potent antitumour agent.

  15. Synergistic effects of combined immunosuppressive modulation. I. Unresponsiveness to dendritic cell-depleted renal allografts in dogs exposed to total-lymphoid irradiation

    International Nuclear Information System (INIS)

    Rapaport, F.T.; Meek, A.; Miura, S.; Hayashi, R.; Arnold, A.N.; Strober, S.

    1988-01-01

    Attenuation of the allogeneic stimulus provided by dendritic cells (DC) was achieved by irradiation of the donors, followed by their reconstitution with bone marrow from the prospective DLA-identical recipient. Following long-term (131-187 days) recovery free of graft-versus-host (GVH) disease, the chimeric kidneys were placed into the corresponding recipients; such allografts were rejected at 55, 55, and 60 days, respectively. Four other recipients were conditioned with 1750-1790 cgy of total lymphoid irradiation (TLI) and were then given a similar chimeric kidney from the corresponding partner. These allografts currently survive for 296, 295, 290, and 252 days, respectively. A third group of four dogs was exposed to TLI prior to transplantation of a normal DLA-identical kidney. These grafts were rejected at 20, 42, 46, and 242 days, respectively. Thirteen DLA-identical renal allografts transplanted into normal dogs survived for 13-38 days (mean survival time = 28.6 days). Depletion of allogeneic DC alone, or TLI alone, produced relative prolongations in allograft survival in canine recipients. Combined use of these two modalities, however, resulted in long-term allogeneic unresponsiveness in the recipients

  16. Association of canine juvenile generalized demodicosis with the dog leukocyte antigen system.

    Science.gov (United States)

    It, V; Barrientos, L; López Gappa, J; Posik, D; Díaz, S; Golijow, C; Giovambattista, G

    2010-07-01

    Demodectic mange is a well-known parasitic skin disease characterized by the presence of a larger than normal number of Demodex mites (Demodex canis) in the skin of dogs. Recent research has suggested that major histocompatibility complex (MHC) class II expression is higher in the skin of dogs suffering from demodicosis than in normal ones. We have investigated whether canine Dog Leukocyte Antigen (DLA) class II alleles are associated with canine juvenile generalized demodicosis (JGD). In the present study, the analysis of microsatellite markers (FH2202, FH2975 and FH2054) linked to DLA was made in Boxer, Argentinean Mastiff and mixed breed dogs. DNA samples from 56 dogs affected with the disease and 60 breed-matched controls collected in Argentina were analysed. A highly significant association, in some of the analysed markers, in all breeds with the presence of demodicosis was observed with P or =5. The results of this study suggest that an underlying DLA association exists with demodicosis in dogs and that this may represent an important immunological risk factor in the aetiology of this condition. This information could be used in the future to develop diagnostic tests to prevent canine JGD.

  17. Prognozowanie zmian korytotwórczych w uregulowanym korycie rzeki Czarny Dunajec z wykorzystaniem modelu jednowymiarowego

    Directory of Open Access Journals (Sweden)

    Karol Plesiński

    2017-09-01

    Full Text Available W pracy przedstawiono prognozę zmian korytotwórczych w korycie rzeki uregulowanej za pomocą bystrza o zwiększonej szorstkości. Obszar badań znajdował się na rzece Czarny Dunajec i obejmował swoim zasięgiem 100-metrowy odcinek koryta powyżej bystrza o zwiększonej szorstkości i 65 m poniżej. Na podstawie pomiarów terenowych, modelowania numerycznego oraz z użyciem wykresu Hjulströma określono miejsca, w których występuje erozja koryta, transport lub sedymentacja rumowiska. Modelowanie numeryczne przeprowadzono dla przepływu wezbraniowego Qwez = 16,9 m3·s–1, zaobserwowanego w rzece 5 sierpnia 2013 roku, oraz dla przepływów prawdopodobnych: Q50% = 59 m3·s–1, Q25% = 99 m3·s–1, Q10% = 165 m3·s–1 i Q1% = 321 m3·s–1. Podjęto także próbę wyznaczenia dla badanego odcinka rzeki wartości przepływu korytotwórczego.

  18. The use of antibiotics to improve phage detection and enumeration by the double-layer agar technique

    Directory of Open Access Journals (Sweden)

    Ferreira Eugénio C

    2009-07-01

    Full Text Available Abstract Background The Double-Layer Agar (DLA technique is extensively used in phage research to enumerate and identify phages and to isolate mutants and new phages. Many phages form large and well-defined plaques that are easily observed so that they can be enumerated when plated by the DLA technique. However, some give rise to small and turbid plaques that are very difficult to detect and count. To overcome these problems, some authors have suggested the use of dyes to improve the contrast between the plaques and the turbid host lawns. It has been reported that some antibiotics stimulate bacteria to produce phages, resulting in an increase in final titer. Thus, antibiotics might contribute to increasing plaque size in solid media. Results Antibiotics with different mechanisms of action were tested for their ability to enhance plaque morphology without suppressing phage development. Some antibiotics increased the phage plaque surface by up to 50-fold. Conclusion This work presents a modification of the DLA technique that can be used routinely in the laboratory, leading to a more accurate enumeration of phages that would be difficult or even impossible otherwise.

  19. Using Target Ablation for Ion Beam Quality Improvement

    International Nuclear Information System (INIS)

    Zhao Shuan; Chen Jia-Er; Lin Chen; Ma Wen-Jun; Yan Xue-Qing; Wang Jun-Jie

    2016-01-01

    During the laser foil interaction, the output ion beam quality including the energy spread and beam divergence can be improved by the target ablation, due to the direct laser acceleration (DLA) electrons generated in the ablation plasma. The acceleration field established at the target rear by these electrons, which is highly directional and triangle-envelope, is helpful for the beam quality. With the help of the target ablation, both the beam divergence and energy spread will be reduced. If the ablation is more sufficient, the impact of DLA-electron-caused field will be strengthened, and the beam quality will be better, confirmed by the particle-in-cell simulation. (paper)

  20. A genetic assessment of the English bulldog.

    Science.gov (United States)

    Pedersen, Niels C; Pooch, Ashley S; Liu, Hongwei

    2016-01-01

    This study examines genetic diversity among 102 registered English Bulldogs used for breeding based on maternal and paternal haplotypes, allele frequencies in 33 highly polymorphic short tandem repeat (STR) loci on 25 chromosomes, STR-linked dog leukocyte antigen (DLA) class I and II haplotypes, and the number and size of genome-wide runs of homozygosity (ROH) determined from high density SNP arrays. The objective was to assess whether the breed retains enough genetic diversity to correct the genotypic and phenotypic abnormalities associated with poor health, to allow for the elimination of deleterious recessive mutations, or to make further phenotypic changes in body structure or coat. An additional 37 English bulldogs presented to the UC Davis Veterinary Clinical Services for health problems were also genetically compared with the 102 registered dogs based on the perception that sickly English bulldogs are products of commercial breeders or puppy-mills and genetically different and inferior. Four paternal haplotypes, with one occurring in 93 % of dogs, were identified using six Y-short tandem repeat (STR) markers. Three major and two minor matrilines were identified by mitochondrial D-loop sequencing. Heterozygosity was determined from allele frequencies at genomic loci; the average number of alleles per locus was 6.45, with only 2.7 accounting for a majority of the diversity. However, observed and expected heterozygosity values were nearly identical, indicating that the population as a whole was in Hardy-Weinberg equilibrium (HWE). However, internal relatedness (IR) and adjusted IR (IRVD) values demonstrated that a number of individuals were the offspring of parents that were either more inbred or outbred than the population as a whole. The diversity of DLA class I and II haplotypes was low, with only 11 identified DLA class I and nine class II haplotypes. Forty one percent of the breed shared a single DLA class I and 62 % a single class II haplotype. Nineteen

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gth = 230 ... Query: 4 ... SLHQGDALAVLSGLPDGCVDSVITDPPYNSGGRTAKERTSRSAKQKYTSADVKNDLAD...FT 63 ... +LH+GDAL VL ... LPD ... V +VITDPPYNSGGRT+ +RT R+A+ KY +++ ... +DLA+F ... Sbjct: 1 ... TLHRGDALTVLKSLPDESVQAVITDPP

  2. The Mean Metal-line Absorption Spectrum of Damped Ly α Systems in BOSS

    Energy Technology Data Exchange (ETDEWEB)

    Mas-Ribas, Lluís [Institute of Theoretical Astrophysics, University of Oslo, Postboks 1029, NO-0315 Oslo (Norway); Miralda-Escudé, Jordi; Pérez-Ràfols, Ignasi; Arinyo-i-Prats, Andreu [Institut de Ciències del Cosmos, Universitat de Barcelona (UB-IEEC), Barcelona E-08028, Catalonia (Spain); Noterdaeme, Pasquier; Petitjean, Patrick [Institut d’Astrophysique de Paris, UPMC and CNRS, UMR7095 98bis Boulevard Arago, F-75014—Paris (France); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); York, Donald G. [Department of Astronomy and Astrophysics and the Enrico Fermi Institute, University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Ge, Jian, E-mail: l.m.ribas@astro.uio.no [Department of Astronomy, University of Florida, Bryant Space Science Center, Gainesville, FL 32611-2055 (United States)

    2017-09-01

    We study the mean absorption spectrum of the Damped Ly α (DLA) population at z ∼ 2.6 by stacking normalized, rest-frame-shifted spectra of ∼27,000 DLA systems from the DR12 of the Baryon Oscillation Spectroscopic Survey (BOSS)/SDSS-III. We measure the equivalent widths of 50 individual metal absorption lines in five intervals of DLA hydrogen column density, five intervals of DLA redshift, and overall mean equivalent widths for an additional 13 absorption features from groups of strongly blended lines. The mean equivalent width of low-ionization lines increases with N {sub H} {sub i}, whereas for high-ionization lines the increase is much weaker. The mean metal line equivalent widths decrease by a factor ∼1.1–1.5 from z ∼ 2.1 to z ∼ 3.5, with small or no differences between low- and high-ionization species. We develop a theoretical model, inspired by the presence of multiple absorption components observed in high-resolution spectra, to infer mean metal column densities from the equivalent widths of partially saturated metal lines. We apply this model to 14 low-ionization species and to Al iii, S iii, Si iii, C iv, Si iv, N v, and O vi. We use an approximate derivation for separating the equivalent width contributions of several lines to blended absorption features, and infer mean equivalent widths and column densities from lines of the additional species N i, Zn ii, C ii*, Fe iii, and S iv. Several of these mean column densities of metal lines in DLAs are obtained for the first time; their values generally agree with measurements of individual DLAs from high-resolution, high signal-to-noise ratio spectra when they are available.

  3. Evaluation of chromogenic medium and direct latex agglutination test for detection of group B streptococcus in vaginal specimens from pregnant women in Lebanon and Kuwait.

    Science.gov (United States)

    Ghaddar, Nahed; Alfouzan, Wadha; Anastasiadis, Elie; Al Jiser, Tamima; Itani, Saad Eddine; Dernaika, Racha; Eid, Toufic; Ghaddar, Ali; Charafeddine, Adib; Dhar, Rita; El Hajj, Hiba

    2014-10-01

    This study was undertaken to evaluate chromogenic medium and a direct latex agglutination test (DLA) for detection of Group B Streptococcus (GBS) in the vaginal specimens of pregnant women, and to ascertain the prevalence of GBS in this population in Kuwait and Lebanon. Vaginal swabs, collected from women at 35-37 weeks of gestation, were cultured on 5 % sheep blood agar (SBA), colistin nalidixic acid agar (CNA), Strept B Select chromogenic agar (SBS) as well as Lim enrichment broth in 168 cases in Lebanon while only SBA was used for 1391 samples in Kuwait. In addition, vaginal samples from 102 GBS-positive and 20 GBS-negative women near the time of delivery were collected in Kuwait for evaluation of the DLA test. During the study period, the prevalence of GBS colonization was determined to be 20.7 % (288/1391) in Kuwait while 18.4 % (31) of 168 pregnant women in Lebanon had vaginal cultures positive for GBS. By direct plating of vaginal swabs on the three media used, the isolation rates of GBS were 51.6, 64.5 and 77.4 % on SBA, CNA and SBS, respectively, which increased to 90.35, 93.1 and 96.8 %, respectively, following subculture in Lim broth after 18 h of incubation. The sensitivity of the DLA test was found to be dependent on the density of GBS colonization, resulting in 100 % sensitivity and 100 % specificity for heavy (>10(2) c.f.u. per swab) and moderately heavy (50-100 c.f.u. per swab) growth of GBS. However, for vaginal specimens yielding women. The DLA test, in particular, could prove to be a useful tool for immediate detection of GBS in women near delivery so that intrapartum antibiotic prophylaxis can be initiated. © 2014 The Authors.

  4. Leaf development of soybean and bean crops and weeds

    International Nuclear Information System (INIS)

    Procopio, Sergio de Oliveira; Santos, Jose Barbosa do; Silva, Antonio Alberto da; Costa, Luiz Claudio

    2003-01-01

    The objective of this study was to compare the emission rate and expansion of the leaves, duration of the leaf area (DLA) and the extinction coefficient (k) for the crops soybean and of the bean, and for the weeds Euphorbia heterophylla sensitive and Euphorbia heterophylla resistant to the herbicides inhibiting of the ALS enzyme, Bidens pilosa and Desmodium tortuosum. The experiment was developed in the field, in soil classified as Red-Yellow Claysoil, in the period of october of 2000 to march of 2001. Each plant species consisted of a treatment. The treatments were arranged in a randomized complete block design with four replications. The mensurations of the photosynthetically active radiation (PAR) were accomplished in two points of the plants: above and bellow the canopy, by means of a light ceptometer. The emission rate and the expansion of leaves was calculated at the end of the cycle of the crops. The DLA and k were calculated before and after the plant flowering. It was not observed differences in the development of the biotypes of E. heterophylla with relation to the rate of appearance of leaves, expansion rate, DLA or k. Among the cultures, the bean presented smaller leaf emission rate (0.591 / day) compared to the soybean (0.933 / day). Among the weeds, the largest leaf emission rate was with D. tortuosum (0.699 / day). The leaf expansion rate observed by the soybean was superior to all the other species (6.77 cm 2 .day-1). All plant species presented larger value for DLA after the flowering compared before flowering. The soybean presented larger value of k (before and after the flowering 0.52 and 0.93, respectively) compared to the other species, demonstrating high potential of interception of solar radiation. (author)

  5. Leaf development of soybean and bean crops and weeds; Desenvolvimento foliar das culturas da soja e do feijao e de plantas daninhas

    Energy Technology Data Exchange (ETDEWEB)

    Procopio, Sergio de Oliveira; Santos, Jose Barbosa do; Silva, Antonio Alberto da [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Fitotecnia]. E-mail: procopio@alunos.ufv.br; jbarbosa2000@yahoo.com.br; aasilva@mail.ufv.br; Costa, Luiz Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Engenharia Agricola]. E-mail: l.costa@mail.ufv.br

    2003-03-15

    The objective of this study was to compare the emission rate and expansion of the leaves, duration of the leaf area (DLA) and the extinction coefficient (k) for the crops soybean and of the bean, and for the weeds Euphorbia heterophylla sensitive and Euphorbia heterophylla resistant to the herbicides inhibiting of the ALS enzyme, Bidens pilosa and Desmodium tortuosum. The experiment was developed in the field, in soil classified as Red-Yellow Claysoil, in the period of october of 2000 to march of 2001. Each plant species consisted of a treatment. The treatments were arranged in a randomized complete block design with four replications. The mensurations of the photosynthetically active radiation (PAR) were accomplished in two points of the plants: above and bellow the canopy, by means of a light ceptometer. The emission rate and the expansion of leaves was calculated at the end of the cycle of the crops. The DLA and k were calculated before and after the plant flowering. It was not observed differences in the development of the biotypes of E. heterophylla with relation to the rate of appearance of leaves, expansion rate, DLA or k. Among the cultures, the bean presented smaller leaf emission rate (0.591 / day) compared to the soybean (0.933 / day). Among the weeds, the largest leaf emission rate was with D. tortuosum (0.699 / day). The leaf expansion rate observed by the soybean was superior to all the other species (6.77 cm{sup 2}.day-1). All plant species presented larger value for DLA after the flowering compared before flowering. The soybean presented larger value of k (before and after the flowering 0.52 and 0.93, respectively) compared to the other species, demonstrating high potential of interception of solar radiation. (author)

  6. Diamond field emitter array cathodes and possibilities for employing additive manufacturing for dielectric laser accelerating structures

    Energy Technology Data Exchange (ETDEWEB)

    Simakov, Evgenya Ivanovna [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Andrews, Heather Lynn [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Herman, Matthew Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hubbard, Kevin Mark [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Weis, Eric [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-20

    These are slides for a presentation at Stanford University. The outline is as follows: Motivation: customers for compact accelerators, LANL's technologies for laser acceleration, DFEA cathodes, and additive manufacturing of micron-size structures. Among the stated conclusions are the following: preliminary study identified DFEA cathodes as promising sources for DLAs--high beam current and small emittance; additive manufacturing with Nanoscribe Professional GT can produce structures with the right scale features for a DLA operating at micron wavelengths (fabrication tolerances need to be studied, DLAs require new materials). Future plans include DLA experiment with a beam produced by the DFEA cathode with field emission, demonstration of photoemission from DFEAs, and new structures to print and test.

  7. The use of NRCS synthetic unit hydrograph and Wackermann conceptual model in the simulation of a flood wave in an uncontrolled catchment/ Zastosowanie syntetycznego hydrogramu jednostkowego NRCS oraz konceptualnego modelu Wackermana do symulacji fali wezbraniowej w zlewni niekontrolowanej

    Directory of Open Access Journals (Sweden)

    Pietrusiewicz Izabela

    2014-12-01

    Full Text Available W pracy przedstawiono wyniki analiz z wykorzystaniem dwóch modeli - konceptualnego modelu Wackermana oraz syntetycznego hydrogramu jednostkowego NRCS-UH - do określenia przepływów w zlewni rzeki Słonka, znajdującej się na obszarze Polski. Wybrane modele charakteryzują się łatwością określenia danych wejściowych do modelu, co jest istotne w aspekcie obliczeń inżynierskich. Obliczenia wykonano dla przepływów o prawdopodobieństwie wystąpienia przekroczenia wynoszącym: 0,5%, 1%, 2%, 5%, 10%, 20% i 50 dla różnych poziomów uwilgotnienia zlewni.

  8. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    Directory of Open Access Journals (Sweden)

    Jakub LEWANDOWSKI

    2016-07-01

    Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

  9. The Microstructures and Energy Dispersive Spectroscopy Analysis of a Hypoeutectoid Steels With 1% Cr

    Directory of Open Access Journals (Sweden)

    Rożniata E.

    2013-12-01

    Full Text Available W artykule zamieszczono wyniki badań mikrostruktury, analizy EDS i twardości stali podeutektoidalnych z 1% Cr imitujących składem chemicznym stale do ulepszania cieplnego. Badania dylatometryczne wykonano przy użyciu dylatometru L78R.I.T.A niemieckiej firmy LlNSElS. Za pomocą dyla- tometru rejestrowano zmiany wydłużenia (Al próbek o wymiarach >p 3X10mm w funkcji temperatury (T. Otrzymane krzywe nagrzewania posłużyły do precyzyjnego wyznaczenia temperatur krytycznych (punktów przełomowych dla badanych stali. Natomiast otrzymane krzywe chłodzenia różniczkowano, co pozwoliło precyzyjnie określić temperatury początków i końców poszczególnych przemian dla wykonania dwóch wykresów CTPc. Analizę składu chemicznego występujących faz w badanych stalach dla różnych szybkości chłodzenia wykonano przy użyciu mikrosondy elektronowej (mikroanalizator rentgenowski. W niniejszej pracy wykorzystano technikę analizy punktowej, liniowej oraz w obszarze o ustalonym polu. Po umieszczeniu próbek z badanych stali w komorze i osiągnięciu odpowiedniej próżni, wyszukano miejsca i dokonano analizy techniką EDS (Energy Dispersive Spectroscopy. Analizy EDS dokonano przy użyciu skaningowego mikroskopu transmisyjnego typu Nova NanoS EM 450. Opracowane wykresy CTPc zgodnie z klasyfikacją Wever’a i Rose’go są typu IV, co oznacza, że przemiany dyfuzyjne są rozdzielone zakresem trwałości przechłodzonego austenitu i mają kształt litery „C". Hartowność badanych stali jest zbliżona, jednak molibden działa zdecydowanie skuteczniej niż nikiel. Molibden zajmuje I-sze miejsce wśród skuteczności pierwiastków stopowych dla stali do niskiego odpuszczania, gdzie „tło" pierwiastków jest słabe. Dla obu badanych stali podeutektoidalnych analiza EDS wykazała wydzielanie się cementy tu stopowego na granicach ziaren. Chrom, jako pierwiastek terrytotwórczy dość silnie dyfunduje do granic ziaren. Widocznie jest to przy

  10. Assessment of the Potential for Privatizing Fuel Infrastructure at Military Installations

    National Research Council Canada - National Science Library

    Gallay, David

    1998-01-01

    .... The military services are responsible for the maintenance and repair of the fuel infrastructure on their installations, and DLA is responsible for the infrastructures' renovation or major construction...

  11. Wartość dla biznesu i wartość godziwa jako alternatywne koncepcje wyceny dla potrzeb sprawozdawczości finansowej

    OpenAIRE

    Frendzel, Maciej

    2011-01-01

    An objective of measurement is one of major problematic issues of current financial repor- ting. Among different solutions there can be distinguished value to the business (deprival value) and fair value – measurement concepts based on economic benefits expected from resources of an entity. These approaches, though using different assumptions, allow for a presentation of economic substance of assets and bring closer measurement to needs of financial information users.

  12. Purchases of Consumable Items Transferred to the Defense Logistics Agency

    National Research Council Canada - National Science Library

    Young, Shelton

    1995-01-01

    Defense Management Report Decision 926, "Consolidation of Inventory Control Points," included a recommendation to transfer all consumable items managed by the Military Departments to the Defense Logistics Agency (DLA...

  13. Dielectric-Lined High-Gradient Accelerator Structure

    Energy Technology Data Exchange (ETDEWEB)

    Jay L. Hirshfield

    2012-04-24

    Rectangular particle accelerator structures with internal planar dielectric elements have been studied, with a view towards devising structures with lower surface fields for a given accelerating field, as compared with structures without dielectrics. Success with this concept is expected to allow operation at higher accelerating gradients than otherwise on account of reduced breakdown probabilities. The project involves studies of RF breakdown on amorphous dielectrics in test cavities that could enable high-gradient structures to be built for a future multi-TeV collider. The aim is to determine what the limits are for RF fields at the surfaces of selected dielectrics, and the resulting acceleration gradient that could be achieved in a working structure. The dielectric of principal interest in this study is artificial CVD diamond, on account of its advertised high breakdown field ({approx}2 GV/m for dc), low loss tangent, and high thermal conductivity. Experimental studies at mm-wavelengths on materials and structures for achieving high acceleration gradient were based on the availability of the 34.3 GHz third-harmonic magnicon amplifier developed by Omega-P, and installed at the Yale University Beam Physics Laboratory. Peak power from the magnicon was measured to be about 20 MW in 0.5 {micro}s pulses, with a gain of 54 dB. Experiments for studying RF high-field effects on CVD diamond samples failed to show any evidence after more than 10{sup 5} RF pulses of RF breakdown up to a tangential surface field strength of 153 MV/m; studies at higher fields were not possible due to a degradation in magnicon performance. A rebuild of the tube is underway at this writing. Computed performance for a dielectric-loaded rectangular accelerator structure (DLA) shows highly competitive properties, as compared with an existing all-metal structure. For example, comparisons were made of a DLA structure having two planar CVD diamond elements with a all-metal CERN structure HDS

  14. Dielectric-Lined High-Gradient Accelerator Structure

    International Nuclear Information System (INIS)

    Hirshfield, Jay L.

    2012-01-01

    Rectangular particle accelerator structures with internal planar dielectric elements have been studied, with a view towards devising structures with lower surface fields for a given accelerating field, as compared with structures without dielectrics. Success with this concept is expected to allow operation at higher accelerating gradients than otherwise on account of reduced breakdown probabilities. The project involves studies of RF breakdown on amorphous dielectrics in test cavities that could enable high-gradient structures to be built for a future multi-TeV collider. The aim is to determine what the limits are for RF fields at the surfaces of selected dielectrics, and the resulting acceleration gradient that could be achieved in a working structure. The dielectric of principal interest in this study is artificial CVD diamond, on account of its advertised high breakdown field (∼2 GV/m for dc), low loss tangent, and high thermal conductivity. Experimental studies at mm-wavelengths on materials and structures for achieving high acceleration gradient were based on the availability of the 34.3 GHz third-harmonic magnicon amplifier developed by Omega-P, and installed at the Yale University Beam Physics Laboratory. Peak power from the magnicon was measured to be about 20 MW in 0.5 (micro)s pulses, with a gain of 54 dB. Experiments for studying RF high-field effects on CVD diamond samples failed to show any evidence after more than 10 5 RF pulses of RF breakdown up to a tangential surface field strength of 153 MV/m; studies at higher fields were not possible due to a degradation in magnicon performance. A rebuild of the tube is underway at this writing. Computed performance for a dielectric-loaded rectangular accelerator structure (DLA) shows highly competitive properties, as compared with an existing all-metal structure. For example, comparisons were made of a DLA structure having two planar CVD diamond elements with a all-metal CERN structure HDS operating at 30

  15. 32 CFR 1280.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ...) Designating a qualified individual under their command, preferably one experienced in the conduct of... reports and information on related litigation forwarded to HQ DLA, Attention: DLAH-G, and processing these...

  16. Supply Inventory Management: Defense Logistics Agency Aviation Investment Strategy Program

    National Research Council Canada - National Science Library

    2002-01-01

    The audit objective was to evaluate the effectiveness of the DLA investment strategy to improve supply support to aviation weapon systems by increasing the stockage levels of consumable repair parts...

  17. Procurement of Contract Reconciliation Services by the Defense Logistics Agency

    National Research Council Canada - National Science Library

    1991-01-01

    The audit objective was to evaluate DLA's procedures for contracting with NSI to reconcile contracts before their transfer from the Defense Contract Administration Services Regions to the Defense Finance Center...

  18. Nauczyciel w roli krytyka literackiego

    Directory of Open Access Journals (Sweden)

    Anna Janus-Sitarz

    2012-06-01

    Full Text Available Artykuł przedstawia przyczyny niechęci młodych ludzi do literatury pięknej i sposoby zmotywowania digitalnych tubylców do lektury. Autorka rozważa możliwość czerpania przez polonistów szkolnych inspiracji z warsztatu krytyki literackiej. Za szczególnie skuteczne uważa wykorzystywanie na lekcjach literatury najnowszej, niezaanektowanej przez internetowe streszczenia, co stanowi wyzwanie interpretacyjne zarówno dla nauczyciela, jak i dla ucznia. Inne sposoby, jakie winien wziąć pod uwagę polonista pragnący wychować prawdziwego czytelnika, to odejście od instrumentalizmu w edukacji literackiej, eksponowanie przez nauczyciela osobistej fascynacji literaturą oraz organizowanie zajęć w „wolnej strefie czytania”.

  19. Wybrane problemy ustalania wartościw sprawozdaniach finansowych przedsiębiorstw

    Directory of Open Access Journals (Sweden)

    Kazimierz Sawicki

    2009-12-01

    Full Text Available W artykule przedstawiono niektóre problemy pomiaru i wyceny w rachunkowości zarówno pozycji bilansu, jak i procesów gospodarczych. Opisano podstawowe modele tradycyjne i współczesne metody wyceny. Podjęto próbę oceny przydatności poszczególnych metod wyceny, zwłaszcza na podstawie wartości godziwej, dla dużych, średnich i małych jednostek. Zdaniem autora, wiarygodność informacji finansowych dla zarządu i użytkowników zewnętrznych może być wątpliwa, jeżeli w wysokim stopniu opiera się na estymacji przyszłości, która zawsze jest niepewna.

  20. Changing Patterns in the Export of Goods Versus International Competitiveness. A Comparative Analysis for Central-East European Countries in the Period 2000–2011

    Directory of Open Access Journals (Sweden)

    Lechman Ewa

    2014-06-01

    Full Text Available W artykule analizie poddano zmieniające się ścieżki eksportu dóbr w podziale na gałęzie o różnej intensywności technologicznej. Analizę przeprowadzono dla lat 2000- 2011 dla 9 wybranych krajów Europy Centralnej i Wschodniej, tj: Bułgarii, Republiki Czeskiej, Estonii, Litwy, Łotwy, Polski, Rumunii oraz Słowacji. Dodatkowo postawiono hipotezę o zachodzącej pozytywnej relacji między rosnącym - w stosunku do całej wartości eksportu kraju-udziale sektorów technologicznie-chłonnych oraz międzynarodową konkurencyjnością, która jest aproksymowana za pomocą Global Competitiveness Index (GCI.

  1. Hafty w sztambuchach Biblioteki Uniwersyteckiej w Poznaniu

    Directory of Open Access Journals (Sweden)

    Karolina Nowaczyk

    2011-01-01

    Full Text Available W artykule przedstawiono hafty znajdujące się w sztambuchach z XVIII i XIX wieku pochodzących ze zbiorów Biblioteki Uniwersyteckiej w Poznaniu. Omówione zostały zarówno technika wykonania haftów, jak i ich wartość artystyczna, a także znaczenie wskazanych przykładów dla historii hafciarstwa amatorskiego na ziemiach polskich. Artykuł jest jednocześnie próbą zwrócenia uwagi na istniejącą w tamtym okresie sztukę hafciarską o wyłącznie amatorskim charakterze oraz na kopiowanie i powtarzalność wzorów, co pozwala na określenie ich jako typowych dla danej epoki.

  2. Sprayed microspheres of poly(lactic acid) obtained with calcium compounds

    International Nuclear Information System (INIS)

    Goncalves, Raquel P.; Picciani, Paulo H. de Souza; Dias, Marcos L.

    2011-01-01

    In this work PLLA and PDLA were synthesized using calcium methoxide (Ca(OMe) 2 ) as initiator. This compound shows good activity in the bulk polymerization of L-lactide (LLA) and D-lactide (DLA) producing polymers with average molecular weight up to 22,300 g/mol, but with microstructure containing a significant amount of estereoerros, as revealed by 13 C NMR. Block copolymers containing blocks of L-and D-lactic acid were also prepared, using the method of sequential addition of LLA and DLA in an attempt to obtain stereo complexes. Analyses of scanning electron microscopy (SEM) revealed that the polymers obtained with catalysts of calcium produced PLA microspheres with diameters of around 5 μm via electro spray technique. (author)

  3. Electric field driven fractal growth dynamics in polymeric medium

    Energy Technology Data Exchange (ETDEWEB)

    Dawar, Anit; Chandra, Amita, E-mail: achandra@physics.du.ac.in

    2014-08-14

    This paper reports the extension of earlier work (Dawar and Chandra, 2012) [27] by including the influence of low values of electric field on diffusion limited aggregation (DLA) patterns in polymer electrolyte composites. Subsequently, specified cut-off value of voltage has been determined. Below the cut-off voltage, the growth becomes direction independent (i.e., random) and gives rise to ramified DLA patterns while above the cut-off, growth is governed by diffusion, convection and migration. These three terms (i.e., diffusion, convection and migration) lead to structural transition that varies from dense branched morphology (DBM) to chain-like growth to dendritic growth, i.e., from high field region (A) to constant field region (B) to low field region (C), respectively. The paper further explores the growth under different kinds of electrode geometries (circular and square electrode geometry). A qualitative explanation for fractal growth phenomena at applied voltage based on Nernst–Planck equation has been proposed. - Highlights: • The paper is an extension of earlier work [Phys. Lett. A 376 (2012) 3604] on effect of electric field on DLA. • Threshold value of electric field has been determined. • Below the threshold, growth is random. • Above the threshold, the growth is governed by diffusion, migration and convection. • Different kinds of electrode geometries have been used to simulate the growth.

  4. Reliability Assessment of a Turbogenerator Coil Retaining Ring Based on Low Cycle Fatigue Data

    Directory of Open Access Journals (Sweden)

    Olmi Giorgio

    2014-03-01

    Full Text Available Pierscienie ustalajace cewek turbogeneratora sa pasowane skurczowo na wirniku wokół cerek by zabezpieczyc je przed działaniem sił odsrodkowych. W typowych warunkach, sa one poddane narazeniom zmeczeniowym o malej liczbie cykli, przy czym kazdy cykl rozpoczyna sie od startu maszyny, a konczy przy jej zatrzymaniu. Przedmiotem artykułu jest wyznaczenie prawdopodobienstwa awarii pierscienia ustalajacego cewki. Rozwazanym uszkodzeniem jest pekniecie pierscienia spowodowane puchnieciem materiału pod wpływem naprezen wywołanych sila odsrodkowa. Ocena niezawodnosci przeprowadzona w tej pracy wykorzystuje dane wejsciowe wpływajace na obciazenie zmeczeniowe przy małej liczbie cykli i ich rozkłady stochastyczne. Dla rozwiazania problemu wyznaczono eksperymentalnie charakterystyki statyczne i krzywe cykli zmeczeniowych stosowanego materiału i zastosowano model statystyczny dla wyliczenia odpowiednich parametrów i ich odchylen standardowych. Na podstawie wyznaczonych rozkładów zmiennych estymuje sie prawdopodobienstwo uszkodzenia w formie dystrybuanty rozkładu. Wykorzystanyalgorytm obliczeniowy o duzej skutecznosci wykorzystuje metode ”zaawansowanej sredniej” (Advanced Mean Value. Uzyskane wyniki daja informacje o odpowiedzi materiału i stanie lokalnych naprezen i odkształcen w najbardziej obciazonych obszarach pierscienia ustalajacego cewki. Prawdopodobienstwo uszkodzenia, wyznaczone na koniec okresu eksploatacji maszyny, wynosi 10-12 i jest porównywalne z wartosciami referencyjnymi dla innych konstrukcji mechanicznych i lotniczych narazonych na zmeczenie.

  5. Electric field driven fractal growth dynamics in polymeric medium

    International Nuclear Information System (INIS)

    Dawar, Anit; Chandra, Amita

    2014-01-01

    This paper reports the extension of earlier work (Dawar and Chandra, 2012) [27] by including the influence of low values of electric field on diffusion limited aggregation (DLA) patterns in polymer electrolyte composites. Subsequently, specified cut-off value of voltage has been determined. Below the cut-off voltage, the growth becomes direction independent (i.e., random) and gives rise to ramified DLA patterns while above the cut-off, growth is governed by diffusion, convection and migration. These three terms (i.e., diffusion, convection and migration) lead to structural transition that varies from dense branched morphology (DBM) to chain-like growth to dendritic growth, i.e., from high field region (A) to constant field region (B) to low field region (C), respectively. The paper further explores the growth under different kinds of electrode geometries (circular and square electrode geometry). A qualitative explanation for fractal growth phenomena at applied voltage based on Nernst–Planck equation has been proposed. - Highlights: • The paper is an extension of earlier work [Phys. Lett. A 376 (2012) 3604] on effect of electric field on DLA. • Threshold value of electric field has been determined. • Below the threshold, growth is random. • Above the threshold, the growth is governed by diffusion, migration and convection. • Different kinds of electrode geometries have been used to simulate the growth

  6. Tradycyjny instytucjonalizm i jego znaczenie dla nauk politycznych

    Directory of Open Access Journals (Sweden)

    Kamil Minkner

    2015-10-01

    Full Text Available The paper presents academic achievements of traditional institutionalism, the first scientific approach in political science, which was developed since the second part of the 19th century in USA, Great Britain, Germany and France. The author argues that this orientation had a creative influence on the progress of the discipline, however this impact is not appreciated by contemporary studies in the field of political science and political theory where limited understanding of the old institutionalism is promoted. The revision of this state of affairs has shown that, apart from the analysis of formal structures and institutions of state power, the traditionalists also have studied political parties (A. L. Lowell, interest groups (T. Eschenburg, public opinion (J. Bryce and informal socio-political phenomena such as influence (C. J. Friedrich. Additionally, the first institutionalists formed the foundations for methodological self-consciousness of young political science and forged concepts that have been verified by subsequent generations of political scientists. They also conducted the first comparative studies of political systems (H. Finer, C. J. Friedrich. Many of these scholars went beyond pure theory by linking their reflections with planning and reforming political institutions. In this context, the author discusses research on relations between politics and administration (F. J. Goodnow, considerations on demonopolization of power (H. J. Laski and refers to the debate on efficiency of different branches of government (e.g. in Poland after passing the March Constitution of 1921.

  7. Velocity-metallicity correlation for high-z DLA galaxies

    DEFF Research Database (Denmark)

    Ledoux, C.; Petitjean, P.; Fynbo, J.P.U.

    2006-01-01

    Galaxies: halos, galaxies: high-redshift, galaxies: ISM, quasars: absorption lines, cosmology: observations Udgivelsesdato: Oct.......Galaxies: halos, galaxies: high-redshift, galaxies: ISM, quasars: absorption lines, cosmology: observations Udgivelsesdato: Oct....

  8. Izoflawony jako alternatywa dla terapii hormonalnej wieku menopauzalnego

    Directory of Open Access Journals (Sweden)

    Michał Bijak

    2010-12-01

    Full Text Available Isoflavones are members of flavonoids which belong to phytoestrogens, a group of non-steroid plant substancesthe chemical structure of which is similar to 17-β-estradiol. One of the richest sources of isoflavones issoybeans and legumes. The most important representatives of this class of compounds which have biologicalactivity are daidzein and genistein. Isoflavones are able to bind to estrogen receptors (ER however, their affinityto ER-β is higher than ER-α. Interaction isoflavones with ER lead to their activation. which causes cell response.The last epidemiological studies provide evidence that in Asia where soya is present in the traditional diet,women have less negative symptoms of menopause compared with the Western population. Clinical studiescarried out in recent years have shown that soy protein or genistein supplementation reduces the number ofhot flushes in post menopausal women. Similar results are shown for bone health. Genistein supplementationcauses an increase in bone mineral density (BMD and decrease in levels of bone resorption markers at a levelcomparable to hormone therapy. Isoflavones have also positive effects on the cardiovascular system. For allthese reasons isoflavones are becoming an increasingly popular and safe alternative to hormone therapy forwomen with menopausal symptoms. This article describes the structure and metabolism of isoflavones as wellas mechanism of action and results of clinical studies in postmenopausal women receiving isoflavones.

  9. Business Case Analysis for Microchip Logistics

    National Research Council Canada - National Science Library

    Vandenberghe, Jack

    2002-01-01

    .... The DLA Microchip Logistics (MICLOG) program is investigating the use of an automatic data collection system to improve item tracking and access to product information, and assist in automating the inventory induction process...

  10. Consumable Item Transfer, Phase 2, Cash Imbalance Issue

    National Research Council Canada - National Science Library

    1997-01-01

    We are providing this report for your information and use. The Deputy Secretary of Defense directed the transfer of the management of consumable items to the Defense Logistics Agency (DLA) in July 1990...

  11. The Environmental Assessment and Management (TEAM) Guide; Maine Supplement, Revised February 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  12. The Environmental Assessment and Management (TEAM) Guide Pennsylvania Supplement. Revised May 1998

    National Research Council Canada - National Science Library

    O'Rourke, Caroloyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army. Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  13. The Environmental Assessment and Management (TEAM) Guide. Indiana Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  14. The Environmental Assessment and Management (TEAM) Guide, Wisconsin Supplement, Revised February 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  15. The Environmental Assessment and Management (TEAM) Guide Vermont Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  16. The Environmental Assessment and Management (TEAM) Guide Virginia Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  17. The Environmental Assessment and Management (TEAM) Guide; Alaska Supplement, Revised May 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  18. The Environmental Assessment and Management (TEAM) Guide South Dakota Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force. U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  19. The Environmental Assessment and Management (TEAM) Guide; New York Supplement, Revised January 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  20. The Environmental Assessment and Management (TEAM) Guide Illinois Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  1. The Environmental Assessment and Management (TEAM) Guide: Illinois Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  2. The Environmental Assessment and Management (TEAM) Guide, West Virginia Supplement, Revised February 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  3. The Environmental Assessment and Management Guide South Carolina Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U%S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identity compliance problems before they are cited as violations...

  4. The Environmental Assessment and Management (TEAM) Guide Iowa Supplement; Revised June 1997

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  5. The Environmental Assessment and Management (TEAM) Guide West Virginia Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  6. The Environmental Assessment and Management (TEAM) Guide; Texas Supplement, Revised June 1997

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  7. The Environmental Assessment and Management (TEAM) Guide: Oregon Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  8. The Environmental Assessment and Management (TEAM) Guide; Michigan Supplement, Revised October 1997

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  9. The Environmental Assessment and Management (TEAM) Guide Georgia Supplement. Revision

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify' compliance problems before they are cited as violations...

  10. The Environmental Assessment and Management Guide, Georgia Supplement. Revised

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  11. The Environmental Assessment and Management (TEAM) Guide. Minnesota Supplement Revised February 1998

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  12. The Environmental Assessment and Management (TEAM) Guide Indiana Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  13. The Environmental Assessment and Management (TEAM) Guide Idaho Supplement

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  14. The Environmental Assessment and Management Guide, Connecticut Supplement. (Revised October 1997)

    National Research Council Canada - National Science Library

    O'Rourke, Carolyn

    1997-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  15. The Environmental Assessment and Management (TEAM) Guide; New Hampshire Supplement, Revised April 1998

    National Research Council Canada - National Science Library

    1998-01-01

    .... The U.S. Air Force, U.S. Army, Defense Logistics Agency (DLA), and Corps of Engineers (Civil Works) have adopted environmental compliance programs that identify compliance problems before they are cited as violations...

  16. ADAPTIVE OPTICS IMAGING OF A MASSIVE GALAXY ASSOCIATED WITH A METAL-RICH ABSORBER

    International Nuclear Information System (INIS)

    Chun, Mark R.; Kulkarni, Varsha P.; Gharanfoli, Soheila; Takamiya, Marianne

    2010-01-01

    The damped and sub-damped Lyα absorption (DLA and sub-DLA) line systems in quasar spectra are believed to be produced by intervening galaxies. However, the connection of quasar absorbers to galaxies is not well-understood, since attempts to image the absorbing galaxies have often failed. While most DLAs appear to be metal poor, a population of metal-rich absorbers, mostly sub-DLAs, has been discovered in recent studies. Here we report high-resolution K-band imaging with the Keck laser guide star adaptive optics (LGSAO) system of the field of quasar SDSSJ1323-0021 in search of the galaxy producing the z = 0.72 sub-DLA absorber. With a metallicity of 2-4 times the solar level, this absorber is one of the most metal-rich systems found to date. Our data show a large bright galaxy with an angular separation of only 1.''25 from the quasar, well-resolved from the quasar at the high resolution of our data. The galaxy has a magnitude of K = 17.6-17.9, which corresponds to a luminosity of ∼3-6 L*. Morphologically, the galaxy is fitted with a model with an effective radius, enclosing half of the total light, of R e = 4 kpc and a bulge-to-total ratio of 0.4-1.0, indicating a substantial bulge stellar population. Based on the mass-metallicity relation of nearby galaxies, the absorber galaxy appears to have a stellar mass of ∼>10 11 M sun . Given the small impact parameter (9.0 kpc at the absorber redshift), this massive galaxy appears to be responsible for the metal-rich sub-DLA. The absorber galaxy is consistent with the metallicity-luminosity relation observed for nearby galaxies, but is near the upper end of metallicity. Our study marks the first application of LGSAO for the study of the structure of galaxies producing distant quasar absorbers. Finally, this study offers the first example of a massive galaxy with a substantial bulge producing a metal-rich absorber.

  17. ALMA + VLT observations of a damped Lyman-α absorbing galaxy: massive, wide CO emission, gas-rich but with very low SFR

    Science.gov (United States)

    Møller, P.; Christensen, L.; Zwaan, M. A.; Kanekar, N.; Prochaska, J. X.; Rhodin, N. H. P.; Dessauges-Zavadsky, M.; Fynbo, J. P. U.; Neeleman, M.; Zafar, T.

    2018-03-01

    We are undertaking an Atacama Large Millimeter Array survey of molecular gas in galaxies selected for their strong H I absorption, so-called damped Lyα absorber (DLA)/sub-DLA galaxies. Here, we report CO(2-1) detection from a DLA galaxy at z = 0.716. We also present optical and near-infrared (NIR) spectra of the galaxy revealing [O II], Hα, and [N II] emission lines shifted by ˜170 km s-1 relative to the DLA, and providing an oxygen abundance 3.2 times solar, similar to the absorption metallicity. We report low unobscured SFR˜1 M⊙ yr-1 given the large reservoir of molecular gas, and also modest obscured SFR =4.5_{-2.6}^{+4.4} M⊙ yr-1 based on far-IR and sub-millimetre data. We determine mass components of the galaxy: log[M*/M_{&sun} ]= 10.80^{+0.07}_{-0.14}, log[Mmol-gas/M⊙] = 10.37 ± 0.04, and log[Mdust/M_{⊙} ]= 8.45^{+0.10}_{-0.30}. Surprisingly, this H I absorption-selected galaxy has no equivalent objects in CO surveys of flux-selected samples. The galaxy falls off current scaling relations for the star formation rate (SFR) to molecular gas mass and CO Tully-Fisher relation. Detailed comparison of kinematical components of the absorbing, ionized, and molecular gas, combined with their spatial distribution, suggests that part of the CO gas is both kinematically and spatially decoupled from the main galaxy. It is thus possible that a major starburst in the past could explain the wide CO profile as well as the low SFR. Support for this also comes from the spectral energy distribution favouring an instantaneous burst of age ≈0.5 Gyr. Our survey will establish whether flux-selected surveys of molecular gas are missing a key stage in the evolution of galaxies and their conversion of gas to stars.

  18. A double-labeling assay for simultaneous estimation and characterization of estrogen and progesterone receptors using radioiodinated estradiol and tritiaded Org 2058

    International Nuclear Information System (INIS)

    Ronchi, E.; Granata, G.; Brivio, M.

    1986-01-01

    Estrogen (ER) and progesterone receptors (PgR) appear to be a perequisite to elicit a biologic response by a hormone-target organ. Current methodologies for analysis of these proteins (e.g:dextran-coated charcoal, DCC) in single-label assay (SLA) require relatively large amounts of tissue material, time and laboriousness. Therefore, the authors have developed for breast cancer tissue an improved dual-label assay (DLA) for simultaneous titration (by DCC) and/or characterization (by sedimentation properties) of ER and PgR on the same sample, using *H1*H2*H5I-E*L2 and *H3H-Org 2058 as tracers. The interaction of *H1*H2*H5I-E*L2 with ER and plasma proteins in comparison to *H3H-E*L2 was studied in terms of specificity, time course, affinity binding and sedimentation pattern. *H1*H2*H5I-E*L2 bound the same molecular forms displayed by *H3H-E*L2 (9 and 3S) but with lower titers (about 1.3-fold), irrespective of the technique used, and did not bind to sex hormone-binding globulin. Simultaneous detection of *H1*H2*H5I and *H3H was achieved by use of a gamma counter plus a beta counter sequentially. ER and PgR titrations with DCC in DLA were in good agreement with those obtained with SLA, in terms of titers and Ka values. An analogous results was obtained with sucrose density gradient (SDG) analysis. Both the DLA methods were highly reproducible (CV<8.0%). Between the rotors available for SDG, the vertical one was preferable because of the larger number of samples processed and of less purturbation of sedimenting receptor molecules. Furthermore, a biochemical applications of the method is described. In conclusion, the DLA procedure, by simplifying ER and PgR estimation, makes it possible to study, even on small tumor biopsies, the molecular properties of these proteins in relation to the clinical response of the disease

  19. Antioxidant properties of selected culinary spices / Antyoksydacyjne właściwości wybranych przypraw

    Directory of Open Access Journals (Sweden)

    Słowianek Marta

    2016-03-01

    Full Text Available Wstęp: Przyprawy dodawane do żywności wzbogacają jej walory smakowe i zapachowe, niektóre z nich mogą także wydłużać jej czas przechowywania dzięki obecności związków o aktywności przeciwutleniającej. Cel: Celem pracy było zbadanie 28 przypraw dostępnych na rynku pod kątem całkowitej zawartości polifenoli i aktywności przeciwutleniającej. Metody: Do oceny całkowitej zawartości związków fenolowych zastosowano metodę Folina- Ciocalteau. Aktywność antyoksydacyjną ekstraktów oznaczono metodą z użyciem rodnika DPPH. Wyniki: Otrzymane wyniki wykazują, że większość analizowanych przypraw jest bogata w związki fenolowe i posiada wysoką aktywność antyoksydacyjną. Całkowita zawartość polifenoli w przyprawach oscylowała od 0,9 do 155,1 mg GAE/g z najniższą wartością odnotowaną dla sezamu i najwyższą dla cynamonu. Zdolność do wygaszania rodnika DPPH wyrażona w procentach była zróżnicowana i wahała się w zakresie od 4,1% dla sezamu do 94,9% dla goździków. Odnotowano umiarkowaną korelację (r=0,63, p<0,05 pomiędzy aktywnością antyoksydacyjną i zawartością polifenoli ogółem, co dowodzi, że związki fenolowe są ważnymi, antyoksydacyjnymi składnikami w badanych przyprawach. Wnioski: Prowadzone badania wykazują, że wiele przypraw może służyć jako naturalne konserwanty żywności i jednocześnie ma korzystny wpływ na nasze zdrowie.

  20. Escitalopram w leczeniu zaburzeń psychicznych chorych w podeszłym wieku

    Directory of Open Access Journals (Sweden)

    Tomasz Sobów

    2015-07-01

    Full Text Available Farmakoterapia zaburzeń psychicznych u chorych w podeszłym wieku jest często trudna i ograniczona powszechniejszym niż u młodszych chorych występowaniem objawów niepożądanych, interakcji lekowych oraz koniecznością brania pod uwagę współchorobowości, nie tylko psychiatrycznej, ale przede wszystkim – somatycznej. Te aspekty, razem z wieloczynnikową patogenezą zaburzeń i znaczną w wielu badaniach odpowiedzią placebo, prowadzą do względnie niższych wskaźników efektywności klinicznej leczenia. Właściwy wybór leku, uwzględniający jego skuteczność i bezpieczeństwo, jest zatem kluczowy dla sukcesu terapii. Escitalopram to obiecujący lek dla starszych chorych. Jego znaczna selektywność farmakodynamiczna, korzystny profil farmakokinetyczny, w tym stosunkowo niewielki potencjał wchodzenia w interakcje lekowe, oraz dość rzadkie wywoływanie poważnych objawów ubocznych spowodowały – wraz z zadowalającymi wynikami badań klinicznych – częste i z korzyścią dla pacjentów stosowanie escitalopramu w zaburzeniach nastroju (także w tzw. organicznych i zaburzeniach lękowych, a ostatnio jako leku korygującego zaburzenia zachowania towarzyszące otępieniu, takie jak pobudzenie, agresja czy psychoza. Dodatkowym ważnym aspektem stosowania escitalopramu jest łatwość podawania (jedna dawka na dobę oraz dostępność postaci w kroplach, która może być szczególnie użyteczna dla chorych z problemami w połykaniu, przyjmujących wiele leków, karmionych poprzez gastrostomię czy z zaburzeniami funkcji poznawczych.

  1. Department of Defense Food Procurement: Background and Status

    National Research Council Canada - National Science Library

    Grasso, Valerie B

    2005-01-01

    ...) to establish a common food management system. Under DLA, DSCP is the inventory control point for food, clothing, textiles, medicines, medical equipment, general and industrial supplies and services for the military, their eligible dependents...

  2. Valuation and Presentation of Inactive Inventory on the FY 1997 Defense Logistics Agency Working Capital Fund Financial Statements

    National Research Council Canada - National Science Library

    1998-01-01

    The overall objective of our audit was to determine whether the FY 1997 Financial Statements of the DLA Working Capital Fund were presented fairly and in accordance with Office of Management and Budget Bulletin...

  3. Workflows des Projektes Mengenentsäuerung im Deutschen Literaturarchiv

    Directory of Open Access Journals (Sweden)

    Melanie Kubitza

    2018-03-01

    Full Text Available Das Deutsche Literaturarchiv Marbach (DLA begann 1998 mit der Evaluation geeigneter Entsäuerungsverfahren für seine unikalen Archiv- und Bibliotheksbestände. Seit 2013 erfolgt eine kontinuierliche Entsäuerungsbehandlung der Buchbestände mit dem Papersave-Verfahren der Nitrochemie AG, mit einer jährlichen Entsäuerungsleistung von insgesamt rund 4,0 t in acht Chargen. Neben den Magazinbeständen mit Erstausgaben bis hin zur Sekundärliteratur zu den einzelnen Autoren, wurden nun auch erstmals erfolgreich Bände aus den Spezialsammlungen des DLA entsäuert, zu denen auch Autorenbibliotheken gehören. Der Beitrag erläutert neben der Zusammenarbeit des Referats Bestandserhaltung mit den Abteilungen Bibliothek und Archiv auch Teilaspekte der Workflows aus restauratorischer Sicht. Dabei steht die intern entwickelte Barcode-unterstützte Dokumentation der Maßnahme auf Exemplarsebene im Bestandskatalog Kallías im Fokus. Sie enthält neben den verfahrensrelevanten Daten u. a. Informationen zu den Ausschlusskriterien oder alternativen und ergänzenden Maßnahmen der Verpackung, Restaurierung oder Digitalisierung. Das Marbacher Mengenentsäuerungsprojekt führt an den Originalen eine Qualitätskontrolle bezüglich aufgetretener Nebenwirkungen am Bibliotheksgut durch und kontrolliert die Langzeitwirkung der Entsäuerung an originalähnlichen Referenzbänden mit nicht zerstörungsfreien Messungen. In 1998 the German Literature Archive (DLA began to evaluate appropriate deacidification processes for its unique archive and library stock. Since 2013, Nitrochemie’s papersave procedure has been used for an ongoing deacidification treatment of the bookstock with an annual output of about 4,0 t in eight batches. The deacidification process has been successfully used for primary and secondary literature as well as - for the first time - for volumes of the rare materials collection of the DLA, including authors‘ libraries. The article describes the

  4. Limit Analysis of Geometrically Hardening Composite Steel-Concrete Systems / Stany Graniczne Geometrycznie Wzmacniających Się Konstrukcji Zespolonych

    Science.gov (United States)

    Alawdin, Piotr; Urbańska, Krystyna

    2015-03-01

    The paper considers some results of creating load-carrying composite systems that have uprated strength, rigidity and safety, and therefore are called geometrically (self-) hardening systems. The optimization mathematic models of structures as discrete mechanical systems withstanding dead load, monotonic or low cyclic static and kinematic actions are proposed. To find limit parameters of these actions the extreme energetic principle is suggested what result in the bilevel mathematic programming problem statement. The limit parameters of load actions are found on the first level of optimization. On the second level the power of the constant load with equilibrium preloading is maximized and/or system cost is minimized. The examples of using the proposed methods are presented and geometrically hardening composite steel-concrete system are taken into account. W pracy przedstawiono sposoby projektowania konstrukcji, które ze względu na swoją geometrię oraz topologię posiadają podwyższoną nośność, sztywność i bezpieczeństwo. Systemy takie nazwano geometrycznie (samo-) wzmacniającymi się. Zaproponowano optymalizacyjne modele matematyczne konstrukcji jako dyskretne systemy mechaniczne będące pod obciążeniem stałym, zmiennym monotoniczne lub niskocyklowym, statycznym lub kinematycznym. Dla znalezienia granicznych parametrów obciążeń wprowadzona została ekstremalna zasada energetyczna, przedstawiona jako problem dwupoziomowego programowania matematycznego. Graniczne parametry obciążeń szukane są na pierwszym poziomie optymalizacji. Na drugim poziomie minimalizowany jest koszt systemu i/lub maksymalizowana jest moc stałego równoważącego obciążenia z dociążeniem. Ponadto w pracy przeanalizowano numerycznie i analitycznie zachowanie konstrukcji geometrycznie wzmacniających się na przykładzie konstrukcji zespolonych stalowobetonowych. Pierwszy przykład dotyczy konstrukcji belkowo-prętowej z podciągiem, belkę stanowi stalowy dwuteownik

  5. Download this PDF file

    African Journals Online (AJOL)

    and the factors in the various groups that motivate or develop their adopted ... main categories, i.e. the deep learning approach (DLA) and surface learning ... whether learning approaches differed significantly between academic years of study.

  6. 75 FR 12492 - Departmental Management; Public Meeting on BioPreferredSM

    Science.gov (United States)

    2010-03-16

    ... business to business, where the receiving business will use the product in some subsequent production or... Logistics Agency (DLA), and a former government procurement official. DATES: April 1, 2010, 8:30 a.m. to 1 p...

  7. Self-affine fractal growth front of Aspergillus oryzae

    Science.gov (United States)

    Matsuura, Shu; Miyazima, Sasuke

    1992-12-01

    Aspergillus oryzae have been grown in various environmental conditions and analyzed from the viewpoint of self-affinity. The growth behavior can be described by the Eden model in favorable conditions, and by DLA in unfavorable conditions.

  8. Performance Impact of Rank-Reordering on Advanced Polar Decomposition Algorithms

    KAUST Repository

    Esposito, Aniello; Keyes, David E.; Ltaief, Hatem; Sukkari, Dalal

    2018-01-01

    We demonstrate the importance of both MPI rank reordering and choice of processor grid topology in the context of advanced dense linear algebra (DLA) applications for distributed-memory systems. In particular, we focus on the advanced polar

  9. Systematic approach in optimizing numerical memory-bound kernels on GPU

    KAUST Repository

    Abdelfattah, Ahmad; Keyes, David E.; Ltaief, Hatem

    2013-01-01

    memory-bound DLA kernels on GPUs, by taking advantage of the underlying device's architecture (e.g., high throughput). This methodology proved to outperform existing state-of-the-art GPU implementations for the symmetric matrix-vector multiplication (SYMV

  10. Wyznaczenie przepływu brzegowegona wybranym odcinku rzeki Powy

    Directory of Open Access Journals (Sweden)

    Joanna Wicher-Dysarz

    2016-12-01

    Full Text Available Znajomość przepływu brzegowego jest istotna dla przeprowadziania prac inżynierskich na wybranych odcinkach rzek. Celem niniejszego artykułu jest wyznaczenie przepływu brzegowego na rzece Powie przy wykorzystaniu wzorów empirycznych. Wybrana rzeka ma charakter nizinny. W badaniach porównywano wartości przepływu brzegowego uzyskiwane dla warunków przed odmuleniem i po odmuleniu rzeki. Wykorzystano w tym celu pomiary przekrojów poprzecznych wykonane w latach 2007 oraz 2014 na odcinku powyżej zbiornika Stare Miasto. Wybrany odcinek rzeki jest niekontrolowany, ponieważ najbliższy wodowskaz zlokalizowano poniżej zbiornika. Obliczenia wykonano w trzech etapach. W pierwszym kroku obliczenia przeprowadzono dla wybranych przekroi za pomocą dwóch wzorów empirycznych – Wolmana oraz Williamsa. W drugim wykonano obliczenia za pomocą programu HEC-RAS i zweryfikowano wcześniej uzyskane wartości poprzez porównanie z wynikami symulacji. Trzeci etap obejmował połączenie modelowania z wynikami uzyskanymi na podstawie wzorów empirycznych. Wyniki porównano ze sobą w pięciu wybranych przekrojach. Na podstawie wykonanych obliczeń stwierdzono dość znaczne rozbieżności pomiędzy zastosowanymi metodami. Wyniki przedstawione w artykule nie dają jednoznacznej odpowiedzi na pytanie, która z tych metod jest właściwa.

  11. Modeling Water Balance of Dammed Lakes Using Computer Code Matlab-Simulink/ Modelowanie Bilansu Wodnego Piętrzonych Jezior Za Pomocą Programu Komputerowego Matlab-Simulink

    Directory of Open Access Journals (Sweden)

    Błażejewski Ryszard

    2014-09-01

    Full Text Available Praca przedstawia bilans wodny przepływowego piętrzonego jeziora, uwzględniający dopływ powierzchniowy, dopływ i odpływ podziemny opisany równaniem Dupuita, opad na powierzchnię jeziora, parowanie z powierzchni wody oraz odpływ w przekroju zamkniętym jazem piętrzącym. Z uwagi na nieliniowe związki wymienionych składników bilansu z poziomem wody w jeziorze, do obliczeń wykorzystano program komuterowy Matlab-Simulink®. Przydatność modelu sprawdzono na przykładzie Jeziora Sławianowskiego o powierzchni 276 ha i średniej głębokości - 6,6 m. Jezioro to zostało podzielone na dwa akweny o zróżnicowanej głębokości. Wyniki obliczeń miesięcznych bilansów wodnych dla roku hydrologicznego 2009, wykazały dobrą zgodność z pomiarami jedynie dla trzech pierwszych miesięcy. Stwierdzono, że dla zmniejszenia błędów obliczeniowych należałoby skrócić interwał bilansowania do jednej doby. Kalibracja modelu byłaby łatwiejsza i bardziej adekwatna, gdyby do oszacowania przewodności hydraulicznej przyległych do jeziora gruntów i osadów dennych wykorzystać badania poziomów wody w piezometrach, zlokalizowanych w kilku transektach, prostopadłych do linii brzegowej jeziora.

  12. Funkcje wykonawcze a osiągnięcia dzieci w wieku wczesnoszkolnym

    Directory of Open Access Journals (Sweden)

    Paweł Jankowski

    2012-03-01

    Full Text Available Artykuł prezentuje wyniki badania dotyczącego związku funkcji wykonawczych i powodzenia szkolnego. W badaniu udział wzięło 46 dzieci w wieku 7 i 8 lat, uczniów pierwszej klasy szkoły podstawowej. W zakresie funkcji wykonawczych dokonano pomiaru dwóch ich przejawów: elastyczności poznawczej i zdolności tworzenia pojęć. Do ich pomiaru użyto dwóch narzędzi, z których jedno zostało stworzone na podstawie testu sortowania kart Wisconsin. Dla drugiego pierwowzorem był dwuwymiarowy test sortowania kart. W celu zbadania powodzenia szkolnego dokonano jego pomiaru z trzech różnych perspektyw: uczniów, nauczycieli i rodziców. Powodzenie szkolne z perspektywy uczniów i rodziców badano narzędziami stworzonymi na podstawie ankiety powodzenia szkolnego autorstwa Anny Żurawskiej (wywiad z uczniami, kwestionariusz dla rodziców;, trzecim wskaźnikiem powodzenia były oceny szkolne. Wyniki wskazują na istotne znaczenie funkcji wykonawczych w zakresie elastyczności poznawczej dla powodzenia szkolnego (część z uzyskanych wyników osiąga poziom istotności statystycznej. Natomiast w zakresie drugiego z przejawów funkcji wykonawczych, czyli zdolności tworzenia pojęć, związek z powodzeniem szkolnym zaobserwowano jedynie w przypadku pomiaru dokonywanego wśród uczniów.

  13. Singlet structure function F_1 in double-logarithmic approximation

    Science.gov (United States)

    Ermolaev, B. I.; Troyan, S. I.

    2018-03-01

    The conventional ways to calculate the perturbative component of the DIS singlet structure function F_1 involve approaches based on BFKL which account for the single-logarithmic contributions accompanying the Born factor 1 / x. In contrast, we account for the double-logarithmic (DL) contributions unrelated to 1 / x and because of that they were disregarded as negligibly small. We calculate the singlet F_1 in the double-logarithmic approximation (DLA) and account at the same time for the running α _s effects. We start with a total resummation of both quark and gluon DL contributions and obtain the explicit expression for F_1 in DLA. Then, applying the saddle-point method, we calculate the small- x asymptotics of F_1, which proves to be of the Regge form with the leading singularity ω _0 = 1.066. Its large value compensates for the lack of the factor 1 / x in the DLA contributions. Therefore, this Reggeon can be identified as a new Pomeron, which can be quite important for the description of all QCD processes involving the vacuum (Pomeron) exchanges at very high energies. We prove that the expression for the small- x asymptotics of F_1 scales: it depends on a single variable Q^2/x^2 only instead of x and Q^2 separately. Finally, we show that the small- x asymptotics reliably represent F_1 at x ≤ 10^{-6}.

  14. Labour Market Developments in the Maritime Industry of the South Baltic Region

    Directory of Open Access Journals (Sweden)

    Bernacki Dariusz

    2014-03-01

    Full Text Available Dwa główne cele badań, to analiza stanu gospodarki morskiej i zatrudnienia w Rejonie Południowego Bałtyku oraz zidentyfikowanie sektorów gospodarki morskiej wykazujących potencjał dla rozwoju i określenie wpływu, jaki będzie to miało na zatrudnienie i wymagane kwalifikacje zawodowe, a także na możliwości wymiany międzyregionalnej pracowników. Badania porównawcze przeprowadzono dla czterech nadmorskich regionów UE, a mianowicie Meklemburgii-Przedpomorza Przedniego(D, województw: Zachodniopomorskiego i Pomorskiego (PL oraz Regionu Kłajpedy (LT. Wskazano na perspektywy rozwoju gospodarczego poszczególnych segmentów gospodarki morskiej i ustalono związany z tym wpływ na rynki pracy w poszczególnych regionach. Analiza porównawcza poszczególnych segmentów gospodarki morskiej Rejonu Południowego Bałtyku umożliwiła zidentyfikowanie różnic w możliwościach ich rozwoju i w efektach popytu na pracę i na kwalifikacje zawodowe dla każdego z regionów. Zjawisko zróżnicowanego potencjału rozwoju rynków pracy w wyróżnionych segmentach gospodarki morskiej w ujęciu międzyregionalnym przedstawiono w formie wielokryterialnych macierzy prognoz popytu na pracę.

  15. The use of Weibull Statistics to Quantify Property Variability in Fe-3Mn-0.8C Sinter-Hardened Structurally Inhomogeneous Steels

    Directory of Open Access Journals (Sweden)

    Cias A.

    2013-12-01

    Full Text Available Aby uzyskać trzy warianty spiekanej stali Fe-3Mn-0.8C wytworzono mieszanki proszków: niskowęglowego żelazoman- ganu. grafitu oraz proszków żelaza firmy Hóganiis: gąbczastego - NC100.24 i rozpylanych - ABC 100.30 oraz ASC 100.29. Z proszków tych zostały sprasowane, przy ciśnieniu 660MPa. kształtki próbek wytrzymałościowych przeznaczonych do wykonania prób rozciągania i zginania, spieczone następnie w półhermetycznych pojemnikach, w czasie 1 godziny, w suchym azocie lub wodorze, w temperaturze 1120 lub 1250°C, po czym chłodzone z szybkością 64°C/mia Zbadano wytrzymałość na rozciąganie i zginanie otrzymanych próbek przy zastosowaniu statystyki Weibulla. W artykule zaprezentowano wyniki badań mających na celu wykorzystanie i ocenę testów zgodności dla dwu- i trzyparametrowych rozkładów Weibulla. Badania podjęto z powodu rozbieżności publikowanych krytycznych wartości testów zgodności dla dwuparametrowego rozkładu Weibulla oraz ogólnego braku testów zgodności dla trzy parametrów ego rozkładu Weibulla. w odniesieniu do własności stali wytworzonych techniką metalurgii proszków.

  16. Determining Outsourcing Potential for the Inventory Management of Navy Repairables

    National Research Council Canada - National Science Library

    Morgart, Andrew

    1996-01-01

    .... The research then analyzes the costs and benefits of several successful DLA and NAVICP outsourcing initiatives. The analysis results in a model which NAVICP can use to screen repairable items to determine which level of outsourcing will succeed.

  17. Wpływ Rafy Żoliborskiej na warunki przepływu na śródmiejskim odcinku Wisły w Warszawie (km 508–518

    Directory of Open Access Journals (Sweden)

    Anna Sosnowska

    2015-03-01

    Full Text Available W artykule omówiono wyniki obliczeń położenia zwierciadła wody na warszawskim odcinku Wisły w oparciu o pomiary geodezyjne. Pozwoliły one na utworzenie modelu rozpatrywanego odcinka Wisły dla przepływu ustalonego w programie HEC-RAS (wersja 4.1.0, za pomocą którego przeprowadzono symulacje różnych warunków przepływu. Na podstawie otrzymanych wyników symulacji podjęto próbę określenia znaczenia Rafy Żoliborskiej dla śródmiejskiego odcinka Wisły w Warszawie. Analiza wykazała, że jest ona ważnym elementem w profilu podłużnym rzeki i ma wpływ na poziom zwierciadła wody w warszawskiej Wiśle.

  18. 75 FR 24663 - Notice of Proposed Solicitation for Cooperative Agreement Applications (SCAA)

    Science.gov (United States)

    2010-05-05

    ... Agreement Applications (SCAA) AGENCY: Defense Logistics Agency, DOD. ACTION: Proposed solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the DoD Procurement Technical Assistance Program (PTAP) by awarding cost sharing cooperative agreements to assist...

  19. Pentagon otsib Eestist kaupa / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2010-01-01

    Pentagoni logistikatugi Defence Logistic Agency (DLA) pöördus Kaitsetööstuse Liidu poole selgitamaks välja, kas Eesti ettevõtetelt oleks võimalik osta Afganistanis sõdivatele vägedele köögivilja, joogivett ja ehitusmaterjale

  20. Properties of the simian virus 40 (SV40) large T antigens encoded by SV40 mutants with deletions in gene A.

    Science.gov (United States)

    Cole, C N; Tornow, J; Clark, R; Tjian, R

    1986-01-01

    The biochemical properties of the large T antigens encoded by simian virus 40 (SV40) mutants with deletions at DdeI sites in the SV40 A gene were determined. Mutant large T antigens containing only the first 138 to 140 amino acids were unable to bind to the SV40 origin of DNA replication as were large T antigens containing at their COOH termini 96 or 97 amino acids encoded by the long open reading frame located between 0.22 and 0.165 map units (m.u.). All other mutant large T antigens were able to bind to the SV40 origin of replication. Mutants with in-phase deletions at 0.288 and 0.243 m.u. lacked ATPase activity, but ATPase activity was normal in mutants lacking origin-binding activity. The 627-amino acid large T antigen encoded by dlA2465, with a deletion at 0.219 m.u., was the smallest large T antigen displaying ATPase activity. Mutant large T antigens with the alternate 96- or 97-amino acid COOH terminus also lacked ATPase activity. All mutant large T antigens were found in the nuclei of infected cells; a small amount of large T with the alternate COOH terminus was also located in the cytoplasm. Mutant dlA2465 belonged to the same class of mutants as dlA2459. It was unable to form plaques on CV-1p cells at 37 or 32 degrees C but could form plaques on BSC-1 monolayers at 37 degrees C but not at 32 degrees C. It was positive for viral DNA replication and showed intracistronic complementation with any group A mutant whose large T antigen contained a normal carboxyl terminus. These findings and those of others suggest that both DNA binding and ATPase activity are required for the viral DNA replication function of large T antigen, that these two activities must be located on the same T antigen monomer, and that these two activities are performed by distinct domains of the polypeptide. These domains are distinct and separable from the domain affected by the mutation of dlA2465 and indicate that SV40 large T antigen is made up of at least three separate functional

  1. Psychologiczne trudności, wsparcie społeczne oraz radzenie sobie ze stresem u rodziców dzieci z chorobą nowotworową

    Directory of Open Access Journals (Sweden)

    Ewelina Chrapek

    2016-03-01

    Full Text Available Choć w leczeniu chorób nowotworowych u dzieci odnotowano znaczące postępy, a tym samym realnie wzrosły szanse na przeżycie nieletnich pacjentów, jest to wciąż sytuacja kryzysowa nie tylko dla chorego, lecz także dla jego rodziny. Rodzice stają bowiem w obliczu szeregu wyzwań, dotyczących m.in. stałej opieki nad dzieckiem, inwazyjnego i długotrwałego leczenia, problemów finansowych, jak również trudności natury psychologicznej. Zgodnie z klasyfikacją DSM-IV nowotwór zdiagnozowany u dziecka może być przeżyciem o charakterze traumatycznym i prowadzić do wystąpienia objawów stresu pourazowego. Te i inne symptomy zaburzonego funkcjonowania emocjonalnego dziecka mogą z kolei poważnie zagrażać adaptacji rodziców do nowej sytuacji. Celem artykułu jest analiza wyników badań dotyczących psychologicznych trudności rodziców dzieci chorych onkologicznie oraz wsparcia społecznego, które te osoby otrzymują, i stosowanych sposobów radzenia sobie w sytuacjach trudnych. Wnioski: Przegląd piśmiennictwa potwierdził zwiększone ryzyko wystąpienia objawów psychopatologicznych o obrazie depresji, lęku i traumy w omawianej grupie rodziców. Analiza wyników badań wykazała zależność poziomu nasilenia objawów od szeregu zmiennych, w tym od czasu, który upłynął od momentu diagnozy dziecka. Uzyskane dane podkreślają znaczenie wsparcia i umiejętności radzenia sobie ze stresem dla funkcjonowania emocjonalnego matki lub ojca podczas choroby dziecka. Stanowi to podstawę do ważnych działań praktycznych, ze szczególnym uwzględnieniem planowania terapii dla tej grupy rodziców.

  2. Aggregates, broccoli and cauliflower

    Science.gov (United States)

    Grey, Francois; Kjems, Jørgen K.

    1989-09-01

    Naturally grown structures with fractal characters like broccoli and cauliflower are discussed and compared with DLA-type aggregates. It is suggested that the branching density can be used to characterize the growth process and an experimental method to determine this parameter is proposed.

  3. 32 CFR 634.29 - Traffic accident investigation reports.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Traffic accident investigation reports. 634.29... records. Installation law enforcement officials will record traffic accident investigations on Service/DLA... traffic accident investigation reports pertaining to accidents investigated by military police that...

  4. 32 CFR 323.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... Agency. (1) The Staff Director, Corporate Communications, DLA Support Services (DSS-C) will: (i... upon assignment. Refresher training will be provided annually or more frequently if conditions warrant... military members upon assignment. Refresher training will be provided annually or more frequently if...

  5. 76 FR 76954 - Notice of Amendment No. 004 to the Solicitation for Cooperative Agreement Applications (SCAA...

    Science.gov (United States)

    2011-12-09

    ... Cooperative Agreement Applications (SCAA) Issued on July 7, 2010 AGENCY: Defense Logistics Agency, Department of Defense (DoD). ACTION: Amended solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the Department of Defense (DoD) Procurement Technical...

  6. 76 FR 8720 - Notice of Proposed Solicitation for Cooperative Agreement Applications (SCAA)

    Science.gov (United States)

    2011-02-15

    ... Agreement Applications (SCAA) AGENCY: Defense Logistics Agency, DoD. ACTION: Proposed solicitation for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the DoD... the submission of applications to be considered for base year cost sharing cooperative agreement...

  7. 77 FR 27740 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2012-05-11

    ... storage media''. Retrievability: Delete ``and Social Security Number''. Safeguards: Delete last sentence...: * * * * * Categories of individuals covered by the system: Delete entry and replace with ``Children and their sponsors... admission to, DLA-managed day care facilities.'' Categories of records in the system: Delete ``Social...

  8. 75 FR 5997 - Privacy Act of 1974; Systems of Records

    Science.gov (United States)

    2010-02-05

    ... Field Activity Safety and Health Offices. Official mailing addresses are published as an appendix to DLA...; grade; career group; gender; date of birth; home address; place of employment; photographs; safety... mitigated through administrative, technical and physical safeguards described in this document. The...

  9. A Cost Analysis of Forward Positioning Material in the Fifth Fleet Area of Responsibility

    Science.gov (United States)

    2014-12-01

    CTF combined task force CY calendar year DDC defense distribution center DDNB Defense Depot Navy Detachment, Bahrain DHL DHL Airways DLA...items from Bahrain to the requesting unit.  Defense Distribution Center ( DDC )– DDC is concerned with getting the requested national item

  10. Growth model of Au films on Ru(001)

    International Nuclear Information System (INIS)

    Canessa, E.; Calmetta, A.

    1992-06-01

    In an attempt to find generic features on the fractal growth of Au films deposited on Ru(001), a simple simulation model based on irreversible diffusion-limited aggregation (DLA) is discussed. Highly irregular two-dimensional dentritic islands of Au particles that gradually grow on a larger host lattice of Ru particles and have fractal dimension d f approx. 1.70 each, are generated via a multiple had-hoc version of the DLA algorithm for single aggregates. Annealing effects on the islands morphology are reproduced assuming different sticking probabilities at nearest-neighbour lattice sites of Au films on Ru(001). Using simulation data, islands growth are described in analogy to diffusion-limited, precipitate growth with soft impingement of precipities. This leads to analyse thin film island growth kinetics in such fractal systems and to predict a main peak in scattering intensity patterns due to interisland interference. (author). 12 refs, 4 figs

  11. Batched Triangular DLA for Very Small Matrices on GPUs

    KAUST Repository

    Charara, Ali; Keyes, David E.; Ltaief, Hatem

    2017-01-01

    linear algebra operations on very small matrix sizes (usually less than 100). Batched dense linear algebra kernels are becoming ubiquitous for such scientific computations. Within a single API call, these kernels are capable of simultaneously launching a

  12. Detection of Lyman/alpha emission from a DLA galaxy

    DEFF Research Database (Denmark)

    Moller, P.; Fynbo, Johan Peter Uldall; Fall, S.M

    2004-01-01

    HIGH-REDSHIFT; BREAK GALAXIES; STARFORMATION; DISK GALAXIES; METAL ENRICHMENT; HOST GALAXY; ABSORPTION; ABSORBER; SYSTEMS; SPECTROSCOPY......HIGH-REDSHIFT; BREAK GALAXIES; STARFORMATION; DISK GALAXIES; METAL ENRICHMENT; HOST GALAXY; ABSORPTION; ABSORBER; SYSTEMS; SPECTROSCOPY...

  13. Fundusze strukturalne dla bibliotek w okresie programowania 2007-2013

    Directory of Open Access Journals (Sweden)

    Maria Wojcińska

    2009-01-01

    Full Text Available Polska w ramach funduszy strukturalnych otrzyma w okresie programowania 2007-2013 około 67,3 mld euro. Jest to największa pomoc przyznana dotychczas państwu członkowskiemu w ramach Polityki Spójności Unii Europejskiej. Przed bibliotekami – zarówno naukowymi, jak również publicznymi czy nawet szkolnymi pojawiła się więc kolejna szansa na dofinansowanie działalności. W artykule przedstawione są możliwości skorzystania przez te instytucje z funduszy strukturalnych w latach 2007-2013 w ramach Programu Operacyjnego Infrastruktura i Środowisko, Programu Operacyjnego Rozwój Polski Wschodniej, Wielkopolskiego Regionalnego Programu Operacyjnego oraz Programu Operacyjnego Kapitał Ludzki.

  14. Batched Triangular DLA for Very Small Matrices on GPUs

    KAUST Repository

    Charara, Ali

    2017-03-13

    In several scientific applications, like tensor contractions in deep learning computation or data compression in hierarchical low rank matrix approximation, the bulk of computation typically resides in performing thousands of independent dense linear algebra operations on very small matrix sizes (usually less than 100). Batched dense linear algebra kernels are becoming ubiquitous for such scientific computations. Within a single API call, these kernels are capable of simultaneously launching a large number of similar matrix computations, removing the expensive overhead of multiple API calls while increasing the utilization of the underlying hardware.

  15. Ekonomia dla emancypacji: doktryny gospodarcze w Instytucie Paula Freirego

    Directory of Open Access Journals (Sweden)

    Piotr Stańczyk

    2017-01-01

    Full Text Available The main purpose of this article is to reconstruct economic doctrines of the Institute of Paulo Freire which is well known for being one of the most important centres of emancipatory education. Researchers associated with Freire’s critical philosophy of education overcome the impasse of critical theory by inventing alternative economy solutions instead of elaborating neverending criticism of capitalist economy. The article discusses positive economic program of Freire’s Institutes which includes people’s economy of solidarity and inclusive hegemony of public policies.

  16. Biblioteka naukowa (także dla najmłodszych

    Directory of Open Access Journals (Sweden)

    Milc Piotr

    2016-12-01

    Full Text Available The first edition of the European Researchers' Night was held in September 2005. Since then, the number of participants and research institutions, which co-organize the project and open their laboratories to the visitors, has been increasing. Although the humanities are not as spectacular as sciences, and do not allow the presentation of impressive experiments, among the partners of the Researchers' Night there are also academic libraries. They reveal, especially to the youngest, their resources and technologies used every day in the work of librarians. Preparing such a meeting could be an interesting project and a challenge to the librarians in the project team.

  17. DLA Systems Modernization Methodology: Logical Analysis and Design Procedures

    Science.gov (United States)

    1990-07-01

    REPORT off" rm DESCRIPTION REPORT DATA ATM2UTff DESCRIPTIONS ARCHITECTURE BITITY NFLATIONSVP DIAGRAM zmnm OMMMATION RELATIO "mrs IRWW MORAN ATTWOUTU...and relationships of data internal and external to the directory. Constraint: A concept that represents a force which can prevent or limit success...differently from the singular form may also be entered on the line reserved for plurals . This will capture the plural form as used by the system without

  18. Znaczenie informacji dla bezpieczeństwa przedsiębiorstwa

    Directory of Open Access Journals (Sweden)

    Jowita Sobczak

    2014-12-01

    Full Text Available The issue of the information safety management in enterprises was characterized. The research of literature was conducted with the aim to present different defini-tions of the concept of information. The importance and the role of information for enterprises was defined. The approach of organizational units to the process of establishment of the safety management information system was presented. The role and importance of risk management and the estimation of risk in the information safety process was determined and the threats resulting from the use of social networking websites were discussed. It was attempted to find the reasons for the passive approach of enterprises to ensure the safety of information. It was shown that enterprises prefer savings over the safety of information and they often make investments in a situation when the information is already lost or another incident occurred that adversely affected their operation.

  19. Dostępność serwisów internetowych na przykładzie pakietu startowego JBiblioteka

    Directory of Open Access Journals (Sweden)

    Dominik Mirosław Piotrowski

    2016-12-01

    Full Text Available JBiblioteka to innowacyjny pakiet startowy (oparty na open source CMS Joomla! dla bibliotek publicznych, kładący nacisk na dostępność stron internetowych (accessibility. Biblioteki za jego pomocą mogą wdrożyć gotowy portal internetowy, który z założenia spełnia wymagania standardu WCAG 2.0 (Web Content Accessibility Guidelines oraz użyteczności (usability serwisów www. Jest to niezwykle ważne ze względu na Rozporządzenie Rady Ministrów z dnia 12 kwietnia 2012 r. w sprawie Krajowych Ram Interoperacyjności, minimalnych wymagań dla rejestrów publicznych i wymiany informacji w postaci elektronicznej oraz minimalnych wymagań dla systemów teleinformatycznych (Dz. U. 2012, pozycja 526. Rozporządzenie to zobowiązuje podmioty realizujące zadania publiczne do dostosowania serwisów www do standardu WCAG 2.0, uznanego w większości krajów Europy. W artykule zaprezentowano wyniki analizy eksperckiej dotyczącej przeglądu funkcjonalności pakietu JBiblioteka oraz analizy jego dostępności. Głównym celem niniejszego tekstu jest przedstawienie nowych rozwiązań w zakresie dostosowywania serwisów internetowych do potrzeb osób z różnego typu niepełnosprawnościami oraz zaznajomienie środowiska bibliotekarskiego z innowacyjnymi rozwiązaniami w zakresie podnoszenia jakości bibliotecznych serwisów internetowych.

  20. Analiza wielkości i zmienności zużycia wody w kampusie Szkoły Głównej Gospodarstwa Wiejskiego w Warszawie

    Directory of Open Access Journals (Sweden)

    Piotr Wichowski

    2015-10-01

    Full Text Available W artykule przedstawiono badania wielkości i zmienności zużycia wody w kampusie SGGW w roku akademickim 2012/13. Przeciętne jednostkowe zużycie wody w okresie, kiedy realizowane są zajęcia dydaktyczne, wyniosło 29,3 dm3·d–1 dla studenta studiów stacjonarnych i 23,2 dm3·d–1 dla studenta studiów niestacjonarnych. W okresie wakacyjnym wskaźniki te są niższe i wynoszą odpowiednio 15,2 oraz 11,4 dm3·d–1. Wskaźniki te wyznaczono bez uwzględnienia zużycia wody w akademikach. Współczynnik nierównomierności dobowej dla całego kampusu wyniósł 1,54 i był zbliżony do współczynnika nierównomierności godzinowej, wynoszącego 1,52. Najwyższe miesięczne zużycie wody wystąpiło w czerwcu i było o 85% większe od najniższego, które wystąpiło w sierpniu. W cyklu tygodniowym najwyższe zużycie wody obserwowano we wtorki, a najniższe w niedziele. Przeciętne rozbiory wtorkowe są wyższe od rozbiorów niedzielnych o 31,5%. Szczyty rozbiorów w ciągu doby przypadały w godzinach 10–15 oraz 23–01.

  1. Kontrola wewnętrzna w jednostkach realizującychzadania publiczne – przegląd zalecanych praktyk

    Directory of Open Access Journals (Sweden)

    Joanna Dyczkowska

    2009-06-01

    Full Text Available Międzynarodowa Organizacja Najwyższych Organów Kontroli (INTOSAI wydała w 2004 roku dokument zawierający wytyczne w zakresie tworzenia systemów kontroli wewnętrznej w jednostkach sektora publicznego. Wraz z raportami COSO oraz standardami opracowanymi przez Dyrekcję Generalną do spraw Budżetu Komisji Europejskiej akt ten stał się podstawą dla sporządzenia polskich standardów kontroli wewnętrznej w jednostkach realizujących zadania publiczne. Mając na uwadze dokument INTOSAI oraz inne źródła literaturowe, w niniejszym artykule przedstawiono rekomendacje dla tworzenia systemów kontroli wewnętrznej w jednostkach realizujących zadania publiczne. W jego pierwszej części opisano istotę kontroli wewnętrznej. W sposób kompleksowy uwydatniono jej cele, wskazano osoby odpowiedzialne za jej sprawowanie oraz zakres ich odpowiedzialności, zasygnalizowano też potencjalne źródła zagrożeń dla efektywności systemu kontroli wewnętrznej. W drugiej części przedstawiono poszczególne elementy systemu kontroli wewnętrznej, a więc jej środowisko, zarządzanie ryzykiem, działania kontrolne, przepływ informacji i komunikację oraz monitoring. Zaprezentowano również przykładowe zestawy pytań wspomagających audytora wewnętrznego w badaniu systemu kontroli wewnętrznej w jednostce realizującej zadania publiczne.

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Zinc electroplating from non-cyanide alkaline solution is carried out in the presence of condensation product formed between DL-alanine (DLA) and glutaraldehyde. The bath constituents and bath variables are optimized through standard Hull cell experiments. The current efficiency and the throwing power are measured.

  3. Loglines. January - February 2012

    Science.gov (United States)

    2012-02-01

    to that organization’s lineup since 00 , Lee said. Some of those were already used by commercial industry but simply needed to be brought into the...recently began updating and rewriting the Defense Logistics Acquisition Directive, the document that establishes DLA procedures relating to the

  4. 78 FR 45182 - Clarification of Sourcing Requirements for the Procurement List

    Science.gov (United States)

    2013-07-26

    ...) 4140.1-R, DoD Supply Chain Materiel Management Regulation, the AbilityOne Program is designating the... Defense and the General Services Administration Governing Supply Management Relationships Under the National Supply System provides DLA the authority to procure and supply certain assigned products for the...

  5. 77 FR 72335 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-12-05

    ... computer networks, systems, or databases. The records contain the individual's name; social security number... Tribal Government; DoD Contractors. Annual Burden Hours: 4,000. Number of Respondents: 20,000. Responses... control and track access to DLA-controlled networks, computer systems, and databases. The records may also...

  6. 76 FR 39390 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2011-07-06

    .... System manager(s) and address: Director, DLA Human Resources, Headquarters, Defense Logistics Agency...; System of Records AGENCY: Defense Logistics Agency, DoD. ACTION: Notice to amend a system of records. SUMMARY: The Defense Logistics Agency is proposing to amend a system of records notice in its existing...

  7. 32 CFR 1285.5 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS DEFENSE LOGISTICS AGENCY FREEDOM OF INFORMATION ACT PROGRAM § 1285.5 Procedures. (a) FOIA channels. If DLA personnel... office, they will immediately forward it to the local FOIA manager. (b) Central log system. Each FOIA...

  8. 32 CFR 1285.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Defense Other Regulations Relating to National Defense DEFENSE LOGISTICS AGENCY MISCELLANEOUS DEFENSE LOGISTICS AGENCY FREEDOM OF INFORMATION ACT PROGRAM § 1285.3 Definitions. The following terms and meanings... independently on FOIA requests. A DLA activity has its own FOIA manager, initial denial authority, and office of...

  9. 77 FR 15361 - Notice of Amendment No. 001 to the Solicitation for Cooperative Agreement Applications (SCAA...

    Science.gov (United States)

    2012-03-15

    ... Cooperative Agreement Applications (SCAA) Issued on April 12, 2011 and Amendment No. 005 to the SCAA Issued on July 7, 2010 AGENCY: Defense Logistics Agency, DoD. ACTION: Amended solicitations for cost sharing cooperative agreement applications. SUMMARY: The Defense Logistics Agency (DLA) executes the Department of...

  10. Loglines. March-April 2015

    Science.gov (United States)

    2015-04-01

    perform tasks that aren’t included in their missions when DLA already has the expertise. — David Kless 5Loglines March - April 2015 nline buyers...substandard. For example, several years ago some refrigerant on the market had contaminants that could explode under certain conditions, she said

  11. 78 FR 23194 - Federal Acquisition Regulation; Commercial and Government Entity Code

    Science.gov (United States)

    2013-04-18

    ... Award Management Name Change, Phase 1 Implementation) which will make a global update to all of the... outside the United States; and Support supply chain traceability and integrity efforts. II. Discussion and.... For Contractors registered in the System for Award Management (SAM), the DLA Logistics Information...

  12. 77 FR 5779 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-02-06

    ...; Comment Request AGENCY: Defense Logistics Agency, DLA Small Business Programs, DoD. ACTION: Notice... Small Business Programs via email to [email protected] , or by regular mail to the Defense Logistics Agency... Logistics Agency announces the proposed extension of a public information collection and seeks public...

  13. Bias of damped Lyman-α systems from their cross-correlation with CMB lensing

    Science.gov (United States)

    Alonso, D.; Colosimo, J.; Font-Ribera, A.; Slosar, A.

    2018-04-01

    We cross-correlate the positions of damped Lyman-α systems (DLAs) and their parent quasar catalog with a convergence map derived from the Planck cosmic microwave background (CMB) temperature data. We make consistent measurements of the lensing signal of both samples in both Fourier and configuration space. By interpreting the excess signal present in the DLA catalog with respect to the parent quasar catalog as caused by the large scale structure traced by DLAs, we are able to infer the bias of these objects: bDLA=2.6±0.9. These results are consistent with previous measurements made in cross-correlation with the Lyman-α forest, although the current noise in the lensing data and the low number density of DLAs limits the constraining power of this measurement. We discuss the robustness of the analysis with respect to a number different systematic effects and forecast prospects of carrying out this measurement with data from future experiments.

  14. The Impact of Propeller on Aerodynamics of Aircraft / Wpływ Śmigła Na Aerodynamikę Samolotu

    Directory of Open Access Journals (Sweden)

    Zalewski Wiesław

    2015-09-01

    Full Text Available W pracy przedstawiono analizę numeryczną wpływu pracujących śmigieł na aerodynamikę samolotu na przykładzie dwusilnikowego, bezzałogowego samolotu o napędzie elektrycznym. Analiza koncentrowała się głównie na symulacji wzajemnego oddziaływania układu skrzydło-śmigło samolotu. Badano i porównywano trzy konfiguracje: samolot bez śmigieł, samolot ze śmigłami pchającymi i samolot ze śmigłami ciągnącym. Dla każdej konfiguracji wyznaczono rozkłady współczynników aerodynamicznych wzdłuż rozpiętości skrzydła oraz ich globalne wartości dla całego samolotu. Obliczenia wykonano za pomocą programu Fluent z implementacja modelu śmigła opartą na Teorii Elementu Łopaty.

  15. Industrial chains and innovation activity in Małopolska region in 2008-2010

    Directory of Open Access Journals (Sweden)

    Świadek Arkadiusz

    2014-05-01

    Full Text Available Znaczenie powiązań przemysłowych dla aktywności innowacyjnej przedsiębiorstw w regionie małopolskim w latach 2008-2010 Głównym celem prowadzonych badań była próba poszukiwania zmiennych warunków wpływu łańcuchów dostaw na działalność innowacyjną przedsiębiorstw w obrębie wybranego regionalnego systemu przemysłowego, a tym samym określenie warunków brzegowych dla modelu regionalnej sieci innowacji, biorąc pod uwagę specyfikę województwa małopolskiego. Badanie zostało oparte na kwestionariuszu ankietowym i wykonane na grupie 500 firm z Małopolski. W badaniu wykorzystano modelowanie probitowe. Metoda ta jest skutecznym narzędziem analizy dużych, ale statycznych prób, w których zmienna zależna ma charakter jakościowy.

  16. Mobbing w miejscu pracy a regulacyjna rola strategii wpływu społecznego

    Directory of Open Access Journals (Sweden)

    Malgorzata Gamian-Wilk

    2017-12-01

    Full Text Available Artykuł stanowi przegląd teoretyczny, dotyczący problematyki mobbinguw miejscu pracy z perspektywy przejawów wpływu społecznego. Porównanonegatywne działania, charakterystyczne dla mobbingu, do procesu manipulacji orazdo taktyk wpływu społecznego, pojawiających się w miejscu pracy. Przedstawionoźródła i czynniki ryzyka rozwoju mobbingu, które mogą ułatwiać lub dawać przyzwoleniena  stosowanie taktyk manipulacji. Wykazano, że  w  procesie mobbingu występują takie strategie wpływu społecznego, jak manipulacja w języku i procesiekomunikacji, ostracyzm czy też plotka. Dyskusji poddano regulacyjną rolę negatywnychsposobów oddziaływania i strategii wpływu dla funkcjonowania i przetrwaniagrupy i organizacji, co przyczyniać się może do utrwalania się rozwoju mobbingu.

  17. Nucleation of Organic Molecules via a Hot Precursor State: Pentacene on Amorphous Mica

    Science.gov (United States)

    2013-01-01

    Organic thin films have attracted considerable interest due to their applicability in organic electronics. The classical scenario for thin film nucleation is the diffusion-limited aggregation (DLA). Recently, it has been shown that organic thin film growth is better described by attachment-limited aggregation (ALA). However, in both cases, an unusual relationship between the island density and the substrate temperature was observed. Here, we present an aggregation model that goes beyond the classical DLA or ALA models to explain this behavior. We propose that the (hot) molecules impinging on the surface cannot immediately equilibrate to the substrate temperature but remain in a hot precursor state. In this state, the molecules can migrate considerable distances before attaching to a stable or unstable island. This results in a significantly smaller island density than expected by assuming fast equilibration and random diffusion. We have applied our model to pentacene film growth on amorphous Muscovite mica. PMID:24340130

  18. Thermodynamic Description Of Ternary Fe-B-X Systems. Part 2: Fe-B-Ni

    Directory of Open Access Journals (Sweden)

    Miettinen J.

    2014-06-01

    Full Text Available Przedstawiono termodynamiczny opis trójskładnikowego układu Fe-B-Ni w kontekście nowej bazy danych dla układów Fe-B-X (X = Cr, Ni, Mn, Si, Ti, V, C. Parametry termodynamiczne dwuskładnikowych stopów Fe-B. Fe-Ni i B-Ni zostały są zaczerpnięte z wcześniejszych opracowań, przy tym opis B-Ni został nieznacznie zmodyfikowany. Parametry dla układu Fe-B-Ni zostały zoptymalizowane w tej pracy w oparciu o eksperymentalne równowagi fazowe i dane termodynamiczne zaczerpnięte z literatury. Roztwory stałe w układzie Fe-B-Ni opisano przy użyciu modelu roztworu substytucyjnego, a borki traktowane są jako fazy stechiometryczne lub półstechiometryczne typu (A.BpCq opisane przy użyciu modelu dwu podsieci.

  19. Propozycja nowego podejścia metodycznego i interpretacji wyników oznaczeń przeciwciał przeciwko Borrelia burgdorferi – analiza składu przeciwciałowego krążących kompleksów immunologicznych

    Directory of Open Access Journals (Sweden)

    Karolina Miąskiewicz

    2011-10-01

    Full Text Available Borelioza z Lyme ma bogatą symptomatologię i w znacznym odsetkuprzypadków może przypominać wczesne stadia układowej chorobytkanki łącznej. Część pacjentów trafia po wizycie u lekarza POZdo reumatologa. Reumatolog może zlecić badania autoprzeciwciał„markerowych” oraz na obecność przeciwciał bakteryjnych (przeciwkoBorrelia burgdorferi. Odsetek wyników dodatnich w kierunku B. burgdorferijest znikomy (14,7%, istnieje zatem problem wiarygodnościtych wyników.Seronegatywność pod względem obecności swoistych przeciwciałdla B. burgdorferi dotyczy ok. 30���40% surowic pacjentów z podejrzeniemboreliozy, łącznie z pacjentami z potwierdzonymi w wywiadzieukąszeniami przez kleszcza i wystąpieniem objawu patognomonicznego(rumienia wędrującego. Mimo że dysponujemy licznymitestami bakteriologicznymi, serologicznymi czy molekularnymi(PCR, diagnostyka boreliozy nastręcza trudności i może prowadzić do uzyskiwania wyników fałszywie ujemnych lub fałszywie dodatnich.Autorzy pracy skupili się na surowicach pacjentów seronegatywnychpod względem przeciwciał dla B. burgdorferi, w których wolneprzeciwciała przeciwko B. burgdorferi zostały związane przezantygeny krętka i utworzyły krążące kompleksy immunologiczne (KKI.Celem pracy była analiza KKI pod kątem obecności przeciwciał przeciwkoB. burgdorferi w trudnych diagnostycznie surowicach pacjentów,u których obraz kliniczny wskazywał na obecność zakażenia krętkiemz rodzaju B. burgdorferi (ryc. 1–7. Badania przeprowadzono nasurowicach 54 chorych z wywiadem wskazującym na boreliozę. Zastosowanonowe metodyczne podejście do analizy obecności swoistychprzeciwciał dla B. burgdorferi – wytrącanie i dysocjację KKI, a następnieoznaczanie w uzyskanej frakcji γ z osadu PEG przeciwciał swoistychdla B. burgdorferi. W 41 surowicach ujemnych w teście ELISAwytrącono frakcję γ z osadu PEG i powtórnie oznaczono przeciwciaładla B. burgdorferi. W 82

  20. 78 FR 14278 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2013-03-05

    ... Logistics; Pub.L. 95-521, Ethics in Government Act; and DoD Directive 7050.5, Coordination of Remedies for Fraud and Corruption Related to Procurement Activities.'' Purpose(s): Delete entry and replace with... or group of individuals or other entities from DLA procurement and sales.'' Routine uses of records...

  1. 78 FR 78943 - Notice of Availability (NOA) of an Environmental Assessment (EA) for the Temporary Storage of...

    Science.gov (United States)

    2013-12-27

    ... Defense Supply Center Richmond, Virginia AGENCY: Defense Logistics Agency, DoD. ACTION: Notice of... at Defense Supply Center Richmond, Virginia. SUMMARY: The Defense Logistics Agency (DLA) announces... Engelberger at (703) 767-0705 during normal business hours Monday through Friday, from 8:00 a.m. to 4:30 p.m...

  2. 75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside

    Science.gov (United States)

    2010-05-10

    ... Small Business Set-Aside AGENCY: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to...) regarding partial small business set-asides for Defense Logistics Agency (DLA), Defense Energy Support..., DESC is requesting a class deviation from FAR Clause 52.219-7, Notice of Partial Small Business Set...

  3. Eclipsing damped Lyα systems in the Sloan Digital Sky Survey Data Release 12★

    Science.gov (United States)

    Fathivavsari, H.; Petitjean, P.; Jamialahmadi, N.; Khosroshahi, H. G.; Rahmani, H.; Finley, H.; Noterdaeme, P.; Pâris, I.; Srianand, R.

    2018-04-01

    We present the results of our automatic search for proximate damped Lyα absorption (PDLA) systems in the quasar spectra from the Sloan Digital Sky Survey Data Release 12. We constrain our search to those PDLAs lying within 1500 km s-1 from the quasar to make sure that the broad DLA absorption trough masks most of the strong Lyα emission from the broad line region (BLR) of the quasar. When the Lyα emission from the BLR is blocked by these so-called eclipsing DLAs, narrow Lyα emission from the host galaxy could be revealed as a narrow emission line (NEL) in the DLA trough. We define a statistical sample of 399 eclipsing DLAs with log N(H I) ≥ 21.10. We divide our statistical sample into three subsamples based on the strength of the NEL detected in the DLA trough. By studying the stacked spectra of these subsamples, we found that absorption from high ionization species are stronger in DLAs with stronger NEL in their absorption core. Moreover, absorption from the excited states of species like Si II are also stronger in DLAs with stronger NEL. We also found no correlation between the luminosity of the Lyα NEL and the quasar luminosity. These observations are consistent with a scenario in which the DLAs with stronger NEL are denser and physically closer to the quasar. We propose that these eclipsing DLAs could be the product of the interaction between infalling and outflowing gas. High resolution spectroscopic observation would be needed to shed some light on the nature of these eclipsing DLAs.

  4. Witnessing the assembly of galaxies in an extended gas-rich structure at z 3.25

    Science.gov (United States)

    Mackenzie, Ruari

    2017-08-01

    The direct study of star formation in Damped Lyman Alpha systems (DLAs), the reservoirs of the majority of neutral gas at high redshift, has previously been hampered by the lack of deep integral field spectroscopy for sensitive searches of faint host galaxies. Building on our successful HST shot-in-the-dark survey that has probed the in-situ star formation rate of z 2-3 DLAs, we have initiated a MUSE follow-up of 6 DLA signlines to overcome this bottleneck. In the first sightline we have studied, we have uncovered a 40 kpc Lyman alpha emitting nebula, composed of two clumps within 50 kpc of the DLA, suggestive of a merger or an extended protodisk. Within this structure, which is the largest nebula known to be associated with a z 3 DLA, we also found a compact continuum source with spectrophotometry consistent with a Lyman Break Galaxy at the same redshift. Aside from the LBG, the rest of the Lyman alpha structure has no continuum counterpart in deep UV and visible imaging. The LBG alone seems unable to power the Lyman alpha nebula and the morphology supports our conclusion that, most likely, this structure is powered by in-situ star formation below detection limit. However, from the Lyman alpha alone the origin of this incredible structure remains ambiguous. With this proposal, we aim to acquire high resolution, deep infrared imaging with HST to probe the rest-frame optical emission to search for the underlying stellar emission of this object and to infer the stellar mass of the LBG. With the powerful combination of HST and MUSE data, we will unravel the nature of this unique system.

  5. Template mediated protein self-assembly as a valuable tool in regenerative therapy.

    Science.gov (United States)

    Kundu, B; Eltohamy, M; Yadavalli, V K; Reis, R L; Kim, H W

    2018-04-11

    The assembly of natural proteinaceous biopolymers into macro-scale architectures is of great importance in synthetic biology, soft-material science and regenerative therapy. The self-assembly of protein tends to be limited due to anisotropic interactions among protein molecules, poor solubility and stability. Here, we introduce a unique platform to self-immobilize diverse proteins (fibrous and globular, positively and negatively charged, low and high molecular weight) using silicon surfaces with pendant -NH 2 groups via a facile one step diffusion limited aggregation (DLA) method. All the experimental proteins (type I collagen, bovine serum albumin and cytochrome C) self-assemble into seaweed-like branched dendritic architectures via classical DLA in the absence of any electrolytes. The notable differences in branching architectures are due to dissimilarities in protein colloidal sub-units, which is typical for each protein type, along with the heterogeneous distribution of surface -NH 2 groups. Fractal analysis of assembled structures is used to explain the underlying route of fractal deposition; which concludes how proteins with different functionality can yield similar assembly. Further, the nano-micro-structured surfaces can be used to provide functional topographical cues to study cellular responses, as demonstrated using rat bone marrow stem cells. The results indicate that the immobilization of proteins via DLA does not affect functionality, instead serving as topographical cues to guide cell morphology. This indicates a promising design strategy at the tissue-material interface and is anticipated to guide future surface modifications. A cost-effective standard templating strategy is therefore proposed for fundamental and applied particle aggregation studies, which can be used at multiple length scales for biomaterial design and surface reformation.

  6. The astrophysical consequences of intervening galaxy gas on fast radio bursts

    Science.gov (United States)

    Prochaska, J. Xavier; Neeleman, Marcel

    2018-02-01

    We adopt and analyze results on the incidence and physical properties of damped Ly$\\alpha$ systems (DLAs) to predict the astrophysical impact of gas in galaxies on observations of Fast Radio Bursts (FRBs). Three DLA measures form the basis of this analysis: (i) the HI column density distribution, parameterized as a double power-law; (ii) the incidence of DLAs with redshift (derived here), $\\ell(z)=A+B \\arctan(z-C)$ with $A=0.236_{-0.021}^{+0.016}, B=0.168_{-0.017}^{+0.010}, C=2.87_{-0.13}^{+0.17}$ and (iii) the electron density, parameterized as a log-normal deviate with mean $10^{-2.6} cm^{-3}$ and dispersion 0.3dex. Synthesizing these results, we estimate that the average rest-frame dispersion measure from the neutral medium of a single, intersecting galaxy is DM$^{NM}_{DLA}=0.25$ pc/cm^3. Analysis of AlIII and CII* absorption limits the putative warm ionized medium to contribute DM$^{WIM}_{DLA}<20$pc/cm^3. Given the low incidence of DLAs, we find that a population of FRBs at z=2 will incur DM(z=2)=0.01 pc/cm^3 on average, with a 99% c.l. upper bound of 0.22 pc/cm^3. Assuming that turbulence of the ISM in external galaxies is qualitatively similar to our Galaxy, we estimate that the angular broadening of an FRB by intersecting galaxies is negligible ($\\theta<0.1$mas). The temporal broadening is also predicted to be small, $\\tau \\approx 0.3$ms for a z=1 galaxy intersecting a z=2 FRB for an observing frequency of $\

  7. Can the Spatial Point Patterns of Animal Distributions Be Detected Using Sparse Samples? A Case Study of Four Soricomorpha (Mammalia Species in Poland / Czy Przestrzenny Wzorzec Rozkładu Punktów W Dystrybucji Zwierząt Może Zostać Określony Na Podstawie Rzadkiego Próbkowania? Studium Przypadku Na Czterech Gatunkach Soricomorpha (Mammalia Występujących W Polsce.

    Directory of Open Access Journals (Sweden)

    Chen Youhua

    2014-12-01

    Full Text Available W niniejszej pracy użyto funkcji K.-Ridley’a oraz alternatywnych modeli przestrzennego rozkładu punktów dla wyliczenia i porównania mieszanych danych o dystrybucji czterech gatunków ssaków występujących w Polsce, należących do Soricomorpha (Talpa europaea, Sorex araneus, Sorex minutus i Neomys fodiens na podstawie prób o różnej wielkości. Następujące modele zostały dopasowane i porównane: homogeniczny proces Poissona (HPP z niehomogenicznym procesem Poissona (1PP. Dla modeli 1PP zmiennymi wyjaśniającymi (kowariantami przebieg trendu były współrzędne geograficzne. Modele procesów przestrzennych i rzeczy- wisty status rozmieszczenia (z użyciem funkcji K. badanych gatunków był też szacowany na podstawie pełnych danych pochodzących z obserwacji w celu sprawdzenia jak wiele komórek sieci jest wymagane do próbkowania, aby oddało ono rzeczywisty wzorzec rozmieszczenia punktowego. Rozważano próbkowanie z wielkością próby: 5, 10, 30, 60 i 100 elementów. Dla każdej wielkości próby wykonano 500 powtórzeń w celu utrzymania spójności i redukcji nieokreśloności modelu. Wykazano, żc bazując na pełnych danych pochodzących z obserwacji modele 1PP są dużo lepsze od zerowego modelu HPP w wyjaśnieniu wzorców dystrybucji gatunków Soricomorpha na całym obszarze Polski. Dla każdej wielkości próby rzeczywisty status koncentracji gatunku jest powiązany z modelami przestrzennymi rozkładu punktów jego występowania na analizowanym obszarze i może być precyzyjnie określony na podstawie ograniczonej liczby prób. Na bazie otrzymanych rezultatów zostało stwierdzone, żc około 20% komórek sieci powinno być użyte jako minimalna, progowa liczba do dokładnego określenia rzeczywistego wzorca przestrzennego rozkładu punktów.

  8. Inna codzienność. Funkcjonowanie Wenecji jako miasta bez samochodów

    Directory of Open Access Journals (Sweden)

    Hubert Trammer

    2017-12-01

    Full Text Available W kształtowaniu przestrzeni zazwyczaj przyjmowane są standardy wynikające z przyjętych powszechnie rozwiązań mających zaspokajać ludzkie potrzeby. Niestety często środki okazują się ważniejsze niż cele. Dążąc do zapewnienia mobilności i jednocześnie ochrony przed uciążliwościami transportu ogromne przestrzenie przeznacza się na wyalienowane z otoczenia trasy komunikacyjne i przestrzenie izolujące. Są jednak inne rozwiązania. Spektakularnym przykładem jest Wenecja – miasto, którego spora część jest niedostępna dla samochodów. Zatem pozbawiona jest związanych z ich obecnością uciążliwości, ale także możliwości wykorzystania ich w wielu różnych celach. W Wenecji w rolach w większości świata zarezerwowanych dla samochodów występują różnego rodzaju łodzie i statki. Warto zwrócić uwagę na szereg codziennych sytuacji z funkcjonowania części Wenecji pozbawionej samochodów. Zastępuje je nie tylko transport wodny, ale także pieszy. Znaczenie dla codzienności Wenecji ma także kameralna skala pieszych placów i uliczek. Wenecja boryka się z problemem utraty mieszkańców wypieranych przez turystów, oraz wypierania funkcji służących mieszkańcom przez przeznaczone dla turystów. Jednakże te problemy nie powinny dyskredytować organizacji przestrzeni w mieście. Są one bowiem skutkiem ubocznym sukcesu turystycznego wynikającego z wyjątkowej jakości miejsca. Przykłady rozwiązań opartych na odrzuceniu podporządkowania przestrzeni samochodom można znaleźć także w wielu innych miejscowościach, na terenie których odrzucenie dominacji samochodu nie przybrało takiej skali jak w Wenecji. Przykłady można znaleźć także w Polsce. Inne relacje przestrzenne powodują inne relacje między różnymi użytkownikami, a także inne relacje między przebywaniem w mieście, a przemieszczaniem się przez nie.

  9. High performance linear algebra algorithms: An introduction

    DEFF Research Database (Denmark)

    Gustavson, F.G.; Wasniewski, Jerzy

    2006-01-01

    his Mini-Symposium consisted of two back to back sessions, each consisting of five presentations, held on the afternoon of Monday, June 21, 2004. A major theme of both sessions was novel data structures for the matrices of dense linear algebra, DLA. Talks one to four of session one all centered...

  10. 32 CFR Appendix to Part 145 - Legal Representation

    Science.gov (United States)

    2010-07-01

    ... COOPERATION WITH THE OFFICE OF SPECIAL COUNSEL OF THE MERIT SYSTEMS PROTECTION BOARD Pt. 145, App. Appendix to... Defense Agency (other than the DLA), or by the General Counsel of a Military Department or the General... cognizant DoD officials to approve a represented employee's request for travel, per diem, witness...

  11. 40 CFR Table 3 to Subpart Jjjjj of... - Requirements for Performance Tests

    Science.gov (United States)

    2010-07-01

    ... pressure drop across the DLA, determine and record the block average pressure drop values for the three test runs, and determine and record the 3-hour block average of the recorded pressure drop measurements for the three test runs. b. Establish the operating limit for the limestone feeder setting Data from...

  12. 32 CFR 34.12 - Payment.

    Science.gov (United States)

    2010-07-01

    ... Program Management § 34.12 Payment. (a) Methods available. Payment methods for awards with for-profit... Administration Services Components,” DLAH 4105.4, which can be obtained from either: Defense Logistics Agency...-6220; or the Defense Contract Management Command home page at http://www.dcmc.dcrb.dla.mil. 2 See...

  13. 78 FR 57845 - Notice of Availability (NOA) for Strategic Network Optimization (SNO) Program Environmental...

    Science.gov (United States)

    2013-09-20

    ... Logistics Agency, DoD. ACTION: Notice of Availability (NOA) for Strategic Network Optimization (SNO) Program Environmental Assessment. SUMMARY: The Defense Logistics Agency (DLA) announces the availability of an...-0705 during normal business hours Monday through Friday, from 8:00 a.m. to 4:30 p.m. (EST) or by email...

  14. The redshifted HI 21 cm signal from the post-reionization epoch ...

    Indian Academy of Sciences (India)

    72

    tral HI gas are housed in the Damped Ly-α (DLA) systems. .... We use δT to denote the redshifted 21-cm brightness temperature fluctuations ..... Two separate telescopes named SKA-low and SKA-mid operating at two ... considered in the 'Baseline Design Document' and 'SKA Level 1 Requirements ... We can see that the.

  15. Exploring the Impact of Students' Learning Approach on Collaborative Group Modeling of Blood Circulation

    Science.gov (United States)

    Lee, Shinyoung; Kang, Eunhee; Kim, Heui-Baik

    2015-01-01

    This study aimed to explore the effect on group dynamics of statements associated with deep learning approaches (DLA) and their contribution to cognitive collaboration and model development during group modeling of blood circulation. A group was selected for an in-depth analysis of collaborative group modeling. This group constructed a model in a…

  16. 32 CFR 1288.5 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... validation sticker will be determined locally. (4) Decals or other media used to identify vehicles of... OF PRIVATELY OWNED MOTOR VEHICLES § 1288.5 Procedures. (a) Issuance of DLA POV decal and 3-year... vehicle. An additional decal may be placed on the rear bumper of the vehicle. For vehicles not equipped...

  17. 32 CFR Appendix H to Part 323 - DLA Exemption Rules

    Science.gov (United States)

    2010-07-01

    ...) when access to accounting disclosures and access to or amendment of records would cause the identity of.... Reasons: From subsection (c)(3) because granting access to the accounting for each disclosure as required... accounting for each disclosure as required by the Privacy Act, including the date, nature, and purpose of...

  18. O teorii transkulturowej i jej implikacjach dla badań humanistycznych

    Directory of Open Access Journals (Sweden)

    Ewa Niedziałek

    2016-06-01

    Full Text Available The article attempts to grasp the essence of transcultural theory, locate its roots and situate it within the framework of previous cultural research. This enables the influence of this theory on the projected future significance of humanistic research. The author makes use of the theoretical approaches of Arianna Dagnino and Mikhail Epstein. Although looking at this theory fromdifferent angles, in both cases the transcultural perspective translates into a unique perception of humanities (“transcultural” or “transformative” humanities, as a field of key importance for the future of science.

  19. Electron accelerators for radiosterilization; Akceleratory elektronow dla potrzeb sterylizacji radiacyjnej

    Energy Technology Data Exchange (ETDEWEB)

    Zimek, Z [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)

    1997-10-01

    The applications of electron accelerators in commercial plants for radiosterilization have been shown. Advantages of such irradiation source have been presented. The types and parameters of accelerators being installed in worldwide irradiation plants for radiosterilization have been listed as well. 2 tabs.

  20. Induction of unresponsiveness to major transplantable organs in adult mammals

    International Nuclear Information System (INIS)

    Rapaport, F.T.; Bachvaroff, R.J.; Mollen, N.; Hirasawa, H.; Asano, T.; Ferrebee, J.W.

    1979-01-01

    Transplantation of renal allografts obtained from prospectively selected genotypically DLA-identical donors into supralethally irradiated dogs reconstituted with their own stored bone marrow has produced a state of unresponsiveness to these kidneys in the recipients. Eleven of 18 kidneys transplanted at 12 hours after marrow replacement currently survive with normal function and maintain life in the recipients. Similar results occurred in eight of 13 allografts transplanted at 28 hours and in eight of 13 kidneys grafted at 36 hours after marrow replacement. Only four of 16 recipients of kidneys transplanted at the time of marrow replacement were unresponsive to their allografts. Similarly, only five of 19 recipients of kidneys placed in irradiated dogs at 40 hours before marrow replacement accepted such allografts. When kidney transplants were placed into the recipients 20 hours before removal of marrow, irradiation, and reconstitution with stored marrow, only three of 21 dogs became unresponsive to such allografts. In five of 12 instances, the recipients were also unresponsive to skin allografts obtained from their respective kidney donors. Rejection of these skin grafts had no detectable effect on the function and survival of kidney allografts from the same source. Seven of eight skin grafts obtained from other DLA-identical donors were rejected. Eleven DLA-incompatible skin allografts placed on the recipients at the same time were rejected within 11 to 20 days. Supralethal total body irradiation and bone marrow replacement can establish in the adult canine host a privileged phase of immunological reactivity during which exposure to alloantigens produces specific long-term unresponsiveness rather than sensitization. The use of stored autologous rather than allogeneic bone marrow for reconstitution of the irradiated recipient eliminates the hazards of GVH complication usually associated with this procedure

  1. Design Pattern Mining Using Distributed Learning Automata and DNA Sequence Alignment

    Science.gov (United States)

    Esmaeilpour, Mansour; Naderifar, Vahideh; Shukur, Zarina

    2014-01-01

    Context Over the last decade, design patterns have been used extensively to generate reusable solutions to frequently encountered problems in software engineering and object oriented programming. A design pattern is a repeatable software design solution that provides a template for solving various instances of a general problem. Objective This paper describes a new method for pattern mining, isolating design patterns and relationship between them; and a related tool, DLA-DNA for all implemented pattern and all projects used for evaluation. DLA-DNA achieves acceptable precision and recall instead of other evaluated tools based on distributed learning automata (DLA) and deoxyribonucleic acid (DNA) sequences alignment. Method The proposed method mines structural design patterns in the object oriented source code and extracts the strong and weak relationships between them, enabling analyzers and programmers to determine the dependency rate of each object, component, and other section of the code for parameter passing and modular programming. The proposed model can detect design patterns better that available other tools those are Pinot, PTIDEJ and DPJF; and the strengths of their relationships. Results The result demonstrate that whenever the source code is build standard and non-standard, based on the design patterns, then the result of the proposed method is near to DPJF and better that Pinot and PTIDEJ. The proposed model is tested on the several source codes and is compared with other related models and available tools those the results show the precision and recall of the proposed method, averagely 20% and 9.6% are more than Pinot, 27% and 31% are more than PTIDEJ and 3.3% and 2% are more than DPJF respectively. Conclusion The primary idea of the proposed method is organized in two following steps: the first step, elemental design patterns are identified, while at the second step, is composed to recognize actual design patterns. PMID:25243670

  2. ANALIZA NIEZAWODNOŚCI STACJI UZDATNIANIA WODY

    Directory of Open Access Journals (Sweden)

    Barbara TCHÓRZEWSKA-CIEŚLAK

    Full Text Available Systemy zbiorowego zaopatrzenia w wodę składają się z połączonych ze sobą elementów (podsystemów stanowiących integralna całość, współpracujących ze sobą w sposób ciągły w celu zapewnienia dla konsumentów wody o odpowiedniej jakości. W przypadku gdy jakość wody w źródle nie odpowiada normatywom stawianym wodzie przeznaczonej do spożycia przez ludzi, woda musi być poddana procesom uzdatniania. Niezawodność funkcjonowania stacji uzdatniania wody jest jednym z podstawowych elementów szeroko rozumianej analizy niezawodności i bezpieczeństwa całego systemu zbiorowego zaopatrzenia w wodę. Niezawodność dostawy wody polega na zapewnieniu stabilnych warunków, umożliwiających pokrycie bieżącego i perspektywicznego zapotrzebowania na wodę w odpowiedniej ilości i wymaganej jakości w dowolnym, dogodnym dla konsumentów wody czasie. W pracy przedstawiono podstawy analizy niezawodności, podano podstawowe miary oraz zasady wykorzystania struktur niezawodnościowych. Obliczenia wykonano dla stacji uzdatniania wody na podstawie schematu niezwodnościowego metodą jednoparametryczną. Na podstawie danych z eksploatacyjnych stacji uzdatniania wody (SUW wchodzącej w skład systemu zbiorowego zaopatrzenia w wodę miasta liczącego ok 80 tys. mieszkańców sporządzono schemat niewodności stacji oraz przeprowadzono obliczenia wskaźnika gotowości K. W metodzie wykorzystano podstawowe struktury niezawodnościowe. Wyznaczoną miarę niezawodności porównano z wartościami kryterialnymi.

  3. PROJEKTOWANIE NOWYCH I MODERNIZACJA ISTNIEJĄCYCH OBIEKTÓW MOSTOWYCH W ASPEKCIE OCHRONY PRZYRODY I KRAJOBRAZU NA PRZYKŁADZIE REALIZACJI W REGIONIE PODLASIA, WARMII I MAZUR

    Directory of Open Access Journals (Sweden)

    Agnieszka JABŁOŃSKA-KRYSIEWICZ

    Full Text Available W artykule przedstawiono, na wybranych przykładach zrealizowanych obiektów, podstawowe determinanty ochrony krajobrazu i przyrody, jakimi należy się kierować przy opracowaniu dokumentacji projektowej dla nowego, czy też dla remontowanego mostu na terenach krajobrazowo i przyrodniczo cennych. Kryterium uwarunkowań historyczno-krajobrazowych przy projektowaniu i modernizacji starych obiektów jest szczególnie ważne na terenach „Zielonych Płuc Polski” do jakich można zaliczyć obszar północno-wschodniej Polski. Szczególną uwagę zwrócono na zachowanie formy starych mostów łukowych ze sklepieniem ceglanym. Mosty te znajdują się często w złym stanie technicznym. Przedstawiono dwa rozwiązania konstrukcyjne stosowane przy przebudowie tego typu obiektów: zastosowanie wzmocnienia w postaci stalowych blach karbowanych opartych na żelbetowych przyczółkach oraz wykonanie żelbetowych łuków, oblicowanych cegłą klinkierową, opartych na istniejących podporach, wzmocnionych żelbetowym oczepem. Omówiono na przykładach wybranych obiektów podstawowe uwarunkowania środowiskowe brane pod uwagę przy projektowaniu mostów i przepustów na terenach wiejskich. Zwrócono uwagę na dostosowanie obiektu do otaczającego krajobrazu poprzez zastosowanie odpowiedniej roślinności, zarówno na zabezpieczeniu skarp jak i po obu stronach mostu. Przedstawiono możliwości wykonania przejść dla zwierząt w małych obiektach mostowych i przepustach. Zwrócono uwagę na zagadnienie estetycznego kształtowania konstrukcji mostowych jako dążenie do zachowania formy współgrającej z otoczeniem, szczególnie na obszarze miast, gdzie most jest ważnym punktem widokowym.

  4. Dynamics of dimethylsulphoniopropionate and dimethylsulphide under different CO2 concentrations during a mesocosm experiment

    Directory of Open Access Journals (Sweden)

    C. LeQuéré

    2008-03-01

    Full Text Available The potential impact of seawater acidification on the concentrations of dimethylsulfide (DMS and dimethylsulfoniopropionate (DMSP, and the activity of the enzyme DMSP-lyase was investigated during a pelagic ecosystem CO2 enrichment experiment (PeECE III in spring 2005. Natural phytoplankton blooms were studied for 24 days under present, double and triple partial pressures of CO2 (pCO2; pH=8.3, 8.0, 7.8 in triplicate 25 m3 enclosures. The results indicate similar DMSP concentrations and DMSP-lyase activity (DLA patterns for all treatments. Hence, DMSP and DLA do not seem to have been affected by the CO2 treatment. In contrast, DMS concentrations showed small but statistically significant differences in the temporal development of the low versus the high CO2 treatments. The low pCO2 enclosures had higher DMS concentrations during the first 10 days, after which the levels decreased earlier and more rapidly than in the other treatments. Integrated over the whole study period, DMS concentrations were not significantly different from those of the double and triple pCO2 treatments. Pigment and flow-cytometric data indicate that phytoplanktonic populations were generally similar between the treatments, suggesting a certain resilience of the marine ecosystem under study to the induced pH changes, which is reflected in DMSP and DLA. However, there were significant differences in bacterial community structure and the abundance of one group of viruses infecting nanoeukaryotic algae. The amount of DMS accumulated per total DMSP or chlorophyll-a differed significantly between the present and future scenarios, suggesting that the pathways for DMS production or bacterial DMS consumption were affected by seawater pH. A comparison with previous work (PeECE II suggests that DMS concentrations do not respond consistently to pelagic ecosystem CO2 enrichment experiments.

  5. Design pattern mining using distributed learning automata and DNA sequence alignment.

    Directory of Open Access Journals (Sweden)

    Mansour Esmaeilpour

    Full Text Available CONTEXT: Over the last decade, design patterns have been used extensively to generate reusable solutions to frequently encountered problems in software engineering and object oriented programming. A design pattern is a repeatable software design solution that provides a template for solving various instances of a general problem. OBJECTIVE: This paper describes a new method for pattern mining, isolating design patterns and relationship between them; and a related tool, DLA-DNA for all implemented pattern and all projects used for evaluation. DLA-DNA achieves acceptable precision and recall instead of other evaluated tools based on distributed learning automata (DLA and deoxyribonucleic acid (DNA sequences alignment. METHOD: The proposed method mines structural design patterns in the object oriented source code and extracts the strong and weak relationships between them, enabling analyzers and programmers to determine the dependency rate of each object, component, and other section of the code for parameter passing and modular programming. The proposed model can detect design patterns better that available other tools those are Pinot, PTIDEJ and DPJF; and the strengths of their relationships. RESULTS: The result demonstrate that whenever the source code is build standard and non-standard, based on the design patterns, then the result of the proposed method is near to DPJF and better that Pinot and PTIDEJ. The proposed model is tested on the several source codes and is compared with other related models and available tools those the results show the precision and recall of the proposed method, averagely 20% and 9.6% are more than Pinot, 27% and 31% are more than PTIDEJ and 3.3% and 2% are more than DPJF respectively. CONCLUSION: The primary idea of the proposed method is organized in two following steps: the first step, elemental design patterns are identified, while at the second step, is composed to recognize actual design patterns.

  6. Design pattern mining using distributed learning automata and DNA sequence alignment.

    Science.gov (United States)

    Esmaeilpour, Mansour; Naderifar, Vahideh; Shukur, Zarina

    2014-01-01

    Over the last decade, design patterns have been used extensively to generate reusable solutions to frequently encountered problems in software engineering and object oriented programming. A design pattern is a repeatable software design solution that provides a template for solving various instances of a general problem. This paper describes a new method for pattern mining, isolating design patterns and relationship between them; and a related tool, DLA-DNA for all implemented pattern and all projects used for evaluation. DLA-DNA achieves acceptable precision and recall instead of other evaluated tools based on distributed learning automata (DLA) and deoxyribonucleic acid (DNA) sequences alignment. The proposed method mines structural design patterns in the object oriented source code and extracts the strong and weak relationships between them, enabling analyzers and programmers to determine the dependency rate of each object, component, and other section of the code for parameter passing and modular programming. The proposed model can detect design patterns better that available other tools those are Pinot, PTIDEJ and DPJF; and the strengths of their relationships. The result demonstrate that whenever the source code is build standard and non-standard, based on the design patterns, then the result of the proposed method is near to DPJF and better that Pinot and PTIDEJ. The proposed model is tested on the several source codes and is compared with other related models and available tools those the results show the precision and recall of the proposed method, averagely 20% and 9.6% are more than Pinot, 27% and 31% are more than PTIDEJ and 3.3% and 2% are more than DPJF respectively. The primary idea of the proposed method is organized in two following steps: the first step, elemental design patterns are identified, while at the second step, is composed to recognize actual design patterns.

  7. Loglines. November-December 2013

    Science.gov (United States)

    2013-12-01

    In the introduction to his fiscal 2014 Director’s Guidance, Harnitchek wrote that DLA’s workforce continues to build on the solid foundation laid...during the rest of your tenure and beyond? William Shakespeare said in one of his plays, “What’s past is prologue.” So when I look at DLA over the

  8. Antitumor and antimicrobial activities and inhibition of in-vitro lipid ...

    African Journals Online (AJOL)

    The antitumor activity was measured in DLA cell line induced mice. Inhibition of in vitro lipid peroxidation activity of the D. nobile in both liver homogenate and RBC ghosts was also carried out. The aqueous extracts of stem and flower of D. nobile showed better zone of bacterial inhibition than that of ethanol and chloroform

  9. Very high column density and small reddening toward GRB 020124 at z=3.20

    DEFF Research Database (Denmark)

    Hjorth, J.; Møller, Per; Gorosabel, J.

    2003-01-01

    We present optical and near-infrared observations of the dim afterglow of GRB 020124, obtained between 2 and 68 hr after the gamma-ray burst. The burst occurred in a very faint (Rgreater than or similar to29.5) damped Lyalpha absorber (DLA) at a redshift of z=3.198+/-0.004. The derived column...

  10. Fractal analysis of Xylella fastidiosa biofilm formation

    Science.gov (United States)

    Moreau, A. L. D.; Lorite, G. S.; Rodrigues, C. M.; Souza, A. A.; Cotta, M. A.

    2009-07-01

    We have investigated the growth process of Xylella fastidiosa biofilms inoculated on a glass. The size and the distance between biofilms were analyzed by optical images; a fractal analysis was carried out using scaling concepts and atomic force microscopy images. We observed that different biofilms show similar fractal characteristics, although morphological variations can be identified for different biofilm stages. Two types of structural patterns are suggested from the observed fractal dimensions Df. In the initial and final stages of biofilm formation, Df is 2.73±0.06 and 2.68±0.06, respectively, while in the maturation stage, Df=2.57±0.08. These values suggest that the biofilm growth can be understood as an Eden model in the former case, while diffusion-limited aggregation (DLA) seems to dominate the maturation stage. Changes in the correlation length parallel to the surface were also observed; these results were correlated with the biofilm matrix formation, which can hinder nutrient diffusion and thus create conditions to drive DLA growth.

  11. A galactomannan polysaccharide from Punica granatum imparts in vitro and in vivo anticancer activity.

    Science.gov (United States)

    Joseph, Manu M; Aravind, S R; George, Suraj K; Varghese, Sheeja; Sreelekha, T T

    2013-11-06

    Galactomannan polysaccharide (PSP001) was isolated from the fruit rind of Punica granatum and was previously reported to have excellent antioxidant and immunomodulatory properties. The cytotoxicity of PSP001 was evaluated in the human cancer cell lines A375, HCT116, and HepG2 as well as the murine cancer cell lines DLA and EAC over a wide range of concentrations. PSP001 exhibited significant cytotoxicity against cancer cells through the induction of apoptosis with no in vivo toxicity up to a concentration of 2000 mg/kg body weight when assessed in BALB/c mice. The antitumor efficacy of PSP001 was tested in DLA and EAC murine ascites and EAC solid tumor mouse models. PSP001 alone and in combination with doxorubicin produced a significant reduction in the tumor burden and increased life span in both models compared to the controls. The results suggest that PSP001 has the potential to be developed as an anticancer agent either alone or as an adjuvant to chemotherapy. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Customer Driven Uniform Manufacture (CDUM) Program. Customer Driven Uniform Management Apparel Research

    Science.gov (United States)

    2008-11-13

    ABSTRACT (Maximum 200 Words) The DLA and DSCP sponsored Customer Driven Uniform Manufacturing (CDUM) program’s primary goals are to reduce total...functions that make decisions or consume apparel items. PDIT’s CDUM assignments were to create the web accessible database, create decision support tools...Manufacturing Monitoring Processes ....................................................40  Figure 32 – Assign Contract to Buyer

  13. Loglines. November-December 2014

    Science.gov (United States)

    2014-12-01

    ar in e 2n d Lt . M ar tin H ar ris U.S. Marines depart Royal Australian Air Force Base Darwin , ending Marine Rotational Force Darwin’s six-month...Petty Officer 2nd Class Charles Poplin (left) and Petty Officer 1st Class Robert Young construct pillars as part of a pier project in Romania. DLA has

  14. Defense Standardization Program Journal. January-March 2012

    Science.gov (United States)

    2012-03-01

    example, the team added standardized qualification and performance verification procedures, such as edge-reten- tion verification, cathodic disbondment...edge retention. In addition, they incorporated cathodic disbondment tests used to verify the performance of pipeline coatings into the specification...pure electrodeposited aluminum—were identified as being suitable plating finishing options for replacing cadmium. DLA Land and Maritime added these

  15. Department of Defense Strategic Sustainability Performance Plan FY 2012

    Science.gov (United States)

    2012-01-01

    interoperability of equipment; and the management and oversight of contingency basing. Improved contingency base sustainability will also enhance mission...with communicating classified information from alternate work locations. In FY 2011, NGA developed and began implementing a telecommuting policy...operating procedures. DLA Disposition Services strengthened its oversight of the electronics demanufacturing process in FY 2011 by tightening

  16. Fuel Price Effects on Readiness

    Science.gov (United States)

    2014-05-01

    have also excluded liquefied propane gas ( LPG ), from this study. 10 through four IDIQ...Wide Fuel Management 1. DLA’s Role DLA-E has the mission of acquiring, storing, selling, and distributing energy including petroleum, natural gas ...energy, and installations also use energy in the form of electricity (11 percent), natural gas (8 percent), and coal (2 percent). See Schwartz, Blakely

  17. Transfer of Department of Defense Managed Sustainment Programs in Iraq to Department of State Control

    Science.gov (United States)

    2013-05-22

    responsible for conducting Reception , Staging, Onward movement, and Integration of personnel and equipment, the distribution management of supplies...temperature refrigerated containers or leased refrigerated containers on semi- trailers . Class III Distribution As the DoD executive agent, DLA is...quantitative approach involves the investigation of a human or social problem, and tests the theory based on the collection of variables, numerically

  18. Study of Using Excess Stock to Reduce Naval Aviation Depot-Level Repairable Piece Part Backorders

    Science.gov (United States)

    2016-12-01

    used to develop and run the comparison of the backorders and excess stock records. Python is chosen because of its ease of learning and use...sustainable source of bit-piece parts for future requisitions. 14. SUBJECT TERMS naval aviation AVDLRs, backorder, excess, DLA, WSS, FRC, Python ...SCHOOL December 2016 Approved by: Geraldo Ferrer Eddine Dahel Peter Ward Bryan Hudgens Academic Associate

  19. Lean Six Sigma in Healthcare: Combating the Military’s Escalating Pharmacy Costs

    Science.gov (United States)

    2009-04-30

    SYSTEM CMOP CONSOLIDATED MAIL ORDER PHARMACY CTQ CRITICAL TO QUALITY DLA DEFENSE LOGISTICS AGENCY DLI DEFENSE LANGUAGE INSTITUTE DMAIC DEFINE...standard improvement procedure in Six Sigma is DMAIC (Define, Measure, Analyze, Improve and Control). DMAIC is a structured, disciplined, rigorous...and techniques prescribed in the DMAIC methodology (Define, Measure, Analyze, Improve and Control) of Lean Six Sigma. To better understand the

  20. Flexure of Thick Plates Resting on Elastic Foundation Using Two-Variable Refined Plate Theory

    Directory of Open Access Journals (Sweden)

    Rouzegar Jafar

    2015-06-01

    Full Text Available Wpublikacji wykorzystano udoskonalona teorie płyty z dwiema zmiennymi do analizy grubych płyt spoczywajacych na sprezystym podłozu. Teoria ta, która zawiera tylko dwa nieznane parametry, pozwala przewidziec paraboliczna zmiennosc naprezen scinajacych. W teorii jest spełniony warunek zerowej trakcji na powierzchni płyty bez uzycia współczynnika korekcyjnego dla scinania. Stosujac zasade minimum energii potencjalnej wyprowadzono równania rzadzace dla płyt prostokatnych o prostym podparciu spoczywajacych na sprezystym podłozu Winklera. Do rozwiazania otrzymanego układu równan sprzezonych zaadoptowano metode Naviera. Obecna teoria pozwoliła rozwiazac szereg przykładowych problemów płyt przy róznych warunkach obciazenia. Porównanie otrzymanych rezultatów z uzyskanymi w innych znanych teoriach wykazuje doskonala efektywnosc stosowanej teorii w modelowaniu grubych płyt spoczywajacych na podłozu sprezystym. Przestudiowano takze wpływ modułu sprezystosci podłoza, grubosci płyty i typu obciazenia. Wyniki pokazuja, ze ugiecia płyty maleja przy wzroscie modułu sprezystosci podłoza i grubosci płyty

  1. Direct fermentation of Jerusalem artichoke tuber powder for production of l-lactic acid and d-lactic acid by metabolically engineered Kluyveromyces marxianus.

    Science.gov (United States)

    Bae, Jung-Hoon; Kim, Hyun-Jin; Kim, Mi-Jin; Sung, Bong Hyun; Jeon, Jae-Heung; Kim, Hyun-Soon; Jin, Yong-Su; Kweon, Dae-Hyuk; Sohn, Jung-Hoon

    2018-01-20

    An efficient production system for optically pure l- and d-lactic acid (LA) from Jerusalem artichoke tuber powder (JAP) was developed by metabolic engineering of Kluyveromyces marxianus. To construct LA-producing strains, the ethanol fermentation pathway of K. marxianus was redirected to LA production by disruption of KmPDC1 and expression of l- and d-lactate dehydrogenase (LDH) genes derived from Lactobacillus plantarum under the control of the K. marxianus translation elongation factor 1α promoter. To further increase the LA titer, the l-LA and d-LA consumption pathway of host strains was blocked by deletion of the oxidative LDH genes KmCYB2 and KmDLD1. The recombinant strains produced 130g/L l-LA and 122g/L d-LA by direct fermentation from 230g/L JAP containing 140g/L inulin, without pretreatment or nutrient supplementation. The conversion efficiency and optical purity were ≫>95% and ≫>99%, respectively. This system using JAP and the inulin-assimilating yeast K. marxianus could lead to a cost-effective process for the production of LA. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Deep linear autoencoder and patch clustering-based unified one-dimensional coding of image and video

    Science.gov (United States)

    Li, Honggui

    2017-09-01

    This paper proposes a unified one-dimensional (1-D) coding framework of image and video, which depends on deep learning neural network and image patch clustering. First, an improved K-means clustering algorithm for image patches is employed to obtain the compact inputs of deep artificial neural network. Second, for the purpose of best reconstructing original image patches, deep linear autoencoder (DLA), a linear version of the classical deep nonlinear autoencoder, is introduced to achieve the 1-D representation of image blocks. Under the circumstances of 1-D representation, DLA is capable of attaining zero reconstruction error, which is impossible for the classical nonlinear dimensionality reduction methods. Third, a unified 1-D coding infrastructure for image, intraframe, interframe, multiview video, three-dimensional (3-D) video, and multiview 3-D video is built by incorporating different categories of videos into the inputs of patch clustering algorithm. Finally, it is shown in the results of simulation experiments that the proposed methods can simultaneously gain higher compression ratio and peak signal-to-noise ratio than those of the state-of-the-art methods in the situation of low bitrate transmission.

  3. UNINETTUNO – międzynarodowy uniwersytet na odległość

    Directory of Open Access Journals (Sweden)

    Maria Lamberti

    2009-01-01

    Full Text Available Artykuł omawia działalność UNINETTUNO, największego wirtualnego uniwersytetu włoskiego o zasięgu międzynarodowym. Università Telematica Uninettuno to realizowany od 1990 roku, początkowo jako konsorcjum NETTUNO, włoski projekt kształcenia na odległość na poziomie uniwersyteckim. Obecnie działa w jedenastu krajach basenu Morza Śródziemnomorskiego, w Wielkiej Brytanii, Albanii i na Ukrainie. Jego działalność opiera się na oryginalnym psychopedagogicznym modelu opracowanym przez prof. M.A. Garito z Rzymu. Dzięki bardzo rozbudowanej bazie technologicznej studenci mogą uczestniczyć w wykładach organizowanych w czasie rzeczywistym jako wideokonferencje, słuchać wykładów transmitowanych za pośrednictwem sieci telewizji satelitarnych oraz korzystać z wykładów umieszczonych w Internecie w dogodnym dla siebie czasie. Bogata i wielojęzyczna oferta programowa stanowi ogromną szansę dla osób pracujących, które mogą zdalnie zdobyć dyplom uniwersytecki w wielu cenionych na rynku pracy specjalnościach.

  4. Development of a dual-layered dielectric-loaded accelerating structure

    International Nuclear Information System (INIS)

    Jing Chunguang; Kanareykin, Alexei; Kazakov, Sergey; Liu Wanming; Nenasheva, Elizaveta; Schoessow, Paul; Gai Wei

    2008-01-01

    rf Power attenuation is a critical problem in the development of dielectric-loaded structures for particle acceleration. In a previous paper [C. Jing, W. Liu, W. Gai, J. Power, T. Wong, Nucl. Instr. Meth. A 539 (2005) 445] we suggested the use of a Multilayer Dielectric-Loaded Accelerating Structure (MDLA) as a possible approach for reducing the rf losses in a single layer device. The MDLA is based on the principle of Bragg reflection familiar from optics that is used to partially confine the fields inside the dielectric layers and reduce the wall current losses at the outer boundary. We report here on the design, construction and testing of a prototype X-band double-layer structure (2DLA). The measurements show an rf power attenuation for the 2DLA more than ten times smaller than that of a comparable single-layer structure, in good agreement with the analytic results. Testing and operation of MDLAs also requires efficient power coupling from test equipment or rf power systems to the device. We describe the design and construction of two novel structures: a TM 03 mode launcher for cold testing and a power coupler for planned high-gradient experiments

  5. Non-Maxwellian electron distributions resulting from direct laser acceleration in near-critical plasmas

    Directory of Open Access Journals (Sweden)

    T. Toncian

    2016-01-01

    Full Text Available The irradiation of few-nm-thick targets by a finite-contrast high-intensity short-pulse laser results in a strong pre-expansion of these targets at the arrival time of the main pulse. The targets decompress to near and lower than critical densities with plasmas extending over few micrometers, i.e. multiple wavelengths. The interaction of the main pulse with such a highly localized but inhomogeneous target leads to the generation of a short channel and further self-focusing of the laser beam. Experiments at the Glass Hybrid OPCPA Scaled Test-bed (GHOST laser system at University of Texas, Austin using such targets measured non-Maxwellian, peaked electron distribution with large bunch charge and high electron density in the laser propagation direction. These results are reproduced in 2D PIC simulations using the EPOCH code, identifying direct laser acceleration (DLA [1] as the responsible mechanism. This is the first time that DLA has been observed to produce peaked spectra as opposed to broad, Maxwellian spectra observed in earlier experiments [2]. This high-density electrons have potential applications as injector beams for a further wakefield acceleration stage as well as for pump-probe applications.

  6. Physical activity in the perinatal period

    Directory of Open Access Journals (Sweden)

    Grażyna Jolanta Iwanowicz-Palus

    2017-08-01

    Celem pracy jest przedstawienie form aktywności fizycznej kobiet w okresie okołoporodowym i ich wpływu na zdrowie oraz przebieg tego okresu życia kobiety. Aktywność fizyczna w okresie okołoporodowym jest korzystna dla funkcjonowania wielu układów w organizmie, w tym układu kostno-stawowego, układu mięśniowo-więzadłowego, płucnego i / lub sercowo-naczyniowego. Ma pozytywny wpływ na zdrowie matki i dziecka, zarówno w sferze fizycznej, jak i mentalnej. Kobieta jest spokojna, ponieważ zna ćwiczenia, które umożliwiają lepsze przygotowanie do porodu i połogu. Kobiety mogą wybierać spośród wielu działań, które są bezpieczne dla ciąży i zalecane również w połogu. Mogą brać udział w specjalnych zajęciach organizowanych przez szkoły rodzenia i kluby fitness. Niestety większość kobiet nie jest zainteresowana aktywnością w okresie okołoporodowym.

  7. Московский печатный двор XVII в.: между средневековьем и Новым временем

    Directory of Open Access Journals (Sweden)

    Ирина [Irina] Поздеева [Pozdeeva

    2016-12-01

    • publikacje do publicznego i prywatnego wyznawania wiary, towarzyszące każdemu człowiekowi oraz działalności instytucji państwowych i rządowych. Badania przeprowadzone w archiwum pozwoliły autorce zrewidować w sposób przekonujący dominującą od dawna koncepcję, że drukarnia moskiewska nie drukowała książek dla celów edukacyjnych. Artykuł podaje informacje o licznych, dotąd nieznanych 51 edycjach Azbuka na listu – Pierwszych Nauk dla Dzieci (258 000 egz., 9 edycjach Elementarza (22 320 egz., 35 edycjach Księgi Godzin (132 000 egz., 35 edycjach Hymnów (93 600 egz.. Wydrukowano ponad pół miliona (536 420 egz. wszystkich publikacji do nauczania wiary oraz listów , tj. 52,98% całkowitego nakładu w tych latach. Krótko opisano w artykule piąty typ – książki z księgozbioru podręcznego. Dzięki drukarni moskiewskiej wykształcono kompetentnych i aktywnych zwolenników reform Piotra i transformacji średniowiecznej Rusi w Rosyjskie Imperium epoki nowożytnej.

  8. Theory of factors limiting high gradient operation of warm accelerating structures

    Energy Technology Data Exchange (ETDEWEB)

    Nusinovich, Gregory S. [University of Maryland; Antonsen, Thomas M. [University of Maryland; Kishek, Rami [University of Maryland

    2014-07-25

    This final report summarizes the research performed during the time period from 8/1/2010 to 7/31/2013. It consists of two parts describing our studies in two directions: (a) analysis of factors limiting operation of dielectric-loaded accelerating (DLA) structures where the main problem is the occurrence of multipactor on dielectric surfaces, and (b) studies of effects associated with either RF magnetic or RF electric fields which may cause the RF breakdown in high-gradient metallic accelerating structures. In the studies of DLA structures, at least, two accomplishments should be mentioned: the development of a 3D non-stationary, self-consistent code describing the multipactor phenomena and yielding very good agreement with some experimental data obtained in joint ANL/NRL experiments. In the metallic structures, such phenomena as the heating and melting of micro-particles (metallic dust) by RF electric and magnetic fields in single-shot and rep-rate regimes is analyzed. Also, such processes in micro-protrusions on the structure surfaces as heating and melting due to the field emitted current and the Nottingham effect are thoroughly investigated with the account for space charge of emitted current on the field emission from the tip.

  9. Demand Forecasting: DLA’S Aviation Supply Chain High Value Products

    Science.gov (United States)

    2015-04-09

    target service level(s) and (3) execute a lean six sigma project to reduce drivers for the organization???s risk exposure. A higher risk exposure...modeling technique described herein to calculate adequate inventory for the target service level(s) and (3) execute a lean six sigma project to...herein to calculate adequate inventory for the target service level. Third, execute a lean six sigma project to reduce lead time (both admin and

  10. Kriegsbeute-Ausstellung Posen 1917. Propagandowa wystawa dla szerokiej publiczności

    Directory of Open Access Journals (Sweden)

    Jakub Skutecki

    2014-01-01

    Full Text Available W zbiorach ikonograficznych Biblioteki Uniwersyteckiej w Poznaniu znajduje się seria widokówek dokumentujących zorganizowaną w 1917 roku Wystawę Zdobyczy Wojennych (Kriegsbeute-Ausstellung Posen 1917, jedną z serii propagandowych ekspozycji prezentujących sukcesy armii niemieckich na wszystkich frontach wielkiej wojny. W czasie trwania wystawy w pobliżu belgijskiego Passchendaele toczyła się jedna z najkrwawszych bitew, a w Poznaniu – codzienne życie w wojennej rzeczywistości.

  11. Materials of 3. scientific-technical seminar: Materials Investigation for Power Industry; Materialy 3. seminarium naukowo-technicznego: Badania Materialowe na Potrzeby Elektrowni i Przemyslu Energetycznego

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    The report is an assembly of the papers concerning material problems during the exploitation of power stations as well as during construction and exploitation of gas pipelines. The accreditation problems according to the European Standards and Office of Technical Inspection prescription are also discussed.

  12. Analysis and Evaluation of Forecasting Methods and Tools to Predict Future Demand for Secondary Chemical-Biological Configuration Items

    Science.gov (United States)

    2013-06-01

    Depot Level Reparable DO Due Out DoD Department of Defense ECBC Edgewood Chemical Biological Center EOQ Economic Order Quantity ERP Enterprise...Objective ROP Reorder Point SAP Security Assistance Program SL Safety Level SPR Special Program Request TACOM U.S. Army Tank-automotive and...Security Assistance Program ( SAP ); items only for SAP Q Bulk Petroleum Products. DLA-managed R Restricted Requisition – Government Furnished Material

  13. Mikuláš Vladimír Desfours-Walderode a Josef Vítězslav Šimák

    Czech Academy of Sciences Publication Activity Database

    Kábová, Hana

    Suppl. 13, - (2009), s. 69-76 ISSN 1211-975X. [Šlechtické rody a jejich sídla v Českém ráji. Turnov, 24.04.2009-25.04.2009] Institutional research plan: CEZ:AV0Z80770509 Keywords : Šimák, Josef Vítězslav * Desfours-Walderode, Mikuláš Vladimír * Czech historiography Subject RIV: AB - History

  14. Monitoring and analysis of technology transfer and intellectual property regimes and their use results of a study carried out on behalf of the European Commission (DG Research)

    CERN Document Server

    Van Eecke, Patrick; Bolger, P; Truyens, M

    2008-01-01

    This report presents the results of a three-year study commissioned by the European Commission (DG Research) regarding the monitoring, analysis and use of technology transfer and intellectual property regimes in the European Union. This study was organised in the context of the 6th Framework Programme for R&D, and was jointly carried out by law firms Mason Hayes+Curran (Dublin) and DLA Piper (Brussels).

  15. Społeczeństwo informacyjne w gminie Sędziszów Małopolski

    OpenAIRE

    Kolbusz, Janusz; Gątarski, Jakub; Hajder, Piotr

    2014-01-01

    Rozdział trzynasty w monografii wieloautorskiej pt. „Innowacyjna Gmina. Informatyka w jednostkach samorządu terytorialnego”. W pracy, scharakteryzowano społeczeństwo informacyjne oraz wykluczenie cyfrowe w gminie Sędziszów Małopolski. Zaprezentowano wyniki badań dostępności sieci Internet dla mieszkańców gminy oferowanej przez operatorów przewodowych i bezprzewodowych. Mariusz Nycz

  16. Consolidation Needed for Procurements of DoD H-60 Helicopter Spare Parts (REDACTED)

    Science.gov (United States)

    2016-10-12

    OFFICIAL USE ONLY FOR OFFICIAL USE ONLY The document contains information that may be exempt from mandatory disclosure under the Freedom of... methods . The Secretary of Defense made recommendations for BRAC in May 2005 that included the realignment or closure of military installations. The...Opportunities to Reduce Potential Duplication in Government Programs, Save Tax Dollars, and Enhance Revenue,” March 1, 2011. DLA obtained H-60

  17. Improving Warehouse Inventory Management Through Rfid, Barcoding and Robotics Technologies

    Science.gov (United States)

    2014-12-01

    analysis and feasibility study on the use of RFID technology in the DLA’s distribution centers to improve inventory management and order processing . In...efficiency in receipt, order processing , and distribution for the DLA. 3 II. BACKGROUND A. SUPPLY CHAIN MANAGEMENT IN THE DEPARTMENT OF DEFENSE...of equipment and supplies. It experiences multiple challenges in inventory management and order processing , resulting in high associated costs. The

  18. Bulk Fuel: Actions Needed to Improve DODs Fuel Consumption Budget Data

    Science.gov (United States)

    2016-09-01

    be reimbursed with more cash than it anticipated. DOD and military service financial management officials prepare budget justification materials...Overseas Contingency Operations OMB Office of Management and Budget OUSD Office of the Under Secretary of Defense This is a work of the U.S...military service budget and financial management offices, and DLA to determine how O&M budget justification materials generally, and fuel

  19. Curcumin-albumin conjugates as an effective anti-cancer agent with immunomodulatory properties.

    Science.gov (United States)

    Aravind, S R; Krishnan, Lissy K

    2016-05-01

    Curcumin (diferuloylmethane) is an active ingredient in turmeric (Curcuma longa) with anti-inflammatory, antioxidant, chemopreventive, chemosensitization, and radiosensitization properties. Conjugation of curcumin (Curc) to albumin (Alb) has been found to increase the aqueous solubility of the drug. The current study aimed to prove the safe use of the Curc-Alb conjugate in animals and to demonstrate that it retains drug action both in vitro and in vivo. Dalton's lymphoma ascites (DLA) cell viability was inhibited by the Curc-Alb conjugate in a dose dependent manner in vitro, as evidenced by the MTT assay. Administration of up to 11.4 mg of conjugated curcumin per kg body weight to healthy animals was non-toxic both in terms of lethality and weight loss. Histological analysis of vital organs (kidney, liver and spleen) also did not show toxic effects. Favorable immuno-modulatory activity was observed after continuous administration of sub-acute doses of the conjugate which caused increase in total leukocyte count, platelet count, and viable cell count in bone marrow, and enhanced proliferation of lymphocyte in vitro upon culture. In vivo studies in the DLA tumor model in mice demonstrated that conjugated drug induces tumor reduction and prevention. Significant tumor reduction was observed when the Curc-Alb conjugate was administered intraperitoneally in DLA-induced mice after 1 day (prevention therapy) and 7 days (reduction therapy) of tumor induction. There was significant reduction in both tumor volume and tumor cell numbers in the treated animals as well as a marked increase in their mean survival time and percent increase in life span. The effect was greater when the conjugate was administered soon after inducing the tumor as compared to when treatment was started after allowing tumor to grow for 7 days. Thus, the results of the present study suggest that curcumin albumin conjugate has immunomodulatory and tumor growth inhibition properties. The study postulates

  20. Zastosowanie programów komputerowych w rehabilitacji neuropsychologicznej dysfunkcji poznawczych u pacjentów ze stwardnieniem rozsianym

    Directory of Open Access Journals (Sweden)

    Ernest Tyburski

    2013-06-01

    Full Text Available W obrazie klinicznym stwardnienia rozsianego (łac. sclerosis multiplex, SM na funkcjonowanie chorych wpływają – poza objawami neurologicznymi – współwystępujące objawy neuropsychologiczne, do których zalicza się zaburzenia emocjonalne i dysfunkcje poznawcze oraz czynniki osobowościowe. Dysfunkcje w sferze procesów uwagi, funkcji wykonawczych czy pamięci mają wpływ na zmniejszenie zdolności adaptacyjnych, które są kluczowe dla jakości życia chorych. W badaniach dużych grup klinicznych udowodniono obecność dysfunkcji poznawczych u 40–65% pacjentów. Najczęściej na SM zapadają osoby młode, u których dysfunkcje ruchowe i zaburzenia poznawcze mogą utrudniać codzienne funkcjonowanie, a często też stają się przeszkodą w podejmowaniu zadań życiowych. Dlatego też istnieje potrzeba opracowania nowych i skutecznych programów rehabilitacyjnych dla tej grupy chorych. Rehabilitacja neuropsychologiczna pacjentów z SM obejmuje różnego rodzaju oddziaływania, których celem jest leczenie dysfunkcji poznawczych. W pracy neuropsychologa coraz częściej jako narzędzie terapeutyczne wykorzystuje się programy komputerowe służące do treningów poznawczych. Podstawą dla tego typu oddziaływań są dowody świadczące o zmianach neuroplastycznych u osób ze stwardnieniem rozsianym. Największe efekty terapeutyczne osiąga się jednak dzięki współpracy zespołu interdyscyplinarnego, w którego skład powinni wchodzić neurolog, psychiatra, neuropsycholog oraz rehabilitant. W Polsce uzyskanie takiej pomocy przez pacjentów z SM jest nadal bardzo trudne. Przykładem obrazującym skuteczne zastosowanie rehabilitacji neuropsychologicznej za pomocą programów komputerowych jest studium przypadku chorego ze stwardnieniem rozsianym.

  1. Defense AT and L. Volume 28, Number 3, 2009

    Science.gov (United States)

    2009-01-01

    As a result, DLA has been de- veloping strong work/life programs. Many of DLA’s global facilities have fi tness centers, and the agency encourages...judges were Karen Barley, president and co-founder of Corporate University Enterprise Inc.; Robert Mosher, global chief learning and strategy...capabilities technology off ers and to extend their distance learning media. Dr. Chris Hardy, director of the DAU eLearning and Tech- nology Center, is

  2. Dollar Summary of Federal Supply Classification and Service Category by Company, FY84, Part 3 (4610-5925).

    Science.gov (United States)

    1984-01-01

    TECHNOLOGY INC TEXAS USAF AIRCRAFT MAINTENANCE & REPAIR SHOP EQUIP 454 MENSOR CORPORATION TEXAS NAVY AIRCRAFT MAINTENANCE & REPAIR SHOP EQUIP 37 MICRO DYNAMICS...VAULT COMPANY INC CALIFORNIA DLA BUILDING GLASS TILE BRICK AND BLOCK 8 FSC TOTAL 1C.776 3530 OFFICINA DE SERVICIOS MULTIPLE HONDURAS ARMY PIPE AND...EXCEPT AIRBORNE 731 CONTRACTOR TOTAL 115 MICPO CONSULTANTS INC CALIFORNIA ARMY RADIO TV EQUIPMENT EXCEPT AIRBORNE 193 MICRO -TEL CORPORATION MARYLAND NAVY

  3. LogLines. July-August 2009

    Science.gov (United States)

    2009-08-01

    Center. The Richmond supply center is using the new Sales and Operations Planning Process, known as S & OP and initiated by DLA Director Navy Vice...Adm. Alan Thompson in September, to facilitate strategic decisionmaking on the project, officials said. S & OP involves balancing the needs of...projects under the S & OP process involve getting 530 stock items on expedited contracts or ac- celerated purchases, and establishing a six-month

  4. Five New Records of Raphignathoid Mites (Acari: Raphignathoidea) from Poland/ Pięć Nowych Gatunków Roztoczy Z Nadrodziny Raphignathoidea (Acari) Stwierdzonych W Faunie Polski

    OpenAIRE

    Doðan Salih; Sevsay Sevgi; Mąkol Joanna; Zeytun Erhan; Buğa Evren

    2014-01-01

    Pięć nowych gatunków roztoczy (Acari: Raphignathoidea) zostało odnoto- wanych jako nowe dla fauny Polski: trzy z rodziny Stigmaeidae, Eustigmaeus rhodomela (Koch), Mediolata obtecta Dónel et Doóan, Stigmaeus glabrisetus Summers, jeden z rodziny Cryptognathidae, Favognathus cucurbita (Berlese), i jeden z rodziny Barbutiidae, Barbuda anguineus (Berlese). Ostatni z wymienio- nych jest jednocześnie pierwszym stwierdzeniem przedstawiciela rodziny Barbutiidae w Polsce.

  5. Summary Report on the Audit of Defense Logistics Agency 1995 Defense Base Realignment and Closure Data Collection Process.

    Science.gov (United States)

    1995-06-19

    VXW-ÄVAVKVX’AWXW/XVXV:*: OFFICE OF THE INSPECTOR GENERAL SUMMARY REPORT ON THE AUDIT OF DEFENSE LOGISTICS AGENCY 1995 DEFENSE BASE REALIGNMENT...FOR DIRECTOR, DEFENSE LOGISTICS AGENCY SUBJECT: Summary Report on the Audit of Defense Logistics Agency 1995 Defense Base Realignment and Closure...the data that DLA provides to support recommendations for the 1995 Commission. The specific objective for the audits was to determine whether the

  6. A local cellular model for growth on quasicrystals

    International Nuclear Information System (INIS)

    Chidyagwai, Prince; Reiter, Clifford A.

    2005-01-01

    The growth of real valued cellular automata using a deterministic algorithm on 2-dimensional quasicrystalline structures is investigated. Quasicrystals are intermediate between the rigid organization of crystals and disorganized random structures. Since the quasicrystalline structures may be highly symmetric or not, we are able to obtain highly organized and relatively random growth patterns. This deterministic growth produces dendrite, sector, stellar, regular polygons, round, and random DLA-like structures

  7. Zarządzanie talentami na przykładzie Wojskowych Zespołów Sportowych oraz Wojskowych Centrach Szkolenia Sportowego / The talent management based on the example of Military Sports Teams and Military Sports Training Centers

    OpenAIRE

    Malinowski, Łukasz

    2015-01-01

    Streszczenie Artykuł dotyczy problematyki pozyskiwania talentów dla Wojskowych Centrów Szkolenia Sportowego wraz z opisaniem wsparcia finansowego udzielanego przez Ministerstwo Sportu i Turystyki i ich działania oraz funkcjonowania w Polsce Wojskowych Zespołów Sportowych i ich osiągnięć. Słowa kluczowe: wojsko, sport, szkolenie, talent Abstract The article concerns the problems of sourcing talent for Military Sports Tr...

  8. Five New Records of Raphignathoid Mites (Acari: Raphignathoidea from Poland/ Pięć Nowych Gatunków Roztoczy Z Nadrodziny Raphignathoidea (Acari Stwierdzonych W Faunie Polski

    Directory of Open Access Journals (Sweden)

    Doðan Salih

    2014-12-01

    Full Text Available Pięć nowych gatunków roztoczy (Acari: Raphignathoidea zostało odnoto- wanych jako nowe dla fauny Polski: trzy z rodziny Stigmaeidae, Eustigmaeus rhodomela (Koch, Mediolata obtecta Dónel et Doóan, Stigmaeus glabrisetus Summers, jeden z rodziny Cryptognathidae, Favognathus cucurbita (Berlese, i jeden z rodziny Barbutiidae, Barbuda anguineus (Berlese. Ostatni z wymienio- nych jest jednocześnie pierwszym stwierdzeniem przedstawiciela rodziny Barbutiidae w Polsce.

  9. Lean Six Sigma Project - Defense Logistics Agency/Honeywell Long-Term Contract Model Using One-Pass Pricing for Sole-Source Spare Parts

    Science.gov (United States)

    2011-02-18

    achieve their goals. Five-Step Data-Driven Process. LSS uses a modern problem-solving method, Define-Measure-Analyze-Improve- Control ( DMAIC ). DMAIC uses...documents for each DMAIC phase , please send an e-mail to audacm@dodig.mil. See Appendix A for acronyms and abbreviations and Appendix B for...Level Repairable DMAIC Define-Measure-Analyze-Improve-Control DORRA DLA Office of Research and Resource Analysis DPAP Defense Procurement and

  10. Ćwiczenia z narastającym oporem w usprawnianiu pacjentów z reumatoidalnym zapaleniem stawów leczonych operacyjnie

    Directory of Open Access Journals (Sweden)

    Agnieszka Prusinowska

    2010-08-01

    Full Text Available W artykule przedstawiono formę ćwiczeń czynnych oporowychwykorzystywanych do usprawniania pacjentów z rozpoznaniemreumatoidalnego zapalenia stawów po typowych zabiegach ortopedycznychw obrębie narządu ruchu. Forma ćwiczeń umożliwiausprawnianie pacjenta zarówno w warunkach klinicznych, jaki domowych. Jest atrakcyjna dla pacjenta, nie wymaga zakupu drogiegoi często skomplikowanego w obsłudze sprzętu.

  11. Driving Innovation to Support the Warfighter: Additive Manufacturing Initiatives Within the Defense Logistics Agency

    Science.gov (United States)

    2016-12-01

    AM) in the commercial sector, but it is also intense for the Defense Logistics Agency (DLA), which hopes to capitalize on the promise of innovation...off. Criteria for assessing provider viability are more clearly defined and the technology’s broad market applicability and relevance are clearly...supply chain allows it to leverage its procurement and distribution ca- pabilities to capitalize on the potential new efficiencies of AM. Background

  12. Progress in characterizing submonolayer island growth: Capture-zone distributions, growth exponents, & hot precursors

    Science.gov (United States)

    Einstein, Theodore L.; Pimpinelli, Alberto; González, Diego Luis; Morales-Cifuentes, Josue R.

    2015-09-01

    In studies of epitaxial growth, analysis of the distribution of the areas of capture zones (i.e. proximity polygons or Voronoi tessellations with respect to island centers) is often the best way to extract the critical nucleus size i. For non-random nucleation the normalized areas s of these Voronoi cells are well described by the generalized Wigner distribution (GWD) Pβ(s) = asβ exp(-bs2), particularly in the central region 0.5 < s < 2 where data are least noisy. Extensive Monte Carlo simulations reveal inadequacies of our earlier mean field analysis, suggesting β = i + 2 for diffusion-limited aggregation (DLA). Since simulations generate orders of magnitude more data than experiments, they permit close examination of the tails of the distribution, which differ from the simple GWD form. One refinement is based on a fragmentation model. We also compare island-size distributions. We compare analysis by island-size distribution and by scaling of island density with flux. Modifications appear for attach-limited aggregation (ALA). We focus on the experimental system para-hexaphenyl on amorphous mica, comparing the results of the three analysis techniques and reconciling their results via a novel model of hot precursors based on rate equations, pointing out the existence of intermediate scaling regimes between DLA and ALA.

  13. Modeling of multibranched crosslike crack growth

    International Nuclear Information System (INIS)

    Canessa, E.; Tanatar, B.

    1991-06-01

    Multibranched crosslike crack patterns formed in concentrically loaded square plates are studied in terms of fractal geometry, where the associated fractal dimension d f is calculated for their characterization. We apply simplest deterministic and stochastic approaches at a phenomenological level in an attempt to find generic features as guidelines for future experimental and theoretical work. The deterministic model for fracture propagation we apply, which is a variant of the discretized Laplace approach for randomly ramified fractal cracks proposed by Takayasu, reproduces the basic ingredients of observed complex fracture patters. The stochastic model, although is not strictly a model for crack propagation, is based on diffusion-limited aggregation (DLA) for fractal growth and produces slightly more realistic assessment of the crosslike growth of the cracks in asymmetric multibranches. Nevertheless, this simple ad-hoc DLA-version for modeling the present phenomena as well as the deterministic approach for fracture propagation give fractal dimensionality for the fracture pattern in accord with our estimations made from recent experimental data. It is found that there is a crossover of two fractal dimensions, corresponding to the core (higher d f ) and multibranched crosslike (lower D f ) regions, that contains loops, that are interpreted as representing different symmetry regions within the square plates of finite size. (author). 26 refs, 5 figs

  14. Geriatric depression and its relation with cognitive impairment and dementia.

    Science.gov (United States)

    Dillon, Carol; Tartaglini, María Florencia; Stefani, Dorina; Salgado, Pablo; Taragano, Fernando E; Allegri, Ricardo F

    2014-01-01

    Different subtypes of depressive syndromes exist in late life; many of them have cognitive impairment and sometimes it is difficult to differentiate them from dementia. This research aimed to investigate subtypes of geriatric depression associated with cognitive impairment, searched for differential variables and tried to propose a study model. A hundred and eighteen depressive patients and forty normal subjects matched by age and educational level were evaluated with an extensive neuropsychological battery, scales to evaluate neuropsychiatric symptoms and daily life activities (DLA). Depressive patients were classified in groups by SCAN 2.1: Major Depression Disorder (MDD) (n: 31), Dysthymia Disorder (DD) (n: 31), Subsyndromal Depression Disorder (SSD) (n: 29), Depression due to Dementia (n: 27) (DdD). Neuropsychological significant differences (pdepressive groups, demonstrating distinctive cognitive profiles. Moreover, significant differences (pdepression. Beck Depression Inventory (BDI) and Mini Mental State Examination (MMSE) were significant variables that helped to differentiate depressive groups. Significant correlations between BDI and Neuropsychological tests were found in MDD and DD groups. Depressive symptoms and its relation with neuropsychological variables, MMSE, cognitive profiles, DLA and age of onset of depression should be taken into consideration for the study of subtypes of geriatric depression. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  15. Dyskusja wokół celu sprawozdawczości finansowej opartej na MSSF

    Directory of Open Access Journals (Sweden)

    Edyta Łazarowicz

    2016-07-01

    Full Text Available Celem artykułu jest analiza i ocena propozycji zmian odnośnie do celu sprawozdawczości finansowej opartej na Międzynarodowych Standardach Sprawozdawczości Finansowej (MSSF przedstawionych w komentarzach do projektu Założeń koncepcyjnych sprawozdawczości finansowej (2015. Większość respondentów uważa, że w celu sprawozdawczości finansowej należy zwiększyć znaczenie dostarczania informacji o wypełnieniu funkcji powierniczej przez kierownictwo (stewardship. Ponadto proponują oni przedstawienie definicji stewardship w Założeniach koncepcyjnych oraz wskazanie konsekwencji zmiany celu sprawozdawczości finansowej dla przyszłego tworzenia standardów i dla sporządzania sprawozdań finansowych. Z analizy komentarzy i przeglądu literatury wynika, że cel sprawozdawczości finansowej powinien być zmieniony. Sprawą dyskusyjną pozostaje jednak, czy stewardship powinien być odrębnym celem. Niestety, jest za mało badań dotyczących relacji pomiędzy stewardship i użytecznością decyzyjną. Ich wyniki mogłyby wskazać twórcom standardów rachunkowości potencjalne kompromisy i konflikty między nimi.

  16. Gry planszowe jako narzędzie wspomagania rozwoju wczesnych kompetencji matematycznych

    Directory of Open Access Journals (Sweden)

    Krzysztof Cipora

    2013-09-01

    Full Text Available Poziom kompetencji matematycznych ma bardzo duże znaczenie dla osiągnięcia sukcesu edukacyjnego, wpływa również znacząco na jakość i poziom życia w wieku dorosłym. Niski poziom kompetencji matematycznych może być dla jednostki bardziej dotkliwy niż deficyty w zakresie czytania. Największe możliwości wspierania rozwoju kompetencji matematycznych pojawiają się na początku edukacji, gdyż z czasem deficyty te się pogłębiają. Liniowo zorganizowane gry planszowe z kolejno ponumerowanymi polami stanowią interesujące narzędzie wspomagania kompetencji matematycznych u dzieci. Pomagają wykształcić odpowiednią reprezentację liczebności, a efekty interwencji z ich wykorzystaniem wykraczają poza poprawę w zadaniach, które przypominają bezpośrednio trenowane umiejętności. W pracy przedstawiono przegląd wyników badań nad skutecznością takiej interwencji oraz propozycję zastosowania ich na polskim gruncie. Co więcej, interwencje z ich wykorzystaniem można przeprowadzić w krótkim czasie i przy niewielkim wkładzie finansowym.

  17. The selected aspects of transport services punctuality measurement rated by the carrier and passengers / Wybrane aspekty pomiaru punktualności przewozów przez przewoźnika i pasażerów

    Directory of Open Access Journals (Sweden)

    Bojda Krzysztof

    2016-10-01

    Full Text Available Jakość funkcjonowania transportu publicznego odgrywa coraz większą rolę w całościowej ocenie jakości życia w dużych aglomeracjach miejskich. Punktualność odjazdów klasyfikowana jest jako jedno z podstawowych kryteriów dla pasażerów, organizatora transportu publicznego oraz przewoźnika. W artykule przedstawiono problematykę pomiaru punktualności przewozów w kontekście oceny przez różnych uczestników procesu transportowego. Omówiono przegląd literatury ze wskazaniem najczęściej stosowanych miar oceny punktualności oraz powiązaniem z niezawodnością czasu podróży. Przedstawiono narzędzie analityczne opracowane dla potrzeb przewoźnika, umożliwiające wykonanie szczegółowych analiz na podstawie danych zarejestrowanych podczas realizacji kursów. Zreferowano model wspomagania informacyjnego procesu użytkowania systemu transportowego, w którym dostępne archiwalne dane o realizacji rozkładu jazdy wykorzystywane są do przedstawienia propozycji zoptymalizowanych tras przejazdu w odpowiedzi na zapytanie użytkownika. Podkreślono zasadność analizy niezawodności dokonywania przesiadki podczas podróży.

  18. Od misji do strategii personalnej biblioteki. Studium teoretyczne

    Directory of Open Access Journals (Sweden)

    Małgorzata Dąbrowicz

    2010-01-01

    Full Text Available Tematem artykułu jest próba ujęcia koncepcji strategicznego zarządzania zasobami ludzkimi w bibliotece jako jednego z najnowszych i dynamicznie rozwijających się obszarów teorii i praktyki sprawowania funkcji personalnej organizacji. Koncepcja ta jest połączeniem tradycyjnego zarządzania zasobami ludzkimi i zarządzania strategicznego. Punktem wyjścia dla zarządzania strategicznego w bibliotece jest sformułowanie misji, na podstawie której opracowuje się strategię. W ramach ogólnej strategii biblioteki powstają jej strategie funkcjonalne, m.in. strategia personalna. W artykule omówiono pojęcie i rodzaje strategii zasobów ludzkich, a także substrategii personalnych wyprowadzonych z poszczególnych funkcji (subdziedzin zarządzania zasobami ludzkimi. Przedstawiono wzajemne zależności między strategią personalną a strategią ogólną organizacji, zwrócono też uwagę na ich integralny związek. Wskazano na głównych kreatorów strategii zarządzania zasobami ludzkimi w bibliotece. Podkreślono także znaczenie opracowania strategii personalnej dla realizacji celów strategicznych biblioteki.

  19. Czynniki prognostyczne progresji radiologicznej w reumatoidalnym zapaleniu stawów

    Directory of Open Access Journals (Sweden)

    Piotr Wiland

    2010-08-01

    Full Text Available Możliwość przewidywania odległych konsekwencji reumatoidalnegozapalenia stawów ma zasadnicze znaczenie dla podejmowaniawłaściwych decyzji terapeutycznych u danego chorego. Markeryprognostyczne są pomocne w identyfikacji chorych o dużym ryzykuszybkiej progresji radiologicznej. Utwierdzają one lekarzaw decyzji o rozpoczęciu intensywnego leczenia u chorych z możliwąznaczną destrukcją stawów w ciągu następnych kilku lat.W artykule zaprezentowano pilotażowy model ryzyka dla przewidywaniaszybkiej progresji radiologicznej. W celu stworzenia tegomodelu posłużono się danymi, w tym wynikami badań radiologicznychpochodzącymi z badania ASPIRE, w którym porównywanomonoterapię metotreksatem z leczeniem skojarzonym metotreksatemi infliksymabem. W tym modelu wybrano wyjściowe parametry,które są łatwe do uzyskania w rutynowej praktyce klinicznej,takie jak: stężenie białka C-reaktywnego, wartość odczynuopadania krwinek czerwonych, liczbę obrzękniętych stawów orazmiano czynnika reumatoidalnego. Ten macierzowy model ryzykamoże być przydatny w ocenie ryzyka postępującego uszkodzeniastawów, szczególnie u chorych z wczesnym zapaleniem stawów.

  20. Enterprise Resource Planning Systems Schedule Delays and Reengineering Weaknesses Increase Risks to DoD’s Auditability Goals

    Science.gov (United States)

    2012-07-13

    completed through SAP -standard templates that are then used for gap analysis as compared to the commercial-off-the-shelf “To-Be” process. The Navy ERP ...13F25-04 4800 Mark Center Drive Alexandria, VA 22350-1500 Acronyms and Abbreviations BPR CMO DAI DCMO DEAMS DLA EBS EC ERP FIAR GAO...overall objective was to evaluate six Enterprise Resource Planning ( ERP ) systems that we identified as necessary for DoD to produce auditable

  1. Issues Regarding Information Safety in Digital Network of Railway Radio Communications / Zagadnienia Bezpieczeństwa Informacyjnego w Sieci Cyfrowej Radiołączności Kolejowej

    Directory of Open Access Journals (Sweden)

    Siergiejczyk Mirosław

    2015-09-01

    Full Text Available W referacie przestawiono architekturę oraz ważniejsze funkcje i usługi systemu cyfrowej telefonii komórkowej GSM-R. System GSM-R jest to system wykorzystywany dla potrzeb wspomagania zarządzania i sterowania w transporcie kolejowym. Szczególną uwagę zwrócono na wybrane problemy związane z bezpieczeństwem teleinformatycznym usług realizowanych z wykorzystaniem systemu GSM-R.

  2. Customer-Focused Business Practice Adoption: A Comparison of Private and Public Sector Implementations

    Science.gov (United States)

    2004-03-01

    not experimentally examined or measured…” ( Denzin and Lincoln , 2000:8). Furthermore, scientific experiments are typically not conducted in business...Objectivist and Constructivist Methods. In N.K. Denzin and Y.S. Lincoln (Eds.), Handbook of Qualitative Research (2nd Edition) (pp. 509-535). Thousand...unpublished article. n. pag. http://www.dla.mil/public_info/read_news.asp?track=182. 5 December 2003. Denzin , N.K. and Lincoln , Y.S. (2000). Handbook of

  3. FAR 13.5 Acquisition Streamlining: Observations and Recommendations for the Defense Logistics Agency

    Science.gov (United States)

    2011-04-01

    revenues of nearly $41 billion that would put DLA in the top 60 of the Fortune 500 list, ahead of companies like American Express, DuPont and Coca ... Cola . • Employs about 27,000 civilian and military employees. • Supports nearly 1,900 weapon systems. • Manages eight supply chains and nearly 5...achieving performance objectives. Currently there are no reported efforts to incentivize the use of FAR 13.5. Given congressional sponsorship and

  4. Managing the Growing Chinese Power in SE Asia: The U.S. Struggle to Maintain Power Projection in the Face of the Rising Middle Kingdom

    Science.gov (United States)

    2016-04-04

    Active Locations Spreadsheet from December 02, 2014. 32 Shannon Deebe and Mary Kaldor, The Ultimate Weapon is No Weapon (New York: Perseus Books ...available online at: https://history.state.gov/historicaldocuments/frus1945-50Intel/d269. See also Kennan’s original hand-annotated draft dated April 30...to further add to the dispersed scheme, DLA-E needs to investigate sites in other politically viable locations such as Cambodia, Brunei, and Malaysia

  5. Zakład Medycyny Sądowej w Bielsku-Białej

    Directory of Open Access Journals (Sweden)

    Jerzy Brzyski

    2014-10-01

    Full Text Available Zakład Medycyny Sądowej w Bielsku-Białej został utworzony w 1978 roku. Podstawą dla jego utworzenia i wpisania w strukturę Wojewódzkiego Szpitala Zespolonego były wytyczne Ministra Zdrowia i Opieki Społecznej z dnia 15.06.1978 roku w sprawie organizacji i zadań komórek medycyny sądowej (Dz.U. MZiOS Nr 11, poz 28.

  6. Defense Standardization Program Journal. April/September 2012

    Science.gov (United States)

    2012-01-01

    were magnified. In 1905, a committee of the National Fire Protection Association established a national standard for the diameter and threads per inch...for fire hydrants and hose couplings. The standard specifies that fire hydrants have 2.5-inch hose connections with 7.5 threads per inch and that...dsp.dla.mil I Field of view, lens material haze, luminous transmittance, and lens abrasion resistance (APR) I Communications (APR) I Fogging (APR

  7. Study of the Effect of Hydrocarbon Type Biodegradation on Fuel Specification Properties

    Science.gov (United States)

    2014-06-01

    diesel fuel (F10428) before and after 1 month exposure to Pseudomonas or a control. Figure 12. QCM profiles at 140°C of mass accumulation (solid...DLA-13) Figure 32. Calibration curve for analysis of BHT in jet fuel. Figure 33. Growth of yeast in 20 mg/L concentrations of A and B. Figure...bladder materials. Some costly problems associated with microbial growth include tank corrosion, fuel pump failures, filter plugging, injector

  8. Department of Defense, Office of Inspector General Semiannual Report to the Congress, 1 April - 30 September 1984.

    Science.gov (United States)

    1984-11-29

    Healthi Fraud, Potential Fraud or Potential Fraud and Human Services (lDoHHS) because of the contrac--0 Referred to Civilian Prosecutive Agencies tor’s...Administra- 7/31/84 Resourec and (;round Fuel Ac(otiunng tion, Government Property in the Cuintrol at Marine Ctirps Air Station, Possession of Contractors...DLA Defense Logistics Agency DoD Department of Defense DoHHS Department of Health and Human Services DoJ Department of Justice EPA Environmental

  9. Gamma-Ray Bursts: Lighting Up the High-Redshift Universe

    Science.gov (United States)

    Toy, Vicki Louise

    Gamma-ray bursts (GRBs) are the most luminous events in the Universe with Egamma,iso ˜ 1048-54 erg. Leading models hypothesize that GRBs are created from inter- nal collisions within collimated and ultrarelativistic jets. The jets then shock-heat the surrounding material (e.g. interstellar medium) to create GRB afterglows. These afterglows are extremely useful probes of the Universe because long GRBs are (1) bright events that can be used as backlights for absorption studies, (2) able to probe at all redshifts massive stars exist, and (3) transient events that allow us to follow- up on the host galaxies at late times. In this thesis we study the environments of GRBs. We first explore the relationship between GRB and supernova (SN) using a nearby GRB-SN (GRB 130702A/SN 2013dx) at z = 0.145. There are only nine other GRB-SNe that were close enough to have extensive spectroscopic and photometric follow-up of the SN at late times. We create a quasi-bolometic light curve of SN 2013dx and fit an analytical equation to the quasi-bolometric light curve combined with measurements of the photospheric velocity to determine SN parameters: mass of 56Ni, kinetic energy, and ejecta mass. We examine the relationship between SN parameters and E gamma,iso for the 10 well-studied GRB-SNe, but find no correlations despite numerical simulation predictions that the mass of 56Ni should correlate with the degree of asymmetry. We then move to larger distance scales and use GRB afterglows as bright back- lights to study distant galaxies. We examine the galactic environments of Damped Lyman-alpha systems (DLAs; NHI ≥ 1020.3 cm-2 ) identified with GRB afterglows at z ˜ 2 - 6. We use late-time photometry after the GRB afterglow has faded to determine star formation rates (SFRs) from rest-frame ultraviolet measurements or spectral energy distribution (SED) models from multiband photometry. We com- pare our sample's SFRs to a sample of quasars (QSOs) DLA host galaxies. Despite the

  10. Improving DLA Supply Chain Agility: Lead Times, Order Quantities, and Information Flow

    Science.gov (United States)

    2015-01-01

    and market for these items. Even for com- mercial items, there is a lack of PLT benchmarking information, which contributes to buyers’ perception...an item is not on an outline agreement (long-term contract) ◦ Micro purchases ◦ Other purchases c. Supplier selection process ◦ Market research process...to find the relationship between Q*/σ and the corresponding reorder point R, fitting to a logarith- mic function R = α – δlog(Q*/σ).6 She arrived at

  11. Skutki nowych form organizacyjnych dla pracy mistrzów w ich ocenie

    OpenAIRE

    Paul, Jadwiga

    1987-01-01

    Digitalizacja i udostępnienie w Cyfrowym Repozytorium Uniwersytetu Łódzkiego kolekcji czasopism naukowych wydawanych przez Uniwersytet Łódzki nr 885/P-DUN/2014 zostało dofinansowane ze środków MNiSW w ramach działalności upowszechniającej naukę.

  12. Wyzwanie dla racjonalności: Leibniz i początek ery Newtona

    Directory of Open Access Journals (Sweden)

    Michał Heller

    2016-12-01

    Full Text Available Our present knowledge in the field of dynamical systems, information theory, probability theory and other similar domains indicates that the human brain is a complex dynamical system working in a strong chaotic regime in which random processes play important roles. In this environment our mental life develops. To choose a logically ordered sequence from a random or almost random stream of thoughts is a difficult and energy consuming task. The only domain in which we are able to do this with a full success is mathematics. Leibniz’s life ambition was to extend this success, with the help of what he called characteristica universalis, to other areas of human activity. The belief that this is possible lies at the basis of Leibniz’s rationalist system. Reasoning within his system, Leibniz claimed that also fundamental laws of physics can be deduced from the “first principles”. Just as linguistic or conceptual units are at the basis of the charactersistica universalis, his monads are responsible for physical activity of material bodies. When this rationalistic strategy is applied to the philosophy of space and time, it leads to their radically relational conception. Leibniz’s rationalistic approach to philosophy and science arouses out sympathy but it was Newton’s mathematical-empirical method that turned out to be effective in human endeavour to understand the functioning of the physical world. Successes of the Newtonian method compel us to revise our concept of rationality.

  13. Sieciowe usługi informacyjne dla nauk technicznych : BazTech, BazTOL

    OpenAIRE

    Derfert-Wolf, Lidia

    2007-01-01

    The paper presents the current state and plans for development of the BazTech "Polish Technical Journals Contents" database. It is created by 22 academic libraries and centers for scientific information. The project is coordinated by the Cracow University of Technology. The Baz Tech database, situated at http://baztech.icm.edu.pl (ICM UW server), within the framework of the project "Virtual Scientific Library" lists over 400 journals. The paper also describes the assumptions for the creation ...

  14. DLA/FedEx Premium Service Effects on Defense Distribution Inventories and Shipments

    National Research Council Canada - National Science Library

    Hill, Marichal L; Pitts, Bobby

    2006-01-01

    .... The research will view the possible benefits gained through commercial inventory and transportation practices by partnering a third party logistics service with the Defense Transportation System...

  15. DIGITALISATION IN FINNISH MUSEUMS

    Directory of Open Access Journals (Sweden)

    Magdalena Laine-Zamojska

    2014-01-01

    Full Text Available W artykule omówiono generalny obraz digitalizacji w fińskim sektorze muzealnym. Przedstawiono szacunkowe liczby dotyczące digitalizacji dziedzictwa kulturowego na podstawie przeprowadzonych statystycznych badań, oraz zaprezentowano wiele projektów związanych z ucyfrowieniem fińskich muzeów.\tFiński sektor muzealny jest niezwykle zróżnicowany, podobnie jak stopień skatalogowania i zdigitalizowania kolekcji. W projektach rozwojowych aktywnie uczestniczy cały sektor muzealny. W ostatnich latach, dzięki wielu inicjatywom i badaniom udało się uzyskać szczegółowy obraz fińskiego sektora muzealnego. Największą inicjatywą jest projekt utworzenia Narodowej Biblioteki Cyfrowej, podlegający Ministerstwu Edukacji i Kultury. Celem projektu jest połączenie i udostępnienie zasobów z instytucji pamięci (bibliotek, archiwów i muzeów. Towarzyszą mu rozległe projekty digitalizacji.\tW związku z ogromną różnorodnością systemów do zarządzania kolekcją i praktykami katalogowymi w muzeach, w 2011 r. Państwowy Urząd Muzealny (Museovirasto / National Board of Antiquities, Fiński Związek Muzeów (Suomen museoliitto / Finnish Museums Association i Państwowa Galeria Sztuki (Valtion taidemuseo / Finnish National Gallery zainicjowały projekt Muzeum2015 (Museo2015 / Museum2015. Jego głównymi celami są: unifikacja procesów związanych z zarządzaniem kolekcją, stworzenie architektury korporacyjnej dla zarządzania muzealną kolekcją, stworzenie modelu zarządzania dla architektury korporacyjnej, oraz określenie i stworzenie warunków do zakupu i implementacji ogólnofińskiego systemu zarządzania kolekcją.\tRozwój cyfrowych narzędzi dla najmniejszych, prowadzonych przez wolontariuszy, muzeów lokalnych jest jednym z celów projektu badawczego ViMuseo, prowadzonego na Uniwersytecie w Jyväskylä (Jyväskylän yliopisto / University of Jyväskylä.

  16. ANALIZA PRACY INSTALACJI FOTOWOLTAICZNEJ W ZALEŻNOŚCI OD ORIENTACJI GEOGRAFICZNEJ

    Directory of Open Access Journals (Sweden)

    Ewelina KRAWCZAK

    Full Text Available Rynek odnawialnych źródeł energii z każdym dniem coraz bardziej się rozwija. Zapotrzebowanie na energię elektryczną wzrasta, przy czym zasoby konwencjonalnych i zarazem nieodnawialnych źródeł energii (paliw kopalnych ulegają zubożeniu. Alternatywą dla nich są odnawialne źródła energii (OZE, których rezerwy uzupełniane są w naturalnych procesach ekosystemu, co stanowi o ich niewyczerpalności. Zmiany legislacyjne w Polsce dotyczące OZE spowodowały duże zainteresowanie małymi instalacjami fotowoltaicznymi w wyniku czego dotychczasowy konsument zmienia się w prosumenta energii elektrycznej. Rozwój rynku odnawialnych źródeł energii stawia przed projektantami ciągłe wyzwania, ponieważ projektowanie instalacji fotowoltaicznych o wysokiej wydajności dla istniejących budynków, przy uwzględnieniu występujących lokalnych warunków oraz architektury budowli, jest niezwykle trudne. Uzysk energetyczny systemu słonecznego zależy od wielu czynników, jednym z najważniejszych jest wartość nasłonecznienia zależna od lokalizacji (szerokości geograficznej, a także orientacja projektowanego systemu względem kierunku azymutu. Narzędziem wspomagającym i usprawniającym projektowanie instalacji PV (Photovoltaics jest oprogramowanie DDS-CAD, pozwalające przeprowadzić symulację uzysków energii elektrycznej. Wyniki otrzymanych symulacji umożliwiają w krótkim czasie porównanie wielu wirtualnych modeli instalacji pod kątem wydajności, a co za tym idzie wybranie najkorzystniejszego wariantu dla istniejącej orientacji geograficznej. W niniejszej pracy poddane zostały analizie rezultaty symulacji wirtualnych modeli instalacji fotowoltaicznych pod względem liczby generatorów fotowoltaicznych oraz wielkości uzysku energii elektrycznej przy założeniu wykorzystania całej powierzchni dachu oraz uwzględnieniu zmiany kąta usytuowania modułów PV względem okapu połaci dachowej i kierunku azymutu.

  17. WŁAŚCIWOŚCI FIZYCZNO-CHEMICZNE BIOMASY OTRZYMANEJ W NOWEJ TECHNOLOGII PRZETWARZANIA OSADÓW ŚCIEKOWYCH „BIONOR SLUDGE”

    Directory of Open Access Journals (Sweden)

    January BIEŃ

    2016-06-01

    Full Text Available Obecny stan prawny w pewien sposób generuje poszukiwania i rozwój nowoczesnych technologii pozwalających na rozwiązanie problemu zagospodarowania osadów ściekowych w Polsce nie tylko dla dużych obiektów, ale przede wszystkim dla instalacji małych i średnich, ponieważ to z nich głównie osady ściekowe obecnie trafiają na składowiska odpadów. Celem pracy jest ocena funkcjonowania prototypowej linii technologicznej do przetwarzania osadów ściekowych i ocena uzyskanej z tej technologii biomasy. Technologia Bionor Sludge stanowi rozwiązanie przeznaczone dla gminnych oczyszczalni o przepustowości do 1000 m3*d-1. Powstające osady ściekowe odpowiednio przetworzone w instalacji mogą zostać zagospodarowane dwojako: jako kompost lub jako wsad do instalacji termicznej, gdzie mogą stanowić biomasę zgodnie z ustawą o OZE. W pracy przedstawiono materiały pozwalające na wstępną ocenę jakości uzyskiwanego produktu pod kątem potencjału nawozowego i energetycznego. Bionor Sludge to technologia, która polega na przekierowaniu, w możliwie największym stopniu, energii chemicznej zgromadzonej w ściekach komunalnych do osadów stanowiących rezerwuar substancji organicznej. Cały układ technologiczny oczyszczania ścieków i przeróbki osadów charakteryzuje się również wysoką efektywnością i elastycznością pracy przy modułowej zabudowie. Możliwe i w pełni zasadne jest zastosowanie wybranych elementów omawianej instalacji w ramach modernizacji istniejących obiektów. Technologia Bionor Sludge dzięki swej innowacyjności i założeniom o możliwie najlepszym wykorzystaniu zasobów nawozowych i energetycznych, umożliwia racjonalne funkcjonowanie oczyszczalni i tym samym znaczące odciążenie budżetu gmin i ostatecznie ich mieszkańców.

  18. Edukacja żywieniowa rodziny w przypadku występowania otyłości

    Directory of Open Access Journals (Sweden)

    Magdalena Pieszko

    2013-12-01

    Full Text Available Edukacja żywieniowa stanowi ważny element terapii osób z nadwagą i otyłością, będąc niejednokrotnie dopełnie‑ niem dla diety redukcyjnej czy farmakoterapii. Prawidłowo dobrana i realizowana metoda szkolenia powinna speł‑ niać funkcję czynnika mobilizującego i wzmacniającego, dzięki któremu pacjent będzie chętniej modyfikował swój styl życia. Głównym celem edukacji dotyczącej diety jest przekazanie i utrwalenie właściwych postaw żywieniowych, przy czym forma przekazu wiedzy na temat odżywiania skierowana do dzieci nie może być taka sama jak przezna‑ czona dla ich rodziców/opiekunów. Związane jest to z różnicami w rozumieniu i przyswajaniu informacji pomiędzy osobami dorosłymi i dziećmi. Mimo to trzeba pamiętać, że rodzina jest społecznością, której członkowie są ze sobą bardzo związani i mają na siebie duży wpływ – nie można zatem pominąć edukacji, która będzie zachęcała całą rodzinę do wspólnych działań. Zmiana nawyków żywieniowych musi dotyczyć wszystkich członków rodziny, gdyż to rodzice poprzez swoje poglądy, preferencje i zachowania kształtują poglądy, preferencje i zachowania dzieci. Również osoba szczupła powinna dostosować się do nowych zasad dla dobra swoich bliskich. Wzajemna moty‑ wacja może być kluczem do sukcesu. Zmiana stylu życia wiąże się też ze zwiększeniem aktywności fizycznej, która jest nieodzownym elementem terapii pacjentów otyłych. Wzrost aktywności ruchowej może skutecznie skrócić czas leczenia oraz przyczynić się do jego lepszych efektów.

  19. Changes in sectoral structure of employment in Poland in comparison to the European Union

    OpenAIRE

    Dworak, Edyta; Malarska, Anna

    2010-01-01

    Przedmiotem opracowania jest diagnostyka i ocena przeobrażeń w sektorowej strukturze zatrudnienia w krajach UE w czasie. Na tym tle eksponowane są zmiany w GN Polski w okresie 1997– 2008. Dla zilustrowania i empirycznej weryfikacji teorii trzech sektorów A. Fishera, C. Clarka i J. Fourastie zorientowanej na ocenę procesu modernizacji unijnych gospodarek wykorzystane zostały klasyczne narzędzia analizy statystycznej oraz mało znana w Polsce, a pop...

  20. A genetic assessment of the English bulldog

    OpenAIRE

    Pedersen, Niels C.; Pooch, Ashley S.; Liu, Hongwei

    2016-01-01

    Background This study examines genetic diversity among 102 registered English Bulldogs used for breeding based on maternal and paternal haplotypes, allele frequencies in 33 highly polymorphic short tandem repeat (STR) loci on 25 chromosomes, STR-linked dog leukocyte antigen (DLA) class I and II haplotypes, and the number and size of genome-wide runs of homozygosity (ROH) determined from high density SNP arrays. The objective was to assess whether the breed retains enough genetic diversity to ...

  1. All Prime Contract Awards by State or Country, Place, and Contractor, FY83, Part 4 (Washington, D.C.-Lafayette, Indiana).

    Science.gov (United States)

    1983-01-01

    CONTRACTOR TOTAL 3 172 ROOAN CONSTRUCTION CO NCMACDILL AFB FLORIDA 033040 2140 10 3 B OTAIG 0157 FO6SO2-! ps4 -CO022 D C E 5 2 2 Z127 002ELCRNIC...DESCRIPTION OF CMDTY/SRVC 2 3 4 5 6 1717 8 9 A 0 1 3 24 $S$SSS(000) ELECTRO MOTIVE INC LA GRANGE ILLINOIS 029204 4720 14 4 J 00700 0007 DLA700-73-90522 B C A 1

  2. Community Project for Accelerator Science and Simulation (ComPASS)

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, Christopher [Univ. of Texas, Austin, TX (United States); Carey, Varis [Univ. of Texas, Austin, TX (United States)

    2016-10-12

    After concluding our initial exercise (solving a simplified statistical inverse problem with unknown parameter laser intensity) of coupling Vorpal and our parallel statistical library QUESO, we shifted the application focus to DLA. Our efforts focused on developing a Gaussian process (GP) emulator within QUESO for efficient optimization of power couplers within woodpiles. The smaller simulation size (compared with LPA) allows for sufficient “training runs” to develop a reasonable GP statistical emulator for a parameter space of moderate dimension.

  3. Loglines. July - August 2012

    Science.gov (United States)

    2012-08-01

    switching to manual push carts. The automated stock selectors used now only allow one person to pick material from a row, but we’ll be able to put as many...Plans and Policy has developed a policy instruction and a procedures manual , both aimed at establishing minimum standards and a consistency of...to those barriers. Peter Apgar , a budget analyst in DLA Finance, was a member of the original working group. “The charter is an excellent example

  4. Miejsce muzeów w turystyce kulturowej w Polsce

    OpenAIRE

    Krakowiak, Beata

    2013-01-01

    The article presents the museums, their potential and their significance for cultural tourism in Poland. Its aims are achieved through a presentation of registered national museums, ‘monuments of history’, museum buildings and the cultural activities undertaken by these institutions Artykuł dotyczy potencjału muzealnego oraz jego znaczenia dla turystyki kulturowej w Polsce. Zamierzone cele pracy realizowane są poprzez prezentację muzeów rejestrowanych, narodowych, muzeów-pomników histor...

  5. Navy Controls for Invoice, Receipt, Acceptance, and Property Transfer System Need Improvement

    Science.gov (United States)

    2016-02-25

    appointment. Defense Finance and Accounting Ser vice personnel who maintain the official DD Form 577 database for DoD stated that the DD Forms 577 for these...agreements bet ween iR APT and the various entitlement systems and a memorandum of understanding bet ween Nav y and the Defense Finance and Accounting ...Pacific, SWRMC, NAVFAC SW, DLA; and Defense Finance and Accounting Ser v ice to identif y policies and procedures in place over the access

  6. Konkursy plastyczne forma promocji biblioteki

    Directory of Open Access Journals (Sweden)

    Folga Agnieszka

    2012-06-01

    Full Text Available Biblioteka Główna Uniwersytetu Pedagogicznego w Krakowie w celu promocji instytucji rozszerza zakres działań między innymi poprzez organizację konkursów plastycznych dla dzieci w wieku przedszkolnym, wczesnoszkolnym i szkolnym. W artykule omówiono konkursy plastyczne, które były zorganizowane w bibliotece. Przedstawiono etapy realizacji konkursu oraz ich przebieg. Dodatkowo poruszono kwestie wpływu podejmowanych działań na wizerunek biblioteki.

  7. Formulation of a possible advanced reactor legislative strategy and proposal

    International Nuclear Information System (INIS)

    1994-01-01

    A number of initiatives have been taken to date regarding the formulation of legislation to support in various ways the DOE advanced nuclear reactor program. Among the more prominent of these are bills that have been introduced by Sen. Johnston (D-La) and Rep. Udall (D-Az) as well as a draft bill put together by the nuclear industry and that could be introduced by Rep. Stallings (D-Id). These legislative initiatives are presented in this paper

  8. Sub-wavelength plasmonic readout for direct linear analysis of optically tagged DNA

    Science.gov (United States)

    Varsanik, Jonathan; Teynor, William; LeBlanc, John; Clark, Heather; Krogmeier, Jeffrey; Yang, Tian; Crozier, Kenneth; Bernstein, Jonathan

    2010-02-01

    This work describes the development and fabrication of a novel nanofluidic flow-through sensing chip that utilizes a plasmonic resonator to excite fluorescent tags with sub-wavelength resolution. We cover the design of the microfluidic chip and simulation of the plasmonic resonator using Finite Difference Time Domain (FDTD) software. The fabrication methods are presented, with testing procedures and preliminary results. This research is aimed at improving the resolution limits of the Direct Linear Analysis (DLA) technique developed by US Genomics [1]. In DLA, intercalating dyes which tag a specific 8 base-pair sequence are inserted in a DNA sample. This sample is pumped though a nano-fluidic channel, where it is stretched into a linear geometry and interrogated with light which excites the fluorescent tags. The resulting sequence of optical pulses produces a characteristic "fingerprint" of the sample which uniquely identifies any sample of DNA. Plasmonic confinement of light to a 100 nm wide metallic nano-stripe enables resolution of a higher tag density compared to free space optics. Prototype devices have been fabricated and are being tested with fluorophore solutions and tagged DNA. Preliminary results show evanescent coupling to the plasmonic resonator is occurring with 0.1 micron resolution, however light scattering limits the S/N of the detector. Two methods to reduce scattered light are presented: index matching and curved waveguides.

  9. Interstellar Gas-phase Element Depletions in the Small Magellanic Cloud: A Guide to Correcting for Dust in QSO Absorption Line Systems

    Energy Technology Data Exchange (ETDEWEB)

    Jenkins, Edward B. [Princeton University Observatory, Princeton, NJ 08544-1001 (United States); Wallerstein, George, E-mail: ebj@astro.princeton.edu, E-mail: walleg@u.washington.edu [University of Washington, Seattle, Dept. of Astronomy, Seattle, WA 98195-1580 (United States)

    2017-04-01

    We present data on the gas-phase abundances for 9 different elements in the interstellar medium of the Small Magellanic Cloud (SMC), based on the strengths of ultraviolet absorption features over relevant velocities in the spectra of 18 stars within the SMC. From this information and the total abundances defined by the element fractions in young stars in the SMC, we construct a general interpretation on how these elements condense into solid form onto dust grains. As a group, the elements Si, S, Cr, Fe, Ni, and Zn exhibit depletion sequences similar to those in the local part of our Galaxy defined by Jenkins. The elements Mg and Ti deplete less rapidly in the SMC than in the Milky Way, and Mn depletes more rapidly. We speculate that these differences might be explained by the different chemical affinities to different existing grain substrates. For instance, there is evidence that the mass fractions of polycyclic aromatic hydrocarbons in the SMC are significantly lower than those in the Milky Way. We propose that the depletion sequences that we observed for the SMC may provide a better model for interpreting the element abundances in low-metallicity Damped Lyman Alpha (DLA) and sub-DLA absorption systems that are recorded in the spectra of distant quasars and gamma-ray burst afterglows.

  10. Dynamics of the Monorail Train Subjected to the Braking on a Straight Guideway Bridge

    Directory of Open Access Journals (Sweden)

    Naeimi Meysam

    2015-09-01

    Full Text Available W pracy zastosowano metodę elementów skończonych do modelowania prostego odcinka prowadnicy mostu kolei jednoszynowej w celu badania oddziaływań dynamicznych, wzdłużnych i pionowych, występujących w systemie. Modelowano skok mostu kolei jednoszynowej, o ograniczonej długości, zawierający pięć odcinków ciągłych. Do badania systemu pociągu jednoszynowego zastosowano model 3D, realizowany w oprogramowaniu MCS ADAMS przeznaczonym do analizy systemu wielu ciał metodą elementów skończonych. Cały model, składający się z modelu pojazdu i podsystemów mostu, jest analizowany numerycznie drogą symulacji dynamicznej w dziedzinie czasu. W czasie analizy są aktywowane siły hamowania występujące pomiędzy oponami pociągu i belkami prowadnicy. Uwzględniono ciężar własny składników konstrukcji i ciężar użytkowy - pasażerów pociągu. Wyznaczono siły dynamiczne w oponach dla przypadku hamowania awaryjnego. Wyznaczono także siły reakcji w filarach mostu, które stanowią dane wejściowe dla celów projektowania mostu.

  11. Raportowanie banków na temat zrównoważonego rozwoju według standardów Global Reporting Initiative

    Directory of Open Access Journals (Sweden)

    Ana Novokmet

    2016-09-01

    Full Text Available Rachunkowość zrównoważonego rozwoju, z jej ostatecznym produktem – raportami społecznej odpo-wiedzialności, jest nową dziedziną rachunkowości i koncentruje się na ocenie i monitorowaniu działań w zakresie zarządzania firmą, ochrony środowiska i integracji społecznej oraz interakcji z otoczeniem. Wśród kilku standardowych ram, firmy na całym świecie często wybierają wytyczne Sustainability Re-porting Global Reporting Initiative (GRI. Od roku 2000 wytyczne GRI ewoluowały i obecnie jest do-stępna czwarta ich generacja. Celem tego artykułu jest ocena raportowania społecznego w ramach zinte-growanych raportów w sektorze bankowym na przykładzie UniCredit Group, która działa w 15 krajach. Raportowanie zrównoważonego rozwoju stanie się obowiązkowe w Unii Europejskiej dla dużych firm, notowanych na giełdach spółek i jednostek interesu publicznego (na przykład banków ze średnim za-trudnieniem co najmniej 500 pracowników, począwszy od roku 2018 (dla działalności w 2017 r.. Wniniejszym artykule skoncentrowano się na krytycznej analizie treści raportu społecznego banku.

  12. Feasibility and patient acceptability of a novel artificial intelligence-based screening model for diabetic retinopathy at endocrinology outpatient services: a pilot study.

    Science.gov (United States)

    Keel, Stuart; Lee, Pei Ying; Scheetz, Jane; Li, Zhixi; Kotowicz, Mark A; MacIsaac, Richard J; He, Mingguang

    2018-03-12

    The purpose of this study is to evaluate the feasibility and patient acceptability of a novel artificial intelligence (AI)-based diabetic retinopathy (DR) screening model within endocrinology outpatient settings. Adults with diabetes were recruited from two urban endocrinology outpatient clinics and single-field, non-mydriatic fundus photographs were taken and graded for referable DR ( ≥ pre-proliferative DR). Each participant underwent; (1) automated screening model; where a deep learning algorithm (DLA) provided real-time reporting of results; and (2) manual model where retinal images were transferred to a retinal grading centre and manual grading outcomes were distributed to the patient within 2 weeks of assessment. Participants completed a questionnaire on the day of examination and 1-month following assessment to determine overall satisfaction and the preferred model of care. In total, 96 participants were screened for DR and the mean assessment time for automated screening was 6.9 minutes. Ninety-six percent of participants reported that they were either satisfied or very satisfied with the automated screening model and 78% reported that they preferred the automated model over manual. The sensitivity and specificity of the DLA for correct referral was 92.3% and 93.7%, respectively. AI-based DR screening in endocrinology outpatient settings appears to be feasible and well accepted by patients.

  13. Rola systemu edukacji w dostarczaniu kwalifikacji poszukiwanych przez pracodawców: analiza przypadku województwa pomorskiego

    Directory of Open Access Journals (Sweden)

    Tomasz Gajderowicz

    2013-06-01

    Full Text Available Kwalifikacyjną strukturę popytu na pracę najczęściej opisuje się poprzez kategorie z klasyfikacji zawodów – powszechnie stosowane w publicznym pośrednictwie pracy. Nie mają one jednak bezpośredniego przełożenia na system edukacji, a jednocześnie są mało intuicyjne dla pracodawców. Celem artykułu jest opisanie popytu na pracę poprzez identyfikację profili kompetencyjnych pożądanych przez pracodawców. Ich analiza pozwala ustalić, które kompetencje stanowią ogólny, a które specyficzny kapitał ludzki, a także sformułować wnioski dla systemu kształcenia. W badaniu wykorzystano dane dotyczące pomorskiego rynku pracy i posłużono się analizą skupień oraz analizą współczynnika zmienności częstości zgłoszeń zapotrzebowania na zdefiniowane cechy osobowe, kompetencje kluczowe i kwalifikacje zawodowe. Wyniki wskazują m.in. na konieczność zwiększenia nacisku na kształtowanie cech osobowych we wczesnych latach edukacji szkolnej oraz w kształceniu zawodowym, a także na konieczność większego udziału kształcenia kompetencji kluczowych w szkolnictwie wyższym.

  14. Opodatkowanie transgranicznych spadków i darowizn

    OpenAIRE

    Szczepański, Jan Karol

    2017-01-01

    Wydział Prawa i Administracji Tematem pracy jest opodatkowanie transgranicznych spadków i darowizn. Opracowanie obejmuje zagadnienia związane z międzynarodowym prawem podatkowym sensu largo. Punktem wyjścia dla pracy jest zarysowanie pojęcia transgranicznego spadku (transgranicznej darowizny), które uzasadnia trójpłaszczyznową analizę reguł podatkowych. Pierwsza część pracy prezentuje zagadnienia teoretycznoprawne dotyczące opodatkowania nieodpłatnego transferu majątku mortis causa czy int...

  15. Loglines. November - December 2011

    Science.gov (United States)

    2011-12-01

    the agency were ranked on Forbes Magazine’s annual list of America’s largest companies, it would land above FedEx, Coca - Cola and Disney in terms of...too complex,” Howerton said. “Reverse auctions are potentially a good target with standard, off-the-shelf items.” Ninety-eight percent of what DLA...shortages of those materials. “We will also do more outreach with the services to see what their requirements are, as well as research the global market

  16. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 2 (Air Force Academy, Colorado-Zion, Illinois).

    Science.gov (United States)

    1984-01-01

    HETRA CORPORATION 131 131 MARTIN MARIETTA CORPORATION 3,478 3,478 NEWPORT ELECTRO - OPTICS 36 36 OPTO MECHANIK INC 2,293 2,293 REGAL MATTRESS COMPANY INC...TELEPHONE & TELO CO 584 58 RIVIERA BEACH BIG THREE INDUSTRIES INC 628 626 KOEHLKE COMPONENTS INC 85 85 LENZAR OPTICS CORP 966 966 MICRO TOOL a ENGINEERING...LOCATION CONTRACTOR DOD AIR NAME NAME TOTAL ARMY NAVY FORCE DLA OCE AURORA ELECTRO -TEST INC 95 95 ELLIS THEODORE AND COMPANY 82 82 FAMILY MOTEL 27 27

  17. Przyczynek do postrzegania struktury współczesnego systemu rachunkowości

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2018-03-01

    Full Text Available Głównym celem artykułu jest objaśnienie procesu ewoluowania elementów systemu rachunkowości organizacji gospodarczej pod wpływem zmian zachodzących w różnicach informacji oczekiwanych przez odbiorców wewnętrznych i zewnętrznych. Dla zrealizowania tego celu przedstawiono zamęt regu- lacyjny w obszarze rachunkowości i jego skutki dla rozwoju systemów rachunkowości w praktyce w Polsce oraz przeanalizowano zmiany w potrzebach informacyjnych interesariuszy w kontekście wprowadzanych zmian w sprawozdaniach finansowych, zintegrowanych raportach biznesowych i zmian w stosowanych metodach rachunkowości zarządczej w organizacjach społecznie odpowiedzialnych. Następnie przedsta- wiona została autorska propozycja nowej struktury systemu rachunkowości odpowiadająca jego współczesnej funkcjonalności w warunkach obecnego poziomu rozwoju globalizacji, zmierzającego w kierun- ku zrównoważonej gospodarki oraz szereg wniosków ogólnych wynikających z przedstawionych rozwa- żań. W propozycji nowej struktury przyjęto, że system rachunkowości organizacji społecznie odpowie- dzialnej powinien być zbudowany z podsystemu rachunkowości biznesowej, emitującego zintegrowany raport biznesowy (sprawozdanie finansowe + raporty niefinansowe i wewnętrzne raporty dla zarządu oraz podsystemu rachunkowości podatkowej, emitującego informacje dla agend podatkowych. W opra- cowaniu artykułu zastosowano analizę treści i opinii autorów wybranych publikacji, metodę analizy dokumentów oraz wiedzę uzyskaną metodą obserwacji bezpośredniej i wyniki badań empirycznych innych autorów. The main goal of the article is to explain the process of evolution of the organization's accounting system elements as a result of changes taking place in information expected by internal and external users. To achieve this goal, regulatory uncertainties in the area of accounting and their consequences for the devel- opment of accounting systems in

  18. Shybka i skuteczna metoda osadzania hydrosyapatytu na polimerze resorbowalnym przeznaczonym dla inzynierii tkankowej

    Czech Academy of Sciences Publication Activity Database

    Pamula, E.; Filová, Elena; Bačáková, Lucie

    2008-01-01

    Roč. 103, - (2008), s. 881-888. ISBN 978-83-60958-08-7. ISSN 0860-3340 R&D Projects: GA ČR(CZ) GA106/06/1576 Grant - others:WIMiC AGH(PL) 11.11.160.361 Institutional research plan: CEZ:AV0Z50110509 Keywords : degradable polyesters * hydroxyapatite * osteoblasts Subject RIV: EI - Biotechnology ; Bionics

  19. Ocena efektywności podziału subwencji oświatowej dla gmin

    Directory of Open Access Journals (Sweden)

    Jan Herczyński

    2016-06-01

    Full Text Available Celem przedstawionych analiz jest ocena dopasowania podziału pomiędzy gminy części oświatowej subwencji ogólnej do kosztów dostarczania usług edukacyjnych. W artykule zarysowano problematykę związaną z podziałem subwencji oświatowej pomiędzy gminy, opisano wagi stosowane w algorytmie podziału subwencji oświatowej, skoncentrowano się na zmianach wprowadzonych do algorytmu w 2015 r. i omówiono konsekwencje wynikające ze stosowania wag wiejskich, które mają stosunkowo duży wpływ na podział środków. W ostatniej części wprowadzono miarę nieefektywności algorytmu podziału części oświatowej subwencji ogólnej i zastosowano ją do oceny podziału środków subwencyjnych pomiędzy gminy. Miara ta pozwala m.in. ilościowo ocenić efekt zmian wprowadzonych do algorytmu w 2015 r. Zaproponowano możliwe korekty wag algorytmu pozwalające na redukcję nieefektywności i zjawiska tzw. przewrotnej motywacji organów prowadzących szkoły. W podsumowaniu przedstawiono główne wnioski wynikające z analiz.

  20. Rozporządzenia językowe Józefa II dla Galicji (1780-1790)

    Czech Academy of Sciences Publication Activity Database

    Timofejev, Dmitrij

    -, č. 1 (2015), s. 59-72 ISSN 1898-1593 Institutional support: RVO:68378092 Keywords : language policy * Habsburg monarchy * Galicia * Joseph II Subject RIV: AB - History http://www.postscriptum.us.edu.pl/pdf/ps2015_1_4.pdf

  1. 3D Deep Learning Angiography (3D-DLA) from C-arm Conebeam CT.

    Science.gov (United States)

    Montoya, J C; Li, Y; Strother, C; Chen, G-H

    2018-05-01

    Deep learning is a branch of artificial intelligence that has demonstrated unprecedented performance in many medical imaging applications. Our purpose was to develop a deep learning angiography method to generate 3D cerebral angiograms from a single contrast-enhanced C-arm conebeam CT acquisition in order to reduce image artifacts and radiation dose. A set of 105 3D rotational angiography examinations were randomly selected from an internal data base. All were acquired using a clinical system in conjunction with a standard injection protocol. More than 150 million labeled voxels from 35 subjects were used for training. A deep convolutional neural network was trained to classify each image voxel into 3 tissue types (vasculature, bone, and soft tissue). The trained deep learning angiography model was then applied for tissue classification into a validation cohort of 8 subjects and a final testing cohort of the remaining 62 subjects. The final vasculature tissue class was used to generate the 3D deep learning angiography images. To quantify the generalization error of the trained model, we calculated the accuracy, sensitivity, precision, and Dice similarity coefficients for vasculature classification in relevant anatomy. The 3D deep learning angiography and clinical 3D rotational angiography images were subjected to a qualitative assessment for the presence of intersweep motion artifacts. Vasculature classification accuracy and 95% CI in the testing dataset were 98.7% (98.3%-99.1%). No residual signal from osseous structures was observed for any 3D deep learning angiography testing cases except for small regions in the otic capsule and nasal cavity compared with 37% (23/62) of the 3D rotational angiographies. Deep learning angiography accurately recreated the vascular anatomy of the 3D rotational angiography reconstructions without a mask. Deep learning angiography reduced misregistration artifacts induced by intersweep motion, and it reduced radiation exposure required to obtain clinically useful 3D rotational angiography. © 2018 by American Journal of Neuroradiology.

  2. Obrazy jednoho sídla: Nymburk očima svých obyvatel

    OpenAIRE

    Malá, Michaela

    2016-01-01

    The diploma thesis The Images of a City: the Resident's View of the Town of Nymburk deals with the issue of why people behave differently. The thesis is inspired by the approach of behavioral geography, which is represented by Kevin Lynch's work. Lynch has proposed the concept of the image of the city, the people's vision about the surroundings of a place where they live. The image of the city consists of its visible features evoking a strong impression and having an effect on people's sensor...

  3. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 3, (Anderson, Indiana-Winona, Mississippi).

    Science.gov (United States)

    1984-01-01

    FORMING COMPANY 33 33 BONNER SPRINGS STEPHEN R E INC 95 95 BURLINGTON BRECKCO CONSTRUCTION CO INC 430 430 CHANUTE PORTER H K COMPANY INC 1,792 364 1,428...SEP) PAGE 848 MASS (DOLLARS IN THOUSANDS) LOCATION CONTRACTOR DOD AIR NAME NAME TOTAL ARMY NAVY FORCE DLA OCE ODA RANDOLPH MC GRAW -EDISON COMPANY 45...221 221 GENERAL DYNAMICS CORPORATION 2,127- 2,127- GENERAL DYNAMICS LAND SYS 12,866 12,866 MC DONNELL DOUGLAS CORPORATION 3,549 1,022 2.527 NC GRAW

  4. Prime Contract Awards Alphabetically by Contractor, by State or Country, and Place, FY83, Part 6 (Johnson Textile & Plastics Co-McKee Robert E Gen Contractor).

    Science.gov (United States)

    1983-01-01

    C B C A 1 2 2 6508 000 C9B MEDICATED COSMETICS AND TOIL 6 4 3 5 A 07 1 B J 1 B 141 4 G 00700 4089 DLA700-82-C C C A 1 2 2 7930 000 C9E CLEANING...TECH REP SERVICES /CONSTRUCT 7 7 3 J A 160 MCCLENDON AUTOMATION CO FENTON MISSOURI 587280 2770 26 5 H OCW31 0125 DACW31-T2 31 B C A 5 2 2 1560 CMG A2

  5. Air Force Journal of Logsitics. Volume 31, Number 3, Fall 2007

    Science.gov (United States)

    2007-01-01

    Prc s roemn DLA Fowr Stokig: An Ecnoi Anlyi O f0122002 htp :/w w.fmahqafmi/gj/Afjhmehm AIR FORCE JOURNAL LOGISTICS Volume XXXI, Number 3 Fall 2007...Foc spl sytm and our ledrhpi plnnn is main ls tic plyi ag m s si uato s an exrie trl meanigful AFL A You LgsisSuiesadAayisCneto htp :/w w.fIahqafmi...less than 5 years (in accordance with CAF LSC - Combat Air Forces Logistics Support Air Force Manual 23-I 10). Therefore. the model evaluates Center

  6. ADDRESSING THE DEFICIT: Updating the Budgetary Implications of Selected GAO Work

    Science.gov (United States)

    1996-06-01

    DGPS DI DLA DOD DOE DOT DUR EDWAA EM EPA FAIR FAA FAS FDIC FHWA FY GAO GSA HACCP HCFA HHS HMO HUD IDB IFAD INS IRS JCT...Marti, the broadcasts are constantly and effectively jammed , USIA’S research data shows that, mainly as a result of the jamming , the number of Cubans...hours (from 3:30 am to 8:00 am), but Cuban jamming also expanded. In an attempt to overcome jamming , TV Marti has plans to convert from VHF to UHF

  7. Četverogodišnje retrospektivno istraživanje pojave folikularnih tumora pasa u Hrvatskoj.

    OpenAIRE

    Beck, Ana; Huber, Doroteja; Šćuric, Valentina; Benić, Miroslav; Hohšteter, Marko; Kužir, Snježana

    2016-01-01

    Folikularni tumori pasa (FTP) pripadaju skupini rijetkih tumora kože koji stvaraju keratin, a razvijaju se iz različitih dijelova dlačnog folikula. Skupina psećih folikularnih tumora sastoji se od infundibularnog keratinizirajućeg akantoma (IKA), triholemoma, trihoepitelioma, pilomatrikoma i trihoblastoma. Sustavna istraživanja FTP-a su rijetka, a većina publiciranih opisa ovih tumora odnosi se na prikaze kliničke i histološke slike pojedinačnih slučajeva. S ciljem da odredimo prevalenciju i ...

  8. Methods for deep examination of DNA

    OpenAIRE

    Neiman, Mårten

    2013-01-01

    The development of sequencing technology has had a rapid pace during the last years and today, the sequencing instruments harbors enormous capacity. This thesis is about the development of methods to make the most out of this capacity and to use it for various applications. In paper I, a dual tagging system for sequencing large sample sets was developed. To proof the concept, 4,700 dogs were subjected to amplicon sequencing of the 2nd exon of the gene DLA-DRB1 using a 454...

  9. Characteristic of Carbon Nanotubes Modified with Cobalt, Copper and Bromine

    Directory of Open Access Journals (Sweden)

    Zygoń P.

    2014-06-01

    Full Text Available W pracy przedstawiono wyniki badań nanorurek węglowych w stanie surowym, po oczyszczeniu jak również po modyfikacji. Zostały przyłączone grupy funkcyjne oraz nanocząstki metali, pochodzące od siarczanu kobaltu, octanu miedzi i mieszaniny bromowodoru z bromem. Dla takich nanorurek przeprowadzono badania powierzchni na mikroskopie sił atomowych (AFM, badania rentgenograficzne (analiza składu fazowego, określenie wielkości krystalitów oraz badania spektroskopowe Raniana.

  10. Papers of 4. Scientific-Technical Seminar: Material Study for Electric Power Stations and Energetics; Referaty 4. Seminarium Naukowo-Techniczne: Badania Materialowe na Potrzeby Elektrowni i Przemyslu Energetycznego

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    The research on the materials commonly used in electric power stations and energetics have been summarized in the course of the seminar. Especially a different kinds of steels have been investigated from the view point of their desirable mechanical and corrosion properties.

  11. Usne u lavi

    Directory of Open Access Journals (Sweden)

    Una Krizmanić Ožegović

    2017-06-01

    Full Text Available [...] opatica je žena, ali žena koju se ne vidi svaki dan. Muškarci je se ne mogu nauživati u svakodnevnom ophođenju, stoga je žele s još većim žarom, skrivena je, zakukuljena, odsječena od svijeta u samostanu, u zatvoru, u beskrajnom zdanju u kojem se iza svakih vrata skrivaju još jedna. Carlos Fuentes, Constancia i druge priče za djeviceBože, oprosti mi. Možeš razumjeti silnu mahnitost u mojim prstima, vulkansku i suspregnutu potrebu mojih usana, vrelinu, i, o moj Bože, miris. Mnoštvo mirisa, otporne dlačice, znoj, znoj, prosta ruka, neobuzdana, poremećena, gruba. Gruba ruka kreće se u rupi, u kaljuži mojega bića. Svjedok – noć: pozornica za nasuprotnosti, noge i raskriljene proscenije, predstava uživo odakle se mrijeste strašne sablasti. Hitnem se s vrhunca svoje vjere, tijelo mi se razvaljuje u prah: prah koji se slobodno kreće, prah koji živi, prah koji je daleko od tebe, Gospodine. Jer griješim s golemim užitkom! I griješim misleći oživjeti. Gospodine, ja umirem od užitka u rukama, jezik traži ono što ne može dodirnuti, slina curi preko otvora; stenjem od trenja grješnih ruku, stenjem, vapim nijemo, ne da bih ti protuslovila, stenjem ne bih li te spoznala; pripojila. Svaka moja pora mjesto je otvorena dijaloga – začepljena znojem i magijom, bludi i slinom. Ruke, nezaustavljive, diraju mi kožu, rupe, mrse dlačice, prodiru divlje kao da nisam ni svoja, ni njihova gospodarica. Ruke puštaju da po njima curi slina s kojom prvo nisam znala što bih, onda sam je prisvojila, pa poslije tražila u iskusnu ritmu. Slina, proziran mulj, nedolično teče iz duše, predaje me na milost noći i mene same, curi, širi se prema netaknutim otvorima, olakšava mi pristup uskim, zabranjenim prolazima, Gospodine. Jer nastojala sam biti, bila sam u zabranjenim i uskim prolazima; zato griješim, Gospodine: s glazbom koja mi klizi niz dušu, s mutnom slinom, obilatom, demonskom, kola mi utrobom, prodire mirisom, miluje

  12. „Pokłosie. Zbieranka literacka na korzyść sierot”

    Directory of Open Access Journals (Sweden)

    Katarzyna Gmerek

    2010-01-01

    Full Text Available Tematem artykułu jest historia noworocznika literackiego „Pokłosie”, wydawanego w latach 1852-1861 w Wielkopolsce (Leszno, później Poznań, część Polski należąca do Prus. Specyfiką tytułu było połączenie trzech czynników: elitarnej zawartości literackiej, regularności wydawania oraz przeznaczenia całkowitego dochodu ze sprzedaży na lokalny cel charytatywny. W połowie XIX wieku region Wielkopolski nawiedziły klęski nieurodzaju, głodu i chorób, jakie dotknęły dużą część Europy. W rezultacie połączenia epidemii cholery oraz kryzysu ekonomicznego pojawiła się pilna potrzeba zorganizowania pomocy dla sierot i innych ubogich. Grupa ziemian wielkopolskich i księży katolickich z okolic Gostynia stworzyła Instytut Gostyński (szpital i sierociniec. Najbardziej aktywny działacz, Edmund Bojanowski z Grabonoga, zbudował także sieć ochronek dla dzieci wiejskich. Dla wsparcia wyżej wymienionych inicjatyw Bojanowski założył czasopismo literackie „Pokłosie”. W zdobywaniu materiałów, redagowaniu, korekcie i dystrybucji „Pokłosia” pomagało mu wielu ochotników; jedynymi osobami, które pobierały opłaty za swą pracę, byli wydawcy i księgarze. Najbliższym współpracownikiem Bojanowskiego był Stanisław Egbert Koźmian, krytyk i tłumacz, redaktor „Przeglądu Poznańskiego”, który dostarczał do „Pokłosia” materiały niewykorzystane w „Przeglądzie”, nie tyle słabsze, ile nieodpowiadające konserwatywnemu profilowi pisma. Przyjęto zasadę, że „Pokłosie” publikuje tylko pierwodruki i przez cały czas pismo zachowywało wysoki poziom. Noworocznik miał urozmaiconą zawartość, ponieważ publikowali w nim autorzy reprezentujący różne prądy literackie i orientacje polityczne. Za przyczynę zaprzestania wydawania „Pokłosia” uznać należy zarówno problemy finansowe, jak i narastające represje polityczne w prowincji, utrudniające wydawanie publikacji w języku polskim.

  13. PARAMETRY OSZKLENIA A KOMFORT CIEPLNY W STREFIE O REGULOWANEJ TEMPERATURZE

    Directory of Open Access Journals (Sweden)

    Beata WILK-SŁOMKA

    na kotle gazowym zasilającym grzejniki płytowe, konwekcyjne. Ocenę komfortu cieplnego przeprowadzono posługując się wskaźnikiem PMV. W rozważaniach uwzględniono podział na pory roku (lato, zima oraz porę dnia (dzień, noc poprzez przyjęcie odpowiednich wartości opisujących aktywność fizyczną człowieka (met oraz oporność cieplną odzieży (clo. Do analiz przyjęto 4 warianty oszklenia. Punkt odniesienia stanowi przeszklona fasada złożona z zestawu szybowego jednokomorowego wypełnionego powietrzem. Pozostałe warianty dobrano tak, aby odpowiadały współczesnym rozwiązaniom zestawów szybowych dla budownictwa niskoenergetycznego. Spełniają one aktualne wymagania izolacyjności termicznej, przy czym różnią się wartościami współczynników: przenikania ciepła U, całkowitej przepuszczalności energii promieniowania słonecznego g oraz przepuszczalności światła τvis. Są to zestawy trójszybowe, w których komory wypełniono argonem, szyby pokryto powłokami selektywnymi. Najbardziej korzystnymi z punktu widzenia uzyskania warunków odczuwania komfortu cieplnego dla opisanych powyżej założeń wydaje się być rozwiązanie W3.

  14. Metabolic Engineering of Lactobacillus plantarum for Direct l-Lactic Acid Production From Raw Corn Starch.

    Science.gov (United States)

    Okano, Kenji; Uematsu, Gentaro; Hama, Shinji; Tanaka, Tsutomu; Noda, Hideo; Kondo, Akihiko; Honda, Kohsuke

    2018-05-01

    Fermentative production of optically pure lactic acid (LA) has attracted great interest because of the increased demand for plant-based plastics. For cost-effective LA production, an engineered Lactobacillus plantarum NCIMB 8826 strain, which enables the production of optically pure l-LA from raw starch, is constructed. The wild-type strain produces a racemic mixture of d- and l-LA from pyruvate by the action of the respective lactate dehydrogenases (LDHs). Therefore, the gene encoding D-LDH (ldhD) is deleted. Although no decrease in d-LA formation is observed in the ΔldhD mutant, additional disruption of the operon encoding lactate racemase (larA-E), which catalyzes the interconversion between d- and l-LA, completely abolished d-LA production. From 100 g L -1 glucose, the ΔldhD ΔlarA-E mutant produces 87.0 g L -1 of l-LA with an optical purity of 99.4%. Subsequently, a plasmid is introduced into the ΔldhD ΔlarA-E mutant for the secretion of α-amylase from Streptococcus bovis 148. The resulting strain could produce 50.3 g L -1 of l-LA from raw corn starch with a yield of 0.91 (g per g of consumed sugar) and an optical purity of 98.6%. The engineered L. plantarum strain would be useful in the production of l-LA from starchy materials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Characterization and lytic activity of methicillin-resistant Staphylococcus aureus(MRSA phages isolated from NICU

    Directory of Open Access Journals (Sweden)

    Golnar Rahimzadeh

    2016-06-01

    Full Text Available Background Methicillin-resistant Staphylococcus aureus (MRSA is a well-known pathogen that causes serious diseases in humans. As part of the efforts to control this pathogen, an isolated bacteriophage, Siphoviridae, which specifically targets Methicillin-resistant Staphylococcus aureus (MRSA, was characterized. Aims The objective of this study was to characterize of a virulent bacteriophage (Siphoviridae isolated from a NICU bathroom sink. Methods The MRSA strain was isolated from patient blood. The isolated strain was confirmed as MRSA using conventional methods. Phages were isolated from a NICU bathroom sink and activity was lytic as determined by spot test. Titer phage lysate was measured by the Double Layer Agar (DLA technique. The morphology was found with electron microscopy. The single-step growth curve was plotted. Results Electron microscopy showed the phage as a member of the family Siphoviridae, serogroup A and F. The isolated phage was capable of lytic activity against methicillin-resistant Staphylococcus aureus (MRSA strain as shown by spot test. By DLA, the titre of the phages was determined to be 10×108PFU/ml. The single-step growth curve showed that the latent period of the isolated bacteriophage was 30 min and the total number of viable progeny per infected host, burst size, was 2600 PFU/infected host. Conclusion In this study, two phages were isolated and characterized from a NICU bathroom sink, from the Siphoviridae family, which specifically targetsmethicillin-resistant Staphylococcus aureus (MRSA.

  16. Pelvic symptoms after radiotherapy in prostate cancer: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Aline Moreira Ribeiro

    Full Text Available Abstract Introduction: Despite the technical and scientific progress that improved therapeutic resources available in Oncology, adverse effects of treatment can be prominent, impacting the quality of life (QoL. Objective: This research aims to determine the prevalence of post-radiotherapy pelvic symptoms in prostate cancer (PC and its impact on QoL. Methods: We assessed three groups of patients at different stages during radiotherapy (RT: Pre-RT, evaluated before of RT; Post-RT#1, evaluated between six months and one year post-RT; Post-RT#2, evaluated between two and a half and four years post-RT. The presence of urinary incontinence (UI, its characteristics and impact on daily living activities (DLA were evaluated by ICIQ-SF questionnaire. WHOQOL-BREF questionnaire was used to assess QoL. Student t test was used, considering significant p < 0.05. Results: Thirty-three men were assessed (pre-RT, n = 12; Post-RT#1, n = 10; Post-RT#2, n = 11. The prevalence of lower urinary tract symptoms (LUTS was highest in Post-RT#1 group. Post-RT#2 group had the highest prevalence of post-RT UI. In QoL, Pre-RT and Post-RT#2 groups experiencing the greatest impact on physical, environmental and overall QoL. Conclusion: Acute effect of RT is characterized by a high prevalence of LUTS. Post-RT#2 group experienced the most adverse effects on DLA due to a higher prevalence of post-RT UI.

  17. X-ray ionization of the intergalactic medium by quasars

    Science.gov (United States)

    Graziani, Luca; Ciardi, B.; Glatzle, M.

    2018-06-01

    We investigate the impact of quasars on the ionization of the surrounding intergalactic medium (IGM) with the radiative transfer code CRASH4, now accounting for X-rays and secondary electrons. After comparing with analytic solutions, we post-process a cosmic volume (≈1.5 × 104 Mpc3h-3) containing a ULAS J1120+0641-like quasar (QSO) hosted by a 5 × 1011M⊙h-1 dark matter (DM) halo. We find that: (i) the average HII region (R ˜ 3.2 pMpc in a lifetime tf = 107 yrs) is mainly set by UV flux, in agreement with semi-analytic scaling relations; (ii) a largely neutral (xHII < 0.001), warm (T ˜ 103 K) tail extends up to few Mpc beyond the ionization front, as a result of the X-ray flux; (iii) LyC-opaque inhomogeneities induce a line of sight (LOS) scatter in R as high as few physical Mpc, consistent with the DLA scenario proposed to explain the anomalous size of the ULAS J1120+0641 ionized region. On the other hand, with an ionization rate \\dot{N}_{γ ,0} ˜ 10^{57} s-1, the assumed DLA clustering and gas opacity, only one LOS shows an HII region compatible with the observed one. We deduce that either the ionization rate of the QSO is at least one order of magnitude lower or the ULAS J1120+0641 bright phase is shorter than 107 yrs.

  18. Wykorzystanie informacji prospektywnychw sprawozdawczości finansowej zorientowanejna wartość na przykładzie MSR 36„Utrata wartości aktywów”

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2009-12-01

    Full Text Available Autorzy artykułu wskazują na istotę i rosnące znaczenie informacji prospektywnych we współczesnych systemach sprawozdawczości finansowej opartej na MSSF. Ewolucja dokonująca się w sprawozdawczości finansowej, pod wpływem harmonizacji zasad rachunkowości wskutek ciągle zmieniających się MSSF, została przedstawiona na tle zmian dokonujących się w otoczeniu, w celach i w systemach zarządzania (orientacja strategiczna, wartość przedsiębiorstwa, jak również w systemach strategicznej rachunkowości zarządczej. Na podstawie szerokiego kontekstu analizy autorzy stawiają wniosek, że koncepcja wartości (przedsiębiorstwa stanowi istotny element systemu pomiaru i wyceny w systemie sprawozdawczości finansowej. Tworzy ona także spójną podstawę dla integracji rachunkowości zarządczej i rachunkowości finansowej w jeden system zapewniający użyteczne informacje zarówno dla użytkowników zewnętrznych, jak i wewnętrznych, których łączy wspólny cel – maksymalizacja wartości. Uwarunkowania tworzenia systemu sprawozdawczości opartego na informacjach prospektywnych, zorientowanego na wartość, jak również stopień dostosowania przedsiębiorstw do jego wdrożenia pokazano na przykładzie praktycznej realizacji postanowień MSR 36.

  19. Apomorphine and its esters

    DEFF Research Database (Denmark)

    Borkar, Nrupa; Chen, Zhizhong; Saaby, Lasse

    2016-01-01

    Oral delivery of apomorphine via prodrug principle may be a potential treatment for Parkinson's disease. The purpose of this study was to investigate the transport and stability of apomorphine and its esters across Caco-2 cell monolayer and their affinity towards chylomicrons. Apomorphine......, monolauroyl apomorphine (MLA) and dilauroyl apomorphine (DLA) were subjected to apical to basolateral (A-B) and basolateral to apical (B-A) transport across Caco-2 cell monolayer. The stability of these compounds was also assessed by incubation at intestinal pH and physiological pH with and without Caco-2...

  20. Analiza krakowskiego rynku nieruchomości na tle wybranych krajów Unii Europejskiej

    OpenAIRE

    Jasińska, Elżbieta; Preweda, Edward; Ruchel, Jan

    2005-01-01

    Wejście Polski do Unii Europejskiej wywołało ożywienie na rynku obrotu nieruchomościami. Obawy o wykupywanie tanich, polskich ziem przez obcokrajowców i podniesienie stawki VAT w budownictwie to najbardziej charakterystyczne bodźce. W przypadku Krakowa dodatkowym bodźcem stymulującym to ożywienie było ponadto wygaśnięcie dotychczas istniejącego Miejscowego Planu Zagospodarowania Przestrzennego i rozpoczęcie trzech dużych inwestycji: przebudowy ronda Mogilskiego i utworzenia torowiska dla szyb...

  1. Baza informacji na temat przemieszczeń poziomych terenu

    OpenAIRE

    Preweda, Edward

    1997-01-01

    Fragment publikacji Dla sformułowania kinematycznych modeli przemieszczeń różnych obiektów niezbędne są wyniki okresowych pomiarów geodezyjnych. W artykule zaprezentowano bazę danych umożliwiającą przechowywanie, aktualizację i łatwy dostęp do informacji potrzebnych do zdefiniowania kinematycznego modelu przemieszczeń poziomych terenu. Dzięki odpowiedniej konstrukcji bazy, aplikacja ta może być wykorzystana przez użytkowników wielu obiektów do innych praktycznych celów. For creating kin...

  2. Zaburzenia hazardowe – rozpowszechnienie, oferta terapeutyczna, dostępność leczenia i predyktory podjęcia leczenia. Przegląd literatury

    OpenAIRE

    Wieczorek, Łukasz; Dąbrowska, Katarzyna

    2015-01-01

    Celem przeglądu jest zaprezentowanie kompleksu zagadnień dotyczących leczenia zaburzeń hazardowych, w tym: definicji hazardu i narzędzi diagnostycznych, współwystępowania zaburzeń hazardowych z innymi zaburzeniami, epidemiologii zjawiska, rozpowszechnienia poszukiwania pomocy, oferty terapeutycznej dla osób z zaburzeniami hazardowymi i jej skuteczności, motywów podjęcia leczenia oraz barier w dostępie do leczenia. Materiał i metoda Do przeglądu literatury wykorzystano bazę artykułów MEDLINE o...

  3. Kto zje żabę Haberschracka? : symbolika żaby w Poliptyku Augustiańskim Mikołaja Haberschracka, XV w

    OpenAIRE

    Tytko, Marek Mariusz

    1998-01-01

    Tekst dotyczy symboliki żaby w Poliptyku Augustiańskim namalowanym przez Mikołaja Haberschracka z Nowej Wsi koło Krakowa w XV w. Obraz powstał w 1468 r. Ufundowany był przez przeora klasztoru i konwent zakonu augustianów w Krakowie. Augustianie krakowscy byli twórcami programu ideowego tego poliptyku. W tekście opisano konteksty biblijne, teologiczne i historyczne dla tego obrazu. Autor artykułu stawia hipotezę o symbolicznym znaczeniu żab w obrazie. Żaby oznaczać mogą tam (alternatywnie): 1)...

  4. Students’ health behaviors – own research = Zachowania zdrowotne studentów – badania własne

    Directory of Open Access Journals (Sweden)

    Magdalena Weber-Rajek

    2015-09-01

    Wyniki Średni wynik kwestionariusza IZZ dla całej badanej grupy wynosi 6,96 sten, co stanowi granicę między wynikami średnimi i wysokimi. Najlepsze wyniki kwestionariusza IZZ uzyskali studenci Dietetyki, najgorsze studenci Logistyki. W całej badanej grupie najlepsze wyniki uzyskano  kategorii „prawidłowe nawyki żywieniowe”, najgorsze w kategorii „praktyki zdrowotne”. Wnioski Istnieje potrzeba dalszych badań zachowań zdrowotnych młodzieży i upowszechniania programów promocji zdrowia na wszystkich etapach edukacji.   Słowa kluczowe: zachowania zdrowotne, studenci.

  5. Sprawozdanie z XII Międzynarodowej Konferencji pt. „Edukacja a nowe technologie w kulturze, informacji i komunikacji” (Toruń, 09–10.06.2015)

    OpenAIRE

    Kwiatkowska, Wioletta

    2016-01-01

    W dniach 9−10 czerwca 2015 roku odbyła się XII Międzynarodowa Konferencja Naukowa z cyklu „Technologia informacyjna w zmieniającej się edukacji”. Temat przewodni konferencji brzmiał: „Edukacja a nowe technologie w kulturze, informacji i komunikacji”. W tej edycji konferencji poruszane były zagadnienia dotyczące nowych technologii i ich znaczenie dla edukacji. Inicjatywy o takim charakterze podejmowane od kilkunastu lat przez Katedrę Dydaktyki i Mediów w Edukacji wpisały się w tradycję Wydział...

  6. "Polnische Patrioten?" Einige Anmerkungen zum frühen Polenbild in Westpreußen um 1700

    OpenAIRE

    Steffen, Frank

    2002-01-01

    Poniższa praca odnosi się głównie do tezy Huberta Orłowskiego, według której „niemiecka dyskusja o Polsce miała legitymujące, nic do pominięcia znaczenie dla wynalezienia niemieckiego narodu”. Wobec rozmiarów i rozdrobnienia społeczno-wyznaniowego Rzeszy Niemieckiej ok. 1700 r. temat ten ograniczony jest do Prus Zachodnich i głównego problemu (teoria państwowości, religia, historia) debaty o przyczynach funkcjonowania powstałego obrazu Polski. Koncentracja na Prusach Zachodnich wy...

  7. Finansowy wymiar psychoterapii a relacja terapeutyczna

    OpenAIRE

    Marchewka, Katarzyna

    2017-01-01

    Cel artykułu stanowi omówienie wybranych zagadnień odnoszących się do wpływu, jaki wywiera finansowy wymiar psychoterapii na relację psychoterapeutyczną. Na początku podejmowane są rozważania dotyczące znaczenia bezpośredniej zapłaty dokonywanej przez klienta za sesje terapeutyczne w relacji terapeutycznej. Następnie poruszona zostaje problematyka refundowania usług psychoterapeutycznych - ukazane zostaną konsekwencje kryteriów refundowania określonych metod terapeutycznych dla jakości re...

  8. Treści bibliologiczne na łamach „Łowca Polskiego” w latach 1989–2011

    Directory of Open Access Journals (Sweden)

    Danuta Wańka

    2012-01-01

    Full Text Available W artykule przedstawiono problematykę bibliologiczną w świetle 23 roczników „Łowca Polskiego” (1989–2011 ukazującego się od 1899 roku. Po krótkiej prezentacji dziejów i zawartości pisma opisano i zacytowano fragmenty tekstów o charakterze bibliologicznym. Niektóre z nich przytoczono ze szczegółami, traktując je jako materiały źródłowe, ważne dla badań nad kulturą książki.

  9. Consultoria colaborativa em terapia ocupacional para professores de crianças pré-escolares com baixa visão Collaborative consultation in occupational therapy for teachers of preschool children with low vision

    Directory of Open Access Journals (Sweden)

    Tatiana Luísa Reis Gebrael

    2011-04-01

    Full Text Available O objetivo deste estudo foi elaborar, implementar e avaliar um programa individualizado de consultoria colaborativa em Terapia Ocupacional para professores. A meta foi aumentar o repertório de estratégias e recursos dos professores para promover a independência de crianças pré-escolares com baixa visão nas atividades de vida diária de higiene e alimentação, denominado PRÓ-AVD. Participaram do estudo 10 professores e 10 alunos da Educação Infantil regular com baixa visão com idades entre 04 e 06 anos. Empregou-se um delineamento experimental com grupo controle. A elaboração do Programa envolveu o estudo prévio das habilidades da criança nas tarefas de autocuidado, e de sua capacidade visual, do repertório inicial do professor, e da dinâmica da díade Professor - Aluno durante a realização das AVDs. A partir de tais dados procedeu-se à elaboração individualizada do PRÓ-AVD. A implementação do Programa ocorreu por meio de consultoria colaborativa em seis encontros semanais. Para registro dos dados e análises, foram realizadas medidas pré-teste e pós-teste por meio de registros em diário de campo, filmagens e questionários, a fim de avaliar quantitativa e qualitativamente o efeito do programa de intervenção. Os resultados apontaram para o aumento do repertório dos professores do Grupo Experimental nas atividades de higiene e alimentação de seus alunos com baixa visão. As estratégias desenvolvidas e empregadas no PRÓ-AVD, como atividades práticas, feedbacks e a interação entre a pesquisadora e professoras foram decisivos para a adesão dos participantes e resultados obtidos na consultoria colaborativa.The purpose of this study was to develop, implement and evaluate an individualized program called PRO-DLA of collaborative consulting in Occupational Therapy for teacher training, to increase theachers repertoire of strategies and resources to promote the independence of preschool children with low vision in

  10. A preliminary study in zero anaphora coreference resolution for Polish

    Directory of Open Access Journals (Sweden)

    Adam Jan Kaczmarek

    2017-12-01

    pracy wykorzystujemy istniejące narzędzia do rozpoznawania koreferencji dla pozostałych rodzajów wzmianek (tj. nazwy własne, frazy rzeczownikowe oraz zaimki jako źródło częściowych zbiorów wzmianek odnoszących się do tego samego obiektu, a także jako punkt odniesienia dla uzyskanych przez nas wyników. Ocena skupia się nie tylko na poprawności uzyskanych zbiorów wzmianek, bez względu na ich typ, co odzwierciedlają wyniki podane dla standardowych metryk CoNLL-2012, ale także na wartości informacji, która zostaje uzyskana w wyniku rozpoznania koreferencji. W nawiązaniu do założeń anotacji korpusu KPWr, jedynie nazwy własne traktowane są jako wzmianki, które zawierają w sobie wystarczająco szczegółową informację, aby można było powiązać je z obiektami rzeczywistymi. W konsekwencji dostarczamy także ocenę opartą na wartości informacji dla podmiotów domyślnych połączonych relacją koreferencji z nazwami własnymi. Z tą samą motywacją rozpatrujemy jedynie zbiory wzmianek koreferencyjnych zbudowane wokół nazw własnych.

  11. Przyspieszona nauka konkurencji. Przewodnik dla zbłąkanych w gąszczu reformy

    Directory of Open Access Journals (Sweden)

    Piotr Szenajch

    2012-12-01

    Full Text Available Crash course on competition. A guide for the lost in the tangle of reform The key resolutions of the reform of the Polish system of science and higher education entered into force in the academic year 2011/2012. This essay contains an in-depth reading of the key governmental documents and legal acts that introduced the reform. Additionally, it comprises a description of the intensive critical discussion on the reform that, unfortunately, started only when the legislative process was nearly finished. Drawing from this debate and developing its interpretations, the essay analyses key institutional solutions of the reform; its fundamental assumptions; its rhetoric and, generally, its discursive background. Such solutions as: moving towards a more competition-based system of public funding for institutions and individuals; intensification of supervision based on quantitatively measured achievement, or enforcing a multi-level integration of public universities with the local business sector do not address the most urgent problems of the underfinanced and insecure students, PhD candidates and academics. In their naively individualistic approach, the reformers ignore the reflection on the social reproduction or the collective and structural aspects of scientific fields. Their monolithic vision of science leads them to imposing requirements developed for natural and technical disciplines upon social sciences and humanities. Finally, what they present as objective expert knowledge grounding the reform can be interpreted as based on deeply conservative economical and ethical assumptions as well as detached from a comprehensive empirical diagnosis.

  12. Analysis of Network Traffic Filtering / Analiza Filtracji Ruchu Sieciowego

    Directory of Open Access Journals (Sweden)

    Kabala Piotr

    2015-09-01

    Full Text Available Artykuł przedstawia badania koncepcji Platformy Sieciowej z zaporą Linux PLD wykorzystującą dostępne narzędzia analizy ruchu, implementację wybranego mechanizmu bezpieczeństwa oraz analizę efektywności przygotowanej Zapory Sieciowej (FW. Badania oparto na architekturze ekranowanych podsieci. Testowanie skuteczności zapory wykonano w dwóch etapach. W pierwszej części sprawdzono bezpieczeństwo poprzez testowanie odporności na próby skanowania portów i najczęstsze typy ataku. Druga część badań miała na celu pokazanie wpływu zapory na czas i opóźnienie realizacji transakcji dla ruchu HTTP w zależności od poziomu bezpieczeństwa i natężenia ruchu generowanego przez użytkowników sieci wewnętrznej. Sprawdzenie skuteczność FW zostało zweryfikowane przez badania odporności w próbie skanowania portów i ataków odmowy usługi (tj. SYN Flood i ICMP zapewniając bazę rozproszonych ataków typu DDoS. Ta część badań miała jeden cel, którym było pokazanie wpływu FW na czas i opóźnienia realizacji transakcji dla ruchu HTTP, w zależności od poziomu bezpieczeństwa i intensywności ruchu generowanego przez użytkowników sieci.

  13. Labour Taxation in Poland Compared to the Other OECD Countries

    Directory of Open Access Journals (Sweden)

    Kryńska Elżbieta

    2014-09-01

    Full Text Available Celem opracowania jest identyfikacja wysokości i zróżnicowania opodatkowania pracy, wyrażanego poprzez tzw. klin podatkowy, w Polsce na tle krajów OECD. Identyfikacji tej dokonano na podstawie analizy danych statystycznych zgromadzonych w bazie OECD obejmujących lata 2000-2012. W opracowaniu dokonano interpretacji pojęć kluczowych, takich jak opodatkowanie pracy, klin podatkowy i pozapłacowe koszty pracy. W dalszej części syntetycznie omówiono ustalenia teoretyczne i wyniki badań empirycznych dotyczących skutków opodatkowania pracy dla funkcjonowania rynku pracy, a zwłaszcza jego wpływ na zatrudnienie i bezrobocie. Badania własne objęły analizę porównawczą wielkości klina podatkowego w różnych typach gospodarstw domowych w Polsce i pozostałych krajach OECD w latach 2000-2012. Najważniejszą konstatacją wynikającą z analiz jest, iż w Polsce opodatkowanie pracy w zbyt małym stopniu uwzględnia sytuację materialną osób nisko zarabiających oraz mających nautrzymaniu dzieci. Wyniki przeprowadzonych badań stały się podstawą sformułowania wniosków syntetycznych i rekomendacji dla Polski. Zasugerowano w nich przede wszystkim, by rozważono selektywne obniżenie pozapłacowych kosztów pracy osób nisko zarabiających oraz obciążonych obowiązkami rodzinnymi.

  14. COSMOLOGICAL CONCORDANCE OR CHEMICAL COINCIDENCE? DEUTERATED MOLECULAR HYDROGEN ABUNDANCES AT HIGH REDSHIFT

    International Nuclear Information System (INIS)

    Tumlinson, J.; Malec, A. L.; Murphy, M. T.; Carswell, R. F.; Jorgenson, R. A.; Buning, R.; Ubachs, W.; Milutinovic, N.; Ellison, S. L.; Prochaska, J. X.; Wolfe, A. M.

    2010-01-01

    We report two detections of deuterated molecular hydrogen (HD) in QSO absorption-line systems at z>2. Toward J2123-0500, we find N(HD) =13.84 ± 0.2 for a sub-Damped Lyman Alpha system (DLA) with metallicity ≅0.5Z sun and N(H 2 ) = 17.64 ± 0.15 at z = 2.0594. Toward FJ0812+32, we find N(HD) =15.38 ± 0.3 for a solar-metallicity DLA with N(H 2 ) = 19.88 ± 0.2 at z = 2.6265. These systems have ratios of HD to H 2 above that observed in dense clouds within the Milky Way disk and apparently consistent with a simple conversion from the cosmological ratio of D/H. These ratios are not readily explained by any available model of HD chemistry, and there are no obvious trends with metallicity or molecular content. Taken together, these two systems and the two published z>2 HD-bearing DLAs indicate that HD is either less effectively dissociated or more efficiently produced in high-redshift interstellar gas, even at low molecular fraction and/or solar metallicity. It is puzzling that such diverse systems should show such consistent HD/H 2 ratios. Without clear knowledge of all the aspects of HD chemistry that may help determine the ratio HD/H 2 , we conclude that these systems are potentially more revealing of gas chemistry than of D/H itself and that it is premature to use such systems to constrain D/H at high redshift.

  15. Stability of Selected PAHs in Sewage Sludge/ Stabilność Wybranych Wwa W Osadach Ściekowych

    Directory of Open Access Journals (Sweden)

    Włodarczyk-Makuła Maria

    2014-09-01

    Full Text Available Celem badań była ocena trwałości WWA w warunkach składowania poprzez wyznaczenie czasu połowicznego rozpadu. Określono zmiany ilościowe WWA w osadach przechowywanych w warunkach tlenowych przez 12 tygodni. W tych samych warunkach pozostawały także osady, w których zahamowano aktywność mikroorganizmów poprzez dodatek azydku sodu. Ilościową analizę WWA prowadzono z wykorzystaniem zestawu GC-MS w odstępach 2-tygodniowych równolegle w osadach biotycznych i abiotycznych. Oznaczano pięć WWA (fluoren, fenentren, antracen, fluoranten, piren, które znajdują się wśród 16 związków podanych na liście EPA. Osady pobrano dwukrotnie z oczyszczalni ścieków komunalnych, które w praktyce kierowane są na składowisko. Zawartość początkowa WWA w osadach była na poziomie 346μg/kg.s.m. W warunkach prowadzonego eksperymentu czas połowicznego rozkładu był zróżnicowany dla poszczególnych związków. W osadach aktywnych biologicznie czas połowicznego rozpadu badanych węglowodorów był w granicach od 19 do 368 dób. Czas połowicznego rozpadu wyznaczony dla WWA w osadach nieaktywnych biologicznie pozostawał w zakresie od 31 do 2961 dób.

  16. Branched Crystalline Patterns of Poly(ε-caprolactone) and Poly(4-hydroxystyrene) Blends Thin Films.

    Science.gov (United States)

    Hou, Chunyue; Yang, Tianbo; Sun, Xiaoli; Ren, Zhongjie; Li, Huihui; Yan, Shouke

    2016-01-14

    The chain organization of poly(ε-caprolactone) (PCL) in its blend with poly(4-hydroxystyrene) (PVPh) in thin films (130 ± 10 nm) has been revealed by grazing incident infrared (GIIR) spectroscopy. It can be found that PCL chains orient preferentially in the surface-normal direction and crystallization occurs simultaneously. The morphology of the PCL/PVPh blends films can be identified by optical microscopy (OM). When crystallized at 35 °C, the blends film shows a seaweed-like structure and becomes more open with increasing PVPh content. In contrast, when crystallized at higher temperatures, i.e., 40 and 45 °C, dendrites with apparent crystallographically favored branches can be observed. This characteristic morphology indicates that the diffusion-limited aggregation (DLA) process controls the crystal growth in the blends films. The detailed lamellar structure can be revealed by the height images of atomic force microscopy (AFM), i.e., the crystalline branches are composed of overlayered flat-on lamellae. The branch width has been found to be dependent on the supercooling and PVPh content. This result differs greatly from pure PCL, in which case the crystal patterns controlled by DLA process developed in ultrathin film or monolayers of several nanometers. In the PCL/PVPh blends case, the strong intermolecular interactions and the dilution effect of PVPh should contribute to these results. That is to say, the mobility of PCL chains can be retarded and diffusion of them to the crystal growth front slows down greatly, even though the film thickness is far more than the lamellar thickness of PCL.

  17. Ocena urodynamiczna nietrzymania moczu po radykalnej prostatektomii - studium przypadku

    Directory of Open Access Journals (Sweden)

    Rafał Święcicki

    2010-06-01

    Full Text Available Nietrzymanie moczu po radykalnej prostatektomii we wczesnym okresie po zabiegu występuje u około 30% operowanych, natomiast w okresie późnym, ponad rok po zabiegu, objawy wysiłkowego nietrzymania moczu utrzymują się u około 5% badanych chorych. Obiektywnych danych na temat przyczyn i nasilenia nietrzymania moczu może dostarczyć kompleksowe badanie urodynamiczne. Zasadnicze znaczenie dla rokowania zależne jest od stopnia dysfunkcji aparatu zwieraczowego. Cel pracy: Celem pracy była ocena możliwości diagnostycznych pooperacyjnego nietrzymania moczu u chorego po prostatektomii radykalnej, na podstawie diagnostyki urodynamicznej. Materia! i metody: W pracowni urodynamicznej 10. Wojskowego Szpitala Klinicznego z Polikliniką (WSKzP wykonano kompleksowe badanie urodynamiczne u chorego skarżącego się na nietrzymanie moczu 12 miesięcy po radykalnej prostatektomii. W ramach badania wykonano przepływ cewkowy, cystometrię, badanie ciśnieniowo-przepływowe oraz profiłometrię spoczynkową. Wyniki: Maksymalne ciśnienie zamknięcia cewki moczowej było wyraźnie obniżone, do wartości 8 cm H20, c o sugerowało obecność wysiłkowego nietrzymania moczu. Stwierdzono również objawy niestabilności wypieracza oraz cechy uszkodzenia mechanizmu zwieraczowego. Wynik ten miał duże znaczenie dla dalszych możliwości leczenia chorego. Wnioski: Kompleksowe badanie urodynamiczne ma istotne znaczenie w diagnozowaniu chorych z pooperacyjnym nietrzymaniu moczu.

  18. The Application of Modern Techniques and Measurement Devices for Identification of Copper Ore Types and Their Properties / Wykorzystanie nowoczesnych technik i urządzeń pomiarowych do identyfikacji typów rud miedzi i ich właściwości

    Science.gov (United States)

    Krawczykowska, Aldona; Trybalski, Kazimierz; Krawczykowski, Damian

    2013-06-01

    minerałów miedzionośnych oraz rodzajem ich skupień i wpryśnięć. Niezwykle istotne jest właściwe rozpoznanie rudy pod względem petrograficzno-mineralogicznym. Znajomość właściwości przerabianej rudy pozwala na pełniejsze jej wykorzystanie poprzez właściwe prowadzenie i sterowanie procesami, dobór ich parametrów takich m.in. jak: czas mielenia, parametry klasyfikacji, rodzaj odczynników flotacyjnych, czas flotacji. W artykule przedstawiono wyniki przeprowadzonych analiz mikroskopowych, analizy obrazów zdjęć skaningowych oraz procedury wykorzystania otrzymanych informacji do identyfikacji typów rud (zastosowanie sieci neuronowych do rozpoznawania składów litologicznych). W badaniach wykorzystano rudę miedzi, pochodzącą z jednego z zakładów górniczych KGHM Polska Miedź S.A. Pobrane próbki rudy reprezentowały każdy z trzech typów litologicznych występujących w krajowych złożach: węglanową, łupkową oraz piaskowcową. Przeprowadzono ilościową analizę mineralogiczno-petrograficzną przy pomocy mikroskopu optycznego w świetle odbitym, a wyniki przedstawiono w tabelach 1 i 2. Wyniki te określają ilościowo stopień uwolnienia i zrosty dla jednego rodzaju minerału. Pokazano także przykładowe zdjęcia mikroskopowe zgładów poszczególnych typów litologicznych rud oraz próbek proszkowych tych typów (rys. 1 i 2). W kolejnym etapie badań wykorzystano skaningowy mikroskop elektronowy. Zdjęcia morfologii próbek uzyskane z mikroskopu elektronowego (obrazy SEM) były przedmiotem komputerowej analizy obrazu, umożliwiającej mikrostrukturalną klasyfikację ilościową typów rud. Analizowano wszystkie próbki poszczególnych typów litologicznych rudy miedzi: węglanowej, łupkowej i piaskowcowej oraz mieszanki tych typów w trzech klasach ziarnowych: 0÷45 μm, 45÷71 μm i 71÷100 μm. Celem przekształceń wykorzystanych w procedurze komputerowej analizy obrazu jest otrzymanie poprawnie posegmentowanego obrazu binarnego, kt

  19. Dlaczego Słowińcy nie chcą rozmawiać? O antropologicznym czytaniu historii

    OpenAIRE

    Filip, Mariusz

    2015-01-01

    Celem eseju jest oswojenie czytelnika ze sposobem antropologicznej/etnologicznej lektury przeszłości. Nie będzie to czynione poprzez prezentowanie czy formułowanie jakiego teoretycznego programu, lecz przez spojrzenie, jak wygląda to w praktyce. Przykładem będzie intrygująca grypa Słowińców. Pretekstem dla mojego antropologicznego czytania historii, jest postawienie na pozór banalnego, lecz świadomego i przemyślanego pytania: „Dlaczego Słowińcy nie chcą rozmawiać”? To pytanie stało się najważ...

  20. Uwarunkowania rozwoju przedsiębiorczości na przykładzie miasta Szczecin

    OpenAIRE

    Klóska, Rafał

    2005-01-01

    W artykule sprecyzowano czynniki determinujące powstawanie przedsiębiorstw w Szczecinie i scharakteryzowano wybrane działania władz lokalnych na rzecz rozwoju przedsiębiorczości w mieście. Liczba ponad 60 tys. przedsiębiorstw prowadzących działalność gospodarczą w Szczecinie wydaje się być wystarczająca dla tej aglomeracji. Dalsze zakładanie i funkcjonowanie mikro i małych przedsiębiorstw zależy nie tylko od szans i zagrożeń stwarzanych przez rynek, lecz także od pomocy i wsparcia udzielanego...

  1. Fundusze i programy Unii Europejskiej wspierające przedsiębiorstwa w perspektywie finansowej 2014-2020

    OpenAIRE

    Sikora-Gaca, Małgorzata; Piechowicz, Michał; Kleinowski, Marcin

    2016-01-01

    Zadaniem prezentowanej publikacji jest przybliżenie czytelnikom problematyki pozyskiwania oraz rozliczania przez podmioty prowadzące działalność gospodarczą w Polsce, wsparcia współfinansowanego ze środków głównie Europejskiego Funduszu Rozwoju Regionalnego w perspektywie finansowej 2014–2020. Stanowi ona selektywne wprowadzenie do wyżej wymienionej tematyki, w możliwie syntetyczny i przystępny sposób, tak aby przekazywane treści były zrozumiałe w szczególności dla osób, które dotychczas nie ...

  2. Age of consent - wiek zgody. Kryminologiczno-prawna problematyka uregulowania kryminalizacji stosunków seksualnych z dzieckiem

    OpenAIRE

    Dziewanowska, Małgorzata

    2014-01-01

    1. Wprowadzenie Praca doktorska jest pogłębioną analizą kryminologiczną stosowania w praktyce art. 200 § 1 kodeksu karnego (k.k.) dotyczącego zakazu wchodzenia w relacje seksualne z dziećmi poniżej 15 roku życia. Podstawowym celem pracy jest zweryfikowanie, czy przepis ten efektywnie służy, zgodnie z założonym jego ratio legis: ochronie obyczajności i samych dzieci przed wykorzystywaniem seksualnym przez osoby dorosłe. Ze względu na przyjęte w prawie karnym granice wieku: 15 lat dla wie...

  3. Aquaculture and Fish Welfare: Are the Rights of Fish Compromised?/ Akwakultura I Dobrostan Ryb: Czy Prawa Ryb Są Szanowane?

    OpenAIRE

    Mustapha Moshood K.

    2014-01-01

    Zagadnienie dobrostanu ryb w akwakulturze jest aktualne przez cały proces produkcyjny, a jego właściwa realizacja, z poszanowaniem praw ryb i humanitarnym ubojem, jest korzystana dla producenta i konsumenta. Poszanowanie praw ryb odnosi się do różnorodnych aspektów hodowli uwzględniając takie jak: baseny i stawy hodowlane, zagęszczenie obsady, jakość wody, pokarm i reżim żywienia, zarażenie chorobami i pasożytami, metody leczenia ryb zarażonych, manipulacja ciałem ryby, odłowy sieciowe, metod...

  4. Resilience a edukacja. Rola fenomenu skutecznej adaptacji w osiągnięciach szkolnych

    Directory of Open Access Journals (Sweden)

    Marek Smulczyk

    2016-12-01

    Full Text Available W kontekście edukacyjnym resilience jest ujmowana jako zwiększone prawdopodobieństwo sukcesu w nauce, mimo doświadczania przeciwności spowodowanych przez wrodzone cechy jednostki, warunki życiowe, czy doświadczenia. W artykule przedstawiono koncepcję resilience, uwzględniając etymologię nazwy, mechanizmy leżące u podstaw tego zjawiska, nurty badawcze oraz związki tej koncepcji z funkcjonowaniem szkolnym. Zaprezentowano argumenty, że academic resilience może być istotnym fenomenem dla wszystkich uczniów uczestniczących w procesie nauki.

  5. Morphological Diversity of the Colony Produced by Bacteria Proteus mirabilis

    Science.gov (United States)

    Nakahara, Akio; Shimada, Yuji; Wakita, Jun-ichi; Matsushita, Mitsugu; Matsuyama, Tohey

    1996-08-01

    Morphological changes of colonies have been investigatedfor a bacterial strain of Proteus mirabilis, which is a famous speciesfor producing concentric-ring-like colonies. It was found that colony patterns can be classified into three types,i.e., cyclic spreading, diffusion-limited growth (DLA-like)and three-dimensional growth (inside the agar medium) patterns. Cyclic spreading patterns can further be classifiedinto three subgroups, i.e., concentric-ring, homogeneous and spatiotemporal patterns. These subgroups were classified by examining the development of colony structure after colonies spread all over petri-dishes. Comparison of the results with thoseof another bacterial species Bacillus subtilis is also discussed.

  6. Wkład Vladislava Vančury w rozwój czeskiej kinematografii

    OpenAIRE

    WALCZAK, Małgorzata

    2011-01-01

    Autorka opisuje znaczenie Vladislav Vančura dla rozwoju kinematografii czeskiej, która została uznana przez niego za nową sztukę. Przedstawia ona wypowiedzi pisarza na temat filmu i kina zawartego w zbiorze pt. Řád nové tvorby. Autorka podkreśla nowość w podejściu do kinematografii, która opiera się głównie na artystycznym eksperymencie. Wskazuje na fakt, że w opinii pisarza, film jest utworzony przez wielu specjalistów. Vančura bowiem postulował wprowadzenie szkolnictwa filmowego, co korespo...

  7. Korzyści z podejmowania regularnej aktywności fizycznej przez osoby starsze = The benefits of regular physical activity for the elderly

    Directory of Open Access Journals (Sweden)

    U. Kaźmierczak

    2015-01-01

    3Wydział Kultury Fizycznej, Zdrowia i Turystyki, Uniwersytet Kazimierza Wielkiego w Bydgoszczy   Słowa kluczowe: regularna aktywność fizyczna, osoby starsze.   Keywords: regular physical activity, elderly.   Abstrakt W państwach rozwiniętych i rozwijających się coraz większą grupę społeczeństw stanowią seniorzy. Świadomość problemu spowodowała podjęcie powszechnej dyskusji ekspertów i praktyków z dziedzin medycznych na temat konieczności działań niezbędnych dla zapewnienia społeczeństwom pomyślnej starości. Od dawna wskazuje się, że brak aktywności ruchowej jest dla zdrowia niebezpieczny. Starzeniu się układu sercowo-naczyniowego towarzyszy dużo niekorzystnych zmian strukturalnych, czynnościowych i biochemicznych. Za typowe dla tego okresu zmiany uważa się osłabienie możliwości relaksacji włókien mięśniowych, co może być przyczyną rozkurczowej niewydolności serca. Trening zdrowotny – jest rodzajem aktywności fizycznej wykonywanej z powodów medycznych. Celem jest uzyskanie efektów fizycznych oraz psychicznych przeciwdziałających zmniejszaniu się zdolności adaptacyjnych organizmu. Eksperci przekonują osoby starsze o korzyściach płynących z aktywnego fizycznie stylu życia. Bogate piśmiennictwo poruszające tematykę medycznych aspektów procesu starzenia, mówi o niezaprzeczalnym znaczeniu ruchu dla toczących się w ludzkim ciele procesów inwolucyjnych. Aktywność fizyczna odpowiednio dozowana jest w stanie wyraźnie zmniejszyć negatywny wpływ tych zmian i jak najdłużej pozwolić utrzymać zdrowie fizyczne, psychiczne i społeczne. Zauważono, że systematycznie dozowany wysiłek fizyczny zmniejsza ryzyko wystąpienia wielu chorób np. cukrzycy, miażdżycy, choroby niedokrwiennej serca. Liczne badania naukowe i bogate piśmiennictwo gerontologiczne przedstawiają najnowsze doniesienia specjalistów o tym, jak należy prawidłowo przygotować i prowadzić trening fizyczny z osobami starszymi

  8. 3D pore-type digital rock modeling of natural gas hydrate for permafrost and numerical simulation of electrical properties

    Science.gov (United States)

    Dong, Huaimin; Sun, Jianmeng; Lin, Zhenzhou; Fang, Hui; Li, Yafen; Cui, Likai; Yan, Weichao

    2018-02-01

    Natural gas hydrate is being considered as an alternative energy source for sustainable development and has become a focus of research throughout the world. In this paper, based on CT scanning images of hydrate reservoir rocks, combined with the microscopic distribution of hydrate, a diffusion limited aggregation (DLA) model was used to construct 3D hydrate digital rocks of different distribution types, and the finite-element method was used to simulate their electrical characteristics in order to study the influence of different hydrate distribution types, hydrate saturation and formation of water salinity on electrical properties. The results show that the hydrate digital rocks constructed using the DLA model can be used to characterize the microscopic distribution of different types of hydrates. Under the same conditions, the resistivity of the adhesive hydrate digital rock is higher than the cemented and scattered type digital rocks, and the resistivity of the scattered hydrate digital rock is the smallest among the three types. Besides, the difference in the resistivity of the different types of hydrate digital rocks increases with an increase in hydrate saturation, especially when the saturation is larger than 55%, and the rate of increase of each of the hydrate types is quite different. Similarly, the resistivity of the three hydrate types decreases with an increase in the formation of water salinity. The single distribution hydrate digital rock constructed, combined with the law of microscopic distribution and influence of saturation on the electrical properties, can effectively improve the accuracy of logging identification of hydrate reservoirs and is of great significance for the estimation of hydrate reserves.

  9. Preliminary Porcine in vivo Evaluation of a Telerobotic System for Transurethral Bladder Tumor Resection & Surveillance.

    Science.gov (United States)

    Sarli, Nima; Del Giudice, Giuseppe; De, Smita; Dietrich, Mary S; Herrell, S Duke; Simaan, Nabil

    2018-03-27

    Transurethral Resection of Bladder Tumors (TURBT) can be a challenging procedure, primarily due to limitations in tool-tip dexterity, visualization and lack of tissue depth information. A transurethral robotic system was developed to revolutionize TURBT by addressing some of these limitations. The results of three pilot in-vivo porcine studies using the novel robotic system are presented and potential improvements are proposed based on experimental observations. A transvesical endoscope with a mounted optically-tracked camera was placed through the bladder of the swine under general anesthesia. Simulated bladder lesions were created by injecting HistoGel processing gel mixed with blue dye trans-abdominally into various locations in the bladder wall under endoscopic visualization. A seven-degree-of-freedom (DoF) robot was then used for transurethral resection/ablation of these simulated tumors. An independent two-DoF distal laser arm (DLA) was deployed through the robot for laser ablation and was assisted by a manually controlled gripper for en-bloc resection attempts. Lesions were successfully created and ablated using our novel endoscopic robot in the swine bladder. Full accessibility of the bladder, including the bladder neck and dome, was demonstrated without requiring bladder deflation or pubic compression. Simulated lesions were successfully ablated using the Holmium laser. En-bloc resection was demonstrated using the DLA and a manual grasper. Feasibility of robot-assisted en-bloc resection was demonstrated. Main challenges were lack of depth perception and visual occlusion induced by the transvesical endoscope presented challenges. Recommendations are given to enhance robot-assisted TURBT. Lessons learned through these pilot swine studies verify the feasibility of robot-assisted TURBT while informing designers about critical aspects needed for future successful clinical deployment.

  10. Systematic approach in optimizing numerical memory-bound kernels on GPU

    KAUST Repository

    Abdelfattah, Ahmad

    2013-01-01

    The use of GPUs has been very beneficial in accelerating dense linear algebra computational kernels (DLA). Many high performance numerical libraries like CUBLAS, MAGMA, and CULA provide BLAS and LAPACK implementations on GPUs as well as hybrid computations involving both, CPUs and GPUs. GPUs usually score better performance than CPUs for compute-bound operations, especially those characterized by a regular data access pattern. This paper highlights a systematic approach for efficiently implementing memory-bound DLA kernels on GPUs, by taking advantage of the underlying device\\'s architecture (e.g., high throughput). This methodology proved to outperform existing state-of-the-art GPU implementations for the symmetric matrix-vector multiplication (SYMV), characterized by an irregular data access pattern, in a recent work (Abdelfattah et. al, VECPAR 2012). We propose to extend this methodology to the general matrix-vector multiplication (GEMV) kernel. The performance results show that our GEMV implementation achieves better performance for relatively small to medium matrix sizes, making it very influential in calculating the Hessenberg and bidiagonal reductions of general matrices (radar applications), which are the first step toward computing eigenvalues and singular values, respectively. Considering small and medium size matrices (≤4500), our GEMV kernel achieves an average 60% improvement in single precision (SP) and an average 25% in double precision (DP) over existing open-source and commercial software solutions. These results improve reduction algorithms for both small and large matrices. The improved GEMV performances engender an averge 30% (SP) and 15% (DP) in Hessenberg reduction and up to 25% (SP) and 14% (DP) improvement for the bidiagonal reduction over the implementation provided by CUBLAS 5.0. © 2013 Springer-Verlag.

  11. Przestrzenne nierówności oferty edukacyjnej w zdecentralizowanym systemie oświaty. Przypadek Polski

    Directory of Open Access Journals (Sweden)

    Mikołaj Herbst

    2014-03-01

    Full Text Available Decentralizacja edukacji, podobnie jak decentralizacja wszelkich usług publicznych, wiąże się z ryzykiem zwiększenia nierówności między jednostkami samorządu terytorialnego w zakresie ponoszonych nakładów i jakości usług. W większości państw próbuje się temu zaradzić poprzez ustanowienie krajowych standardów usług edukacyjnych oraz redystrybucję środków finansowych, która pozwala zneutralizować wpływ terytorialnych zróżnicowań bazy podatkowej. Niniejsze opracowanie poświęcone będzie analizie skutecznościowych działań w przypadku Polski. W pierwszej części, na podstawie danych panelowych na poziomie gmin, pokazujemy, że mimo różnych instrumentów wyrównawczych stosowanych przez rząd centralny, lokalna baza podatkowa w znaczącym stopniu wpływa na wysokość nakładów przeznaczanych na edukację gimnazjalną. W części drugiej porównujemy liczbę i charakter przedmiotowy godzin lekcyjnych w gimnazjach położonych w najbiedniejszych i najbogatszych gminach. Wedle naszych ustaleń czas nauczania dla uczniów z najbiedniejszych i najbogatszych środowisk nie jest istotnie różny. Nie występują także znaczące różnice wysokości wynagrodzeń nauczycieli. Biedne i bogate gminy różnią się natomiast zakresem indywidualnego wsparcia dla uczniów.

  12. Properties of Waste from Coal Gasification in Entrained Flow Reactors in the Aspect of Their Use in Mining Technology / Właściwości odpadów ze zgazowania węgla w reaktorach dyspersyjnych w aspekcie ich wykorzystania w technologiach górniczych

    Science.gov (United States)

    Pomykała, Radosław

    2013-06-01

    przedstawiono analizę możliwości wykorzystania ubocznych produktów zgazowania, jako materiałów do podsadzki hydrauliczne (wg normy PN-93/G-11010), podsadzki zestalanej oraz mieszaniny do doszczelniania zrobów (wg normy PN-G-11011:1998) - technologii stosowanych w polskim górnictwie węgla kamiennego. Podstawowe badania ubocznych produktów zgazowania obejmowały takie właściwości jak gęstość, wilgotność, skład ziarnowy, wymywalność zanieczyszczeń chemicznych oraz zawartość radionuklidów. Wybrane właściwości fizyczne ubocznych produktów zgazowania oraz ich oznaczenie zestawiono w tabeli 1. Składy ziarnowe żużli ze zgazowania, analizowanych pod kątem zastosowania w podsadzce hydraulicznej przedstawiono na rys. 1, a materiałów dla technologii zawiesinowej, czyli popiołu lotnego A2 oraz zmielonych żużli oznaczonych, jako S1m, S2m oraz S3m - na rys. 2. Żużle ze zgazowania zawierają nie więcej niż 6% ziaren mniejszych niż 0,1 mm, co odpowiada wymaganiom dla materiałów podsadzkowych I klasy. Analiza wymywalności zanieczyszczeń chemicznych wykazała przekroczenia wymagań jednej lub obu przywołanych norm w zakresie pH i/lub niklu dla próbek żużli S1 i S2 oraz popiołu A2 (tab. 2). Zwraca uwagę bardzo niska wartość pH oraz bardzo wysoka zawartość niklu dla żużla S1. Jest to rzecz nietypowa dla krajowych odpadów energetycznych powstających ze spalania węgla kamiennego. W zakresie zawartości radionuklidów wszystkie materiały spełniają nie tylko wymagania norm podsadzkowych, ale również wymagania stawiane materiałom budowlanym (tab. 3). Ściśliwość żużli ze zgazowania kształtuje się na poziomie 11÷14%, co pozwala zakwalifikować je do materiałów podsadzkowych III klasy. Aby uzyskać materiał wyższej klasy, konieczne jest zmieszanie żużli z piaskiem podsadzkowych. W zakresie wodoprzepuszczalności wszystkie żużle kwalifikują się, jako materiał podsadzkowy klasy I (rys. 5, tab. 4). W normie PN-G-11011

  13. Biblioteczne warsztaty nauki języka włoskiego dla dzieci - nauka poprzez zabawę

    Directory of Open Access Journals (Sweden)

    Koman Aleksandra

    2016-12-01

    Full Text Available During the Week of Italian Culture organised by the Pedagogical University of Cracow a library workshop of teaching the Italian language to preschool children was arranged. The program was based on Bobles, activating the linguistic memory through physical activation, and included three games which were supposed to help the children to memorise, in an accessible way, the names of colours, animals, and some basic expressions in Italian. Moreover, the children also participated in the artistic part of the workshop and the revision part. Events like these are not only an unconventional attempt at teaching a foreign language to children, but also a great example of active participation of libraries in the process of education of the youngest user.

  14. WIEDZA I DEKLAROWANE POSTAWY RODZICÓW WOBEC SZCZEPIEŃ OCHRONNYCH DLA DZIECI W WARSZAWIE I TALLINIE

    Directory of Open Access Journals (Sweden)

    Małgorzata Klotško

    2015-12-01

    Tel: 22 599 21 80 Fax: 22 599 21 81     Słowa kluczowe: szczepienia ochronne, zachowania zdrowotne, Polska, Estonia. Keywords: vaccination, health behaviors, Poland, Estonia.     Streszczenie   Wprowadzenie Szczepienia, jako jedno ze szczytowych osiągnięć w medycynie stanowią istotny element realizowania polityki zdrowotnej na szczeblu krajowym I globalnym. Regularne uodparnianie dzieci oraz ludzi dorosłych poprawiło jakość i przedłużyło długość życia. Ponadto szczepienia wyeliminowały ospę prawdziwą oraz przyczyniły się do ograniczenia występowania niektórych chorób takich jak polio, świnki czy tężca. Szczepienia zaliczane są do profilaktyki swoistej pierwszego rzędu, która ma za zadanie wpływać na jeden z trzech elementów łańcucha epidemicznego - na wrażliwą populację. Materiał i metody Materiał stanowiło 231 osób rodziców dzieci objętych obowiązkowymi szczepieniami ochronnymi w Warszawie i Tallinie. Wśród ankietowanych znalazły się 173 oraz 58 mężczyzn.. Badanie było przeprowadzone przy użyciu komputera CAWI (ang. Computer-Assisted Web Interview oraz  metodą papierową PAPI (ang. Paper nad Pencil Interview. Do obliczeń korelacji zastosowano test Chi, zaś za poziom istotności przyjęto wartość 0,05. Wyniki Po zastosowaniu metody top2boxes wynika, że w Estonii 30% wierzy w bezpieczeństwo szczepionek, natomiast 70% nie. W Polsce wynik ten kształtuje się odpowiednio na poziomie 38% i 62%. Po zastosowaniu metody top2boxes wynika, że w Estonii 48% badanych widzi w pormowaniu szczepień interes producentów, natomiast 52% nie zgadza się z tym.  Natomiast w Polsce na korzyści koncernów wskazuje 59% i 41 % zaprzecza tej teorii. Po zastosowaniu metody top2boxes okazuje się, że w Estonii 84% badanych popiera dobrowolność szczepień, natomiast 15% jest przeciwnych.  Natomiast w Polsce jest 65% zwolenników dobrowolności szczepień i 35 % jej przeciwników. Wnioski Rodzice w Estonii i Polsce są świadomi zalet wypływających ze szczepienia dzieci.  Może świadczyć o tym udzielenie  przez większość ankietowanych pozytywnych odpowiedzi na pytanie 1,2 i 3. Niestety większość z nich nie posiada wiedzy na temat największego osiągnięcia szczepień jakim jest eradykacja ospy prawdziwej w 1980 roku. Może to świadczyć o braku informacji na ten temat ze strony instytucji  zajmujących się ochroną zdrowia jak i samego personelu medycznego, szczególnie lekarzy rodzinnych. Rodzice dzieci w Polsce i Estonii nie są wystarczająco informowani na temat wpływu szczepień na zdrowie dziecka. Świadczy o tym zaznaczenie przez większość respondentów pozytywnych odpowiedzi na pytanie 4, 5, i 6. W celu poprawy tej sytuacji należy edukować społeczeństwo poprzez rzetelne kampanie społeczne. Bardzo dużą role powinien odgrywać tutaj personel medyczny, a szczególnie położne, lekarze rodzinni i pediatrzy.     Abstract   Introduction. Vaccination as one of the top achievements in medicine is an important part of implementing health policy at the national and global levels. Regular immunization of children and adults improved quality of life and extended its expectancy. In addition, inoculation eliminated smallpox and have contributed to reducing the incidence of certain diseases such as polio, mumps and tetanus. Vaccination is classified as specific first order prevention which affects one of the three components of an epidemic chain - the sensitive population. Material and methods The material consisted of 231 persons (parents of children covered by the mandatory vaccinations in Warsaw and in Tallinn (Estonia. Among those surveyed were 173 and 58 men. The study was conducted using a computer CAWI (Computer-Assisted Web Interview approach and paper PAPI (Paper on Pencil Interview one. For the calculation of correlation a Chi test was used, and a level of significance was set at 0.05. Results After applying the top2boxes method following results appeared. In Tallinn 30% of respondents believe in the safety of vaccines, while 70% do not. In Warsaw, these results are respectively 38% and 62%. When it comes to promoting of vaccination  there are 48% of respondents in Estonia who see the interest of vaccine producers in its promoting, while 52% of them disagree with that. Whereas in Poland 59% of them are for the benefit of corporations and 41% deny this theory. Differences are seen in regard of the voluntary vaccination. It appears that in Estonia there are 84% of respondents who support its voluntariness, while 15% are opposed. In Poland it is 65% as proponents of vaccination  voluntariness and 35% as opponents of it. Conclusions Parents in Estonia and Poland are aware of the advantages arising from the vaccination of children. It may indicates from positive responses to the initial three questions of the majority of respondents. Unfortunately most of them do not have knowledge about the greatest achievement of vaccination which is the eradication of smallpox in 1980. This may indicate a lack of information from the institutions dealing with the health care and the medical staff, especially family doctors. Parents of children in both countries are not sufficiently informed about the impact of vaccination on the health of the child. Evidence of this is selection of positive answers to following three questions by the majority of respondents. In order to improve this situation should educate the public should be educated by reliable social campaigns. A very big role here should be played by medical personnel, particularly midwives, family doctors and pediatricians.

  15. Nagły zgon z powodu hipertermii złośliwej podczas znieczulenia ogólnego

    Directory of Open Access Journals (Sweden)

    Katarzyna Wochna

    2014-10-01

    Full Text Available W prezentowanej pracy autorzy przedstawiają przypadek hipertermii złośliwej. Omawiana jest sprawa zgonu 4-letniego chłopca, który pod opieką rodziców zgłosił się na leczenie stomatologiczne w znieczuleniu ogólnym. Początkowo zabieg przebiegał prawidłowo, jednakże nieoczekiwanie wystąpiły powikłania w postaci zaburzeń rytmu serca, wzrostu temperatury ciała i sztywności mięśni, charakterystyczne dla hipertermii złośliwej. Pomimo przeprowadzonej akcji resuscytacyjnej i pomocy zespołu pogotowia ratunkowego, pacjent zmarł.

  16. Zarządzanie zasobami wodnymi w kulturze Majów

    OpenAIRE

    Gilewski, Michał

    2011-01-01

    in lieu of an abstract here is a brief excerpt: "Starożytni Majowie zamieszkiwali obszary o trudnych warunkach hydrologicznych, na któ-rych opady były sezonowe i nieprzewidywalne oraz brakowało stałych źródeł wody. Stąd też istotne dla tej kultury było zarządzanie zasobami wodnymi. Przy próbie rekonstrukcji świata Majów nale-ży uwzględnić fakt, że krajobraz, który ich otaczał ulegał licznym zmianom na skutek podejmowa-nych działań w celu pozyskania i kontroli zasobów wodnych[...]" Micha...

  17. The school as an arena of political contestation: education policy from a post-Marxist perspective

    Directory of Open Access Journals (Sweden)

    Adam Wright

    2013-01-01

    Full Text Available Marksizm był i wciąż zdaje się być dominującą perspektywą teoretyczną w obrębie krytycznej analizy polityki edukacyjnej. Autor opisuje zróżnicowane „obrazy” szkoły obecne w teorii marksistowskiej, a krytykowane za determinizm ekonomiczny i redukcjonizm klasowy. Odwołując się do prac Ernesto Laclaua, prezentuje alternatywne dla marksizmu ramy teoretyczne, które można wykorzystać w krytycznych badaniach produkcji i implementacji polityki edukacyjnej. Z tej perspektywy, szkoła oraz polityka edukacyjna postrzegane są jako przestrzenie politycznej kontestacji i walki o hegemonię.

  18. Endokrynny wpływ tkanki tłuszczowej na stan skóry

    OpenAIRE

    Jaśkiewicz, Jerzy; Goździalska, Anna; Lizak, Dorota

    2012-01-01

    Praca recenzowana / peer-reviewed paper Komórki tkanki tłuszczowej, adipocyty, różnicują się w okresie życia płodowego z pierwotnych fi broblastów. W adipocytach gromadzone są substraty energetyczne w postaci zestryfi - kowanych kwasów tłuszczowych. W komórkach tych zachodzą aktywne procesy syntezy kwasów tłuszczowych, a także reakcji elongacji i desaturacji lipidów. Dla stabilności energetycznej ustroju znaczący wpływ ma korelacja osi insulina–glukagon z aktywnością takich enzymów, jak...

  19. Wolontariat - działania na rzecz jednostki i społeczeństwa

    OpenAIRE

    Roguska, Agnieszka

    2010-01-01

    Wolontariat jest okazaniem realnej chęci pomocy innemu człowiekowi, ponieważ wolontariuszem może zostać każdy i realizować się w obszarze dla siebie najbardziej adekwatnym, uwzględniając np. wiek, doświadczenie, wykonywany zawód, ilość wolnego czasu, itd. Siły ludzkie (fizyczne i psychiczne) można rozpatrywać jako swego rodzaju potencjał, nośnik wartości etycznych i edukacyjnych. To odkrywanie a także umacnianie możliwości oraz zdolności jednostkowych i zbiorowych. Wolontariat jest działan...

  20. Zasady ujawniania aktywów biologicznychw sprawozdaniach finansowych jednostek rolniczychwedług Międzynarodowych StandardówSprawozdawczości Finansowej

    Directory of Open Access Journals (Sweden)

    Teresa Kiziukiewicz

    2009-03-01

    Full Text Available Charakterystycznym dla przedsiębiorstw rolniczych składnikiem aktywów są aktywa biologiczne. Wyróżnia je fakt podlegania przemianie biologicznej, wskutek której przekształcają się one w produkty rolnicze lub inne aktywa biologiczne. W związku z tą specyfiką powstaje problem odpowiedniej prezentacji informacji o nich. W artykule są przedstawione zasady i zakres ujawnień o aktywach biologicznych w sprawozdaniu finansowym i dołączanych do niego raportach szczegółowych, ze szczególnym uwzględnieniem problemów wyceny według wartości godziwej.

  1. Obcy gatunkowo pyłek i czynnik chemiczny w indukcji rozwoju zarodków haploidalnych u Lactuca sativa L.

    OpenAIRE

    Piosik, Łukasz

    2014-01-01

    Wydział Biologii Sałata siewna (Lactuca sativa) jest popularną oraz cenną z ekonomicznego punktu widzenia rośliną warzywną. Głównym celem tej pracy było opracowanie efektywnej metody haploidyzacji Lactuca sativa, która byłaby użyteczna dla hodowców sałaty siewnej. Krzyżowanie oddalone oraz chemiczną indukcję prowadzono w warunkach in vivo oraz in vitro. Pyłek wszystkich gatunków należących do Asteraceae, kiełkował na znamionach sałaty już 1h po zapyleniu. Rozwój haploidalnych prazarodk...

  2. Modified Stability Charts for Rock Slopes Based on the Hoek-Brown Failure Criterion / Zmodyfikowane Diagramy Stabilności Skalistych Zboczy Otrzymane W Oparciu O Warunek Wytrzymałości Hoeka-Browna

    Science.gov (United States)

    Nekouei, Mahdi; Ahangari, Kaveh

    2013-09-01

    ące na metodzie równowagi granicznej i wykorzystujące oprogramowanie Slide. Dla każdego kąta nachylenia zbocza, wybierana jest metoda najskuteczniejsza, czyli taka która zapewnia wysoki współczynnik korelacji. Następnie sporządzane są wykresy końcowe, zgodnie w wybraną metodą i z wykorzystaniem odpowiednich równań. Spośród 40 równań, 25 z nich (czyli 62.5%) odnosi się do metod numerycznych (oprogramowanie Phase2), sześć równań (15%) należy do metody równowagi granicznej Felleniusa, kolejne sześć równań (15%) ma odniesienie do metody równowagi granicznej Bishopa, zaś trzy równania (7.5%) należą do metody równowagi granicznej Janbu. W celu walidacji nowych diagramów, przeprowadzono analizę stabilności zboczy na kilku wybranych odcinkach kopalni odkrywkowej rud żelaza w Chadormalu, Iran. Następnie porównano otrzymane procentowe wskaźniki niedokładności nowych diagramów uzyskanych za pomocą metody równowagi granicznej i przy wykorzystaniu oprogramowania Slide oraz w metodzie Bishopa obliczone dla zboczy kopalni rud żelaza Chadormalu. Diagramy uzyskane na podstawie warunku stabilności Hoeka-Browna dla zboczy w kopalni dają wskaźnik błędu na poziomie ±4%. Oznacza to, że diagramy takie są odpowiednimi narzędziami a współczynniki bezpieczeństwa dla zboczy skalnych wyliczone na ich podstawie uznać można za optymalne.

  3. “An isolated case”: the Slovene Carinthians and the 1920 plebiscite

    Directory of Open Access Journals (Sweden)

    Maria Isabella Reinhard

    2016-08-01

    Wilsonowskiego samostanowienia, skupiając uwagę na przypadku Słoweńców karynckich i korzystnym dla Austrii rezultacie plebiscytu z 1920 roku. Wyniki plebiscytu pokazują, że podejmując decyzję o swej przynależności państwowej, mniejszości kierują się nie tylko względami etniczno-językowymi. Dla Słoweńców karynckich, którzy zdecydowali się na pozostanie z Austrią, oprócz innych czynników kluczowe znaczenie miały motywy o charakterze ekonomicznym i politycznym. Autorka dowodzi, że wielowiekowa akulturacja Słoweńców karynckich w monarchii austro-węgierskiej spowodowała, iż bliższa była im Austria niż Królestwo Serbów, Chorwatów i Słoweńców. Taki wynik plebiscytu spowodowany był także sformułowaniem pytań: pytano o preferowaną państwowość, a nie o tożsamość etniczno-językową. Ponadto, kluczową rolę dla wyniku głosowania odegrał przykry przebieg okupacji części Karyntii przez wojska Królestwa SHS oraz większa skuteczność propagandy austriackiej. Wreszcie, fakt, że większość Słoweńców karynckich stanowili rolnicy, którzy chcieli nadal korzystać z dawnych możliwości, jakie dla tego zawodu stwarzała Austria, wpłynął na to, że głosowali oni za pozostaniem w tym kraju. Plebiscyt karyncki 1920 roku stanowi zatem przekonywające świadectwo niecelności założenia, że same tylko więzi etniczno-językowe mogą stanowić fundament kształtowania państwa, a ponadto dowodzi, że równie ważną rolę odgrywają w tym także inne czynniki.

  4. Geotechnical Risk Classification for Underground Mines / Klasyfikacja Poziomu Zagrożenia Geotechnicznego W Kopalniach Podziemnych

    Science.gov (United States)

    Mishra, Ritesh Kumar; Rinne, Mikael

    2015-03-01

    Underground mining activities are prone to major hazards largely owing to geotechnical reasons. Mining combined with the confined working space and uncertain geotechnical data leads to hazards having the potential of catastrophic consequences. These incidents have the potential of causing multiple fatalities and large financial damages. Use of formal risk assessment in the past has demonstrated an important role in the prediction and prevention of accidents in risk prone industries such as petroleum, nuclear and aviation. This paper proposes a classification system for underground mining operations based on their geotechnical risk levels. The classification is done based on the type of mining method employed and the rock mass in which it is carried out. Mining methods have been classified in groups which offer similar geotechnical risk. The rock mass classification has been proposed based on bulk rock mass properties which are collected as part of the routine mine planning. This classification has been subdivided for various stages of mine planning to suit the extent of available data. Alpha-numeric coding has been proposed to identify a mining operation based on the competency of rock and risk of geotechnical failures. This alpha numeric coding has been further extended to identify mining activity under `Geotechnical Hazard Potential (GHP)'. GHP has been proposed to be used as a preliminary tool of risk assessment and risk ranking for a mining activity. The aim of such classification is to be used as a guideline for the justification of a formal geotechnical risk assessment. Górnictwo podziemne pociąga za sobą różnorakie zagrożenia spowodowane przez uwarunkowania geotechniczne. Urabianie złoża w połączeniu z pracą w zamkniętej przestrzeni oraz z niepewnymi danymi geotechnicznymi powodować może zagrożenia, które w konsekwencji prowadzić mogą do wypadków, a te potencjalnie powodować mogą skutki śmiertelne dla osób oraz poważne straty

  5. Free Surface of the Liquid-Gas Phase Separation as a Measuring Membrane of a Device for Measuring Small Hydrostatic Pressure Difference Values / Powierzchnia Swobodna Rozdziału Faz Ciecz-Gaz Jako Membrana Pomiarowa Urządzenia Do Pomiaru Małych Wartości Różnicy Ciśnienia Hydrostatycznego

    Science.gov (United States)

    Filipek, Wiktor; Broda, Krzysztof; Branny, Marian

    2015-03-01

    to the broader considerations related to uncertainty of the proposed method's measurements, due to the authors' awareness that this is the first prototype of such a device and, on the basis of this experience, another one will be built and tested. The observations and numerical analysis of the image formed on the screen by the passage of a laser beam through the free surface of the liquid-gas separation show that at low values of pressure difference, the bubble acts as a membrane shifting in the direction of lower pressure, in such way that the displacement is proportional to the pressure difference at both ends of the bubble. The proprietary method of numerical data processing presented in this article, based on analysis of the intensity of color change in a frame moving along a selected line outside of visual changes in the image of the laser beam after passing through the test structure, provided a tool to create first mathematical models to describe the observed changes (2),(3). Presented in this article method of measuring the difference between the free surface levels in two containers, and hence the measurement of hydrostatic pressure difference provides a new tool for laboratory measurements in the fields of science, which were previously unattainable. Do poprawnego opisu przepływu płynu przez ośrodek porowaty niezbędna jest znajomość rozkładu ciśnienia. O ile dla dużych liczb Reynoldsa (przepływy turbulentne) pomiar ciśnienia dostępnymi na rynku przyrządami nie stanowi większego problemu, to dla przepływów laminarnych cieczy (tj. dla liczb Re (Bear, 1988; Duckworth, 1983; Troskolański, 1957) z zakresu 0.01 do 3) nie ma na rynku przyrządów o wystarczającej dokładności. Przyczyny powodujące taką sytuację zostały omówione w poprzednich opracowaniach (Broda i Filipek, 2012, 2013), Dlatego większość prac dotyczących tego zagadnienia dotyczy badań rozkładu prędkości medium filtrującego przez badany ośrodek (Bear, 1988) lub rozk

  6. Comments on "Determination and Analysis of the Theoretical Production of a Bucket Wheel Excavator" / Uwagi I Komentarze Do Pracy: "Określanie I Analiza Teoretycznej Wydajności Pracy Koparki Wielonaczyniowej Kołowej"

    Science.gov (United States)

    Bošnjak, Srđan M.

    2015-03-01

    żne przeoczenie. Che i Chen (2014) kwestionują prawidłowość równania (6), lecz przedstawione w niniejszej pracy analizy i uwagi prowadzą do następujących wniosków: • Stwierdzenie w pracy (Che i Chen 2014) że równanie (6) nie uwzględnia wpływu tmax i h nie jest prawdziwe. Dowód: Równanie (6'). • Stwierdzenie że równanie (6) nie uwzględnia wpływu R_s^' - "...czyli obrotowego promienia działania..." (Che i Chen 2014) jest prawdziwe, w przeciwnym razie równanie (6) byłoby nieprawdziwe. Równanie (6) uwzględnia odpowiedni promień zdefiniowany w równaniu (i), które jest prawdziwe. Dowód: Równanie (6'). W rozdziale 2 pracy (Che i Chen 2014) zatytułowanym: "Analiza teoretycznej wydajności koparki kołowej wielonaczyniowej" kierując się błędnymi wnioskami odnośnie niedokładności równania (6) autorzy podjęli próbę skorygowania powyższej niedokładności, by w ten sposób poprawić istniejącą teorię, W trakcie realizacji koncepcji wykorzystania równania (11) do zdefiniowania zasad rządzących zmianą prędkości kątowej wysięgnika Che i Chen (2014) popełnili błąd. Przyjęli oni mianowicie, że wyrażenie (14), otrzymane dla górnego przekroju wykopu e odnosić się będzie także do wszystkich przekrojów, dla całej wysokości wrębu. Pominęli w ten sposób fakt iż prędkość w ruchu łukowym wysięgnika nie jest wielkością stałą, patrz: równania (f) i (f'), i przyjęli jej wartość maksymalną, równanie (f'). Dlatego też równania (15), (16), (18) i (19) nie są prawidłowe. Wszystkie wejściowe dane obliczeniowe a także sposób ich zapisu (Tabela 1) zostały zaczerpnięte z pracy (Che i Chen 2014). Ponadto, zaprezentowane dane o pracy koparki wielonaczyniowej SchRs wykorzystywanej w kopalni "Zukunft" w Reńskim Zagłębiu Węglowym, zaczerpnięto z pracy (Durst i Vogt 1988). Osiągnięcia badań teoretycznych Che i Chen (2014, strona 289) przedstawione dla konkretnej koparki wielonaczyniowej kołowej eksploatowanej w

  7. Impact of meteorological conditions on stability of selected slopes in the Wiśnicz Foothills

    Directory of Open Access Journals (Sweden)

    Demczuk Piotr

    2014-12-01

    Full Text Available Wpływ warunków meteorologicznych na kształtowanie się warunków stateczności wybranych zboczy Pogórza Wiśnickiego. Jednym z najważniejszych procesów wpływających na kształtowanie stoków górskich zbudowanych z fl iszu karpackiego są ruchy masowe. Tylko na nielicznych obiektach prowadzono kompleksowe, pogłębione badania mechanizmów inicjacji ruchów osuwiskowych. Badania takowe są czasochłonne, a zadowalające i wiarygodne wyniki osiąga się po co najmniej kilkuletnim okresie pomiarów i analiz. Większość programów badań ogranicza się do krótkich, jednorazowych obserwacji i pomiarów powierzchniowych. Uwaga uczestników tych projektów skupia się na dużych osuwiskach strukturalnych obejmujących swoim zasięgiem głęboko zalegające skały trzeciorzędowe, pomijając płytkie osuwiska zachodzące na granicy zwietrzeliny i skał litych oraz w zasięgu samej zwietrzeliny. Celem pracy było określenie przebiegu zmian warunków stateczności wybranych zboczy związanych ze warunkami meteorologicznych występujących w latach 2008-2013 na obszarze Pogórza Wiśnickiego. Dla potrzeb pracy wykorzystano dane meteorologiczne, tj. temperatura powietrza, wilgotność gleby, prędkość wiatru, sumy opadów i liczba dni z deszczem, pochodzące ze Stacji Naukowej IGiGP UJ w Łazach koło Bochni (Pogórze Wiśnickie. Przeprowadzono terenowe i laboratoryjne badania parametrów geotechnicznych gruntów stanowiących pokrywy stokowe wybranych zboczy osuwiskowych we wsiach Królówka i Łychówo. Wcześniej wspomiane dane meteorologiczne, a także dane dotyczące temperatury, wilgotności względnej powietrza wykorzystano w dalszej części pracy do określenia zmian stanu naprężeń dla dwóch zboczy osuwiskowych. W tym celu zastosowano moduły Slope/W, Vados/W oraz Seep/W stanowiące część pakietu GeoSlope. Wyniki analiz potwierdziły, że stabilność zbocza jest silnie związana z opadami atmosferycznymi, ale wykazały r

  8. Kin term patterns and language familie

    Directory of Open Access Journals (Sweden)

    Vladimir Borissov Pericliev

    2017-12-01

    Full Text Available Kin term patterns and language familie The anthropologist G. P. Murdock has found a strong correlation between the kin term patterns (or feature-values for the relative (feature “sibling” and language families. This important finding for language classification, however, has not been pursued further. In particular, it has not yet been tested whether the kin term patterns domain as a whole, including the patterns for other features (“grandparents”, “uncles”, “aunts”, “nephews and nieces”, etc., is sufficient to demarcate all language families from one another. This paper presents a large-scale computational profiling of all language families in terms of their kin term patterns. The most significant findings are: (i that language families can be quite neatly differentiated on the basis of their kin term patterns, and therefore these patterns may be considered as strong indicators of genetic affiliation, and (ii that the kin term patterns for the features “nephews and nieces (= siblings' children”, “siblings”, and “siblings-in-law” — i.e. all features including the idea of siblings — are the best predictors of genetic affiliation, as they are significantly more frequently used in the profiles than any other feature.    Modele terminologii powinowactwa i pokrewieństwa a rodzina językowa Antropolog G. P. Murdock odkrył silny związek między modelami powinowactwa i pokrewieństwa dla krewnych (rodzeństwa a rodzinami językowymi. To ważne odkrycie w klasyfikacji języków nie było odpowiednio dalej wykorzystywane. W szczególności nie sprawdzono jeszcze, czy domena modeli powinowactwa i pokrewieństwa jako całości, w tym modele dla innych cech („dziadkowie”, „wujkowie”, „ciotki”, „siostrzeńcy i siostrzenice” itp. są wystarczająco ukształtowane we wszystkich rodzinach językowych. W niniejszym artykule przedstawiono profilowanie komputerowe na dużą skalę wszystkich rodzin j

  9. Renovation and Modernization of Residential Structures in Gliwice Based on Survey of the Environment Built from the Years 1848-2014 / Renowacja I Modernizacja Struktury Mieszkaniowej W Gliwicach Na Podstawie Badań Ankietowych Środowiska Zbudowanego Z Lat 1848-2014

    Science.gov (United States)

    Cibis, Jerzy; Serdyńska, Joanna

    2015-03-01

    The subject of the survey carried out in 2013-2014 are changes in Gliwice residential substance in relation to the two fundamental issues:how proceeded transformation of the existing housing stock, which changes has it undergone during operation. The range of changes within the housing illustrates all the positive and negative solutions characteristic for each of the periods. In the selection of research technique decision was made to form the survey. The quantitative data collected during the survey are the basis for building applications and also from grouped and developed characteristics for the surveyed collections. The test results help to identify regularities concerning the scope of the changes made in each period and - indirectly - give evidence to evaluate the built environment in terms of meeting the expectations and needs of the residents. Analysis of the assumptions also draws attention to the life cycles of the apartment, as the original part undergoing transformation during the adaptation, modernization and reconstruction of housing environment to changing needs during operational requirements. The scope of the changes introduced by them within the housing allows to evaluate the accuracy of functional and spatial, technical and technological solutions characteristic of the period in which they developed. Przedmiotem badania przeprowadzonego w latach 2013-2014 są zmiany zachodzące w substancji mieszkaniowej Gliwic w odniesieniu do dwu zasadniczych kwestii: jak przebiegała transformacja istniejących zasobów mieszkaniowych, jakim zmianom została ona poddana w czasie eksploatacji. Zakres zmian w obrębie mieszkania ilustruje wszelkie pozytywne i negatywne rozwiązania charakterystyczne dla każdego z badanych okresów. W doborze techniki badawczej zdecydowano się na formę badania ankietowego. Dane ilościowe zebrane podczas badań ankietowych są podstawą do budowania wniosków i tez z pogrupowanych i opracowanych cech charakterystycznych dla

  10. ANALIZA ZMIAN MIKROSTRUKTURY ZAPRAW W MURACH Z CEGŁY KLINKIEROWEJ PO DŁUGOTRWAŁEJ EKSPOZYCJI NA POLSKIE WARUNKI KLIMATYCZNE

    Directory of Open Access Journals (Sweden)

    Maria WESOŁOWSKA

    2016-07-01

    Full Text Available Mury licowe podlegają ciągłym wpływom czynników pochodzących z otaczającego środowiska. Oddziaływania te  przyczyniają się do destrukcji materiału, obniżając ich trwałość użytkową. Zaprawy należą do grupy materiałów aktywnych chemicznie, podlegającym korozji zewnętrznej i wewnętrznej. Do korozji zewnętrznej zalicza się wszystkie te przypadki, w których zaprawa narażona jest na niekorzystne czynniki zewnętrzne (gazowy CO2, kwaśne deszcze, zmienne temperatury przekraczające często punkt 0̊C, roztwory rozpuszczalnych soli mineralnych pochodzących z otaczających elementów. Przyczyną korozji wewnętrznej są same składniki zapraw. Wymienione czynniki istotnie wpływają na zmiany mikrostruktury zapraw. Proces ten jest rozłożony w czasie. Analizę przeprowadzono na stanowisku poligonowym zlokalizowanym na terenie Uniwersytetu Technologiczno – Przyrodniczego w Bydgoszczy. Do analizy wytypowano 3 mury licowe na różnych zaprawach. W kolejnych latach funkcjonowania murów obserwowano pojawianie się wykwitów o różnym zakresie i nasileniu. Zebrane informacje pozwoliły na ustalenie obszaru o najwyższej intensywności wykwitów. Po dziesięciu latach, dla każdego muru, z wytypowanego miejsca pobrano próbki zapraw, dla których zbadano mikrostrukturę metodą porozymetrii rtęciowej. Uzyskane wyniki posłużyły do oceny zmian udziału mezo- i makro-porów w badanych zaprawach powstałych w wyniku oddziaływania środowiska zewnętrznego.

  11. A Systematic Approach for Obtaining Performance on Matrix-Like Operations

    Science.gov (United States)

    Veras, Richard Michael

    Scientific Computation provides a critical role in the scientific process because it allows us ask complex queries and test predictions that would otherwise be unfeasible to perform experimentally. Because of its power, Scientific Computing has helped drive advances in many fields ranging from Engineering and Physics to Biology and Sociology to Economics and Drug Development and even to Machine Learning and Artificial Intelligence. Common among these domains is the desire for timely computational results, thus a considerable amount of human expert effort is spent towards obtaining performance for these scientific codes. However, this is no easy task because each of these domains present their own unique set of challenges to software developers, such as domain specific operations, structurally complex data and ever-growing datasets. Compounding these problems are the myriads of constantly changing, complex and unique hardware platforms that an expert must target. Unfortunately, an expert is typically forced to reproduce their effort across multiple problem domains and hardware platforms. In this thesis, we demonstrate the automatic generation of expert level high-performance scientific codes for Dense Linear Algebra (DLA), Structured Mesh (Stencil), Sparse Linear Algebra and Graph Analytic. In particular, this thesis seeks to address the issue of obtaining performance on many complex platforms for a certain class of matrix-like operations that span across many scientific, engineering and social fields. We do this by automating a method used for obtaining high performance in DLA and extending it to structured, sparse and scale-free domains. We argue that it is through the use of the underlying structure found in the data from these domains that enables this process. Thus, obtaining performance for most operations does not occur in isolation of the data being operated on, but instead depends significantly on the structure of the data.

  12. PI-103 and Quercetin Attenuate PI3K-AKT Signaling Pathway in T- Cell Lymphoma Exposed to Hydrogen Peroxide.

    Directory of Open Access Journals (Sweden)

    Akhilendra Kumar Maurya

    Full Text Available Phosphatidylinositol 3 kinase-protein kinase B (PI3K-AKT pathway has been considered as major drug target site due to its frequent activation in cancer. AKT regulates the activity of various targets to promote tumorigenesis and metastasis. Accumulation of reactive oxygen species (ROS has been linked to oxidative stress and regulation of signaling pathways for metabolic adaptation of tumor microenvironment. Hydrogen peroxide (H2O2 in this context is used as ROS source for oxidative stress preconditioning. Antioxidants are commonly considered to be beneficial to reduce detrimental effects of ROS and are recommended as dietary supplements. Quercetin, a ubiquitous bioactive flavonoid is a dietary component which has attracted much of interest due to its potential health-promoting effects. Present study is aimed to analyze PI3K-AKT signaling pathway in H2O2 exposed Dalton's lymphoma ascite (DLA cells. Further, regulation of PI3K-AKT pathway by quercetin as well as PI-103, an inhibitor of PI3K was analyzed. Exposure of H2O2 (1mM H2O2 for 30min to DLA cells caused ROS accumulation and resulted in increased phosphorylation of PI3K and downstream proteins PDK1 and AKT (Ser-473 and Thr-308, cell survival factors BAD and ERK1/2, as well as TNFR1. However, level of tumor suppressor PTEN was declined. Both PI-103 & quercetin suppressed the enhanced level of ROS and significantly down-regulated phosphorylation of AKT, PDK1, BAD and level of TNFR1 as well as increased the level of PTEN in H2O2 induced lymphoma cells. The overall result suggests that quercetin and PI3K inhibitor PI-103 attenuate PI3K-AKT pathway in a similar mechanism.

  13. THE MOST METAL-POOR DAMPED Lyα SYSTEMS: AN INSIGHT INTO DWARF GALAXIES AT HIGH-REDSHIFT

    International Nuclear Information System (INIS)

    Cooke, Ryan J.; Pettini, Max; Jorgenson, Regina A.

    2015-01-01

    In this paper we analyze the kinematics, chemistry, and physical properties of a sample of the most metal-poor damped Lyα systems (DLAs), to uncover their links to modern-day galaxies. We present evidence that the DLA population as a whole exhibits a ''knee'' in the relative abundances of the α-capture and Fe-peak elements when the metallicity is [Fe/H] ≅ –2.0, assuming that Zn traces the buildup of Fe-peak elements. In this respect, the chemical evolution of DLAs is clearly different from that experienced by Milky Way halo stars, but resembles that of dwarf spheroidal galaxies in the Local Group. We also find a close correspondence between the kinematics of Local Group dwarf galaxies and of high-redshift metal-poor DLAs, which further strengthens this connection. On the basis of such similarities, we propose that the most metal-poor DLAs provide us with a unique opportunity to directly study the dwarf galaxy population more than ten billion years in the past, at a time when many dwarf galaxies were forming the bulk of their stars. To this end, we have measured some of the key physical properties of the DLA gas, including their neutral gas mass, size, kinetic temperature, density, and turbulence. We find that metal-poor DLAs contain a warm neutral medium with T gas ≅ 9600 K predominantly held up by thermal pressure. Furthermore, all of the DLAs in our sample exhibit a subsonic turbulent Mach number, implying that the gas distribution is largely smooth. These results are among the first empirical descriptions of the environments where the first few generations of stars may have formed in the universe

  14. The effect of fucoidan on intestinal flora and intestinal barrier function in rats with breast cancer.

    Science.gov (United States)

    Xue, Meilan; Ji, Xinqiang; Liang, Hui; Liu, Ying; Wang, Bing; Sun, Lingling; Li, Weiwei

    2018-02-21

    Recent research studies have shown that the intestinal flora are related to the occurrence and progress of breast cancer. This study investigates the effect of fucoidan on intestinal flora and intestinal barrier function in rats with 7,12-dimethylbenz[a]anthracene (DMBA)-induced breast cancers. Sixty female Sprague-Dawley rats were randomly assigned to the control group, the model group, and the F1 and F2 groups, which were fed fucoidan at concentrations of 200 and 400 mg per kg bw (body weight), respectively. Intestinal histopathological analysis was performed and 16S rDNA high-throughput sequencing was used to provide an overview of the intestinal flora composition. The contents of d-lactic acid (d-LA), diamine oxidase (DAO) and endotoxin in plasma were detected by ELISA. Expression levels of the tight junction (TJ) proteins, phosphorylated p38 MAPK and ERK1/2 were measured using western blotting. Our results suggested that the intestinal wall of the model group was damaged. However, after fucoidan intervention, the villi were gradually restored. ELISA showed that the levels of plasma endotoxin, d-LA and DAO decreased in the F1 and F2 groups compared to those in the model group. Fucoidan treatment also increased the expressions of ZO-1, occludin, claudin-1 and claudin-8. Furthermore, the expression levels of phosphorylated p38 MAPK and ERK1/2 were upregulated in fucoidan treatment groups. The results of 16S rDNA high-throughput sequencing indicated that fucoidan increased the diversity of the intestinal microbiota and induced changes in microbial composition, with the increased Bacteroidetes/Firmicutes phylum ratio. In conclusion, the supplement of fucoidan could improve the fecal microbiota composition and repair the intestinal barrier function. The study suggested the use of fucoidan as an intestinal flora modulator for potential prevention of breast cancer.

  15. Electron acceleration by femtosecond laser interaction with micro-structured plasmas

    Science.gov (United States)

    Goers, Andy James

    Laser-driven accelerators are a promising and compact alternative to RF accelerator technology for generating relativistic electron bunches for medical, scientific, and security applications. This dissertation presents three experiments using structured plasmas designed to advance the state of the art in laser-based electron accelerators, with the goal of reducing the energy of the drive laser pulse and enabling higher repetition rate operation with current laser technology. First, electron acceleration by intense femtosecond laser pulses in He-like nitrogen plasma waveguides is demonstrated. Second, significant progress toward a proof of concept realization of quasi-phasematched direct acceleration (QPM-DLA) is presented. Finally, a laser wakefield accelerator at very high plasma density is studied, enabling relativistic electron beam generation with ˜10 mJ pulse energies. Major results from these experiments include: • Acceleration of electrons up to 120 MeV from an ionization injected wakefield accelerator driven in a 1.5 mm long He-like nitrogen plasma waveguide • Guiding of an intense, quasi-radially polarized femtosecond laser pulse in a 1 cm plasma waveguide. This pulse provides a strong drive field for the QPM-DLA concept. • Wakefield acceleration of electrons up to ˜10 MeV with sub-terawatt, ˜10 mJ pulses interacting with a thin (˜200 mum), high density (>1020 cm-3) plasma. • Observation of an intense, coherent, broadband wave breaking radiation flash from a high plasma density laser wakefield accelerator. The flash radiates > 1% of the drive laser pulse energy in a bandwidth consistent with half-cycle (˜1 fs) emission from violent unidirectional acceleration of electron bunches from rest. These results open the way to high repetition rate (>˜kHz) laser-driven generation of relativistic electron beams with existing laser technology.

  16. Flexibility in Management of Modernization in Construction - Electrical Works/ Elastyczność W Zarządzaniu Modernizacją Obiektów Budowlanych Na Przykładzie Robót Elektrycznych

    Directory of Open Access Journals (Sweden)

    Nowotarski Piotr

    2015-06-01

    Full Text Available Artykuł prezentuje możliwość zastosowania elastyczności w modernizacjach istniejących obiektów budowlanych na przykładzie instalacji oświetleniowej. Elastyczność jest rozumiana w tym przypadku jako umiejętne dostosowanie się do zmian w dynamicznie zmieniającym się środowisku. Istotą podejścia elastycznego jest podejmowanie odpowiednich decyzji w odpowiednim czasie opartych na monitoringu środowiska i procesu w toku. Prezentowane studium przypadku modernizacji instalacji elektrycznej w budownictwie wielorodzinnym w częściach wspólnych obiektu (korytarze, klatki schodowe, hala garażowa opiera się na wymianie i modernizacji tylko tych punktów, które w danym momencie ulegają awarii. Prosta analiza oby typów modernizacji opiera się na porównaniu kosztów, natomiast trzeba zaznaczyć, że możliwe są także inne kryteria (środowiskowe, konfliktu społecznego, itp., które będą przedmiotem kolejnych publikacji. Zastąpienie tradycyjnych żarówek rozwiązaniami opartymi na technologii LED z zastosowaniem czujników ruchu może prowadzić do znacznych oszczędności, ale może też oznaczać obniżenie komfortu dla użytkowników (np. dla osób starszych, którym jeden cykl działania oświetlenia nie jest wystarczający do pokonania całej drogi na korytarzu. Osiągnięcie kompromisu w tego typu konfliktach interesów może być rozwiązane za pomocą podejścia elastycznego i zwinnego.

  17. Quasar 2175 Å dust absorbers - II. Correlation analysis and relationship with other absorption line systems

    Science.gov (United States)

    Ma, Jingzhe; Ge, Jian; Prochaska, J. Xavier; Zhang, Shaohua; Ji, Tuo; Zhao, Yinan; Zhou, Hongyan; Lu, Honglin; Schneider, Donald P.

    2018-03-01

    We present the cold neutral content (H I and C I gas) of 13 quasar 2175 Å dust absorbers (2DAs) at z = 1.6-2.5 to investigate the correlation between the presence of the UV extinction bump with other physical characteristics. These 2DAs were initially selected from the Sloan Digital Sky Surveys I-III and followed up with the Keck-II telescope and the Multiple Mirror Telescope as detailed in our Paper I. We perform a correlation analysis between metallicity, redshift, depletion level, velocity width, and explore relationships between 2DAs and other absorption line systems. The 2DAs on average have higher metallicity, higher depletion levels, and larger velocity widths than Damped Lyman α absorbers (DLAs) or subDLAs. The correlation between [Zn/H] and [Fe/Zn] or [Zn/H] and logΔV90 can be used as alternative stellar mass estimators based on the well-established mass-metallicity relation. The estimated stellar masses of the 2DAs in this sample are in the range of ˜109 to ˜2 × 1011 M⊙ with a median value of ˜2 × 1010 M⊙. The relationship with other quasar absorption line systems can be described as (1) 2DAs are a subset of Mg II and Fe II absorbers, (2) 2DAs are preferentially metal-strong DLAs/subDLAs, (3) More importantly, all of the 2DAs show C I detections with logN(C I) > 14.0 cm-2, and (4) 2DAs can be used as molecular gas tracers. Their host galaxies are likely to be chemically enriched, evolved, massive (more massive than typical DLA/subDLA galaxies), and presumably star-forming galaxies.

  18. The Properties of Quasar 2175 Å Dust Absorbers at z = 1.0-2.5

    Science.gov (United States)

    Ma, Jingzhe; Ge, Jian; Prochaska, Jason; Zhao, Yinan; Zhang, Shaohua; Ji, Tuo; Lundgren, Britt; Zhou, Hongyan; Lu, Honglin; Schneider, Donald

    2018-01-01

    Quasar 2175 Å dust absorbers (2DAs) are a population of quasar absorption line systems identified by the broad absorption feature centered around rest-frame 2175 Å, which is ubiquitously seen in the Milky Way extinction curves. These absorbers are excellent tracers of gas and dust properties, metal abundances, chemical evolution, physical conditions, as well as kinematics in the absorbing galaxies. We present the metallicity, depletion pattern, kinematics, and the cold neutral content (HI and CI gas) of a sample of 2DAs at z = 1.0-2.5 that were initially selected from the Sloan Digital Sky Survey and followed up with Keck and MMT spectrographs. We perform a correlation analysis between metallicity, redshift, depletion level, velocity width, and explore relationships between 2DAs and other absorption line systems. The 2DAs on average have higher metallicity, higher depletion levels, and larger velocity widths than Damped Lyman-α absorbers (DLAs) or subDLAs. The correlation between [Zn/H] and [Fe/Zn] or [Zn/H] and logΔV90 can be used as alternative stellar mass estimators based on the well-established mass-metallicity relation. The relationship with other quasar absorption line systems can be described as (1) 2DAs are a subset of Mg II and Fe II absorbers, (2) 2DAs are preferentially metal-strong DLAs/subDLAs, (3) More importantly, all of the 2DAs show CI detections with N(CI) > 14.0 cm-2, (4) 2DAs can be used as molecular gas tracers. Their host galaxies are likely to be chemically enriched, evolved, and massive galaxies (more massive than typical DLA/subDLA galaxies). In addition, we have, for the first time, identified the host galaxy of a 2DA beyond the local Universe using HST IR direct imaging and grism spectroscopy.

  19. Composite Ag-La0.8Sr0.2MnO3-σ Cathode for Solid Oxide Fuel Cells

    Directory of Open Access Journals (Sweden)

    Mosiałek M.

    2013-12-01

    Full Text Available Na powierzchni elektrolitu stałego wytwarzano kompozytowe katody dla stałotlenkowych ogniw paliwowych zbudowane z metalicznego srebra rozproszonego w osnowie z La0.8Sr0,3MnO3-σ Osnowę o kontrolowanej porowatości otrzymywano przez prażenie mieszaniny proszku La0.8Sr0.2MnO3-σ z kulkami z tworzywa organicznego. Porowatą osnowę nasycano roztworem AgNCb i ponownie wyprażano. Tak otrzymane katody wykazywały wyższą przewodność elektryczną i niższą oporność akty- wacyjną w reakcji redukcji tlenu w porównaniu z katodami z czystej ceramiki.

  20. Aproksymacja środkowej powierzchni powłok

    OpenAIRE

    Preweda, Edward

    1997-01-01

    Konstrukcjom cienkościennym stawiany jest warunek zgodności ich powierzchni środkowej z powierzchnią określoną założeniami projektowymi. Grubość powłoki uzależniona jest od panujących w niej naprężeń i najczęściej nie jest stała dla całej powłoki. W pracy przedstawiono algorytm badania kształtu powłok uwzględniający powyższe uwarunkowania. Weryfikacja algorytmu na przykładzie hiperboloidalnych chłodni jednopowłokowych wyraźnie uwidacznia różnice pomiędzy aproksymacją powierzchni zewnętrznej i...

  1. Ocena dokładności wyznaczania przestrzennego położenia punktów metodą biegunową

    OpenAIRE

    Preweda, Edward

    1997-01-01

    Położenie, wymiary czy też kształt wielu obiektów przemysłowych określa się na podstawie wyników pomiarów geodezyjnych. Kontrolowane obiekty reprezentowane są przez zbiory punktów położonych na ich powierzchni. Jedną z metod wyznaczania współrzędnych przestrzennych punktów jest metoda biegunową. W pracy wyprowadzono zależności określające macierz kowariancji dla współrzędnych punktów wyznaczanych tą metodą. Positions, dimensions or shape of many industrial objects are determined on the bas...

  2. Wpływ cukrzycy na rozwój i funkcjonowanie dziecka

    OpenAIRE

    Buchnat, Marzena

    2006-01-01

    Choroba przewlekła, jaką jest cukrzyca, wpływa niekorzystnie na rozwój dziecka, powodując zmianę sposobu życia zarówno dla dziecka jak i jego rodziny. Jest źródłem wielu trudnych sytuacji, ponieważ wpływa na sposób funkcjonowania dziecka na różnych płaszczyznach. Jednak jak dalece choroba będzie zakłócać ten sposób funkcjonowania, zależy nie tylko od samej choroby, ale i od sposobu jej przyjęcia przez dziecko Cukrzyca szczególnie negatywne wpływa na kształtowanie się osobowości. Trzeba ...

  3. The Time-course of Lexical Reactivation of Unaccusative Verbs in Broca’s Aphasia

    Directory of Open Access Journals (Sweden)

    Natalie Sullivan

    2014-04-01

    Similar to Friedmann et al.’s (2008 findings of normally delayed re-access of the displaced argument, the results for all 12 participants (Fig.1 revealed priming only at the downstream probe position [*2], t(11=3.08, p=.01. In a separate subgroup analysis, the same pattern was found for the Broca group, t(6=4.77, p=.003. These results suggest that participants with Broca’s aphasia can take advantage of the inherent delay of unaccusatives and exhibit similar patterns of syntactic dependency linking as unimpaired individuals. We discuss these findings with reference to its generalizability across patient groups, the DLA, and the interaction between lexical and syntactic processes.

  4. Analiza pracy wybranych stopni wodnych na odcinku Noteci Bystrej w warunkach zagrożenia powodziowego

    Directory of Open Access Journals (Sweden)

    Justyna Płaczek

    2016-12-01

    Full Text Available Celem przestawionej publikacji jest analiza warunków przepływu oraz pracy budowli wodnych usytuowanych na odcinku Noteci Bystrej od stopnia Romanowo do jazu w Rosku. Obiekt badawczy zostały wybrany z dwóch powodów: (1 dla tego odcinka rzeki Noteć zostały opracowane mapy zagrożenia powodziowego jako wdrożenie Dyrektywy Powodziowej UE w ramach prac nad projektem ISOK, (2 na wymienionym odcinku znajduje się szereg budowli piętrzących posiadających zdolność retencjonowania wody i oddziaływania na falę wezbraniową. W ramach badań wykorzystano szeroko narzędzia GIS oraz modelowania matematycznego.

  5. All Prime Contract Awards by State or Country, Place, and Contractor, FY83, Part 5 (LaGrange, Indiana-Escanaba, Michigan).

    Science.gov (United States)

    1983-01-01

    ASTRO GEAR & INSTRUMENT CO INC BROCKTON MASS 018398 0330 22 4 I 00700 4882 DLA700-83-C3752 B C A 1 2 2 3020 000 AIC GEARS PULLEYS SPROCKETS...1285 000 A7 FIRE CONTROL RADAR EQUIP FXC 8 A 4 5 A 1009 5 B J 2 H 78 I LCSO4 0045 NOO104-83-G0015 B C A 1 2 2 1290 SCB C9E MISCELLANEOUS FIRE CONTROL E...3360 22 1 I OAGO8 0381 DAAGO-83-C0478 E C B 5 2 2 5820 000 A7 RADIO TV EQUIPMENT EXCEPT Al 5 A 3 3 J 0000 0 J 1 I 27 ASTRO DYNAMICS INC WOBURN MASS

  6. Wpływ bisantracykliny WP 631 na komórki raka jajnika

    OpenAIRE

    Gajek, Arkadiusz

    2016-01-01

    Rak jajnika stanowi szósty najczęściej rozpoznawany nowotwór złośliwy w populacji kobiet na świecie. Stale utrzymująca się wysoka umieralność z powodu tej choroby, będąca najwyższą wśród nowotworów żeńskich narządów płciowych związana jest niewątpliwie z brakiem metod skutecznego wczesnego rozpoznawania. W większości przypadków choroba ta wykrywana jest w zaawansowanym stadium (III, IV), kiedy rokowanie dla pacjentek jest zdecydowanie mniej korzystne w porównaniu z wczesnymi ...

  7. Kapitał ludzki w bibliotekach – zarys problematyki badawczej

    Directory of Open Access Journals (Sweden)

    Błach Marzena

    2015-12-01

    Full Text Available Artykuł prezentuje stan badań na temat jednego ze składników zasobów niematerialnych bibliotek – kapitału ludzkiego. Zgodnie ze współczesnymi teoriami kapitał ludzki postrzegany jest jako źródło korzyści dla biblioteki. W artykule zwrócono uwagę na różne formy rozwijania i doskonalenia umiejętności osobistych i zawodowych, scharakteryzowano przykładowe ścieżki zawodowe bibliotekarzy i zaproponowano zagadnienia powiązane z pojęciem kapitału ludzkiego w bibliotekach warte uwagi polskich bibliotekoznawców, praktyków i teoretyków.

  8. Nowe kryteria klasyfikacyjne reumatoidalnego zapalenia stawów

    Directory of Open Access Journals (Sweden)

    Ewa Stanisławska-Biernat

    2010-12-01

    Full Text Available W artykule przedstawiono nowe kryteria klasyfikacyjne reumatoidalnegozapalenia stawów (RZS, opracowane pierwszy raz przezwspólną grupę roboczą badaczy amerykańskich – z AmerykańskiegoKolegium Reumatologicznego (ACR – i europejskich – z EuropejskiejLigi Przeciwreumatycznej (EULAR. Omówiono przyczynywprowadzenia nowych kryteriów oraz zasady ich opracowywania.Na podstawie prac nad nowymi kryteriami wymieniono objawy klinicznei wyniki badań dodatkowych, które są czynnikami ryzykaprzetrwałego albo nadżerkowego zapalenia stawów. Przedstawionosposób posługiwania się nowymi kryteriami ACR/EULAR 2010dla RZS. Zwrócono także uwagę na ewentualne konsekwencjewprowadzenia nowych kryteriów.

  9. Wpływ promocji - na rozwój firmy rodzinnej Ogród Jagi

    OpenAIRE

    Król-Mamiak, Anna

    2012-01-01

    Praca dotyczy wpływu działań promocyjnych na rozwój firmy rodzinnej jaką jest Kwiaciarnia Ogród Jagi. To ważny temat, szczególnie obecnie, kiedy małe firmy są wypierane przez duże sklepy sieciowe i powstające galerie handlowe, w których nie ma miejsca na działalność małych, rodzinnych przedsiębiorstw. Barierą jest dla nich między innymi cena wynajmu powierzchni i czynsz płacony właścicielom centrów handlowych. Tym bardziej więc ważne jest pokazanie, jakimi sposobami rodzinne firmy docierają d...

  10. The magnetic field gradients generation for magnetic resonance tomography; Generacja gradientow pola magnetyczbego dla tomografii MR

    Energy Technology Data Exchange (ETDEWEB)

    Jasinski, A.; Skorka, T.; Kwiecinski, S. [Institute of Nuclear Physics, Cracow (Poland)

    1994-12-31

    To obtain three-dimensional images in the computerized tomography a gradient of magnetic field should be generated. In this paper the analytical as well as computerized calculations of magnetic coils for such purposes are presented. 4 refs, 8 figs.

  11. STAR FORMATION FROM DLA GAS IN THE OUTSKIRTS OF LYMAN BREAK GALAXIES AT z ∼ 3

    International Nuclear Information System (INIS)

    Rafelski, Marc; Wolfe, Arthur M.; Chen, Hsiao-Wen

    2011-01-01

    We present evidence for spatially extended low surface brightness emission around Lyman break galaxies (LBGs) in the V-band image of the Hubble Ultra Deep Field, corresponding to the z ∼ 3 rest-frame far-UV (FUV) light, which is a sensitive measure of star formation rates (SFRs). We find that the covering fraction of molecular gas at z ∼ 3 is not adequate to explain the emission in the outskirts of LBGs, while the covering fraction of neutral atomic-dominated hydrogen gas at high redshift is sufficient. We develop a theoretical framework to connect this emission around LBGs to the expected emission from neutral H I gas, i.e., damped Lyα systems (DLAs), using the Kennicutt-Schmidt (KS) relation. Working under the hypothesis that the observed FUV emission in the outskirts of LBGs is from in situ star formation in atomic-dominated hydrogen gas, the results suggest that the SFR efficiency in such gas at z ∼ 3 is between factors of 10 and 50 lower than predictions based on the local KS relation. The total SFR density in atomic-dominated gas at z ∼ 3 is constrained to be ∼10% of that observed from the inner regions of LBGs. In addition, the metals produced by in situ star formation in the outskirts of LBGs yield metallicities comparable to those of DLAs, which is a possible solution to the 'Missing Metals' problem for DLAs. Finally, the atomic-dominated gas in the outskirts of galaxies at both high and low redshifts has similar reduced SFR efficiencies and is consistent with the same power law.

  12. Studium Języka Polskiego dla Cudzoziemców Uniwersytetu Łódzkiego w latach 1952-2002

    OpenAIRE

    Wielkiewicz-Jałmużna, Dorota

    2008-01-01

    Kształcenie cudzoziemców jest zjawiskiem występującym w ponad 30 państwach współczesnego świata. Czołówkę tworzą Stany Zjednoczone, Anglia, Francja, Niemcy, Włochy. W ostatnich latach o dołączenie do niej usilnie starała się Japonia. Różnice w przygotowaniu merytorycznym cudzoziemców do studiów wyższych, wynikające z odmiennego programu nauczania i poziomu szkolnictwa średniego w krajach macierzystych obcokrajowców, wraz z trudnościami związanymi z pobieraniem nauki w języku...

  13. Improving DLA Aviation Engineering’s Support to its Customers and the DoD Supply Chain

    Science.gov (United States)

    2014-10-01

    Report and issued DMRD 926 under the same title. The report’s central recommendation transferred Item Management (IM) responsibilities for...3200.1 and other related functions are more appropriately addressed in a DoDI sponsored by ASD (L&MR). Currently, there is no DoDI that addresses...appropriate, of DCMA to perform in-plant quality assurance, and the option to conduct PLT when circumstances warrant, must be combined in a coherent and

  14. Specjalistyczny język medyczny a multimedialny kurs języka zawodowego dla pielęgniarek

    OpenAIRE

    Magajewska, Mirosława

    2016-01-01

    In the age of the widespread globalization, intensive international economic, scientific and technical cooperation, there are promising prospects for those specialists who aim at improving their professional qualifications or taking up employment abroad. A fundamental conditio which is to be met in order to fulfil those plans is to achieve the command of professional language of the target country or professional English. The need of skilful verbal communication is connected with the occupati...

  15. SYSTEM WYŚWIETLANIA PARAMETRÓW LOTU DLA ŚMIGŁOWCA TYPU Mi-17 – WYNIKI BADAŃ

    Directory of Open Access Journals (Sweden)

    Bęczkowski Grzegorz

    2015-08-01

    Full Text Available Przedmiotem artykułu są badania w locie nowo opracowanego systemu wyświetlania parametrów lotu (SWPL. Omawiany system przeznaczony jest do zobrazowania na wyświetlaczu przeziernym umieszczonym przed okiem pilota pełnej informacji pilotażowo-nawigacyjnej, ostrzeganiu o sytuacji niebezpiecznej na pokładzie śmigłowca i sygnalizacji błędów pracy systemów pokładowych. System przystosowany jest do pracy w warunkach dziennych i nocnych, przy czym w warunkach nocnych współpracuje z goglami noktowizyjnymi stosowanymi w lotnictwie Sił Zbrojnych RP.

  16. The Research into the Quality of Rock Surfaces Obtained by Abrasive Water Jet Cutting

    Science.gov (United States)

    Młynarczuk, Mariusz; Skiba, Marta; Sitek, Libor; Hlaváček, Petr; Kožušníková, Alena

    2014-12-01

    In recent years, water jet cutting technology has been being used more and more often, in various domains of human activity. Its numerous applications include cutting different materials - among them, rock materials. The present paper discusses the results of the research that aimed at determining - in a quantitative manner - the way in which the water jet cutting parameters (such as the traverse speed of the head, and the distance between the high-pressure inlet of the water jet and the cut material) influence the quality of the processed surface. Additionally, the impact of these parameters on the surface of various materials was investigated. The materials used were three granites differing with respect to the size of grains. In the course of the research, the standard parameters defined by the ISO norms were analyzed. It was also proposed that variograms be used to analyze the quality of the cut surface. Technologia cięcia strumieniem wodnym staje się w ostatnich latach coraz intensywniej wykorzystywana w różnych dziedzinach działalności człowieka. Jest ona wykorzystywana do obróbki różnorodnych materiałów, również materiałów skalnych. W ramach badań analizowano trzy granity różniące się m.in. wielkościami ziarn, które były przecinane przy różnych prędkościach przesuwu głowicy z wlotem strumienia wodnego. Analizowano standardowe parametry zdefiniowane w normach ISO jak również zaproponowano wykorzystanie wariogramów do analizy jakości wyciętej powierzchni. W pracy opisano w sposób ilościowy zmiany jakości powierzchni skał ciętych strumieniem wodnym ze ścierniwem w zależności od prędkości przesuwu głowicy, jak również w zależności od odległości przecinanego fragmentu powierzchni od wlotu strumienia wodnego do materiału. Wyniki uzyskane w pomiarach wskazują też na wpływ wielkości uziarnienia skały na jakość otrzymanej powierzchni. Jest to szczególnie widoczne dla najmniej optymalnych parametrów ci

  17. Wartości poznawcze sprawozdawczości regulacyjnej podmiotu świadczącego powszechne usługi pocztowe

    Directory of Open Access Journals (Sweden)

    Leszek Borowiec

    2018-03-01

    Full Text Available Ze względu na aspekty strategiczne, gospodarcze czy społeczne, niektóre obszary aktywności przedsiębiorstw w gospodarce rynkowej są organizowane w ramach tzw. rynków regulowanych. Regulacja danej części rynku najczęściej podlega dodatkowym rygorom sprawozdawczości. Celem artykułu jest próba oceny wartości poznawczych sprawozdawczości z rachunkowości regulacyjnej operatora wyznaczonego do świadczenia powszechnych usług pocztowych. W opracowaniu dokonano przeglądu uwarunkowań prawnych działania operatora wyznaczonego oraz scharakteryzowano zakres ujawnianych informacji w sprawozdawczości regulacyjnej, na przykładzie rynku pocztowych usług powszechnych. Podstawą analizy były sprawozdania regulacyjne składne przez operatora wyznaczonego, tj. Pocztę Polską. Wopracowaniu zastosowano takie metody badawcze jak: studia literaturowe, analiza aktów prawnych regulujących rynek usług pocztowych, wywiady oraz badanie poprzez działanie. Konkluzje skłaniają do stwierdzenia, iż sprawozdawczość regulacyjna, mimo swojej specyfiki, dla regulatora rynku stanowi istotne źródło informacji do oceny efektywności świadczonych usług. Jednocześnie ma bardzo wątpliwe walory poznawcze dla interesariuszy zewnętrznych, ze względu na szeroki zakres stosowania instytucji „tajemnicy przedsiębiorstwa”. Artykuł jest oryginalnym spojrzeniem autora na słabo rozpoznany od strony naukowej problem wartości informacyjnej dla interesariuszy sprawozdawczości podmiotów działających w sektorach regulowanych. For strategic, economic or social reasons, some areas of business activity in the market economy are organized under the so-called regulated markets. The regulation of a given part of the market is most often subject to additional reporting requirements. The aim of this article is to try to assess the cognitive value of reporting from the regulatory accounting of an operator designated to provide universal postal services. The

  18. Historia i znaczenie zbiorów Biblioteki Katedry Filologii Germańskiej Uniwersytetu Mikołaja Kopernika w Toruniu – depozyt w Bibliotece Uniwersyteckiej w Toruniu

    Directory of Open Access Journals (Sweden)

    Wiesław Sieradzan

    2014-12-01

    Full Text Available Jedną z bardziej interesujących części zbiorów Biblioteki Głównej UMK jest znajdujący się tam od niedawna depozyt Biblioteki Katedry Filologii Germańskiej. Jego geneza łączy się nierozerwalnie z dziejami Uniwersytetu oraz samej Katedry, kształcącej germanistów już od ponad 40 lat. Celem autora jest poznanie tego księgozbioru, zarówno pod względem jego proweniencji, jak i wartości dla germanistów i historyków. Ważną kwestia jest ustalenie głównych twórców biblioteki germanistycznej po II wojnie światowej, jak również po reaktywacji Katedry Filologii Germańskiej w 1969 r. Depozyt Katedry Filologii Germańskiej w BG UMK liczy 7627 tomów. Już sam fakt sposobu jego powstawania, szczególnie po II wojnie światowej, głównie drogą zabezpieczania zbiorów poniemieckich, a ponadto zakupów i darów, musiał wpłynąć na różnorodność gatunkową oraz proweniencję. W depozycie daje się zauważyć mnogość ośrodków, z których nastąpiło rozproszenie zbiorów bibliotecznych. W ujęciu geograficznym jest to obszar od Greifswaldu na zachodzie po Królewiec na wschodzie. Od Gdańska i Słupska na północy aż po Dzierżoniów (Reichenbach, Świdnicę (Schweidnitz oraz Wrocław na południu. W księgozbiorze tym można wyróżnić prozę i poezję niemiecką ze szczególnym uwzględnieniem twórców z XIX i pierwszej połowy XX w., następnie opracowania krytyczne literatury niemieckiej, słowniki języka niemieckiego w tym rozmaitych jego dialektów.Ustalenia niewątpliwie autora potwierdzają tezę, że charakteryzowany księgozbiór ma niewątpliwie nie tylko ciekawą proweniencję, często udokumentowaną znakami własnościowymi w postaci pięknych exlibrisów lub superexlibrisów, ale przede wszystkim znaczną wagę dla filologów germańskich. Może bowiem stanowić cenną pomoc naukową dla badań językoznawczych i historycznych (historia Niemiec i Skandynawii. Kryje on jeszcze, pomimo powyższych ustale

  19. Empiryczna weryfikacja hipotezy o przenośności modelu Altmana na warunki polskiej gospodarki oraz uniwersalności sektorowej modeli

    Directory of Open Access Journals (Sweden)

    Tomasz Iwanowicz

    2018-03-01

    Full Text Available Celem artykułu jest próba udzielenia odpowiedzi na pytanie, czy istnieje uzasadnienie dla mechanicznego przenoszenia modelu Altmana na warunki polskiej gospodarki oraz sprawdzenie, czy wśród testowanych modeli istnieje model wykazujący dla każdego typu przedsiębiorstwa (przemysłowe, handlowe, usługo- we najwyższą skuteczność i najlepsze wartości zastosowanych metod porównawczych. W artykule porównano trzynaście testowanych modeli używając macierzy klasyfikacji, ilorazu szans, krzywej kon- centracji CAP i wskaźnika dokładności Giniego, będących metodami oceny sprawności, oraz wskaźnika Briera będącego metodą oceny modeli z punktu widzenia kryterium kalibracji. Badania zostały przepro- wadzone na bazie 439 sprawozdań finansowych opublikowanych przez 139 spółek kapitałowych zarejestrowanych w warszawskich sądach okręgowych i rejonowych (w tym 79 spółek, które w rzeczywistości ogłosiły upadłość. Przeprowadzone badania obaliły mit o przenośności modelu Altmana na warunki polskiej gospodarki oraz uniwersalności sektorowej modeli. Wykazano, że sprawność modeli różni się dla spółek produkcyjnych, handlowych i usługowych oraz określono te sprawności. Ponadto udowodniono, że istnieją modele dyskryminacyjne różniące się zestawem zmiennych oraz współczynnikami wagowymi, które wykazują zbliżone skuteczności predykcyjne. The purpose of this paper is to answer the question about the validity of mechanical transfer of the Alt- man model to Polish economy and to check if among the tested models there is a model with the highest efficiency and best outcomes for the used comparative methods for each type of enterprise (manufactur- ing, trading, service. Thirteen tested models were compared using the classification matrix, odds ratio, CAP concentration curve and Gini accuracy index, which are efficiency evaluation methods, as well as using the Brier index, which is a method of evaluating models

  20. Odkryć ukryte... Praca socjalna w Polsce z perspektywy women's/gender/feminist studies

    Directory of Open Access Journals (Sweden)

    Anna Kola

    2015-06-01

    Full Text Available Celem artykułu jest zaprezentowanie rzadkiej i mało rozpowszechnionej perspektywy rozumienia pracy socjalnej nie tylko jako dyscypliny naukowej czy akademickiej, ale także jako określonych działań wspierających. Autorka włącza badania z zakresu studiów nad kobiecością, studiów genderowych oraz feministycznych do analizy profesjonalnej pracy socjalnej, polityki społecznej, praw społecznych itd. W artykule opisuje się akty opresji za pomocą tych współczesnych teorii, które są pomocne dla praktyki pracy socjalnej, wyjaśnia źródła mechanizmów odpowiedzialnych za opresję oraz wskazuje na możliwe rozwiązania.

  1. Aktywność fizyczna kobiet w ciąży w świadomości przyszłych instruktorów rekreacji ruchowej = Physical activity of expecting mothers in the awareness of future exercise professionals

    OpenAIRE

    Aneta Worska; Anna Szumilewicz

    2015-01-01

    Streszczenie             Kobiety ciężarne coraz częściej podejmują aktywność fizyczną, z której czerpią wielokierunkowe korzyści bez negatywnych konsekwencji dla zdrowia dziecka. Regurlarne zajęcia ruchowe w ciąży pozwalają m.in. zachować sprawność ciała, zapobiegają nadmiernemu przyrostowi masy ciała, ułatwiają poród oraz skracają czas połogu. Przed rozpoczęciem ćwiczeń konieczna jest nie tylko konsultacja z lekarzem, ale również z instruktorem zajęć ruchowych, by dobrać odpowiedni rodza...

  2. Supplementary notes to the biology of Cordyceps entomorrhiza (Dicks. ex Fr. Link and the morphology of its conidial stages

    Directory of Open Access Journals (Sweden)

    Stanisław Bałazy

    2014-08-01

    Full Text Available Cordyceps entomorrhiza develops on the larvae, pupae and adults on the ground beetles Carabus spp. (Coleoptera, Carabidae and on the bugs (Heteroptera, Nabidae ot the genera Himacerus Wolff et Nabis Latr. There are two forms of the conidial sporulation of this fungus with an identical sporogenesis type (Phialosporae but different as to the arrangement of sporogenous cells (Tilachiadtopsis and Hymenostilbe-like The names Tilachlidiopsis hippotrichoides (Lindau Keisler and T. nigra Yakushiji et Kumazawa should be treated as synonymous; they refer to the conidial stage of C. entomorrhiza, Hirsutella dla eleutheratorum (Nees ex Fr. Petch — contrary to the hitherto existing notion — is not connected with the above mentioned fungus. It constitutes a separate species, close to or identical with H. entomophila Pat.

  3. Propaganda Daesh

    OpenAIRE

    Klein, Grzegorz

    2016-01-01

    Celem artykułu było pokazanie różnorodności propagandy Daesh. Składają się na nią treści polityczne, religijne i społeczne. Mają one jedno zadanie - przekonać świat, że nowopowstały ‘kalifat’jest faktem : posiada zdolność do obrony swojego terytorium, niezależnie od tego, jak wielkie są wysiłki „krzyżowców”, ponadto stanowi sprawnie działające państwo, będące wymarzonym domem dla sunnitów. Brutalność, będąca tym elementem, z którym propaganda Daesh przede wszystkim się kojarzy, pojawia się ni...

  4. Thorium Nitrate Stockpile--From Here to Eternity

    International Nuclear Information System (INIS)

    Hermes, W. H.; Hylton, T. D.; Mattus, C.H.; Storch, S. N.; Singley, P.S.; Terry, J. W.; Pecullan, M.; Reilly, F. K.

    2003-01-01

    The Defense National Stockpile Center (DNSC), a field level activity of the Defense Logistics Agency (DLA) has stewardship of a stockpile of thorium nitrate that has been in storage for decades. The stockpile is made up of approximately 3.2 million kg (7 million lb) of thorium nitrate crystals (hydrate form) stored at two depot locations in the United States. DNSC sought technical assistance from Oak Ridge National Laboratory (ORNL) to define and quantify the management options for the thorium nitrate stockpile. This paper describes methodologies and results comprising the work in Phase 1 and Phase 2. The results allow the DNSC to structure and schedule needed tasks to ensure continued safe long-term storage and/or phased disposal of the stockpile

  5. Advanced Field Investigations of Screw Piles and Columns / Zaawansowane Badania Terenowe Pali I Kolumn Wkrecanych

    Directory of Open Access Journals (Sweden)

    Krasiński A.

    2011-03-01

    Full Text Available Dla potrzeb projektu badawczego „Nosnosc i praca w gruncie pali wkrecanych” finansowanego przez Ministerstwo Nauki i Szkolnictwa Wyzszego - projekt nr N N506 369234 rozpoczeto badania terenowe pali i kolumn wkrecanych. W artykule opisano badania na pierwszym zorganizowanym do tego celu poletku doswiadczalnym. Przeprowadzono na nim badania trzech pali wkrecanych z uzyciem specjalnego systemu pomiarowego oraz w połaczeniu z badaniami podłoza gruntowego za pomoca sondowan CPTU oraz z pomiarami parametrów wykonawstwa pali (moment wkrecajacy i inne. Celem badan terenowych i całego projektu badawczego jest rozpoznanie charakteru pracy pali wkrecanych w gruncie oraz okreslenie zaleznosci pomiedzy wynikami sondowan CPT a oporami wkrecania i nosnoscia pali wkrecanych. W artykule zawarto opis przebiegu oraz podstawowe wyniki wykonanych badan.

  6. Zabytkowa architektura drewniana jako element zachowania walorów historycznych miast na Podlasiu

    Directory of Open Access Journals (Sweden)

    Aleksander Owerczuk

    2018-04-01

    Full Text Available Miasta ulegają ciągłym przeobrażeniom. Nowy kształt urbanistyczny i nowa zabudowa wkraczają do dzielnic historycznych miast. Zachowana zabytkowa architektura przeważnie nie zawiera spektakularnych obiektów. Natomiast jako całość jest cennym świadkiem epoki. W miasteczkach nierzadko ważną rolę odgrywa zabudowa drewniana, chociaż przeważnie zachowana w szczątkowym stanie. Na Podlasiu duże nasycenie zabudową drewnianą było charakterystyczne dla małych miast. Jednym z nich jest Bielsk Podlaski. Na jego przykładzie zostanie omówiony problem zmiany dawnego charakteru miasta, którego ważnym elementem była architektura drewniana.

  7. Dokumenty piśmiennicze w grach komputerowych. Funkcje i forma

    OpenAIRE

    Przemysław Ciszek

    2012-01-01

    Abstrakt w j. polskim:Książki i inne dokumenty piśmiennicze (czasopisma, pamiętniki czy listy) występują w wielu grach wideo. Szczególnie często można je znaleźć w grach cRPG (fabularne gry komputerowe) i przygodowych, które to pozwalają na dużą interakcję ze światem gry. Książki mogą pełnić w grach podobne funkcje jak w świecie rzeczywistym – funkcję poznawczą i rozrywkową. Książki i dokumenty mogą zawierać treść dostępną dla gracza, ale wiele z nich oddziałuje jedynie na awatara w grze. Eng...

  8. Diagnostyczna funkcja arteterapii na oddziale psychiatrycznym dla młodzieży – opis przypadku

    Directory of Open Access Journals (Sweden)

    Agnieszka Gmitrowicz

    2012-09-01

    Full Text Available Opis przypadku klinicznego dotyczy analizy dynamiki obrazu psychopatologicznego u pacjentki hospitalizowanej w Klinice Psychiatrii Młodzieżowej, w kontekście twórczości spontanicznej oraz inspirowanej w trakcie indywidualnych zajęć arteterapii. Proces rediagnozy – z choroby afektywnej dwubiegunowej na zaburzenia schizoafektywne – został zapoczątkowany w toku omawiania prac plastycznych pacjentki. W jej twórczości podczas kolejnej fazy depresyjnej bez objawów psychotycznych zaczęły występować: cechy znacznej dezorganizacji, symbole, deformacja postaci, kontaminacje, nieuzasadnione treścią podziały przestrzeni, zachwiania perspektywy, o kilka miesięcy wyprzedzające rozwój pełnoobjawowej psychozy o obrazie schizofrenii. Osiemnastoletnia pacjentka, chorująca od roku, początkowo była leczona z powodu manii w przebiegu choroby afektywnej dwubiegunowej. Prezentowała podwyższony nastrój i napęd, przyspieszony tok myślenia, wypowiadała urojenia wielkościowe, posłannicze, skracała dystans, relacjonowała „wyostrzenie zmysłów”, „poszerzenie świadomości”, chciała „nieść światu piękno”. Relacjonowała, że od dawna obserwuje u siebie wahania nastroju – od stanów „depresji” z uczuciem smutku, wyczerpania, anhedonii, nadmierną sennością, znacznym spadkiem aktywności, myślami samobójczymi do stanów „euforii”, „hiperaktywności”. Krótko po wypisie pacjentka odstawiła leki i po kilku miesiącach trafiła ponownie na oddział z objawami epizodu depresji i tendencjami samobójczymi. W trakcie tej hospitalizacji pacjentce zaproponowano udział w indywidualnych zajęciach arteterapeutycznych z uwagi na jej spontaniczną twórczość plastyczną (w tym malowanie na ścianach oraz odmowę udziału w zajęciach grupowych. Zespół terapeutyczny, w skład którego wchodziła arteterapeutka, określił następujące cele arteterapii: diagnostyczny, komunikacyjny, integracyjny i katartyczny. Dodatkową rolą arteterapeutki było inicjowanie zmian w funkcjonowaniu pacjentki oraz indywidualnego procesu twórczego.

  9. DLA TEST Defense Infrastructure: Improvement Needed in Energy Reporting and Security Funding at Installations with Limited Connectivity

    Science.gov (United States)

    2016-01-01

    include natural gas, petroleum, coal, and incorporation of renewable sources of energy— e.g., wind, solar, and biodiesel . • Use of renewable energy...based fuels—making it vulnerable to price fluctuations in the energy market and disruptions to the transportation of fuels. In 2013 and 2014, Alaska

  10. POMIAR CHARAKTERYSTYKI PRĄDOWO-NAPIĘCIOWEJ OGNIWA FOTOWOLTAICZNEGO METODĄ POJEMNOŚCIOWĄ W WARUNKACH OŚWIETLENIA SZTUCZNEGO

    Directory of Open Access Journals (Sweden)

    Patrycja PRAŻMO

    Full Text Available Charakterystyka prądowo-napięciowa to podstawowa forma prezentacji parametrów elektrycznych ogniwa fotowoltaicznego. Wykres krzywej I-V modułu PV zmienia się w ciągu dnia w zależności od natężenia promieniowania słonecznego oraz temperatury modułu. Artykuł przedstawia pomiary krzywych I-V w warunkach oświetlenia sztucznego wykonanych autorskim urządzeniem. W skład układu pomiarowego oprócz urządzenia wchodził również komputer sterujący wraz z oprogramowaniem Arduino w celu kontroli procesu pomiaru oraz zapisu odczytu danych do pliku. Spośród różnych dostępnych metod pomiarowych do realizacji urządzenia wybrano metodę pojemnościową wykorzystującą proces ładowania kondensatora do zmiany rezystancji układu od zera do nieskończoności. Taka metoda pomiaru nie umożliwia odtworzenia krzywej od punktu zwarcia i wymaga ekstrapolacji wyników, natomiast wykorzystuje ona stosunkowo łatwy w konstrukcji układ elektroniczny a także nie jest ona kosztowna. Urządzenie mierzy napięcie poprzez wbudowany konwerter ADC porównując badane napięcie z napięciem referencyjnym oraz natężenie prądu w obwodzie wykorzystując czujnik natężenia oparty o efekt Halla. W pracy porównano rezultaty pomiarów dla dwóch różnych typów ogniw fotowoltaicznych: polikrystalicznego i monokrystalicznego ogniwa krzemowego. Otrzymane wyniki zaprezentowano w formie wykresów. Porównano na nich wyniki dla kilku pomiarów oraz wartości uśrednionych. Porównano obliczone wartości współczynnika wypełnienia, który określa stosunek mocy maksymalnej ogniwa rzeczywistego do mocy maksymalnej ogniwa idealnego z danymi podanymi przez producenta.

  11. Bismuth 213-labeled anti-CD45 radioimmunoconjugate to condition dogs for nonmyeloablative allogeneic marrow grafts

    Energy Technology Data Exchange (ETDEWEB)

    Sandmaier, B M.(Fred Hutchinson Cancer Research Center, Seattle, WA); Bethge, W A.(Fred Hutchinson Cancer Research Center, Seattle, WA); Wilbur, D. Scott (Washington, Univ Of); Hamlin, Donald K.(Washington, Univ Of); Santos, E B.(Fred Hutchinson Cancer Research Center, Seattle, WA); Brechbiel, M W.(National Cancer Institute, National Institutes of Health, Bethesda, MD); Fisher, Darrell R.(BATTELLE (PACIFIC NW LAB)); Storb, R. (Fred Hutchinson Cancer Research Center)

    2002-01-01

    To lower treatment-related mortality and toxicity of conventional marrow transplantation, a nonmyeloablative regimen using 200 cGy total-body irradiation (TBI) and mycophenolate mofetil (MMF) combined with cyclosporine (CSP) for postgrafting immunosuppression was developed. To circumvent possible toxic effects of external- beam gamma irradiation, strategies for targeted radiation therapy were investigated. We tested whether the short-lived (46 minutes) alpha-emitter Bi-213 conjugated to an anti-CD45 monoclonal antibody (mAb) could replace 200 cGy TBI and selectively target hematopoietic tissues in a canine model of nonmyeloablative DLA-identical marrow transplantation. Biodistribution studies using iodine 123-labeled anti-CD45 mAb showed uptake in blood, marrow, lymph nodes, spleen, and liver. In a dose-escalation study, 7 dogs treated with the Bi-213-anti-CD45 conjugate (Bi-213 dose, 0.1-5.9 mCi/kg[3.7-218 MBq/kg]) without marrow grafts had no toxic effects other than a mild, reversible suppression of blood counts. On the basis of these studies, 3 dogs were treated with 0.5 mg/kg Bi-213-labeled anti-CD45 mAb (Bi-213 doses, 3.6, 4.6, and 8.8 mCi/kg[133, 170, and 326 MBq/kg]) given in 6 injections 3 and 2 days before grafting of marrow from DLA-identical littermates. The dogs also received MMF (10 mg/kg subcutaneously twice daily the day of transplantation until day 27 afterward) and CSP (15 mg/kg orally twice daily the day before transplantation until 35 days afterward). Therapy was well tolerated except for transient elevations in levels of transaminases in 3 dogs, followed by, in one dog, ascites. All dogs achieved prompt engraftment and stable mixed hematopoietic chimerism, with donor contributions ranging from 30% to 70% after more than 27 weeks of follow-up. These results form the basis for additional studies in animals and the design of clinical trials using Bi-213 as a nonmyeloablative conditioning regimen with minimal toxicity.

  12. Aquaculture and Fish Welfare: Are the Rights of Fish Compromised?/ Akwakultura I Dobrostan Ryb: Czy Prawa Ryb Są Szanowane?

    Directory of Open Access Journals (Sweden)

    Mustapha Moshood K.

    2014-12-01

    Full Text Available Zagadnienie dobrostanu ryb w akwakulturze jest aktualne przez cały proces produkcyjny, a jego właściwa realizacja, z poszanowaniem praw ryb i humanitarnym ubojem, jest korzystana dla producenta i konsumenta. Poszanowanie praw ryb odnosi się do różnorodnych aspektów hodowli uwzględniając takie jak: baseny i stawy hodowlane, zagęszczenie obsady, jakość wody, pokarm i reżim żywienia, zarażenie chorobami i pasożytami, metody leczenia ryb zarażonych, manipulacja ciałem ryby, odłowy sieciowe, metody pozyskiwania ryb przed ubojem, metody uboju, metody oczyszczania z pokarmu, sztuczny fotoperiod, selekcja w kierunku szybkiego wzrostu, selektywny i indukowany rozród, manipulacje genetyczne, ekspozycja na drapieżnictwo, hodowla w polikulturach, znakowanie, stłaczanie ryb, sortowanie, transport, rybie atraktory, przypadkowe bądź celowe introdukcje ryb modyfikowanych genetycznie do akwakultury. Najbardziej rekomendowaną metodą utrzymywania ryb w pożądanym dobrostanie, która zapewni też korzyści dla hodowcy jest zachowywanie tzw. „pięciu wolności” w odniesieniu do hodowanych zwierząt. Sposoby realizacji takiego prowadzenia hodowli są przedstawione i dyskutowane w niniejszej pracy. Stan ryb w niewoli powinien uwzględniać czynniki etyczne, produkcyjne, ekonomiczne i handlowe. Jest to coraz ważniejsze ze względu na rosnącą potrzebę konsumenta do zapoznania się z technikami stosowanymi w produkcji pożywienia pochodzenia zwierzęcego i akceptacji tych praktyk. Polepszenie dobrostanu produkowanych ryb w akwakulturze skutkuje zwiększeniem korzyści produkcyjnej: ryby będą przyrastać lepiej, a jakość mięsa będzie wyższa. Wzrasta też poziom akceptacji u konsumentów tak wyprodukowanego mięsa w powiązaniu z humani- tarnym ubojem.

  13. Leki przeciwdepresyjne i przeciwpsychotyczne zarejestrowane u dzieci i młodzieży. Trudności prawne i etyczne związane z zakresem rejestracji leków

    Directory of Open Access Journals (Sweden)

    Piotr Niwiński

    2017-11-01

    Full Text Available Wstęp: Wykonując swój zawód, lekarz jest zobowiązany do przestrzegania nie tylko zasad sztuki lekarskiej, lecz także przepisów prawa. Regulacje prawne dotyczą m.in. zgody na leczenie i zasad rejestracji leków. Leki są zarejestrowane w ściśle określonych wskazaniach, dla konkretnych grup pacjentów. Zastosowanie leku poza rejestracją może zostać zinterpretowane jako przeprowadzenie eksperymentu medycznego. Podstawą stosowania leków są zalecenia towarzystw naukowych. W psychiatrii dzieci i młodzieży wiele leków nie ma rejestracji do stosowania u osób poniżej 18. roku życia, w związku z czym lekarz po udzieleniu odpowiednich informacji musi uzyskać pisemną zgodę na leczenie od rodzica lub opiekuna prawnego. Cel: Celem pracy był przegląd leków stosowanych w terapii zaburzeń depresyjnych i psychotycznych w populacji dzieci i młodzieży pod kątem wieku pacjentów zgodnego ze wskazaniami rejestracyjnymi. Metoda: Bazując na Indeksie Leków Medycyny Praktycznej, przeanalizowano charakterystyki produktów leczniczych. Wyniki: Spośród 226 leków przeciwpsychotycznych i przeciwdepresyjnych zarejestrowanych w Polsce 149 jest niewskazanych lub przeciwwskazanych do podawania pacjentom poniżej 18. roku życia. Kolejnych 29 leków zostało zarejestrowanych u dzieci, ale we wskazaniach innych niż leczenie zaburzeń depresyjnych i psychotycznych. Ponadto różne postacie leków lub postacie wytwarzane przez różne firmy farmaceutyczne mogą mieć odmienną rejestrację. Wnioski: Brak rejestracji leków stosowanych w psychiatrii dzieci i młodzieży stanowi zagrożenie prawne i finansowe dla lekarza, a także może powodować nieufność rodzica.

  14. Peregrynant uczony. Rola biblioteki i książki w programie staropolskich podroży edukacyjnych XVII w.

    Directory of Open Access Journals (Sweden)

    Adam Kucharski

    2011-12-01

    Full Text Available Głównym celem niniejszego opracowania jest analiza roli i miejsca jakie pełniły księgi i księgozbiory w trakcie polskich podróży edukacyjnych w XVII w. Z natury rzeczy książki były integralnym elementem studiów, zarówno w kraju jak i poza jego granicami. Podręczniki historii, retoryki, filozofii czy matematyki i architektury militarnej odgrywały podstawową rolę w procesie edukacji akademickiej. Także staropolscy studenci podróżujący dla zdobycia wiedzy i umiejętności byli autorami drukowanych rozpraw wieńczących ich studia akademickie. Książka stanowiąca w epoce baroku cenne, a nierzadko główne, źródło wiedzy o świecie była także obiektem zainteresowania w aspekcie jej gromadzenia i przechowywania. Biblioteki stanowiły z pewnością ważny, chociaż nie najistotniejszy, składnik licznych peregrynacji. Chętnie odwiedzano biblioteki kościelne i miejskie, publiczne, a nawet prywatne. Charakterystycznym rysem ich opisów była jednak predylekcja do opisywania wszelakich ciekawych eksponatów tam oglądanych. Tendencja taka wyraźnie zdominowała długość i dokładność opisów księgozbiorów bibliotecznych. Właściwa dla kultury barokowej pasja do zdobywania wiedzy o rzadkich i osobliwych dziełach sztuki, wynalazkach technicznych, zwierzętach czy przedmiotach objawiała się także podczas zwiedzania gmachów bibliotek. Niejednokrotnie przeradzała się ona wyłącznie w chęć oglądania niezwykłych eksponatów stając się de facto rodzajem rozrywki.

  15. Investigations of Geosynthetic Interlayer Bonding in Asphalt Layers / Badania Połaczen Miedzywarstwowych W Warstwach Asfaltowych Z Geosyntetykiem

    Directory of Open Access Journals (Sweden)

    Zielinski P.

    2011-12-01

    Full Text Available Problem zwiazania miedzywarstwowego jest jednym z powazniejszych problemów wykonawczych w budowie nawierzchni asfaltowych, zwłaszcza w sytuacji zastosowania geosyntetyków, które sa bardzo wrazliwe na błedy aplikacji. Brak zapewnienia dobrego połaczenia warstw skutkuje zmniejszeniem trwałosci całej konstrukcji nawierzchni. Problemem badawczym jest wiec okreslenie jak spadek połaczenia warstw wpływa na trwałosc zmeczeniowa konstrukcji nawierzchni. Badania takie zostały wykonane w ramach 2 grantów badawczych, natomiast niniejszy artykuł prezentuje tylko czesc dotyczaca badan połaczen miedzywarstwowych. Badania te zostały wykonane metoda scinania opracowana na Politechnice Krakowskiej, w dwóch wybranych temperaturach tj. -2°C i + 25°C. Jako czynniki determinujace sczepnosc miedzywarstwowa przebadano wpływy rodzaju geosyntetyku, rodzaju lepiszcza stosowanego do połaczenia warstw, rodzaju mieszanki mineralno-asfaltowej a takze ilosci lepiszcza stosowanej do skropienia miedzywarstwowego. Istotnosc wpływów poszczególnych czynników na parametry zwiazania miedzywarstwowego okreslono z wykorzystaniem metod statystycznych z zastosowaniem programu Statgraphics Plus v.5.1. Stwierdzono pozytywny wpływ zastosowania geosyntetyków wstepnie impregnowanych srodkiem adhezyjnym, jako lepiszcze do nasycania i przyklejania geosyntetyku najbardziej efektywny okazał sie asfalt na goraco badz emulsja modyfikowana, stosowanie emulsji niemodyfikowanych dało gorsze rezultaty. Bardzo istotny okazał sie wpływ ilosci lepiszcza stosowanego do nasycania i przyklejania geosyntetyków. Wykazano, ze dla kazdego rodzaju warstwy posredniej istnieje optymalna ilosc skropienia miedzywarstwowego, przy której wytrzymałosc na scinanie i sztywnosc scinania jest najwieksza. Zarówno zwiekszenie jak i zmniejszenie tej ilosci lepiszcza powoduje spadek parametrów zwiazania miedzywarstwowego. W aspekcie praktycznym wyniki te pokazuja koniecznosc indywidualnego

  16. The Sightline to Q2343-BX415: Clues to Galaxy Formation in a Quasar Environment

    Science.gov (United States)

    Rix, Samantha A.; Pettini, Max; Steidel, Charles C.; Reddy, Naveen A.; Adelberger, Kurt L.; Erb, Dawn K.; Shapley, Alice E.

    2007-11-01

    We have discovered a strong DLA coincident in redshift with the faint QSO Q2343-BX415 (R=20.2, zem=2.57393). Follow-up observations at intermediate spectral resolution reveal that the metal lines associated with this proximate DLA (PDLA) consist of two sets of absorption components. One set is moving toward the quasar with velocities of ~150-600 km s-1 this gas is highly ionized and does not fully cover the continuum source, suggesting that it is physically close to the active nucleus. The other, which accounts for most of the neutral gas, is blueshifted relative to the QSO, with the strongest component at ~-160 km s-1. We consider the possibility that the PDLA arises in the outflowing interstellar medium of the host galaxy of Q2343-BX415, an interpretation supported by strong C IV and N V absorption at nearby velocities, and by the intense radiation field longward of the Lyman limit implied by the high C II*/H I ratio. If Q2343-BX415 is the main source of these UV photons, then the PDLA is located at either ~8 or ~37 kpc from the active nucleus. Alternatively, the absorber may be a foreground star-forming galaxy unrelated to the quasar and coincidentally at the same redshift, but our deep imaging and follow-up spectroscopy of the field of Q2343-BX415 has not yet produced a likely candidate. We measure the abundances of 14 elements in the PDLA, finding an overall metallicity of ~1/5 solar and a normal pattern of relative element abundances for this metallicity. Thus, in this PDLA there is no evidence for the supersolar metallicities that have been claimed for some proximate, high-ionization, systems. Based on data obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and NASA, and was made possible by the generous financial support of the W. M. Keck Foundation.

  17. Prime Contract Awards Alphabetically by Contractor, by State or Country, and Place, FY83, Part 7, (McKee Roofing Co Inc-Pirelli Cable Corp).

    Science.gov (United States)

    1983-01-01

    TRUCTI13N, ALL OTHER NON-B 8 \\ 3 4 1 O1B T B .j 0 CONTRACTOR TOTAL 2 156 ME(CHANICSBURG TRUCKING SERVICE CO HERSHEY PA 03141*7 2175 39 ? C J4110 1801...cgB DRUGS BIOLOGICALS AND OFFICI 6 A 4 5 A 07 6 B I 2 I 4 F 00120 1996 DLA120-82-D0773 B C A 5 2 2 6505 000 C9B DRUGS BIOLOGICALS AND OFFICI 6 A 4 5 B...LOCATION TOTAL 12 1,794 1 A OEAO8 1 C OEAO8 E5 TEL & TEL CO PETERSON AFB COLORADO 014754 2175 06 1 D OEAO8 )2 DCA200-78-HO015 B C Z 5 2 2 S1t3 000 S1

  18. Prime Contract Awards Alphabetically by Contractor, by State or Country, and Place, FY83, Part 8 (Piros Construction Inc-Smith Russ Corp).

    Science.gov (United States)

    1983-01-01

    0087A B C Z 1 2 2 8920 000 B2 BAKERY AND CEREAL PRODUCTS 6 6 4 5 A 09 7 B J 3 A 31 4 I 00137 55 13H-83-50087 C C A 1 2 2 8925 000 62 SUGAR CONFECTIONERY ...MEAT POULTRY AND FISH 6 2 3 5 C 09 1B J I A 4 A 0013H 2589 DLA13H-83-CC283 E C Z 1 2 2 8925 000 B2 SUGAR CONFECTIONERY AND NUTS 6 2 3 5 C 09 1B J A 4...6720 000 C9C CAMERAS STILL PICTURE 6 A 3 5 J 1015 5 B J I D 12, LOCATION TOTAL 2 161 REFINERS MARKETING CO TERMINAL ISLAND CALIFORNIA 717900 7060 05 2 C

  19. Dynamic Modeling and Analysis of a Lightweight Robotic Manipulator in Joint Space

    Directory of Open Access Journals (Sweden)

    Wolinski Łukasz

    2015-06-01

    Full Text Available W artykule przedstawiono efektywny algorytm do analizy dynamiki manipulatora przestrzennego o otwartym łancuchu kinematycznym. Równania opisujace dynamike układu zapisano w formie algebraiczno-macierzowej w przestrzeni współrzednych złaczowych. Wprowadzona zwarta reprezentacja równan opisujacych ruch manipulatora pozwoliła na rozwiazanie zadania prostego i odwrotnego dynamiki manipulatora w rekursywny i wydajny sposób. Algorytm uogólniono na przypadki analizy dynamiki otwartych łancuchów kinematycznych z dowolna liczba stopni swobody. Opracowane sformułowanie zastosowano do analizy dynamiki manipulatora KUKA LWR o siedmiu stopniach swobody. Zweryfikowano poprawnosc obliczen numerycznych dla testowych przypadków ruchu manipulatora, a wyniki porównano z rezultatami otrzymanymi w pakiecie komercyjnym do obliczen dynamiki układów wieloczłonowych

  20. Allogeneic unresponsiveness to orthotopic cardiac transplants in DL-A-identical radiation chimeras

    International Nuclear Information System (INIS)

    Boyd, A.D.; Spencer, F.C.; Hirose, H.; Engelman, R.M.; Cannon, F.D.; Ferrebee, J.W.; Rapaport, F.T.

    1975-01-01

    Nine Cooperstown beagles of known DL-A genotypes were exposed to supralethal total-body irradiation and received bone-marrow allografts from DL-A-identical donors. Four to 5 months later, the resulting chimeras received orthotopic cardiac allografts from their corresponding donors of marrow. Six chimeras died of operative complications in the immediate postoperative period. The other 3 chimeras survived from 173 to 547 days; 1 dog died at 173 days as a result of right-sided heart failure, secondary to stenosis at the site of the pulmonary artery anastomosis. The other two recipients continue to be active and healthy at 545 and 547 days. The results indicate that dogs can be rendered specifically tolerant to orthotopic cardiac allografts by supralethal total-body irradiation and the transplantation of marrow obtained from the prospective allograft donor