WorldWideScience

Sample records for dk epa environmental

  1. EPA Environmental Chemistry Laboratory

    Science.gov (United States)

    1993-01-01

    The Environmental Protection Agency's (EPA) Chemistry Laboratory (ECL) is a national program laboratory specializing in residue chemistry analysis under the jurisdiction of the EPA's Office of Pesticide Programs in Washington, D.C. At Stennis Space Center, the laboratory's work supports many federal anti-pollution laws. The laboratory analyzes environmental and human samples to determine the presence and amount of agricultural chemicals and related substances. Pictured, ECL chemists analyze environmental and human samples for the presence of pesticides and other pollutants.

  2. EPA Region 1 Environmentally Sensitive Areas (Points)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage represents point equivalents of environmentally sensitive areas in EPA New England. This coverage represents polygon equivalents of environmentally...

  3. EPA Region 1 Environmentally Sensitive Areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage represents polygon equivalents of environmentally sensitive areas (ESA) in EPA Region I. ESAs were developed as part of an EPA headquarters initiative...

  4. Environmental Protection Agency (EPA) Facilities

    Data.gov (United States)

    Department of Homeland Security — This SEGS layer shows the names, locations and biographical information of EPA facilities in the U.S. and its territories. Included in this layer are headquarters...

  5. AN OVERVIEW OF EPA ENVIRONMENTAL PHOTOGRAPHIC INTERPRETATION CENTER (EPIC)

    Science.gov (United States)

    The EPA Environmental Photographic Interpretation Center (EPIC) supports the EPA Regions and Program Offices with remote sensing based technical support and research and development products. Since 1972, EPIC has provided both imagery and imagery-derived products to the E...

  6. Environmental Finance Center Serving EPA's Region 8 States

    Science.gov (United States)

    The National Rural Water Association, headquartered in Duncan Oklahoma, has been selected through a competitive grants process to establish a regional Environmental Finance Center (EFC) serving EPA Region 8 states.

  7. ORAL PRESENTATION:EPA'S ENVIRONMENTAL PHOTOGRAPHIC INTERPRETATION CENTER (EPIC)

    Science.gov (United States)

    This presentation provides an overview of the remote sensing technical support and research and development activities of the Environmental Photographic Interprettion Center (EPIC). It is the basis for a presentation given at the EPA's Office of Acquisition Management's Annual C...

  8. 78 FR 18589 - EPA Office of External Affairs and Environmental Education; Request for Nominations of Candidates...

    Science.gov (United States)

    2013-03-27

    ... AGENCY EPA Office of External Affairs and Environmental Education; Request for Nominations of Candidates for the National Environmental Education Advisory Council AGENCY: Environmental Protection Agency (EPA... Affairs and Environmental Education (OEAEE) Staff Office is soliciting applications for environmental...

  9. Overview of the EPA quality system for environmental programs

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, G.L. [Environmental Protection Agency, Research Triangle Park, NC (United States)

    1993-12-31

    Formalized quality assurance program requirements for the U.S. Environmental Protection Agency (EPA) have been established for more than a decade. During this period, the environmental issues and concerns addressed by the EPA have changed. Many issues, such as ozone depletion and global climate warming, have become international concerns among the world environmental community. Other issues, such as hazardous waste cleanup and clean air, remain a focus of national environmental concerns. As the environmental issues of the 1980`s evolved, the traditional quality assurance (QA) program was transformed through the use of quality management principles into a Quality System to help managers meet the needs of the 1990`s and beyond.

  10. About Region 3's Laboratory and Field Services at EPA's Environmental Science Center

    Science.gov (United States)

    Mission & contact information for EPA Region 3's Laboratory and Field Services located at EPA's Environmental Science Center: the Office of Analytical Services and Quality Assurance & Field Inspection Program

  11. 75 FR 44255 - EPA Office of External Affairs and Environmental Education Staff Office; Request for Nominations...

    Science.gov (United States)

    2010-07-28

    ... AGENCY EPA Office of External Affairs and Environmental Education Staff Office; Request for Nominations of Candidates for the National Environmental Education Advisory Council AGENCY: Environmental... of External Affairs and Environmental Education Staff Office is soliciting applications...

  12. 78 FR 14090 - EPA Office of External Affairs and Environmental Education; Request for Nominations of Candidates...

    Science.gov (United States)

    2013-03-04

    ... AGENCY EPA Office of External Affairs and Environmental Education; Request for Nominations of Candidates for the National Environmental Education Advisory Council (Sub-Committee) AGENCY: Environmental...) Office of External Affairs and Environmental Education Staff Office is soliciting applications,...

  13. Overview of EPA`s environmental standards for the land disposal

    Energy Technology Data Exchange (ETDEWEB)

    Gruhlke, J.M.; Galpin, F.L.; Holcomb, W.F. [Environmental Protection Agency, Washington, DC (United States). Office of Radiation Programs

    1989-11-01

    The Environmental Protection Agency (EPA) program to develop proposed generally applicable environmental standards for land disposal of low-level radioactive waste and certain naturally occurring and accelerator-produced radioactive wastes has been completed. The elements of the proposed standards include the following: (1) exposure limits for pre-disposal management and storage operations, (2) criteria for other regulatory agencies to follow in specifying wastes that are Below Regulatory Concern (BRC), (3) post-disposal exposure limits, (4) ground water protection requirements, and (5) qualitative implementation requirements. In addition to covering those radioactive wastes subject to the Atomic Energy Act (AEA), the Agency also intends to propose a standard to require the disposal of high concentration, Naturally occurring and Accelerator-produced Radioactive Materials (NARM) wastes exceeding 2 nCi/g, excluding a few consumer items, in regulated LLW disposal facilities.

  14. White House, EPA Honor Georgia Teachers with Environmental Education Award EPA, U.S. Fish and Wildlife also announce new environmental education partnership

    Science.gov (United States)

    (07/17/2015) ATLANTA - On Friday, July 17, the White House Council on Environmental Quality, in conjunction with the U.S. Environmental Protection Agency (EPA), will recognize the winners and honorable mentions for the annual Presidential Innovation

  15. EPA Awards Environmental Education Grant to Captain Planet Foundation in Atlanta, GA

    Science.gov (United States)

    ATLANTA --- Today, the U.S. Environmental Protection Agency (EPA) announced the Captain Planet Foundation as a recipient of an Environmental Education Grant. The Atlanta-based non-profit was selected in the latest round of awards

  16. Environmental Protection Agency (EPA) Facility Registry Service (FRS) Power Plants

    Data.gov (United States)

    Department of Homeland Security — This GIS dataset contains data on wastewater treatment plants, based on EPA's Facility Registry Service (FRS) and NPDES, along with Clean Watersheds Needs Survey...

  17. 72 FR 41322 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2007-07-27

    ... Integrated Weed Management, To Establish Beneficial Vegetation and Weed Resistant Plant Communities, Missoula... supports improvements to the Integrated Weed Management Program, but suggests additional measures to further mitigate potential environmental effects of proposed weed treatments. EPA expressed...

  18. The EPA CompTox Chemistry Dashboard - an online resource for environmental chemists (ACS Spring Meeting)

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) Computational Toxicology Program integrates advances in biology, chemistry, and computer science to help prioritize chemicals for further research based on potential human health risks. This work involves computational and data drive...

  19. FRIDAY: EPA Administrator Visiting Georgia Tech to Discuss Manufacturing Innovation and Environmental Sustainability

    Science.gov (United States)

    ATLANTA - On Friday, EPA Administrator Gina McCarthy will visit Georgia Tech to speak about the connection between manufacturing innovation and environmental sustainability. McCarthy will meet with more than 50 high school students and faculty parti

  20. The EPA CompTox Chemistry Dashboard - an online resource for environmental chemists (ACS Spring Meeting)

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) Computational Toxicology Program integrates advances in biology, chemistry, and computer science to help prioritize chemicals for further research based on potential human health risks. This work involves computational and data drive...

  1. 78 FR 23928 - EPA Office of External Affairs and Environmental Education; Cancellation of the National...

    Science.gov (United States)

    2013-04-23

    ... AGENCY EPA Office of External Affairs and Environmental Education; Cancellation of the National Environmental Education Advisory Council Meetings Scheduled for May 22, 2013 and June 19th, 2013 AGENCY... Agency) Office of External Affairs and Environmental Education (OEAEE) is issuing this notice to...

  2. EPA offers grant funds for environmental education in the Northwest

    Science.gov (United States)

    (Seattle-Jan. 14, 2015) The U.S. Environmental Protection Agency is accepting grant applications for its Environmental Education Grants Program. The grants seek to support locally-focused environmental education projects that promote environmental awarenes

  3. Notification: EPA Progress in Reducing Taxpayer Environmental Liabilities

    Science.gov (United States)

    Project #OPE-FY15-0052, May 28, 2015. The EPA OIG plans to begin preliminary research on the EPA’s progress in reducing taxpayer liabilities through the use of financial assurance instruments for RCRA facilities and Superfund sites.

  4. EPA Provides Environmental Education Grant to Universidad Metropolitana

    Science.gov (United States)

    (New York, N.Y.) The U.S. Environmental Protection Agency is awarding a $91,000 environmental education grant to the Universidad Metropolitana in San Juan, Puerto Rico, to enhance environmental education for students island-wide.

  5. Two Boston Organizations Awarded EPA Environmental Education Grants

    Science.gov (United States)

    Two organizations in Massachusetts have been awarded 181,864 in Environmental Education Grants by the US Environmental Protection Agency to support their work in addressing a range of topics in classrooms.

  6. EPA Awards Environmental Education Grants to Four Massachusetts Organizations

    Science.gov (United States)

    Four Massachusetts organizations were awarded a total of $275,332 by the US Environmental Protection Agency for programs that will educate the community about climate change and other environmental issues.

  7. 75 FR 3729 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-01-22

    ... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean Air... Federal Register. Draft EISs EIS No. 20090381, ERP No. D-IBR-K65382-CA, New Melones Lakes Area Resource Management Plan, Implementation, Tuolumne and Calaveras Counties, CA. Summary: While EPA has no objections...

  8. 75 FR 11882 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-03-12

    ... comments prepared pursuant to the Environmental Review Process (ERP), under Section 309 of the Clean Air.... Draft EISs EIS No. 20090435, ERP No. D-APH-A65798-00, Glyphosate-Tolerant Alfalfa Events J101 and J163: Request for Non-Regulated Status, Implementation, United States. Summary: EPA does not object to...

  9. 75 FR 14593 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-03-26

    ..., Implementation. Summary: EPA does not object to the proposed action. Rating LO. EIS No. 20100005, ERP No. DS-FHW... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean Air.... Draft EISs EIS No. 20090429, ERP No. D-IBR-L39067-ID, Minidoka Dam Spillway Replacement Project,...

  10. 75 FR 13275 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-03-19

    ... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean Air... Federal Register. Draft EISs EIS No. 20090438, ERP No. D-NPS-C61013-NY, Roosevelt-Vanderbilt National Historic Sites, General Management Plan, Implementation, Hyde Park, NY. Summary: EPA does not object to...

  11. Notification: Hotline Complaint Regarding the EPA Region 4 Environmental Justice Program

    Science.gov (United States)

    Project #OPE-FY12-0017, September 17, 2012. We have completed the preliminary research portion ofour evaluation, Hotline Complaint Regarding the EPA Region 4 Environmental Justice Program (OPE FY12-0017) and will now continue into the fieldwork phase.

  12. U.S. EPA Environmental Technology Verification Program, the Founder of the ETV Concept

    Science.gov (United States)

    The U.S. EPA Environmental Technology Verification (ETV) Program develops test protocols and verifies the performance of innovative technologies that have the potential to improve protection of human health and the environment. The program was created in 1995 to help accelerate t...

  13. LCACCESS: A U.S. EPA-SPONSORED WEBSITE FOR ENVIRONMENTAL LIFE CYCLE ASSESSMENT INFORMATION

    Science.gov (United States)

    The EPA's Office of Research and Development has initiated a project with the aim of encouraging and supporting the use of life cycle assessments (LCA's) in environmental management. While LCA is being recognized internationally as an appropriate tool for dealing with environmen...

  14. Environmental Factor{trademark} system: Superfund site information from five EPA databases

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Environmental Factor puts today`s technology to work to provide a better, more cost-efficient and time-saving way to access EPA information on hazardous waste sites. Environmental consultants, insurers, and reinsurers, corporate risk assessors and companies actively involved in the generation, transport, storage or cleanup of hazardous waste materials can use its user-friendly information retrieval system to gain rapid access to vital information in immediately-usable form. Search, retrieve, and export information in real time. No more waiting for the mail or overnight delivery services to deliver hard copies of voluminous listings and individual site reports. More than 200,000 pages of EPA hazardous waste site information are contained in 5 related databases: (1) Site data from the National Priority List (NPL) and CERCLIS databases, Potentially Responsible Parties (PRP) and Records of Decision (RODs) summaries; (2) Complete PRP information; (3) EPA Records of Decision (Full Text); (4) entire Civil Enforcement Docket; and (5) Glossary of EPA terms, abbreviations and acronyms. Environmental Factor`s powerful database management engine gives even the most inexperienced computer user extensive search capabilities, including wildcard, phonetic and direct cross reference searches across multiple databases.

  15. EPA Administrative Enforcement Dockets

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Administrative Enforcement Dockets database contains the electronic dockets for administrative penalty cases filed by EPA Regions and Headquarters. Visitors...

  16. EPA Grants to Help New York City Communities Address Local Environmental Challenges, Includes Air Sampling Around JFK Airport

    Science.gov (United States)

    (New York, N.Y.) The U.S. Environmental Protection Agency has awarded $84,000 to three New York City organizations working to address environmental contamination in their communities. The grants were awarded under the EPA's Environmental Justice Small Gran

  17. EPA OFFICE OF RESEARCH AND DEVELOPMENT PERSPECTIVES: CAREER DEVELOPMENT, PROFESSIONAL ASSOCIATIONS AND MINORITY STUDENTS' PREPARATION FOR THE ENVIRONMENTAL WORKFORCE

    Science.gov (United States)

    This presentation was given at the Minority Environmental Leadership Development Initiative (MELDI) National Summit on Diversity in the Environmental Field at the University of Michigan on August 30, 2005. The presentation was an outline of how it is like to work at an EPA resea...

  18. Project-Based Learning in Undergraduate Environmental Chemistry Laboratory: Using EPA Methods to Guide Student Method Development for Pesticide Quantitation

    Science.gov (United States)

    Davis, Eric J.; Pauls, Steve; Dick, Jonathan

    2017-01-01

    Presented is a project-based learning (PBL) laboratory approach for an upper-division environmental chemistry or quantitative analysis course. In this work, a combined laboratory class of 11 environmental chemistry students developed a method based on published EPA methods for the extraction of dichlorodiphenyltrichloroethane (DDT) and its…

  19. 7 CFR 650.21 - Working relations with the U.S. Environmental Protection Agency (EPA) and related State...

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE SUPPORT ACTIVITIES COMPLIANCE WITH NEPA Related Environmental Concerns § 650.21 Working relations... representatives of EPA and state environmental agencies in matters of mutual concern within his state. (d... 7 Agriculture 6 2010-01-01 2010-01-01 false Working relations with the U.S....

  20. EPA Regional Boundaries (EPA.EPA_REGIONS) GIS Layer

    Data.gov (United States)

    U.S. Environmental Protection Agency — Each EPA Regional Office is responsible within its states for the execution of the Agency's programs. EPA has ten regional offices, each of which is responsible for...

  1. Environmental Monitoring, Water Quality - WATER_QUALITY_STATISTICS_EPA_IN: Water Quality Monitoring and Data Summaries Indiana, Derived from EPA BASINS (United States Environmental Protection Agency, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — WATER_QUALITY_STATISTICS_EPA_IN is a point shapefile developed by the USEPA BASINS 3.0 program and edited by Bernardin, Lochmueller and Associates. Points represent...

  2. Headache symptoms and indoor environmental parameters: Results from the EPA BASE study.

    Science.gov (United States)

    Tietjen, Gretchen E; Khubchandani, Jagdish; Ghosh, Somik; Bhattacharjee, Suchismita; Kleinfelder, Joann

    2012-08-01

    The objective of this investigation was to determine the prevalence of migraine and headache symptoms in a national sample of US office employees. Also, we explored the association of headache symptoms with indoor environmental parameters of the work place. Sick building syndrome (SBS), which includes headache, is a common global phenomenon, but the underlying environmental cause is uncertain. We used data from the 1994-1998 US Environmental Protection Agency's (EPA) Building Assessment and Survey Evaluation, a cross-sectional study of workers employed in 100 public and private office buildings across 25 states. The study used a self-administered questionnaire to assess headache frequency and prevalence of self-reported physician-diagnosed (SRPD) migraine. Indoor environmental parameters (IEP) were collected per EPA protocol from each building over a 1-week period and included carbon dioxide, carbon monoxide, temperature, relative humidity, particulate matter, volatile organic compound, illuminance, and sound level. The standards of American Society of Heating, Refrigerating and Air Conditioning Engineers were used to categorize IEP as either within- or out-of-comfort range for human dwelling. These limits delineate whether a parameter value is safe for human dwelling. Out-of-comfort range IEPs are associated with SBS and other human diseases. SRPD migraine and headache frequency were the primary outcome measures of the study. Multivariate logistic regression analyses were employed for the purpose of assessing the association between the outcome variable and IEPs. Of the 4326 participants, 66% were females and 60% were between 30 and 49 years. Headache frequency during the last 4 weeks was as follows: None in 31%, 1-3 days in 38%, 1-3 days per week in 18%, and every or almost every workday in 8%. Females had higher SRPD migraine prevalence compared to males (27% vs. 11%, PIEP out-of-comfort range, and odds of exposure to out-of-comfort range IEPs were higher in

  3. Headache symptoms and indoor environmental parameters: Results from the EPA BASE study

    Directory of Open Access Journals (Sweden)

    Gretchen E Tietjen

    2012-01-01

    Full Text Available Objective: The objective of this investigation was to determine the prevalence of migraine and headache symptoms in a national sample of US office employees. Also, we explored the association of headache symptoms with indoor environmental parameters of the work place. Background: Sick building syndrome (SBS, which includes headache, is a common global phenomenon, but the underlying environmental cause is uncertain. Materials and Methods: We used data from the 1994-1998 US Environmental Protection Agency′s (EPA Building Assessment and Survey Evaluation, a cross-sectional study of workers employed in 100 public and private office buildings across 25 states. The study used a self-administered questionnaire to assess headache frequency and prevalence of self-reported physician-diagnosed (SRPD migraine. Indoor environmental parameters (IEP were collected per EPA protocol from each building over a 1-week period and included carbon dioxide, carbon monoxide, temperature, relative humidity, particulate matter, volatile organic compound, illuminance, and sound level. The standards of American Society of Heating, Refrigerating and Air Conditioning Engineers were used to categorize IEP as either within- or out-of-comfort range for human dwelling. These limits delineate whether a parameter value is safe for human dwelling. Out-of-comfort range IEPs are associated with SBS and other human diseases. SRPD migraine and headache frequency were the primary outcome measures of the study. Multivariate logistic regression analyses were employed for the purpose of assessing the association between the outcome variable and IEPs. Results: Of the 4326 participants, 66% were females and 60% were between 30 and 49 years. Headache frequency during the last 4 weeks was as follows: None in 31%, 1-3 days in 38%, 1-3 days per week in 18%, and every or almost every workday in 8%. Females had higher SRPD migraine prevalence compared to males (27% vs. 11%, P<0.001 and were more

  4. EPA Envirofacts API

    Data.gov (United States)

    U.S. Environmental Protection Agency — Envirofacts integrates information from a variety of EPA's environmental databases. Each of these databases contains information about facilities that are required...

  5. EPA Web Taxonomy

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPA's Web Taxonomy is a faceted hierarchical vocabulary used to tag web pages with terms from a controlled vocabulary. Tagging enables search and discovery of EPA's...

  6. EPA eXcats

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA eXcats is an enterprise-level data tracking application that provides management complaint tracking information for the EPA's Office of Civil Rights (OCR)...

  7. Environmental Factor(tm) system: Superfund site information from five EPA databases (on cd-rom). Database

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    Environmental Factor puts today`s technology to work to provide a better, more cost-efficient and time-saving way to access EPA information on hazardous waste sites. Environmental consultants, insurers, and reinsurers, corporate risk assessors and companies actively involved in the generation, transport, storage or cleanup of hazardous waste materials can use its user-friendly information retrieval system to gain rapid access to vital information in immediately-usable form. Search, retrieve, and export information in real time. No more waiting for the mail or overnight delivery services to deliver hard copies of voluminous listings and individual site reports. More than 200,000 pages of EPA hazardous waste site information are contained in 5 related databases: (1) Site data from the National Priority List (NPL) and CERCLIS databases, Potentially Responsible Parties (PRP) and Records of Decision (RODs) summaries; (2) Complete PRP information; (3) EPA Records of Decision (Full Text); (4) entire Civil Enforcement Docket; and (5) Glossary of EPA terms, abbreviations and acronyms. Environmental Factor`s powerful database management engine gives even the most inexperienced computer user extensive search capabilities, including wildcard, phonetic and direct cross reference searches across multiple databases. The first menu option delivers information from the NPL, CERCLIS site data, PRP and RODs summary information. Enter a set of search criteria and then immediately access displays containing information from all of these databases. Get full PRP information and Full Text RODs by using their respective menu options. If your search turns up multiple items, a list of site names appears. To bring up the data, highlight the specific site you want and hit Enter. That`s how easy it is to access the vast amount of data stored in the Environmental Factor CD-ROM.

  8. Environmental Protection Agency (EPA) Facility Registry Service (FRS) Wastewater Treatment Plants

    Data.gov (United States)

    Department of Homeland Security — This GIS dataset contains data on wastewater treatment plants, based on EPA's Facility Registry Service (FRS) and NPDES, along with Clean Watersheds Needs Survey...

  9. Confidential Financial Disclosure Form for Environmental Protection Agency Special Government Employees (EPA Form 3110-48)

    Science.gov (United States)

    EPA uses the Confidential Financial Disclosure Form to determine whether there is a conflict of interest or the appearance of a lack of impartiality with regard to the topic under review by the FIFRA Scientific Advisory Panel.

  10. The US EPA Geographic Information System for mapping environmental releases of toxic chemical release inventory (TRI) chemicals

    Energy Technology Data Exchange (ETDEWEB)

    Stockwell, J.R.; Sorensen, J.W.; Eckert, J.W. Jr.; Carreras, E.M. (Environmental Protection Agency, Atlanta, GA (United States))

    1993-04-01

    This study characterizes the environmental releases of toxic chemicals of the Toxic Chemical Release Inventory (TRI) in the southeastern United States by using the US Environmental Protection Agency (EPA) Geographic Information System (GIS) to map them. These maps show that the largest quantities of TRI releases in the Southeast are usually near densely populated areas. This GIS mapping approach takes the first steps in defining those areas in the region which may be potential exposure zones and which could be strategic targets for future risk screening efforts in this geographic area. 8 refs., 6 figs., 1 tab.

  11. EPA Facilities and Regional Boundaries Service, US, 2012, US EPA, SEGS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This SEGS web service contains EPA facilities, EPA facilities labels, small- and large-scale versions of EPA region boundaries, and EPA region boundaries extended to...

  12. 78 FR 27220 - EPA Activities To Promote Environmental Justice in the Permit Application Process

    Science.gov (United States)

    2013-05-09

    ..., the regional implementation plans reflect a balance between national consistency and regional... appropriately takes into account available resources to engage in this work, variability across EPA regions, and... priority, to the extent such information is available. Locate existing data and studies that are...

  13. EPA awards over $1.9 million to Commonwealth of Northern Mariana Islands for environmental protection

    Science.gov (United States)

    HONOLULU - The U.S. Environmental Protection Agency has awarded over $1.9 million to the Commonwealth of Northern Mariana Islands in federal funds for CNMI environmental programs to continue environmental protection work.

  14. ENVIRONMENTAL HEALTH RISKS: Information on EPA’s Draft Reassessment of Dioxins

    Science.gov (United States)

    2002-04-01

    basis that the source animals had unusually high levels of dioxin exposure . However, the analysis does not explain why the ratios (and thus the overall...sensitive to dioxin exposure , and newborns may also be more vulnerable to certain effects. Some individuals or groups of individuals may be exposed to...of dioxin exposure . 4. Reviewers thought EPA identified important “special populations” of highly exposed individuals and suggested that the agency

  15. US EPA EJ Grants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a provisional dataset that contains point locations for all Environmental Justice (EJ) grants given out by the US EPA. There are many limitations to the data...

  16. Sediment Types - SEDIMENT_INVENTORY_EPA_IN: National Sediment Inventory (NSI) and Data Summaries in Indiana, Derived from EPA BASINS 3 (United States Environmental Protection Agency, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — SEDIMENT_INVENTORY_EPA_IN is a point shapefile from the National Sediment Inventory developed by the USEPA BASINS 3.0 program and edited by Bernardin, Lochmueller...

  17. Dam Inventory - DAMS_1996_EPA_IN: Inventory of Dams in Indiana, Derived from EPA BASINS (United States Environmental Protection Agency, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — DAMS_1996_EPA_IN is a point shapefile developed by the USEPA BASINS 3.0 program and clipped by Bernardin, Lochmueller and Associates. Clips were performed using the...

  18. ACTA Technology Presents EPA with Patent Copy

    Science.gov (United States)

    US EPA SBIR awardee, ACTA Technology, presented James H. Johnson, Director of the US EPA National Center for Environmental Research, and April Richards, Program Manager of the US EPA's SBIR Program, with a copy of their Red Ribbon patent.

  19. Potential Environmental Justice (EJ) areas in Region 2 based on 2000 Census [EPA.EJAREAS_2000

    Data.gov (United States)

    U.S. Environmental Protection Agency — Potential Environmental Justice (EJ) areas in Region 2 . This dataset was derived from 2000 census data and based on the criteria setforth in the Region 2 Interim...

  20. EPA Awards Providence Group $91K to Advance Environmental Education in Rhode Island

    Science.gov (United States)

    A Providence, R.I. organization that will involve students in becoming smarter and better stewards of the environment was awarded $91,000 for environmental education by the US Environmental Protection Agency.

  1. Environmental Characteristics of EPA, NRC, and DOE Sites Contaminated with Radioactive Substances

    Science.gov (United States)

    This report is one of several documents developed cooperatively by the Interagency Environmental Pathway Modeling Workgroup to help bring a uniform approach to solving environmental modeling problems common to site remediation and restoration efforts.

  2. EPA Announces Grant Funding to the University of Maryland to Support Regional Environmental Finance Center

    Science.gov (United States)

    PHILADELPHIA (August 25, 2015) -- The U.S. Environmental Protection Agency has selected the University of Maryland as one of the nine winners of a six-year grant to support a regional Environmental Finance Center. Through the Environmental Finance C

  3. EPA and a Brief History of Environmental Law in the United States

    Science.gov (United States)

    There are numerous environmental laws in the United States (US) which provide the common purpose to protect human health and the environment. Most current major environmental statutes were passed in a timeframe from the late 1960s through the early 1980s. On 1 January 1970, Pre...

  4. Developments in the EPA Computational Toxicology Program to Identify Environmental Endocrine Disruptors ( Environmental Endocrine Disruptors Gordon Conference)

    Science.gov (United States)

    Presentation at the Environmental Endocrine Disruptors Gordon Conference in Newry, ME June 22, 2016 to give an overview of the use of high throughput screening and high throughput toxicokinetics to build models for endocrine disruption by environmental chemicals for estrogen rece...

  5. NIEHS/EPA CEHCs: Children's Environmental Health and Disease Prevention Center - Dartmouth College

    Science.gov (United States)

    The Columbia Center for Children’s Environmental Health (CCCEH) at Columbia University studies long-term health of urban pollutants on children raised in minority neighborhoods in inner-city communities.

  6. Fact Sheet: Environmental Characteristics of EPA, NRC, and DOE Sites Contaminated with Radioactive Substances

    Science.gov (United States)

    This fact sheet summarizes the findings of a report by a joint Interagency Environmental Pathway Modeling Working Group. It was designed to be used by technical staff responsible for implementing flow and transport models to support cleanup decisions.

  7. NIEHS/EPA Children’s Environmental Health Centers: Lifecourse Exposures & Diet: Epigenetics, Maturation & Metabolic Syndrome

    Science.gov (United States)

    The Columbia Center for Children’s Environmental Health (CCCEH) at Columbia University studies long-term health of urban pollutants on children raised in minority neighborhoods in inner-city communities.

  8. EPA Facilities and Regional Boundaries Download Package, US, 2012, US EPA, SEGS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This downloadable package contains the following layers: EPA facility points, EPA region boundary polygons and EPA region boundary polygons extended to the 200nm...

  9. Interdependences between Smallholder Farming and Environmental Management in Rural Malawi: A Case of Agriculture-Induced Environmental Degradation in Malingunde Extension Planning Area (EPA

    Directory of Open Access Journals (Sweden)

    Kondwani G. Munthali

    2013-04-01

    Full Text Available The objective of this article was to develop a deeper understanding of the interdependences between smallholder farming and the state of environmental management in rural Malawi. We examined the agricultural local governance framework in Malingunde Extension Planning Area (EPA, its contribution to food security and how it conflicts with overall land and forest resources management. The charcoal production process was discussed in line with its implications for agricultural production and environmental sustainability. The smallholder households employ inappropriate land management practices, engage in agricultural production on unsuitable land and use fertile soils, timber and firewood for brick production and construction and secondly engage in charcoal production (deforestation as a coping mechanism against food deficiency. However, while detrimental in its own right, this environmental degradation in the area cannot be explicitly pinned to, for instance, the total charcoal supply being out of balance with wood stocks or insufficient land. It is, rather, usually due to failures to provide incentives to manage land and forest resources in a manner that allows regeneration of both the soils and wood stocks in the area. An improvement in the quality and quantity of the smallholder agriculture sector production would promote significantly the environmental management efforts.

  10. US EPA CARE Grants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a provisional dataset that contains point locations for the subset of Community Action for a Renewed Environment (CARE) grants given out by the US EPA. CARE...

  11. EPA Recovery Mapper

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Recovery Mapper is an Internet interactive mapping application that allows users to discover information about every American Recovery and Reinvestment Act...

  12. EPA Collaboration with Morocco

    Science.gov (United States)

    For the last four years, EPA has been collaborating with Morocco on environmental governance through the Middle East Partnership Initiative (MEPI). Initial work with Morocco focused on water pollution from the textile industry.

  13. 75 FR 6025 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-02-05

    ... concerns about the need to develop a project level adaptive management plan. EIS No. 20090406, ERP No. F... action. EIS No. 20090446, ERP No. F-AFS-K65373-NV, Jarbidge Ranger District Rangeland Management Project... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean...

  14. 2003 JOINT EPA/SAE-ESSC WORKSHOP: ENVIRONMENTAL SYSTEMS DECISION MAKING

    Science.gov (United States)

    This is a report of a workshop held mid-August of 2002 at Northwestern University, Evanton, IL to explore what it takes to make a decision regarding environmental systems in the US. The participants in the workshop represented federal government, industry, non-governmental or...

  15. 75 FR 4810 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-01-29

    ..., ERP No. F-AFS-K65366-CA, Lassen National Forest, Motorized Travel Management Plan, Implementation... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean Air.... Draft EISs EIS No. 20080460, ERP No. D-FHW-J40186-CO, I-70 East Project, Transportation Improvement...

  16. U.S. EPA requires Cupertino cement company to report toxic chemicals, commit to environmental projects

    Science.gov (United States)

    SAN FRANCISCO - The U.S. Environmental Protection Agency announced a settlement with Lehigh Southwest Cement Company for failing to properly report releases of toxic chemicals at its Cupertino, Calif. plant. The company is required to pay a $47,600

  17. 75 FR 2541 - Environmental Impact Statements and Regulations; Availability of EPA Comments

    Science.gov (United States)

    2010-01-15

    ... comments prepared pursuant to the Environmental Review Process (ERP), under section 309 of the Clean Air.... Draft EISs EIS No. 20090324, ERP No. D-AFS-H65031-00, Nebraska National Forests and Grassland Travel... and water quality impacts. Rating EC2. EIS No. 20090337, ERP No. D-BLM-L65522-OR,...

  18. Environmental Monitoring, Water Quality - BACTERIA_MONITORING_EPA_IN: Bacteria Monitoring Stations and Data Summaries in Indiana, Derived from EPA BASINS 3 (United States Environmental Protection Agency, 1:45,000, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — BACTERIA_MONITORING_EPA_IN is a point shapefile developed by the USEPA BASINS 3.0 program and edited by Bernardin, Lochmueller and Associates. Joinable tables must...

  19. Environmental Health: Opportunities for Greater Focus, Direction, and Top-Level Commitment to Children's Health at EPA. Testimony Before the Committee on Environment and Public Works, U.S. Senate. GAO-10-545T

    Science.gov (United States)

    Stephenson, John B.

    2010-01-01

    This testimony discusses highlights of GAO's report about the Environmental Protection Agency's (EPA) efforts to institutionalize the protection of children's health. EPA's mission is to protect human health and the environment. As a result of mounting evidence about the special vulnerabilities of the developing fetus and child, the federal…

  20. drdk.dk

    DEFF Research Database (Denmark)

    Brügger, Niels

    2007-01-01

    Netsted i forbindelse med forskningsprojektet 'dr.dks historie 1996-2006'. Indeholder bl.a. forskerblog om forskningsprojektet ”dr.dks historie 1996-2006” samt om aktuelle internet- og dr.dk-relevante forhold (10. januar 2008-) samt en wiki om dr.dks historie, 1996-2006 (29. november 2009-)...

  1. Sprogvurdering.dk

    DEFF Research Database (Denmark)

    Jensen, Kasper Østerholdt; Jørgensen, Rune Nørgaard; Bleses, Dorthe

    2009-01-01

    Elektronisk registrering af sprogvurderinger landet over åbner for spændende perspektiver for praksis og forskning. For den logopædiske praksis giver Sprogvurdering.dk mulighed for lettilgængeligt overblik og indblik i sprogvurderingsindsatsen i forhold til kommune, dagtilbud og det enkelte barn....

  2. UMTRA Project remedial action planning and disposal cell design to comply with the proposed EPA (Environmental Protection Agency) standards (40 CFR Part 192)

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    The Uranium Mill Tailings Remedial Action (UMTRA) Project involves stabilizing 24 inactive uranium mill tailings piles in 10 states. Remedial work must meet standards established by the US Environmental Protection Agency (EPA). Remedial action must be designed and constructed to prevent dispersion of the tailings and other contaminated materials, and must prevent the inadvertent use of the tailings by man. This report is prepared primarily for distribution to parties involved in the UMTRA Project, including the US Nuclear Regulatory Commission (NRC), and states and tribes. It is intended to record the work done by the DOE since publication of the proposed EPA groundwater protection standards, and to show how the DOE has attempted to respond and react in a positive way to the new requirements that result from the proposed standards. This report discusses the groundwater compliance strategies now being defined and implemented by the DOE, and details the changes in disposal cell designs that result from studies to evaluate ways to facilitate compliance with the proposed EPA groundwater protection standards. This report also serves to record the technical advances, planning, and progress made on the UMTRA Project since the appearance of the proposed EPA groundwater protection standards. The report serves to establish, document, and disseminate technical approaches and engineering and groundwater information to people who may be interested or involved in similar or related projects. 24 refs., 27 figs., 8 tabs.

  3. Enforcement Alert: U.S. EPA Encourages Iron and Steel Minimills to Self Audits to Address Noncompliance with Environmental Requirements; Nucor Corp. agrees to Control Practices; Provides Model for Industry

    Science.gov (United States)

    This is the enforcement alert for U.S. EPA Encourages Iron and Steel Minimills to Self Audits to Address Noncompliance with Environmental Requirements; Nucor Corp. agrees to Control Practices; Provides Model for Industry

  4. EPA Calls for the 21st Presidential Green Chemistry Award Nominations/Program promotes environmental and economic benefits of using novel green technologies in chemical design, manufacture, and use

    Science.gov (United States)

    WASHINGTON - Today, the U.S. Environmental Protection Agency (EPA) announced its request for nominations for its 2016 Presidential Green Chemistry Challenge Awards for companies or institutions that have developed a process or product that better pr

  5. 2011 EPA Pesticide General Permit (PGP)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The 2011 EPA Pesticide General Permit (PGP) covers discharges of biological pesticides, and chemical pesticides that leave a residue, in areas where EPA is the NPDES...

  6. U.S. EPA Metadata Editor (EME)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EPA Metadata Editor (EME) allows users to create geospatial metadata that meets EPA's requirements. The tool has been developed as a desktop application that...

  7. Easy, fast and environmental friendly method for the simultaneous extraction of the 16 EPA PAHs using magnetic molecular imprinted polymers (mag-MIPs).

    Science.gov (United States)

    Villar-Navarro, Mercedes; Martín-Valero, María Jesús; Fernández-Torres, Rut Maria; Callejón-Mochón, Manuel; Bello-López, Miguel Ángel

    2017-02-15

    An easy and environmental friendly method, based on the use of magnetic molecular imprinted polymers (mag-MIPs) is proposed for the simultaneous extraction of the 16 U.S. EPA polycyclic aromatic hydrocarbons (PAHs) priority pollutants. The mag-MIPs based extraction protocol is simple, more sensitive and low organic solvent consuming compared to official methods and also adequate for those PAHs more retained in the particulate matter. The new proposed extraction method followed by HPLC determination has been validated and applied to different types of water samples: tap water, river water, lake water and mineral water.

  8. CalEnviroScreen 1.0 (CES) Group, California, 2013, California EPA and Office of Environmental Health Hazard Assessment

    Data.gov (United States)

    U.S. Environmental Protection Agency — Developed jointly by the Agency and the Office of Environmental Health Hazard Assessment (OEHHA), the tool uses data about 11 types of pollution and environmental...

  9. Experience City.DK

    DEFF Research Database (Denmark)

    Marling, Gitte; Kiib, Hans; Jensen, Ole B.

    I de seneste 20 år er der foretaget meget store investeringer i kulturhuse, museer og koncertsale. Mange nye spillesteder og "performancehuse" er dukket op, og som noget nyt sker der en samlokalisering af forskellige kunstarter med cafemiljøer, uddannelsesmiljøer, bibliotekter og virksomheder med...... bydele omtales som "oplevelsesbyen". Den kulturelle podning stiller krav til de fysiske omgivelser, til arkitekturen og til design af byrum. Experience City.DK undersøger betingelser for og konsekvenser af nye hybride kulturprojekter og performative byrum i danske byer....

  10. Energy and Emissions at EPA

    Science.gov (United States)

    To demonstrate its leadership in energy and environmental stewardship, EPA is committed to managing its own facilities and operations in a way that minimizes greenhouse gas (GHG) emissions and energy use.

  11. EPA Region 1 Tribal Lands

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a dataset of Tribal/Native American lands in the New England region. EPA notes that there are some disputes over the exact boundaries of the territories of...

  12. EPA Awards $91,000 Environmental Education Grant to Woonasquatucket River Watershed Council in Providence, R.I.

    Science.gov (United States)

    The U.S. Environmental Protection Agency has awarded a $91,000 environmental education grant to the Woonasquatucket River Watershed Council in Providence, R.I. to work on a two-year effort to educate K-12 students in greater Providence about environmental

  13. Sundhedsmappen.dk

    DEFF Research Database (Denmark)

    Christensen, Kaj Sparle; Mortensen, Marie; Beyer, Hanne;

    2013-01-01

    Den praktiserende læge anvender et bredt udvalg af diagnostiske redskaber, fx psykometriske test, hjemmeblodtryksmålinger, hovedpinedagbøger, væske-vandladningsskemaer osv. Disse målinger udføres i dag ofte ved hjælp af papirbaserede skemaer og kuglepen og bliver derfor sjældent systematisk...... praksis - i et fælles elektronisk bibliotek, som både lægen og patienten har adgang til. De første skemaer, der bliver stillet rådighed, er Major Depression Inventory (MDI) og Angst Symptom Skemaet (ASS) til diagnostik og monitorering af depression og angsttilstande. Sundhedsmappen.dk, der er oprettet på...

  14. NEPA, EPA and risk assessment: Has EPA lost its way?

    Science.gov (United States)

    Calabrese, Edward J

    2012-11-01

    The EPA risk assessment practice denies the inclusion of beneficial responses in the evaluation process. This practice represents a marked deviation from the original guidelines set forth within NEPA, which required the integrated goal of environmental protection as including both a reduction in risk as well as an enhancement of health benefit. It is time for regulatory agencies such as EPA to incorporate both harm and benefit within its risk assessment process.

  15. EPA/AEERL (Environmental Protection Agency/Air and Energy Engineering Research Laboratory) source testing program for coal-gasification technologies (Kosovo test site)

    Energy Technology Data Exchange (ETDEWEB)

    Bombaugh, K.J.; Rhodes, W.J.

    1985-01-01

    The paper summarizes EPA's environmental assessment testing program for synthetic fuels technology, with emphasis on the Kosovo source test and evaluation program. The Kosovo program included: (a) field tests to characterize process waste streams that would be input to control technologies in U.S. synfuels plants, (b) characterization of fugitive emissions, and (c) characterization of components in the ambient air and correlation of those components with source-characterization data. Results from the Kosovo program have been (and are being ) used: (a) to evaluate and select pollution control technologies for U.S. coal-gasification plants using pressurized fixed-bed gasification technology, (b) as input to health studies, (c) to develop worker health and safety programs for U.S. synfuels plants, (d) to acquire environmental permits that address regulated and nonregulated pollutants, (e) to develop supplemental environmental monitoring plans required by the U.S. Synthetic Fuels Corporation, and (f) to develop and validate ambient air-monitoring methodology.

  16. EPA-developed, patented technologies related to miscellaneous areas of environmental experties and invention that are available for licensing

    Data.gov (United States)

    U.S. Environmental Protection Agency — Under the Federal Technology Transfer Act (FTTA), Federal Agencies can patent inventions developed during the course of research. These technologies can then be...

  17. NIEHS/EPA Children’s Environmental Health Centers: Novel Methods to Assess Effects of Chemicals on Child Development

    Science.gov (United States)

    The Columbia Center for Children’s Environmental Health (CCCEH) at Columbia University studies long-term health of urban pollutants on children raised in minority neighborhoods in inner-city communities.

  18. U.S. EPAs Geospatial Data Access Project

    Data.gov (United States)

    U.S. Environmental Protection Agency — To improve public health and the environment, the United States Environmental Protection Agency (EPA) collects information about facilities, sites, or places...

  19. US EPA Region 4 RMP Facilities

    Science.gov (United States)

    To improve public health and the environment, the United States Environmental Protection Agency (USEPA) collects information about facilities, sites, or places subject to environmental regulation or of environmental interest. Through the Geospatial Data Download Service, the public is now able to download the EPA Geodata shapefile containing facility and site information from EPA's national program systems. The file is Internet accessible from the Envirofacts Web site (http://www.epa.gov/enviro). The data may be used with geospatial mapping applications. (Note: The shapefile omits facilities without latitude/longitude coordinates.) The EPA Geospatial Data contains the name, location (latitude/longitude), and EPA program information about specific facilities and sites. In addition, the file contains a Uniform Resource Locator (URL), which allows mapping applications to present an option to users to access additional EPA data resources on a specific facility or site.

  20. EPA RE-Powering Mapper Feasibility Studies

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  1. EPA RE-Powering Mapper Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  2. EPA RE-Powering Mapper Completed Installations

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  3. EPA RE-Powering Mapper Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  4. EPA RE-Powering Mapper Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  5. EPA RE-Powering Mapper Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  6. EPA RE-Powering Mapper Large Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  7. EPA RE-Powering Mapper Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  8. EPA RE-Powering Screening Shapefile

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Center for Program Analysis (CPA) initiated the RE-Powering America’s...

  9. EPA RE-Powering Mapper Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  10. EPA RE-Powering Mapper Utility Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  11. EPA RE-Powering Mapper Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  12. EPA RE-Powering Mapper Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  13. EPA RE-Powering Mapper Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  14. EPA RE-Powering Mapper Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  15. Aggregating Data for Computational Toxicology Applications: The U.S. Environmental Protection Agency (EPA Aggregated Computational Toxicology Resource (ACToR System

    Directory of Open Access Journals (Sweden)

    Elaine A. Cohen Hubal

    2012-02-01

    Full Text Available Computational toxicology combines data from high-throughput test methods, chemical structure analyses and other biological domains (e.g., genes, proteins, cells, tissues with the goals of predicting and understanding the underlying mechanistic causes of chemical toxicity and for predicting toxicity of new chemicals and products. A key feature of such approaches is their reliance on knowledge extracted from large collections of data and data sets in computable formats. The U.S. Environmental Protection Agency (EPA has developed a large data resource called ACToR (Aggregated Computational Toxicology Resource to support these data-intensive efforts. ACToR comprises four main repositories: core ACToR (chemical identifiers and structures, and summary data on hazard, exposure, use, and other domains, ToxRefDB (Toxicity Reference Database, a compilation of detailed in vivo toxicity data from guideline studies, ExpoCastDB (detailed human exposure data from observational studies of selected chemicals, and ToxCastDB (data from high-throughput screening programs, including links to underlying biological information related to genes and pathways. The EPA DSSTox (Distributed Structure-Searchable Toxicity program provides expert-reviewed chemical structures and associated information for these and other high-interest public inventories. Overall, the ACToR system contains information on about 400,000 chemicals from 1100 different sources. The entire system is built using open source tools and is freely available to download. This review describes the organization of the data repository and provides selected examples of use cases.

  16. EPA Facility Locations and Regional Boundaries - National Geospatial Data Asset (NGDA)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This downloadable package contains the following layers: EPA facility points, EPA region boundary polygons and EPA region boundary polygons extended to the 200nm...

  17. Abandoned Uranium Mines (AUM) Site Screening Map Service, 2016, US EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — As described in detail in the Five-Year Report, US EPA completed on-the-ground screening of 521 abandoned uranium mine areas. US EPA and the Navajo EPA are using the...

  18. EPA Recognizes Dallas Stars for Reducing Food Waste

    Science.gov (United States)

    DALLAS - (Jan. 29, 2015) The U.S. Environmental Protection Agency (EPA) recently recognized the Dallas Stars of the National Hockey League for the team's achievements in reducing food waste. The Stars participated in EPA's Food Recovery Challenge, w

  19. Notification: EPA Investments in Information Technology Products and Services

    Science.gov (United States)

    Project #OA-FY14-0307, June 10, 2014. The U.S. Environmental Protection Agency (EPA) Office oflnspector General (OIG) plans to begin preliminary research on the EPA's management of information technology (IT) investments.

  20. EPA Region 1 Coast Guard Jurisdictional Boundary - Polygons

    Data.gov (United States)

    U.S. Environmental Protection Agency — Jurisdictional boundary between EPA and Coast Guard for EPA Region I. Created from 1:100000 USGS DLGs with greater detail drawn from 1:24000 commercial street data...

  1. EPA Facility Registry Service (FRS): Wastewater Treatment Plants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This GIS dataset contains data on wastewater treatment plants, based on EPA's Facility Registry Service (FRS), EPA's Integrated Compliance Information System (ICIS)...

  2. EPA Region 1 Coast Guard Jurisdictional Boundary - Arcs

    Data.gov (United States)

    U.S. Environmental Protection Agency — Jurisdictional boundary between EPA and Coast Guard for EPA Region I. Created from 1:100000 USGS DLGs with greater detail drawn from 1:24000 commercial street data...

  3. U.S. EPAs Public Geospatial Metadata Service

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAs public geospatial metadata service provides external parties (Data.gov, GeoPlatform.gov, and the general public) with access to EPA's geospatial metadata...

  4. 75 FR 77636 - Public Information Exchange on EPA Nanomaterial Case Studies

    Science.gov (United States)

    2010-12-13

    ... AGENCY Public Information Exchange on EPA Nanomaterial Case Studies AGENCY: Environmental Protection... Information on EPA Nanomaterial Case Studies and Their Purpose SUMMARY: EPA is announcing a public meeting to receive comments and questions on the EPA Nanomaterial Case Studies ( http://cfpub.epa.gov/ncea/cfm...

  5. EPA OIG Hotline

    Science.gov (United States)

    The EPA OIG Hotline receives complaints of fraud, waste, and abuse in EPA programs and operations including mismanagement or violations of law, rules, or regulations by EPA employees or program participants.

  6. Sustainable Design of EPA's Campus in Research Triangle Park, NC—Environmental Performance Specifications in Construction Contracts—Section 01450 Sequence of Finishes Installation

    Science.gov (United States)

    Learn more about the special construction scheduling/sequencing requirements and procedures necessary to assure achievement of designed Indoor Air Quality (IAQ) levels for the completed project required by the EPA IAQ Program.

  7. GAC-EPA

    CERN Multimedia

    GAC-EPA

    2012-01-01

    It saddens us deeply to learn of the passing away of Jean-Paul Diss who died suddenly on 7 June 2012 at his home.  A tribute can be read on the GAC-EPA site. * * * * * Information: http://gac-epa.org/ e-mail: gac-epa@gac-epa.org

  8. EPA Facility Registry Service (FRS): RADINFO

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  9. Level III Ecoregions of EPA Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  10. Level III Ecoregions of EPA Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  11. Level IV Ecoregions of EPA Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  12. Level III Ecoregions of EPA Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  13. Level IV Ecoregions of EPA Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  14. Level IV Ecoregions of EPA Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  15. Level IV Ecoregions of EPA Region 6

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  16. Level III Ecoregions of EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  17. Level IV Ecoregions of EPA Region 8

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  18. 2013 EPA Vessels General Permit (VGP)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Information for any vessel that submitted a Notice of Intent (NOI), Notice of Termination (NOT), or annual report under EPA's 2013 Vessel General Permit (VGP)....

  19. EPA Facility Registry Service (FRS): NCDB

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  20. Registry of EPA Applications, Models, and Databases

    Data.gov (United States)

    U.S. Environmental Protection Agency — READ is EPA's authoritative source for information about Agency information resources, including applications/systems, datasets and models. READ is one component of...

  1. EPA Facility Registry Service (FRS): BIA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  2. EPA Facility Registry System (FRS): NEPT

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  3. EPA Facility Registry Service (FRS): BRAC

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  4. Level IV Ecoregions of EPA Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  5. Level IV Ecoregions of EPA Region 3

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  6. Level III Ecoregions of EPA Region 10

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  7. Level III Ecoregions of EPA Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  8. Level IV Ecoregions of EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions for EPA Administrative Regions were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the...

  9. Level III Ecoregions of EPA Region 5

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  10. Level III Ecoregions of EPA Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  11. EPA Facility Registry Service (FRS): ICIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  12. Level IV Ecoregions of EPA Region 7

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  13. Level III Ecoregions of EPA Region 2

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  14. EPA Region 1 Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage contains boundaries of EPA-approved sole source aquifers. Sole source aquifers are defined as an aquifer designated as the sole or principal source of...

  15. EPA Holds National Sustainable Design Expo

    Science.gov (United States)

    WASHINGTON, DC - Environmental Protection Agency (EPA) Deputy Administrator Stan Meiburg will open the 11th Annual National Sustainable Design Expo Saturday morning in Alexandria, Va. The expo will host student teams from colleges and universities across t

  16. EPA Facility Registry Service (FRS): LANDFILL

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of non-hazardous waste...

  17. EPA Facility Registry Service (FRS): RBLC

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  18. Checklist for Reviewing EPA Quality Management Plans

    Science.gov (United States)

    This checklist will be used to review the Quality Management Plans (QMPs) that are submitted to the Quality Staff of the Office of Environmental Information (OEI) for Agency review under EPA Order 5360.1 A2.

  19. Substance Identification Information from EPA's Substance Registry

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Substance Registry Services (SRS) is the authoritative resource for basic information about substances of interest to the U.S. EPA and its state and tribal...

  20. Reservoirs, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  1. EPA Facility Registry Service (FRS): ACRES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service consists of location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of sites that link to...

  2. EPA Facility Registry Service (FRS): RMP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  3. EPA Facility Registry System (FRS): NCES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  4. EPA Facility Registry Service (FRS): Power Plants

    Data.gov (United States)

    U.S. Environmental Protection Agency — This GIS dataset contains data on power plants, based on the Energy Information Administration's EIA-860 dataset and supplemented with data from EPA's Facility...

  5. EPA Facility Registry Service (FRS): TRI

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  6. Level IV Ecoregions of EPA Region 4

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  7. "EPA'S NATIONAL BEACHES STUDY: HUNTINGTON BEACH, 2003"

    Science.gov (United States)

    The original U. S. Environmental Protection Agency (EPA) recreational water health studies, initiated in 1972 and completed in 1982, were designed to determine the relationship between swimming-associated gastroenteritis and the quality of the bathing water. However, these healt...

  8. Springs, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  9. Wellheads, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  10. Level III Ecoregions of EPA Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  11. EPA Region 1 - Valley Depth in Meters

    Data.gov (United States)

    U.S. Environmental Protection Agency — Raster of the Depth in meters of EPA-delimited Valleys in Region 1. Valleys (areas that are lower than their neighbors) were extracted from a Digital Elevation Model...

  12. Methane Tracking and Mitigation Options - EPA CMOP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains the sub-model for EPA's MARKAL model, which tracks methane emissions from the energy system, and limited other sources (landfills and manure...

  13. Level IV Ecoregions of EPA Region 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ecoregions by EPA region were extracted from the seamless national shapefile. Ecoregions denote areas of general similarity in ecosystems and in the type, quality,...

  14. EPA Facility Registry Service (FRS): NEI

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  15. EPA Administrative Law Judge Legal Documents

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains Decisions and Orders originating from EPAs Office of Administrative Law Judges (OALJ), which is an independent office in the Office of the...

  16. EPA Facility Registry Service (FRS): CAMDBS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  17. EPA Facility Registry Service (FRS): OIL

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link to the Oil...

  18. Protect Childrens Health with EPA School App

    Science.gov (United States)

    DALLAS - (Aug. 24, 2015) Are you looking for ways to promote a healthier learning environment, reduce absenteeism, improve test scores or enhance student or staff productivity? The U.S. Environmental Protection Agency (EPA) recently launched a new m

  19. EPA Facility Registry Service (FRS): RCRA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of hazardous waste...

  20. EPA Facility Registry Service (FRS): SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  1. WAsP engineering DK

    DEFF Research Database (Denmark)

    Mann, Jakob; Astrup, Poul; Kristensen, Leif;

    2000-01-01

    This report summarizes the findings of the EFP project WAsP Engineering Version 1.0 DK - Vindforhold for vindmølledesign. WAsP Engineering is a series of experimental and theoretical activities concerning properties of the winds in moderately complexterrain with relevance for loads on wind turbines...... and other large structures. These properties include extreme winds, wind shear and turbulence. Most of the models have been integrated in a windows program prototype, also called WAsP Engineering. Thebasic mean flow model LINCOM has been changed in several respects to accommodate the demands from load...

  2. Decomposition Theorems and Conjugate Pair in DK Spaces

    Institute of Scientific and Technical Information of China (English)

    Ji Zhen ZHOU; Yu Tian WU

    2014-01-01

    Let K be a right-continuous and nondecreasing function. A function f analytic in the unit disk D belongs to the space DK if ?D|f?(z)|2K(1-|z|2)dA(z)<∞. Decomposition theorems for DK spaces are established in this paper. As an application, we obtain a characterization of interpolation by functions in DK spaces. Furthermore, we characterize functions in DK spaces by conjugate pairs.

  3. AcEST: DK944247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK944247 - Show DK944247 Clone id YMU02A01NGRL0005_G24 Library YMU02 Length 128 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_G24. 5' end sequence. Accession DK944247 Tissue t

  4. AcEST: DK944432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK944432 - Show DK944432 Clone id YMU02A01NGRL0006_A18 Library YMU02 Length 104 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_A18. 5' end sequence. Accession DK944432 Tissue t

  5. National Air Toxics Assessment - 2002, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  6. National Air Toxics Assessment - 2005, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  7. National Air Toxics Assessment - 1999, EPA Region 2 (EPA.AIR.NATA99_R2)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...

  8. AcEST: DK962247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK962247 CL304Contig1 Show DK962247 Clone id TST39A01NGRL0013_F15 Library TST39 Length 5...92 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_F15. 5' end sequence. Accession DK962247...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962247|Adiantum capillu...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962247|Adiantum capi...ICASALNARCGAEQTQTVTRESSTITI 103 Query: 247 TQARQKENLPKLDDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFIKEKEKD 426

  9. AcEST: DK957247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK957247 CL1064Contig1 Show DK957247 Clone id TST39A01NGRL0027_N22 Library TST39 Length ...540 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0027_N22. 5' end sequence. Accession DK957247... Acids Res. 25:3389-3402. Query= DK957247|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0027_N22, 5' (5... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957247|Adiant

  10. AcEST: DK952247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK952247 CL745Contig1 Show DK952247 Clone id TST38A01NGRL0013_J09 Library TST38 Length 5...88 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_J09. 5' end sequence. Accession DK952247...rams, Nucleic Acids Res. 25:3389-3402. Query= DK952247|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL00...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952247|Ad

  11. AcEST: DK956247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK956247 CL1315Contig1 Show DK956247 Clone id TST39A01NGRL0025_D22 Library TST39 Length ...614 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_D22. 5' end sequence. Accession DK956247...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956247...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956247|Adiantum capillus-veneris mRNA, clo

  12. AcEST: DK960247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK960247 - Show DK960247 Clone id TST39A01NGRL0006_O09 Library TST39 Length 667 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_O09. 5' end sequence. Accession DK960247 Tissue t...ams, Nucleic Acids Res. 25:3389-3402. Query= DK960247|Adiantum capillus-veneris m...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960247|Adiantum capillus-

  13. AcEST: DK950247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK950247 CL15Contig1 Show DK950247 Clone id TST38A01NGRL0008_C11 Library TST38 Length 66...4 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_C11. 5' end sequence. Accession DK950247...cids Res. 25:3389-3402. Query= DK950247|Adiantum capillus-veneris mRNA, clone: TS...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950247|Adiantum capill

  14. AcEST: DK959247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK959247 CL3392Contig1 Show DK959247 Clone id TST39A01NGRL0004_C19 Library TST39 Length ...669 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_C19. 5' end sequence. Accession DK959247...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959247...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959247

  15. AcEST: DK948247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK948247 - Show DK948247 Clone id TST38A01NGRL0002_N02 Library TST38 Length 660 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_N02. 5' end sequence. Accession DK948247 Tissue t...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948247|Adiantum cap...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948247|Adiantum capillus-veneris

  16. AcEST: DK945247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK945247 CL259Contig1 Show DK945247 Clone id YMU02A01NGRL0008_L06 Library YMU02 Length 7...63 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_L06. 5' end sequence. Accession DK945247...s. 25:3389-3402. Query= DK945247|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0008_L06, 5' (736 letter...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945247|Adiantum capillus-veneris mRNA, cl

  17. AcEST: DK946247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK946247 CL1Contig2 Show DK946247 Clone id YMU02A01NGRL0011_P11 Library YMU02 Length 150... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_P11. 5' end sequence. Accession DK946247...25:3389-3402. Query= DK946247|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0011_P11, 5' (120 letters) ...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946247|Ad

  18. AcEST: DK963247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK963247 - Show DK963247 Clone id TST39A01NGRL0016_A09 Library TST39 Length 624 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_A09. 5' end sequence. Accession DK963247 Tissue t...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963247...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963247|Adiantum capillus-veneris mRNA

  19. AcEST: DK951247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK951247 CL112Contig1 Show DK951247 Clone id TST38A01NGRL0010_O09 Library TST38 Length 6...51 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_O09. 5' end sequence. Accession DK951247...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951247... Acids Res. 25:3389-3402. Query= DK951247|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0010_O09, 5' (6

  20. AcEST: DK954247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK954247 CL2Contig2 Show DK954247 Clone id TST39A01NGRL0019_P01 Library TST39 Length 625... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_P01. 5' end sequence. Accession DK954247...ds Res. 25:3389-3402. Query= DK954247|Adiantum capillus-veneris mRNA, clone: TST3... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954247

  1. AcEST: DK949247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK949247 CL97Contig2 Show DK949247 Clone id TST38A01NGRL0005_H18 Library TST38 Length 68...2 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_H18. 5' end sequence. Accession DK949247...Nucleic Acids Res. 25:3389-3402. Query= DK949247|Adiantum capillus-veneris mRNA, ... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949247|Adian

  2. AcEST: DK953247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK953247 CL1540Contig1 Show DK953247 Clone id TST39A01NGRL0017_E09 Library TST39 Length ...606 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_E09. 5' end sequence. Accession DK953247...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953247|Adian...enic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 Length = 247...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953247|Adiantum capil

  3. AcEST: DK947247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK947247 CL1Contig5 Show DK947247 Clone id YMU02A01NGRL0015_E16 Library YMU02 Length 243... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_E16. 5' end sequence. Accession DK947247...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947247...ams, Nucleic Acids Res. 25:3389-3402. Query= DK947247|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL001

  4. AcEST: DK948100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK948100 CL380Contig1 Show DK948100 Clone id TST38A01NGRL0002_G19 Library TST38 Length 6...89 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_G19. 5' end sequence. Accession DK948100...s Res. 25:3389-3402. Query= DK948100|Adiantum capillus-veneris mRNA, clone: TST38...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948100

  5. AcEST: DK944100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK944100 CL459Contig1 Show DK944100 Clone id YMU02A01NGRL0004_P13 Library YMU02 Length 4...47 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_P13. 5' end sequence. Accession DK944100... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944100... Nucleic Acids Res. 25:3389-3402. Query= DK944100|Adiantum capillus-veneris mRNA,

  6. AcEST: DK951007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK951007 CL5Contig3 Show DK951007 Clone id TST38A01NGRL0010_D21 Library TST38 Length 669... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_D21. 5' end sequence. Accession DK951007...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95100...ams, Nucleic Acids Res. 25:3389-3402. Query= DK951007|Adiantum capillus-veneris m...RGGMQIF Sbjct: 190 PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF 232 Score = 428 bits (1100), Expect = e-118 I

  7. AcEST: DK960100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK960100 - Show DK960100 Clone id TST39A01NGRL0006_H21 Library TST39 Length 690 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_H21. 5' end sequence. Accession DK960100 Tissue t...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960100|Adiantum capillus-veneris mR...ucleic Acids Res. 25:3389-3402. Query= DK960100|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0006_H21,

  8. AcEST: DK951001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK951001 - Show DK951001 Clone id TST38A01NGRL0010_D15 Library TST38 Length 665 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_D15. 5' end sequence. Accession DK951001 Tissue t... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95100...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951001|Adiantum capillus-vener...h = 224 Score = 174 bits (442), Expect = 3e-42 Identities = 100/192 (52%), Positi

  9. AcEST: DK962220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK962220 CL1478Contig1 Show DK962220 Clone id TST39A01NGRL0013_E11 Library TST39 Length ...615 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_E11. 5' end sequence. Accession DK962220... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962220...leic Acids Res. 25:3389-3402. Query= DK962220|Adiantum capillus-veneris mRNA, clo

  10. AcEST: DK957220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK957220 CL2961Contig1 Show DK957220 Clone id TST39A01NGRL0027_M17 Library TST39 Length ...580 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0027_M17. 5' end sequence. Accession DK957220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957220|Adiantum capillus-veneris ...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957220|Adiantum capillus-veneris mRNA, clone:

  11. AcEST: DK946220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK946220 - Show DK946220 Clone id YMU02A01NGRL0011_N24 Library YMU02 Length 518 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_N24. 5' end sequence. Accession DK946220 Tissue t...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946220... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946220

  12. AcEST: DK948220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK948220 CL26Contig1 Show DK948220 Clone id TST38A01NGRL0002_L22 Library TST38 Length 65...5 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_L22. 5' end sequence. Accession DK948220...ids Res. 25:3389-3402. Query= DK948220|Adiantum capillus-veneris mRNA, clone: TST...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK948220|Adiantum capillus-veneris mRNA, clone: TST38

  13. AcEST: DK947220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK947220 CL1Contig3 Show DK947220 Clone id YMU02A01NGRL0015_D09 Library YMU02 Length 520... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_D09. 5' end sequence. Accession DK947220...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947220|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= DK947220|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL00

  14. AcEST: DK944220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK944220 CL1Contig3 Show DK944220 Clone id YMU02A01NGRL0005_F15 Library YMU02 Length 524... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_F15. 5' end sequence. Accession DK944220...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944220|Adiantu...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK944220|Adiantum capillus-veneris mRNA, clone: YMU02

  15. AcEST: DK953220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK953220 CL62Contig1 Show DK953220 Clone id TST39A01NGRL0017_D05 Library TST39 Length 58...1 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_D05. 5' end sequence. Accession DK953220... search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953220|Adiantum capillus-veneris mRNA, clone: TS... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953220

  16. AcEST: DK955220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK955220 CL71Contig1 Show DK955220 Clone id TST39A01NGRL0022_I06 Library TST39 Length 53...5 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_I06. 5' end sequence. Accession DK955220...5:3389-3402. Query= DK955220|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_I06, 5' (520 letters) D...ic Acids Res. 25:3389-3402. Query= DK955220|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_I06, 5'

  17. AcEST: DK945220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK945220 CL199Contig1 Show DK945220 Clone id YMU02A01NGRL0008_J20 Library YMU02 Length 5...96 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_J20. 5' end sequence. Accession DK945220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945220|Adiantum capillus-veneris ... Res. 25:3389-3402. Query= DK945220|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0008_J20, 5' (566 let

  18. AcEST: DK950220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK950220 - Show DK950220 Clone id TST38A01NGRL0008_B08 Library TST38 Length 637 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_B08. 5' end sequence. Accession DK950220 Tissue t...e search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950220|Adiantum capillus-veneris mRNA, clone: T...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950220

  19. AcEST: DK952220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK952220 CL304Contig1 Show DK952220 Clone id TST38A01NGRL0013_I03 Library TST38 Length 5...72 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_I03. 5' end sequence. Accession DK952220...ucleic Acids Res. 25:3389-3402. Query= DK952220|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0013_I03,...grams, Nucleic Acids Res. 25:3389-3402. Query= DK952220|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0

  20. AcEST: DK959220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK959220 CL2407Contig1 Show DK959220 Clone id TST39A01NGRL0004_B16 Library TST39 Length ...668 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_B16. 5' end sequence. Accession DK959220... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959220...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959220

  1. AcEST: DK960004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_D14 670 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_D1...4. 5' end sequence. DK960004 CL3069Contig1 Show DK960004 Clone id TST39A01NGRL0006_D14 Library TST39 Length ...670 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_D14. 5' end sequence. Accession DK96000...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960004|Adiantum capil

  2. AcEST: DK960007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_D17 674 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_D1...7. 5' end sequence. DK960007 - Show DK960007 Clone id TST39A01NGRL0006_D17 Library TST39 Length 674 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_D17. 5' end sequence. Accession DK960007 Tissue t...rch programs, Nucleic Acids Res. 25:3389-3402. Query= DK960007|Adiantum capillus-...database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960007|Adiant

  3. AcEST: DK962120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK962120 CL775Contig1 Show DK962120 Clone id TST39A01NGRL0013_A06 Library TST39 Length 3...25 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_A06. 5' end sequence. Accession DK962120... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962120...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962120|Adiantum ca

  4. AcEST: DK961957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK961957 - Show DK961957 Clone id TST39A01NGRL0011_J03 Library TST39 Length 686 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_J03. 5' end sequence. Accession DK961957 Tissue t...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961957|Adiantum ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961957...TST39A01NGRL0011_J03 686 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_J0

  5. AcEST: DK961598 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK961598 - Show DK961598 Clone id TST39A01NGRL0010_J05 Library TST39 Length 526 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_J05. 5' end sequence. Accession DK961598 Tissue t...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961598|Adiantu...p. patens Align length 106 Score (bit) 159.0 E-value 6.0e-38 Report BLASTX 2.2.19...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961598|Adiantum

  6. AcEST: DK951159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK951159 CL85Contig1 Show DK951159 Clone id TST38A01NGRL0010_K12 Library TST38 Length 55...6 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_K12. 5' end sequence. Accession DK951159...ds Res. 25:3389-3402. Query= DK951159|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0010_K12, 5' (556 l...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951159

  7. AcEST: DK961592 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK961592 - Show DK961592 Clone id TST39A01NGRL0010_I23 Library TST39 Length 648 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_I23. 5' end sequence. Accession DK961592 Tissue t...es. 25:3389-3402. Query= DK961592|Adiantum capillus-veneris mRNA, clone: TST39A01...ams, Nucleic Acids Res. 25:3389-3402. Query= DK961592|Adiantum capillus-veneris m...FLAT 316 G +QQS+R+ALGA+KD+TKVGLAKVNS +K+LDIAVVKATNHVECPPK+KHVR++FLAT Sbjct: 159 GMASQQSIRKALGAIKDSTKVGLAKVNS

  8. AcEST: DK959159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK959159 CL611Contig1 Show DK959159 Clone id TST39A01NGRL0003_O22 Library TST39 Length 5...66 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_O22. 5' end sequence. Accession DK959159... Nucleic Acids Res. 25:3389-3402. Query= DK959159|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0003_O2...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959159|Adiantum capi

  9. AcEST: DK946159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK946159 CL1Contig3 Show DK946159 Clone id YMU02A01NGRL0011_K16 Library YMU02 Length 518... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_K16. 5' end sequence. Accession DK946159...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946159|Adiantum capi...ms, Nucleic Acids Res. 25:3389-3402. Query= DK946159|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0011

  10. AcEST: DK944159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK944159 CL338Contig1 Show DK944159 Clone id YMU02A01NGRL0005_C15 Library YMU02 Length 4...25 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_C15. 5' end sequence. Accession DK944159...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944159|Ad...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944159|Adiantum capillus-veneris mR

  11. AcEST: DK955159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK955159 - Show DK955159 Clone id TST39A01NGRL0022_F16 Library TST39 Length 612 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_F16. 5' end sequence. Accession DK955159 Tissue t...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955159|Adiantum ...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955159|Adiantum capillus-veneris m

  12. AcEST: DK948159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK948159 - Show DK948159 Clone id TST38A01NGRL0002_J07 Library TST38 Length 614 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_J07. 5' end sequence. Accession DK948159 Tissue t...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948159|Adiantum capillus-veneris mRNA...25:3389-3402. Query= DK948159|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0002_J07, 5' (593 letters)

  13. AcEST: DK953159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK953159 CL3511Contig1 Show DK953159 Clone id TST39A01NGRL0017_A15 Library TST39 Length ...597 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_A15. 5' end sequence. Accession DK953159... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953159|Adia...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953159

  14. AcEST: DK963159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK963159 - Show DK963159 Clone id TST39A01NGRL0015_M14 Library TST39 Length 558 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_M14. 5' end sequence. Accession DK963159 Tissue t... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963159..., Nucleic Acids Res. 25:3389-3402. Query= DK963159|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0015_M

  15. AcEST: DK954830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK954830 - Show DK954830 Clone id TST39A01NGRL0021_H22 Library TST39 Length 627 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_H22. 5' end sequence. Accession DK954830 Tissue t...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954830...ds Res. 25:3389-3402. Query= DK954830|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0021_H22, 5' (627 l

  16. AcEST: DK961830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK961830 CL88Contig1 Show DK961830 Clone id TST39A01NGRL0011_D19 Library TST39 Length 68...2 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_D19. 5' end sequence. Accession DK961830...database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961830|Adiant...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961830|Adiantum capillus-veneris m

  17. AcEST: DK947830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK947830 CL1Contig2 Show DK947830 Clone id YMU02A01NGRM0001_E04 Library YMU02 Length 173... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRM0001_E04. 5' end sequence. Accession DK947830...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947830...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947830

  18. AcEST: DK955830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK955830 CL711Contig1 Show DK955830 Clone id TST39A01NGRL0024_C08 Library TST39 Length 6...19 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_C08. 5' end sequence. Accession DK955830...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955830...Res. 25:3389-3402. Query= DK955830|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0024_C08, 5' (619 lett

  19. AcEST: DK946830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK946830 CL30Contig1 Show DK946830 Clone id YMU02A01NGRL0013_O02 Library YMU02 Length 57...2 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_O02. 5' end sequence. Accession DK946830...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946830...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946830|Adiantum capillus-veneris mRNA, clone:

  20. AcEST: DK949830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK949830 - Show DK949830 Clone id TST38A01NGRL0007_A16 Library TST38 Length 716 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_A16. 5' end sequence. Accession DK949830 Tissue t...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949830|Adiantu... thaliana GN=At3g46290 PE=1 SV=1 Length = 830 Score = 160 bits (405), Expect = 6e-39 Identities = 91/194 (46...rograms, Nucleic Acids Res. 25:3389-3402. Query= DK949830|Adiantum capillus-vener

  1. AcEST: DK952830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK952830 CL594Contig1 Show DK952830 Clone id TST38A01NGRL0015_C14 Library TST38 Length 6...25 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_C14. 5' end sequence. Accession DK952830...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952830|Adiantum ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952830|A

  2. AcEST: DK956830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK956830 - Show DK956830 Clone id TST39A01NGRL0026_M08 Library TST39 Length 573 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_M08. 5' end sequence. Accession DK956830 Tissue t... Nucleic Acids Res. 25:3389-3402. Query= DK956830|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0026_M0...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956830|Adiantum capillus-veneris

  3. AcEST: DK950830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK950830 CL851Contig1 Show DK950830 Clone id TST38A01NGRL0009_L23 Library TST38 Length 6...29 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_L23. 5' end sequence. Accession DK950830...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950830...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950830

  4. AcEST: DK948830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK948830 - Show DK948830 Clone id TST38A01NGRL0004_F18 Library TST38 Length 631 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0004_F18. 5' end sequence. Accession DK948830 Tissue t...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948830|Adiantu...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948830|Adiantum capillus

  5. AcEST: DK958830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK958830 CL56Contig1 Show DK958830 Clone id TST39A01NGRL0003_A19 Library TST39 Length 66...9 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_A19. 5' end sequence. Accession DK958830..., Nucleic Acids Res. 25:3389-3402. Query= DK958830|Adiantum capillus-veneris mRNA...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958830|Adiantum capillus-veneris mRNA, clo

  6. AcEST: DK957830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK957830 CL902Contig1 Show DK957830 Clone id TST39A01NGRL0029_G10 Library TST39 Length 5...39 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0029_G10. 5' end sequence. Accession DK957830... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957830...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957830

  7. AcEST: DK951830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK951830 CL39Contig1 Show DK951830 Clone id TST38A01NGRL0012_H03 Library TST38 Length 66...4 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_H03. 5' end sequence. Accession DK951830...ic Acids Res. 25:3389-3402. Query= DK951830|Adiantum capillus-veneris mRNA, clone... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951830

  8. AcEST: DK958305 [AcEST

    Lifescience Database Archive (English)

    Full Text Available otropism protein 2, RPT2 DK958305 - Show DK958305 Clone id TST39A01NGRL0030_K12 Library TST39 Length 649 Def...inition Adiantum capillus-veneris mRNA weakly similar to Root phototropism protein 2, RPT2 Accession DK95830...eic Acids Res. 25:3389-3402. Query= DK958305|Adiantum capillus-veneris mRNA, clon...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95830

  9. AcEST: DK944830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK944830 CL33Contig1 Show DK944830 Clone id YMU02A01NGRL0007_F06 Library YMU02 Length 21...5 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0007_F06. 5' end sequence. Accession DK944830...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944830|Adiantum capillus-veneris mRNA, cl...25:3389-3402. Query= DK944830|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0007_F06, 5' (186 letters)

  10. AcEST: DK945830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK945830 CL1Contig2 Show DK945830 Clone id YMU02A01NGRL0010_J09 Library YMU02 Length 172... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0010_J09. 5' end sequence. Accession DK945830...s, Nucleic Acids Res. 25:3389-3402. Query= DK945830|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0010_...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945830|Adi

  11. AcEST: DK960830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK960830 CL833Contig1 Show DK960830 Clone id TST39A01NGRL0008_H11 Library TST39 Length 5...81 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_H11. 5' end sequence. Accession DK960830... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960830|Adiantum capillus-veneris mRNA, ...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960830|Adiantu

  12. AcEST: DK943830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK943830 CL194Contig1 Show DK943830 Clone id YMU02A01NGRL0004_B15 Library YMU02 Length 6...87 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_B15. 5' end sequence. Accession DK943830..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK943830...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK943830|Adiantu

  13. AcEST: DK952183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK952183 CL1482Contig1 Show DK952183 Clone id TST38A01NGRL0013_G14 Library TST38 Length ...539 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_G14. 5' end sequence. Accession DK952183...ograms, Nucleic Acids Res. 25:3389-3402. Query= DK952183|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952183|Adiantum

  14. AcEST: DK949183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK949183 - Show DK949183 Clone id TST38A01NGRL0005_E22 Library TST38 Length 710 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_E22. 5' end sequence. Accession DK949183 Tissue t... Nucleic Acids Res. 25:3389-3402. Query= DK949183|Adiantum capillus-veneris mRNA,...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949183

  15. AcEST: DK961838 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK961838 CL1667Contig1 Show DK961838 Clone id TST39A01NGRL0011_E03 Library TST39 Length ...673 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_E03. 5' end sequence. Accession DK96183...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961838|Adiantu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961838|Adiantum capillus-...=Drosophila ananassae GN=GF12498 PE=4 SV=1 Length = 2183 Score = 35.0 bits (79), Expect = 4.3 Identities = 2

  16. AcEST: DK954183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK954183 CL1473Contig1 Show DK954183 Clone id TST39A01NGRL0019_M08 Library TST39 Length ...598 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_M08. 5' end sequence. Accession DK954183...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954183...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954183

  17. AcEST: DK958183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK958183 - Show DK958183 Clone id TST39A01NGRL0030_F09 Library TST39 Length 612 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_F09. 5' end sequence. Accession DK958183 Tissue t...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958183...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK958183|Adiantum capillus-veneris mRNA, clone: TST39...A SF D +Y Sbjct: 1 MLEELLIFTRGGLILWSSCRALGAAALKGSPIDALIRSCLLEERSADASFSQD----NYA 56 Query: 183 LKWSFHNDLGLVFV

  18. AcEST: DK950183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK950183 CL3322Contig1 Show DK950183 Clone id TST38A01NGRL0007_P18 Library TST38 Length ...678 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_P18. 5' end sequence. Accession DK950183...ds Res. 25:3389-3402. Query= DK950183|Adiantum capillus-veneris mRNA, clone: TST3...rograms, Nucleic Acids Res. 25:3389-3402. Query= DK950183|Adiantum capillus-veneris mRNA, clone: TST38A01NGR

  19. AcEST: DK945183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK945183 CL1Contig2 Show DK945183 Clone id YMU02A01NGRL0008_I01 Library YMU02 Length 232... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_I01. 5' end sequence. Accession DK945183...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945183|Adiantum capillus-v...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945183

  20. AcEST: DK961839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK961839 CL2471Contig1 Show DK961839 Clone id TST39A01NGRL0011_E04 Library TST39 Length ...509 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_E04. 5' end sequence. Accession DK96183...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961839|Adiantum capillus-vene... (30%), Positives = 33/91 (36%) Frame = -3 Query: 362 GSCSKKLFSIKPRTSINKKQRKTLPIYSNVNSALRPLGSLPPG*KRPGSKFSATSVSDLK 183...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961839|Adi

  1. AcEST: DK961994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK961994 CL1294Contig1 Show DK961994 Clone id TST39A01NGRL0011_K17 Library TST39 Length ...673 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_K17. 5' end sequence. Accession DK961994... programs, Nucleic Acids Res. 25:3389-3402. Query= DK961994|Adiantum capillus-ven...base search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961994|Adiantum c...TST39A01NGRL0011_K17 673 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_K1

  2. AcEST: DK952403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK952403 CL673Contig1 Show DK952403 Clone id TST38A01NGRL0013_P22 Library TST38 Length 5...87 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_P22. 5' end sequence. Accession DK952403...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952403|Adiantum capillus-veneris mRNA, clon...) Frame = +2 Query: 242 MKFLKDTPLVRIDAFLTTVNVGDSFLKGNLEAYSCKAAGLDKKHFQSLEQE----VID-- 403 MK L+++ I++ LT + GD...FLTTVNVGDSFLKGNLEAYSCKAAGLDKKHFQSLEQE----VID-- 403 MK L+++ I++ LT V GD+ + G +E+YSCK AG DK F+ QE V++ Sbjct: 1

  3. AcEST: DK954403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954403 - Show DK954403 Clone id TST39A01NGRL0020_F14 Library TST39 Length 534 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_F14. 5' end sequence. Accession DK954403 Tissue t..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954403...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954403|A

  4. AcEST: DK962403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK962403 CL3688Contig1 Show DK962403 Clone id TST39A01NGRL0013_M11 Library TST39 Length ...630 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_M11. 5' end sequence. Accession DK962403...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962403...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962403|Adiantum capillus-veneris mRNA

  5. AcEST: DK949403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK949403 CL3Contig3 Show DK949403 Clone id TST38A01NGRL0005_O10 Library TST38 Length 664... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_O10. 5' end sequence. Accession DK949403...es. 25:3389-3402. Query= DK949403|Adiantum capillus-veneris mRNA, clone: TST38A01.... 25:3389-3402. Query= DK949403|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0005_O10, 5' (664 letters

  6. AcEST: DK958403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK958403 CL571Contig1 Show DK958403 Clone id TST39A01NGRL0030_O15 Library TST39 Length 4...34 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_O15. 5' end sequence. Accession DK958403...c Acids Res. 25:3389-3402. Query= DK958403|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0030_O15, 5' (...s Res. 25:3389-3402. Query= DK958403|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0030_O15, 5' (408 le

  7. AcEST: DK956403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK956403 CL70Contig1 Show DK956403 Clone id TST39A01NGRL0025_K10 Library TST39 Length 55...9 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_K10. 5' end sequence. Accession DK956403...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956403|Adiantum capillus-veneris ...itives = 25/39 (64%) Frame = +1 Query: 403 FDPLGLGKDPAALKWYREAEIIHGRWAMAAVVGIFVGQA 519 FDPLG KDPA + + EI +GR...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956403

  8. AcEST: DK955403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK955403 - Show DK955403 Clone id TST39A01NGRL0023_A02 Library TST39 Length 508 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_A02. 5' end sequence. Accession DK955403 Tissue t...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955403|Adiantum capillus-veneris...es. 25:3389-3402. Query= DK955403|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0023_A02, 5' (508 lette

  9. AcEST: DK950403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK950403 CL4038Contig1 Show DK950403 Clone id TST38A01NGRL0008_J01 Library TST38 Length ...528 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_J01. 5' end sequence. Accession DK950403... Tissue type prothallia Developmental stage gametophyte Contig ID CL4038Contig... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950403|Adiantum capillus-ven...ams, Nucleic Acids Res. 25:3389-3402. Query= DK950403|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL000

  10. AcEST: DK947403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK947403 CL1Contig3 Show DK947403 Clone id YMU02A01NGRL0015_M14 Library YMU02 Length 519... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_M14. 5' end sequence. Accession DK947403...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947403|Adiantum capillus-veneris mRNA, clo...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947403|Adiantum capillus-veneris mRNA, clone: YMU

  11. AcEST: DK945403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK945403 CL19Contig1 Show DK945403 Clone id YMU02A01NGRL0009_D05 Library YMU02 Length 32...0 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_D05. 5' end sequence. Accession DK945403...programs, Nucleic Acids Res. 25:3389-3402. Query= DK945403|Adiantum capillus-veneris mRNA, clone: YMU02A01NG.... 25:3389-3402. Query= DK945403|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0009_D05, 5' (280 letters

  12. AcEST: DK951403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK951403 - Show DK951403 Clone id TST38A01NGRL0011_F03 Library TST38 Length 670 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_F03. 5' end sequence. Accession DK951403 Tissue t..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951403...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951403|Adiantu

  13. AcEST: DK946403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK946403 CL120Contig1 Show DK946403 Clone id YMU02A01NGRL0012_I05 Library YMU02 Length 1...92 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_I05. 5' end sequence. Accession DK946403...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946403|Adiantum capillus-veneris mRNA,...eic Acids Res. 25:3389-3402. Query= DK946403|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0012_I05, 5'

  14. AcEST: DK961403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK961403 - Show DK961403 Clone id TST39A01NGRL0010_A06 Library TST39 Length 668 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_A06. 5' end sequence. Accession DK961403 Tissue t...earch programs, Nucleic Acids Res. 25:3389-3402. Query= DK961403|Adiantum capillu...s. 25:3389-3402. Query= DK961403|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0010_A06, 5' (668 letter

  15. AcEST: DK948403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK948403 CL11Contig1 Show DK948403 Clone id TST38A01NGRL0003_D15 Library TST38 Length 65...8 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_D15. 5' end sequence. Accession DK948403...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948403...cids Res. 25:3389-3402. Query= DK948403|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0003_D15, 5' (658

  16. AcEST: DK957403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK957403 - Show DK957403 Clone id TST39A01NGRL0028_E12 Library TST39 Length 623 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0028_E12. 5' end sequence. Accession DK957403 Tissue t...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957403|Adi...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957403|Adiantum capillus-vene

  17. AcEST: DK948500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK948500 CL63Contig1 Show DK948500 Clone id TST38A01NGRL0003_H17 Library TST38 Length 67...0 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_H17. 5' end sequence. Accession DK948500...ucleic Acids Res. 25:3389-3402. Query= DK948500|Adiantum capillus-veneris mRNA, c... 25:3389-3402. Query= DK948500|Adiantum capillus-veneris mRNA, clone: TST38A01NGR...AK-GEWLPGLSSPSYL 65 Query: 321 DGNLAGDNGFDPLGLAEDPANLKWYVQAELQNGRWAMLGVAGMLIPDLLTKIGIINVPAW 500

  18. AcEST: DK956500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK956500 - Show DK956500 Clone id TST39A01NGRL0025_O12 Library TST39 Length 608 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_O12. 5' end sequence. Accession DK956500 Tissue t...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956500|Adiantum capillus-v...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956500

  19. AcEST: DK950028 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_J02 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_J0...2. 5' end sequence. DK950028 CL3704Contig1 Show DK950028 Clone id TST38A01NGRL0007_J02 Library TST38 Length ...613 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_J02. 5' end sequence. Accession DK9500...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950028|Adiantum capillus-vener...rch programs, Nucleic Acids Res. 25:3389-3402. Query= DK950028|Adiantum capillus-

  20. AcEST: DK950060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_K13 702 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_K1...3. 5' end sequence. DK950060 CL316Contig1 Show DK950060 Clone id TST38A01NGRL0007_K13 Library TST38 Length 7...02 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_K13. 5' end sequence. Accession DK9500...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950060...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950060

  1. AcEST: DK946500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK946500 CL3744Contig1 Show DK946500 Clone id YMU02A01NGRL0012_N09 Library YMU02 Length ...313 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_N09. 5' end sequence. Accession DK946500...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946500|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= DK946500|Adiantum capillus-veneris mRNA, clone: YMU02A0

  2. AcEST: DK951500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK951500 - Show DK951500 Clone id TST38A01NGRL0011_J06 Library TST38 Length 501 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_J06. 5' end sequence. Accession DK951500 Tissue t...ucleic Acids Res. 25:3389-3402. Query= DK951500|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0011_J06,...ids Res. 25:3389-3402. Query= DK951500|Adiantum capillus-veneris mRNA, clone: TST

  3. AcEST: DK958500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK958500 - Show DK958500 Clone id TST39A01NGRL0002_C19 Library TST39 Length 632 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_C19. 5' end sequence. Accession DK958500 Tissue t...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958500...Res. 25:3389-3402. Query= DK958500|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0002_C19, 5' (632 lett

  4. AcEST: DK954500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK954500 CL167Contig1 Show DK954500 Clone id TST39A01NGRL0020_J17 Library TST39 Length 6...05 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_J17. 5' end sequence. Accession DK954500...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954500|Ad...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954500|Adiantum capillus-veneris mRNA, clone: TST

  5. AcEST: DK955005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK955005 CL2Contig2 Show DK955005 Clone id TST39A01NGRL0021_P06 Library TST39 Length 667... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_P06. 5' end sequence. Accession DK955005...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955005|...ch programs, Nucleic Acids Res. 25:3389-3402. Query= DK955005|Adiantum capillus-v...TST39A01NGRL0021_P06 667 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_P0

  6. AcEST: DK961500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK961500 CL37Contig1 Show DK961500 Clone id TST39A01NGRL0010_E20 Library TST39 Length 69...2 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_E20. 5' end sequence. Accession DK961500... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961500...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961500

  7. AcEST: DK950087 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_L16 709 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_L1...6. 5' end sequence. DK950087 - Show DK950087 Clone id TST38A01NGRL0007_L16 Library TST38 Length 709 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_L16. 5' end sequence. Accession DK950087 Tissue t...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950087|Adia...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK9500

  8. AcEST: DK944440 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0006_B03 348 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_B0...3. 5' end sequence. DK944440 CL1Contig3 Show DK944440 Clone id YMU02A01NGRL0006_B03 Library YMU02 Length 348... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_B03. 5' end sequence. Accession DK944440...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK94444...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944440|Adiantum

  9. AcEST: DK945431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK945431 - Show DK945431 Clone id YMU02A01NGRL0009_E17 Library YMU02 Length 419 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_E17. 5' end sequence. Accession DK945431 Tissue t...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945431...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945431|Adiantum ca...YMU02A01NGRL0009_E17 419 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_E1

  10. AcEST: DK963303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK963303 - Show DK963303 Clone id TST39A01NGRL0016_C20 Library TST39 Length 589 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_C20. 5' end sequence. Accession DK963303 Tissue t... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963303|Adiantum capillus-ven... Acids Res. 25:3389-3402. Query= DK963303|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0016_C20, 5' (5

  11. AcEST: DK951303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK951303 CL245Contig1 Show DK951303 Clone id TST38A01NGRL0011_A19 Library TST38 Length 7...10 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_A19. 5' end sequence. Accession DK951303...Acids Res. 25:3389-3402. Query= DK951303|Adiantum capillus-veneris mRNA, clone: T... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951303|Adiantum capillus-veneris mRNA,

  12. AcEST: DK960303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK960303 CL302Contig1 Show DK960303 Clone id TST39A01NGRL0007_A22 Library TST39 Length 5...27 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_A22. 5' end sequence. Accession DK960303...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK960303...ds Res. 25:3389-3402. Query= DK960303|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0007_A22, 5' (502 l

  13. AcEST: DK952303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK952303 CL359Contig1 Show DK952303 Clone id TST38A01NGRL0013_L17 Library TST38 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_L17. 5' end sequence. Accession DK952303...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952303...ids Res. 25:3389-3402. Query= DK952303|Adiantum capillus-veneris mRNA, clone: TST

  14. AcEST: DK948303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK948303 CL785Contig1 Show DK948303 Clone id TST38A01NGRL0002_P10 Library TST38 Length 6...82 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_P10. 5' end sequence. Accession DK948303... 25:3389-3402. Query= DK948303|Adiantum capillus-veneris mRNA, clone: TST38A01NGR...e search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948303|Adiantum capillus-veneris mRNA, clone: T

  15. AcEST: DK945303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK945303 - Show DK945303 Clone id YMU02A01NGRL0008_O03 Library YMU02 Length 219 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_O03. 5' end sequence. Accession DK945303 Tissue t...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945303|Adiantum capillus-veneris ... Nucleic Acids Res. 25:3389-3402. Query= DK945303|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0008_O0

  16. AcEST: DK963033 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK963033 - Show DK963033 Clone id TST39A01NGRL0015_H05 Library TST39 Length 682 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_H05. 5' end sequence. Accession DK963033 Tissue t...earch programs, Nucleic Acids Res. 25:3389-3402. Query= DK963033|Adiantum capillu... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96303...TST39A01NGRL0015_H05 682 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_H0

  17. AcEST: DK955303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK955303 CL62Contig1 Show DK955303 Clone id TST39A01NGRL0022_L20 Library TST39 Length 55...2 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_L20. 5' end sequence. Accession DK955303...ds Res. 25:3389-3402. Query= DK955303|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0022_L20, 5' (552 l...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955303|Adiantum capillus-

  18. AcEST: DK954303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK954303 - Show DK954303 Clone id TST39A01NGRL0020_B10 Library TST39 Length 589 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_B10. 5' end sequence. Accession DK954303 Tissue t...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954303|Adiantum capillus-veneris mRNA, clone: ... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954303|Adian

  19. AcEST: DK949303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK949303 CL43Contig1 Show DK949303 Clone id TST38A01NGRL0005_K02 Library TST38 Length 70...2 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_K02. 5' end sequence. Accession DK949303...c Acids Res. 25:3389-3402. Query= DK949303|Adiantum capillus-veneris mRNA, clone:...us genotype 2c (isolate BEBE1) PE=3 SV=3 Length = 3037 Score = 33.5 bits (75), Ex...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949303|Adi

  20. AcEST: DK953303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK953303 - Show DK953303 Clone id TST39A01NGRL0017_G17 Library TST39 Length 555 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_G17. 5' end sequence. Accession DK953303 Tissue t..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953303... Acids Res. 25:3389-3402. Query= DK953303|Adiantum capillus-veneris mRNA, clone:

  1. AcEST: DK946303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK946303 CL440Contig1 Show DK946303 Clone id YMU02A01NGRL0012_C14 Library YMU02 Length 5...65 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_C14. 5' end sequence. Accession DK946303...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946303|Adiantum capillus-veneris mRN... 25:3389-3402. Query= DK946303|Adiantum capillus-veneris mRNA, clone: YMU02A01NGR

  2. AcEST: DK958303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK958303 - Show DK958303 Clone id TST39A01NGRL0030_K10 Library TST39 Length 634 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_K10. 5' end sequence. Accession DK958303 Tissue t... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958303|Adiant...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958303

  3. AcEST: DK944303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK944303 CL2Contig4 Show DK944303 Clone id YMU02A01NGRL0005_J22 Library YMU02 Length 570... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_J22. 5' end sequence. Accession DK944303...rograms, Nucleic Acids Res. 25:3389-3402. Query= DK944303|Adiantum capillus-veneris mRNA, clone: YMU02A01NGR...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944303

  4. AcEST: DK958008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 008 CL139Contig1 Show DK958008 Clone id TST39A01NGRL0029_O01 Library TST39 Length 6...60 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0029_O01. 5' end sequence. Accession DK95800...ams, Nucleic Acids Res. 25:3389-3402. Query= DK958008|Adiantum capillus-veneris m...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958008|...TST39A01NGRL0029_O01 660 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0029_O01. 5' end sequence. DK958

  5. AcEST: DK958100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK958100 CL1933Contig1 Show DK958100 Clone id TST39A01NGRL0030_B21 Library TST39 Length ...612 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_B21. 5' end sequence. Accession DK958100...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958100...%), Positives = 56/92 (60%), Gaps = 6/92 (6%) Frame = +1 Query: 100 QEGDSLVGTGVIL...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958100|Adiantum cap

  6. AcEST: DK952100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK952100 - Show DK952100 Clone id TST38A01NGRL0013_C23 Library TST38 Length 631 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_C23. 5' end sequence. Accession DK952100 Tissue t... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952100|Adiantum capillus-ven... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952100

  7. AcEST: DK952432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK952432 CL2129Contig1 Show DK952432 Clone id TST38A01NGRL0014_B06 Library TST38 Length ...644 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_B06. 5' end sequence. Accession DK952432...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952432|Adi...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952432

  8. AcEST: DK958432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK958432 CL5Contig1 Show DK958432 Clone id TST39A01NGRL0030_P20 Library TST39 Length 642... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_P20. 5' end sequence. Accession DK958432... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958432...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958432|Adiantum capillus-veneris mRNA, clone: TST

  9. AcEST: DK953432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK953432 - Show DK953432 Clone id TST39A01NGRL0017_M02 Library TST39 Length 550 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_M02. 5' end sequence. Accession DK953432 Tissue t...ds Res. 25:3389-3402. Query= DK953432|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_M02, 5' (532 l...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953432

  10. AcEST: DK955432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK955432 CL2Contig2 Show DK955432 Clone id TST39A01NGRL0023_B08 Library TST39 Length 617... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_B08. 5' end sequence. Accession DK955432...25:3389-3402. Query= DK955432|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955432

  11. AcEST: DK954432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK954432 - Show DK954432 Clone id TST39A01NGRL0020_G19 Library TST39 Length 588 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_G19. 5' end sequence. Accession DK954432 Tissue t...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954432|Adiantum capillus-veneris mRNA, clone:...c Acids Res. 25:3389-3402. Query= DK954432|Adiantum capillus-veneris mRNA, clone:

  12. AcEST: DK944328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK944328 CL1461Contig1 Show DK944328 Clone id YMU02A01NGRL0005_L07 Library YMU02 Length ...394 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_L07. 5' end sequence. Accession DK94432...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944328|Adiantum capill...s, Nucleic Acids Res. 25:3389-3402. Query= DK944328|Adiantum capillus-veneris mRN...YMU02A01NGRL0005_L07 394 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_L0

  13. AcEST: DK945432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK945432 CL122Contig1 Show DK945432 Clone id YMU02A01NGRL0009_E18 Library YMU02 Length 2...39 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_E18. 5' end sequence. Accession DK945432...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945432...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945432|Adiantum capillu

  14. AcEST: DK957432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK957432 CL970Contig1 Show DK957432 Clone id TST39A01NGRL0028_F18 Library TST39 Length 6...07 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0028_F18. 5' end sequence. Accession DK957432... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK957432|Adiantum c...Nucleic Acids Res. 25:3389-3402. Query= DK957432|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0028_F18

  15. AcEST: DK950432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK950432 CL4Contig1 Show DK950432 Clone id TST38A01NGRL0008_K07 Library TST38 Length 613... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_K07. 5' end sequence. Accession DK950432...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950432|Adiantum capillus-veneris ...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950432

  16. AcEST: DK963432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK963432 - Show DK963432 Clone id TST39A01NGRL0016_I10 Library TST39 Length 549 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_I10. 5' end sequence. Accession DK963432 Tissue t...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963432|Adiantum capillus-veneris mRNA, clone: ...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963432

  17. AcEST: DK948432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK948432 - Show DK948432 Clone id TST38A01NGRL0003_E20 Library TST38 Length 649 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_E20. 5' end sequence. Accession DK948432 Tissue t...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948432... search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948432|Adiantum capillus-veneris mRNA, clone: TS

  18. AcEST: DK962432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK962432 CL1199Contig1 Show DK962432 Clone id TST39A01NGRL0013_N18 Library TST39 Length ...580 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_N18. 5' end sequence. Accession DK962432...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962432|Adiantum capillu...ucleic Acids Res. 25:3389-3402. Query= DK962432|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0013_N18,

  19. AcEST: DK956432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK956432 CL4222Contig1 Show DK956432 Clone id TST39A01NGRL0025_L15 Library TST39 Length ...549 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_L15. 5' end sequence. Accession DK956432...ams, Nucleic Acids Res. 25:3389-3402. Query= DK956432|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL002...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956432|Adiantum capillus-veneris mRNA,

  20. AcEST: DK961432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK961432 - Show DK961432 Clone id TST39A01NGRL0010_B17 Library TST39 Length 697 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_B17. 5' end sequence. Accession DK961432 Tissue t... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961432|Adian...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961432

  1. AcEST: DK946432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK946432 - Show DK946432 Clone id YMU02A01NGRL0012_J22 Library YMU02 Length 267 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_J22. 5' end sequence. Accession DK946432 Tissue t...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946432...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946432|Adiantum

  2. AcEST: DK959432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK959432 - Show DK959432 Clone id TST39A01NGRL0004_K19 Library TST39 Length 659 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_K19. 5' end sequence. Accession DK959432 Tissue t...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959432|Adi...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959432|A...H S IF +VG D LY++SEA+DVV+ Sbjct: 374 -KAEVSESPGERSTAQAQSEKGLEIIEVYKSSIHNSAIFASVGEDKGNLYTASEATDVVF 432 Query:

  3. AcEST: DK961101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK961101 CL398Contig1 Show DK961101 Clone id TST39A01NGRL0009_D07 Library TST39 Length 6...81 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_D07. 5' end sequence. Accession DK961101...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961101|Ad...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961101...TST39A01NGRL0009_D07 681 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_D0

  4. AcEST: DK956547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK956547 CL945Contig1 Show DK956547 Clone id TST39A01NGRL0026_A11 Library TST39 Length 7...52 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_A11. 5' end sequence. Accession DK956547...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956547|Adiantum capillus-veneris mRNA, clo...s. 25:3389-3402. Query= DK956547|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0026_A11, 5' (706 letter

  5. AcEST: DK954766 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_F02 668 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_F0...2. 5' end sequence. DK954766 CL2909Contig1 Show DK954766 Clone id TST39A01NGRL0021_F02 Library TST39 Length ...668 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_F02. 5' end sequence. Accession DK9547... search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954766|Adiantum capil... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954766|Adiantum capillus-veneri

  6. AcEST: DK943547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK943547 CL1Contig2 Show DK943547 Clone id YMU02A01NGRL0003_C22 Library YMU02 Length 172... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_C22. 5' end sequence. Accession DK943547...s, Nucleic Acids Res. 25:3389-3402. Query= DK943547|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0003_...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK943547|Adi

  7. AcEST: DK949547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK949547 - Show DK949547 Clone id TST38A01NGRL0006_E11 Library TST38 Length 675 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_E11. 5' end sequence. Accession DK949547 Tissue t... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949547...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949547|Adiantum capillus-veneris mRNA, clone:

  8. AcEST: DK948547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK948547 CL187Contig1 Show DK948547 Clone id TST38A01NGRL0003_J17 Library TST38 Length 6...81 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_J17. 5' end sequence. Accession DK948547...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948547|Adiantum cap...ch programs, Nucleic Acids Res. 25:3389-3402. Query= DK948547|Adiantum capillus-veneris mRNA, clone: TST38A0

  9. AcEST: DK947547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK947547 CL2527Contig1 Show DK947547 Clone id YMU02A01NGRL0016_D22 Library YMU02 Length ...166 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0016_D22. 5' end sequence. Accession DK947547...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947547... Acids Res. 25:3389-3402. Query= DK947547|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0016_D22, 5' (1

  10. AcEST: DK946547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK946547 CL8Contig1 Show DK946547 Clone id YMU02A01NGRL0012_P16 Library YMU02 Length 645... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_P16. 5' end sequence. Accession DK946547...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946547...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK946547|Adiantum capillus-veneris mRNA, clone: YMU02

  11. AcEST: DK954747 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0021_E07 621 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_E0...7. 5' end sequence. DK954747 - Show DK954747 Clone id TST39A01NGRL0021_E07 Library TST39 Length 621 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_E07. 5' end sequence. Accession DK954747 Tissue t... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954747|Adiant...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK954747|Adiantum capillus

  12. AcEST: DK952547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK952547 CL1489Contig1 Show DK952547 Clone id TST38A01NGRL0014_G06 Library TST38 Length ...616 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_G06. 5' end sequence. Accession DK952547...rch programs, Nucleic Acids Res. 25:3389-3402. Query= DK952547|Adiantum capillus-veneris mRNA, clone: TST38A...e search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952547|Adiantum capillus-veneris mRNA, clone: T

  13. AcEST: DK945547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK945547 CL1Contig2 Show DK945547 Clone id YMU02A01NGRL0009_K20 Library YMU02 Length 174... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_K20. 5' end sequence. Accession DK945547...ams, Nucleic Acids Res. 25:3389-3402. Query= DK945547|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL000...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945547|A

  14. AcEST: DK950547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK950547 CL2Contig5 Show DK950547 Clone id TST38A01NGRL0008_P06 Library TST38 Length 663... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_P06. 5' end sequence. Accession DK950547...leic Acids Res. 25:3389-3402. Query= DK950547|Adiantum capillus-veneris mRNA, clo...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950547|Adiantum capillus-veneris mRN

  15. AcEST: DK958547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK958547 CL6Contig1 Show DK958547 Clone id TST39A01NGRL0002_E18 Library TST39 Length 570... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_E18. 5' end sequence. Accession DK958547...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958547|Adiantum capillus-vener... Acids Res. 25:3389-3402. Query= DK958547|Adiantum capillus-veneris mRNA, clone:

  16. AcEST: DK944260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK944260 CL1Contig3 Show DK944260 Clone id YMU02A01NGRL0005_H15 Library YMU02 Length 497... Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_H15. 5' end sequence. Accession DK944260...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944260|Adiantum capillus-veneris mRNA, cl.... 25:3389-3402. Query= DK944260|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0005_H15, 5' (468 letters

  17. AcEST: DK962260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK962260 CL385Contig1 Show DK962260 Clone id TST39A01NGRL0013_G05 Library TST39 Length 1...03 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_G05. 5' end sequence. Accession DK962260...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962260... search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962260|Adiantum capil

  18. AcEST: DK956260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK956260 CL494Contig1 Show DK956260 Clone id TST39A01NGRL0025_E11 Library TST39 Length 6...07 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_E11. 5' end sequence. Accession DK956260...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956260|Adiantum capi...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956260|Adiantum ca

  19. AcEST: DK963260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK963260 CL9Contig1 Show DK963260 Clone id TST39A01NGRL0016_A22 Library TST39 Length 645... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_A22. 5' end sequence. Accession DK963260...ids Res. 25:3389-3402. Query= DK963260|Adiantum capillus-veneris mRNA, clone: TST... Res. 25:3389-3402. Query= DK963260|Adiantum capillus-veneris mRNA, clone: TST39A

  20. AcEST: DK948260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK948260 CL524Contig1 Show DK948260 Clone id TST38A01NGRL0002_N15 Library TST38 Length 6...59 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_N15. 5' end sequence. Accession DK948260... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948260...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948260|Adiantum capillus-veneris mRNA

  1. AcEST: DK962609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK962609 CL115Contig1 Show DK962609 Clone id TST39A01NGRL0014_F07 Library TST39 Length 6...64 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0014_F07. 5' end sequence. Accession DK96260...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962609|...base search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962609|Adiantum c...TST39A01NGRL0014_F07 664 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0014_F0

  2. AcEST: DK958260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK958260 - Show DK958260 Clone id TST39A01NGRL0030_I15 Library TST39 Length 629 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_I15. 5' end sequence. Accession DK958260 Tissue t...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958260...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK958260|Adiantum capillus-veneris mRNA, clone: TST

  3. AcEST: DK955260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK955260 CL1847Contig1 Show DK955260 Clone id TST39A01NGRL0022_J22 Library TST39 Length ...555 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_J22. 5' end sequence. Accession DK955260...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955260|Adiantum capillus-veneris mRNA, clo...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955260|Adiantum capillus-veneris mRNA, clone:

  4. AcEST: DK947260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK947260 - Show DK947260 Clone id YMU02A01NGRL0015_F08 Library YMU02 Length 512 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_F08. 5' end sequence. Accession DK947260 Tissue t...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947260|Adiantum...base search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947260|Adiantum capillus-veneris mRNA, clone

  5. AcEST: DK950260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK950260 CL2720Contig1 Show DK950260 Clone id TST38A01NGRL0008_C24 Library TST38 Length ...521 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_C24. 5' end sequence. Accession DK950260...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950260|Adiantum capillus...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK950260|Adiantum capillus

  6. AcEST: DK946260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK946260 CL147Contig1 Show DK946260 Clone id YMU02A01NGRL0012_A05 Library YMU02 Length 5...93 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_A05. 5' end sequence. Accession DK946260... programs, Nucleic Acids Res. 25:3389-3402. Query= DK946260|Adiantum capillus-veneris mRNA, clone: YMU02A01N...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946260|Adiantum capillus-veneris mRNA, clone:

  7. AcEST: DK945260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK945260 CL99Contig1 Show DK945260 Clone id YMU02A01NGRL0008_L20 Library YMU02 Length 36...1 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_L20. 5' end sequence. Accession DK945260...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK945260...25:3389-3402. Query= DK945260|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0008_L20, 5' (361 letters)

  8. AcEST: DK952604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK952604 CL2982Contig1 Show DK952604 Clone id TST38A01NGRL0014_I20 Library TST38 Length ...647 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_I20. 5' end sequence. Accession DK95260... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952604|Adiantum c...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95260...SYLPGWQKP----YKVVPYEDLH 259 Query: 259 WRFSQRLLDLMWIPMKWLAIPVFALS 336 WR ++ W+PMKWLAI F L+ Sbjct: 260 WRVTRP

  9. AcEST: DK949260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK949260 - Show DK949260 Clone id TST38A01NGRL0005_I07 Library TST38 Length 592 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_I07. 5' end sequence. Accession DK949260 Tissue t... programs, Nucleic Acids Res. 25:3389-3402. Query= DK949260|Adiantum capillus-veneris mRNA, clone: TST38A01N...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949260

  10. AcEST: DK954260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954260 CL108Contig1 Show DK954260 Clone id TST39A01NGRL0019_P14 Library TST39 Length 5...61 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_P14. 5' end sequence. Accession DK954260...rograms, Nucleic Acids Res. 25:3389-3402. Query= DK954260|Adiantum capillus-veneris mRNA, clone: TST39A01NGR...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954260|Adiantum capil

  11. AcEST: DK951260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK951260 - Show DK951260 Clone id TST38A01NGRL0010_O23 Library TST38 Length 427 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_O23. 5' end sequence. Accession DK951260 Tissue t...ograms, Nucleic Acids Res. 25:3389-3402. Query= DK951260|Adiantum capillus-veneri...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951260|Adiantum capillus-veneris m

  12. AcEST: DK952609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK952609 - Show DK952609 Clone id TST38A01NGRL0014_J01 Library TST38 Length 628 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_J01. 5' end sequence. Accession DK952609 Tissue t...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952609|Ad...LG+ Sbjct: 1 MSSLASPGR--IARVFAALHARREVAFIPFITAGDPDLETTAEALLTLDRNGADLLELGL 58 Query: 260 PYSDPLADGPVIQAAATRAL...s, Nucleic Acids Res. 25:3389-3402. Query= DK952609|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0014_

  13. AcEST: DK959515 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_O11 666 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O11. 5' end sequence. DK95...9515 CL484Contig1 Show DK959515 Clone id TST39A01NGRL0004_O11 Library TST39 Length 6...66 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O11. 5' end sequence. Accession DK9595...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK959515|Adiantum capillus... programs, Nucleic Acids Res. 25:3389-3402. Query= DK959515|Adiantum capillus-ven

  14. AcEST: DK956395 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0025_K02 647 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_K02. 5' end sequence. DK95...6395 CL207Contig1 Show DK956395 Clone id TST39A01NGRL0025_K02 Library TST39 Length 6...47 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0025_K02. 5' end sequence. Accession DK956395...rams, Nucleic Acids Res. 25:3389-3402. Query= DK956395|Adiantum capillus-veneris ...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956395

  15. AcEST: DK961400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK961400 CL3Contig1 Show DK961400 Clone id TST39A01NGRL0010_A03 Library TST39 Length 633... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_A03. 5' end sequence. Accession DK961400...leic Acids Res. 25:3389-3402. Query= DK961400|Adiantum capillus-veneris mRNA, clo...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961400

  16. AcEST: DK963400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK963400 CL3471Contig1 Show DK963400 Clone id TST39A01NGRL0016_G24 Library TST39 Length ...625 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_G24. 5' end sequence. Accession DK963400...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963400...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK963400

  17. AcEST: DK955400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK955400 - Show DK955400 Clone id TST39A01NGRL0022_P23 Library TST39 Length 609 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_P23. 5' end sequence. Accession DK955400 Tissue t...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955400|Adiantum cap...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955400|Adiantum capillus-vene

  18. AcEST: DK952400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK952400 CL112Contig1 Show DK952400 Clone id TST38A01NGRL0013_P19 Library TST38 Length 5...90 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0013_P19. 5' end sequence. Accession DK952400..., Nucleic Acids Res. 25:3389-3402. Query= DK952400|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0013_P...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952400|Adiantum capillus-vene

  19. AcEST: DK946400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK946400 CL2662Contig1 Show DK946400 Clone id YMU02A01NGRL0012_I02 Library YMU02 Length ...305 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_I02. 5' end sequence. Accession DK946400...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946400|Adiantum capillus-veneris mRNA... Res. 25:3389-3402. Query= DK946400|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0012_I02, 5' (260 let

  20. AcEST: DK944400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK944400 CL138Contig1 Show DK944400 Clone id YMU02A01NGRL0005_O24 Library YMU02 Length 3...49 Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_O24. 5' end sequence. Accession DK944400...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944400...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944400|Adiantum cap

  1. AcEST: DK954400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK954400 CL233Contig1 Show DK954400 Clone id TST39A01NGRL0020_F11 Library TST39 Length 6...47 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_F11. 5' end sequence. Accession DK954400...Acids Res. 25:3389-3402. Query= DK954400|Adiantum capillus-veneris mRNA, clone: T...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954400|Adiantum capillus-vener

  2. AcEST: DK948400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK948400 CL407Contig1 Show DK948400 Clone id TST38A01NGRL0003_D12 Library TST38 Length 6...81 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_D12. 5' end sequence. Accession DK948400... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948400...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948400

  3. AcEST: DK950400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK950400 CL3626Contig1 Show DK950400 Clone id TST38A01NGRL0008_I22 Library TST38 Length ...702 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_I22. 5' end sequence. Accession DK950400...base search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950400|Adiantum c..., Nucleic Acids Res. 25:3389-3402. Query= DK950400|Adiantum capillus-veneris mRNA

  4. AcEST: DK951100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK951100 CL180Contig1 Show DK951100 Clone id TST38A01NGRL0010_H22 Library TST38 Length 5...66 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_H22. 5' end sequence. Accession DK951100...Res. 25:3389-3402. Query= DK951100|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0010_H22, 5' (566 lett...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK951100

  5. AcEST: DK953100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK953100 CL618Contig1 Show DK953100 Clone id TST38A01NGRL0015_O02 Library TST38 Length 6...22 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_O02. 5' end sequence. Accession DK953100...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953100|Adiantum capillus-veneris mRNA, clone: ...cleic Acids Res. 25:3389-3402. Query= DK953100|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0015_O02,

  6. AcEST: DK955100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK955100 CL997Contig1 Show DK955100 Clone id TST39A01NGRL0022_D05 Library TST39 Length 6...17 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_D05. 5' end sequence. Accession DK955100... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955100|Adiant...ams, Nucleic Acids Res. 25:3389-3402. Query= DK955100|Adiantum capillus-veneris m

  7. AcEST: DK957100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK957100 CL162Contig1 Show DK957100 Clone id TST39A01NGRL0027_H17 Library TST39 Length 5...44 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0027_H17. 5' end sequence. Accession DK957100... Nucleic Acids Res. 25:3389-3402. Query= DK957100|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0027_H1...es. 25:3389-3402. Query= DK957100|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0027_H17, 5' (544 lette

  8. AcEST: DK961941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK961941 CL23Contig1 Show DK961941 Clone id TST39A01NGRL0011_I11 Library TST39 Length 64...1 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_I11. 5' end sequence. Accession DK961941..., Nucleic Acids Res. 25:3389-3402. Query= DK961941|Adiantum capillus-veneris mRNA... search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961941|Adiantum capil...TST39A01NGRL0011_I11 641 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_I1

  9. EPA RE-Powering Mapper Solar on Landfills

    Data.gov (United States)

    U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Office of Communications, Partnerships and Analysis (OCPA) initiated...

  10. U.S. EPAs Geospatial Data Access Project

    Data.gov (United States)

    U.S. Environmental Protection Agency — To improve public health and the environment, the United States Environmental Protection Agency (EPA) collects information about facilities, sites, or places subject...

  11. 77 FR 32088 - EPA Board of Scientific Counselors Advisory Board; Notice of Charter Renewal

    Science.gov (United States)

    2012-05-31

    ... AGENCY EPA Board of Scientific Counselors Advisory Board; Notice of Charter Renewal AGENCY: Environmental Protection Agency (EPA). ACTION: Notice of Charter Renewal. Notice is hereby given that the Environmental... Committee Act (FACA), 5 U.S.C. App.2, the EPA Board of Scientific Counselors Advisory Board (BOSC) is...

  12. 75 FR 29338 - EPA Board of Scientific Counselors Advisory Board; Notice of Charter Renewal

    Science.gov (United States)

    2010-05-25

    ... AGENCY EPA Board of Scientific Counselors Advisory Board; Notice of Charter Renewal AGENCY: Environmental Protection Agency (EPA). ACTION: Notice of charter renewal. Notice is hereby given that the Environmental... Committee Act (FACA), 5 U.S.C. App.2, the EPA Board of of Scientific Counselors Advisory Board (BOSC) is...

  13. EPA's (Environmental Protection Agency's) draft drinking-water criteria document for monochlorobenzene. Technical comments of the Halogenated Organics Subcommittee. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-16

    The Halogenated Organics Subcommittee evaluated the animal evidence for carcinogencity of chlorobenzene to be inadequate under EPA's new guidelines based on the lack of a statistically significant increase in the incidence of tumors in female mice, male mice and female rats, and on the basis of the perception of a diminished biologic significance of reported malignant neoplastic nodules of the liver in the highest dose-treated male rats. The evidence would place chlorobenzene into the overall weight-of-the-evidence category D (not classified).

  14. "Slicer" for EPA

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    During the design of the Electron-Positron-Accumulator (EPA), there was an apprehension about the stability-limit of positron bunch-intensity in the SPS. In case that EPA would be able to produce bunches with intensities exceeding what the SPS could digest, an electrostatic septum was to slice up the EPA beam over 2 or 4 turns, thus lowering the bunch intensity while maintaining fast filling of LEP. The "slicer" septum was built and installed, but thanks to the good appetite of the SPS its use never became necessary. The slicer was removed from EPA to lower the machine impedance.

  15. Environmental report 2010

    Energy Technology Data Exchange (ETDEWEB)

    2010-06-15

    As the electricity and natural gas transmission system operator in Denmark, Energinet.dk is obliged by the Danish Electricity Supply Act to prepare an annual environmental report for the purpose of creating an overview of the environmental conditions in the electricity sector. The environmental report also contributes to assessing the objectives implemented in Danish environmental and energy strategies. Environmental Report 2010 describes the most significant environmental impact of electricity and CHP production in Denmark and of the operation of the electricity and natural gas transmission systems. Environmental Report 2010 deals with the following five main topics: 1) A status of the environmental impact of the Danish power system in 2009. The status includes the most important key figures for electricity and CHP production, electricity exchange with neighbouring countries, and emissions of the substances subject to the EU Emissions Trading Scheme, ie carbon dioxide (CO{sub 2}), sulphur dioxide (SO{sub 2}) and nitrogen oxides (NO{sub x}). 2) The Environmental Impact Statement for electricity, which states the environmental impact of consuming one kWh of electricity. The statement accounts for a total of eight emissions to the air, seven residual products and eight fuel types. 3) Historical analysis of the environmental conditions in the electricity sector in the 1990-2020 period and a forecast of the future environmental impact of the electricity sector until 2020. An account is given of developments in electricity consumption, power generation, fuel consumption and emissions of CO{sub 2}, SO{sub 2} and NO{sub x}. 4) The environmental impact of transporting electricity and natural gas in the electricity and natural gas transmission systems and of storing natural gas in Energinet.dk's gas storage facility in Lille Torup. 5) Energinet.dk's own environmental activities. Here, some of Energinet.dk's other environmental activities, which are not

  16. Draft reference grid cells for emergency response reconnaissance developed for use by the US Environmental Protection Agency [ER.QUADS6K_EPA

    Data.gov (United States)

    U.S. Environmental Protection Agency — Draft reference grid cells for emergency response reconnaissance developed for use by the US Environmental Protection Agency. Grid cells are based on densification...

  17. EPA Administrative Law Judge Legal Documents

    Science.gov (United States)

    This dataset contains Decisions and Orders originating from EPAs Office of Administrative Law Judges (OALJ), which is an independent office in the Office of the Administrator of the EPA. The Administrative Law Judges conduct hearings and render decisions in proceedings between the EPA and persons, businesses, government entities, and other organizations which are or are alleged to be regulated under environmental laws. Administrative Law Judges preside in enforcement and permit proceedings in accordance with the Administrative Procedure Act. Most enforcement actions initiated by the EPA are for the assessment of civil penalties. The Decisions and Orders are organized into three categories: (1) alphabetical listing by the respondent involved, (2) reverse chronological listing by date, and (3) Decisions and Orders under FIFRA Section 6. This dataset includes Decisions and Orders dating back to 1989 in the Reverse Chronological list, Decisions and Orders dating back to 1997 in the Alphabetical list, and a few Decisions and Orders dating back to 1974 under FIFRA Section 6.

  18. EPA Study Finds Electronics Recycling Standards are Well Implemented and Makes Recommendations for Further Improvement

    Science.gov (United States)

    WASHINGTON -- The U.S. Environmental Protection Agency (EPA) today released a study assessing the implementation of the two third-party certification programs for electronic waste recyclers in the United States. EPA's study found that the certificat

  19. EPA Releases the First of Four Preliminary Risk Assessments for Insecticides Potentially Harmful to Bees

    Science.gov (United States)

    WASHINGTON-- The U.S. Environmental Protection Agency (EPA) announced a preliminary pollinator risk assessment for the neonicotinoid insecticide, imidacloprid, which shows a threat to some pollinators. EPA's assessment, prepared in collaboration wit

  20. EPA Region 1 - Map Layers for Valley ID Tool (Hosted Feature Service)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Valley Service Feature Layer hosts spatial data for EPA Region 1's Valley Identification Tool. These layers contain attribute information added by EPA R1 GIS...

  1. Risk Management Plan (RMP) Facility Points, Region 9, 2014, US EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Risk Management Plan (RMP): Under the Clean Air Act, Section 112(r), the EPA established a program requiring risk management plans to be provided to the EPA by...

  2. USEPA Geospatial Metadata EPA Region 2 All Regulated Facilities GIS layer PUB.

    Data.gov (United States)

    U.S. Environmental Protection Agency — This ArcGIS 10.2 point feature class (All Regulated Facilities [R2] Public contains a unique record for every EPA Regulated Facility in EPA Region 2 (NYS, NJ, Puerto...

  3. BIOREMEDIATION OF HAZARDOUS WASTE SITES: PRACTICAL APPROACHES TO IMPLEMENTATION (EPA/625/K-96/001)

    Science.gov (United States)

    This document contains abstracts and slide hardcopy for the U.S. Environmental Protection Agency's (EPA's) "Seminar Series on Bioremediation of Hazardous Waste Sites: Practical Approaches to Implementation." This technology transfer seminar series, sponsored by EPA's Biosystems ...

  4. EPA Recognizes Whole Foods Market in Marietta, Ga for Reducing Food Waste

    Science.gov (United States)

    ATLANTA - Today, U.S. Environmental Protection Agency (EPA) Regional Administrator Heather McTeer Toney recognized the Whole Foods Market Merchant Walk Marietta Store in Georgia for the store's achievements in EPA's Food Recovery Challenge. Whole Fo

  5. EPA Takes Action to Reduce Exposure to TCE in Art and Crafts Spray Fixatives

    Science.gov (United States)

    WASHINGTON - After the U.S. Environmental Protection Agency's (EPA) assessment of trichloroethylene or TCE showed risk, the sole manufacturer of a fixative product using TCE voluntarily withdrew it from the marketplace. The EPA is now taking action

  6. EPA, NASA, NOAA and USGS Creating Early Warning System to Detect Harmful Algal Blooms

    Science.gov (United States)

    WASHINGTON- The U.S. Environmental Protection Agency (EPA) announced today that it is developing an early warning indicator system using historical and current satellite data to detect algal blooms. EPA researchers will develop a mobile app to inform water

  7. DK SUPERCONDUCTING TAPE TECHNOLOGY 2002-2003

    DEFF Research Database (Denmark)

    Nielsen, Morten Storgaard; Andersen, Niels Hessel; Eriksen, Morten;

    Report on the work performed by AFM, Risø and IPL, DTU in collaboration with NST A/S and Haldor Topsøe A/S within the Danish Energy Research Program EFP, DK SUPERLEDERE I ELSEKTOREN 2002-2003......Report on the work performed by AFM, Risø and IPL, DTU in collaboration with NST A/S and Haldor Topsøe A/S within the Danish Energy Research Program EFP, DK SUPERLEDERE I ELSEKTOREN 2002-2003...

  8. EPA Library Network Communication Strategies

    Science.gov (United States)

    To establish Agency-wide procedures for the EPA National Library Network libraries to communicate, using a range of established mechanisms, with other EPA libraries, EPA staff, organizations and the public.

  9. $DK$ and $D^* K$ scattering near threshold

    Energy Technology Data Exchange (ETDEWEB)

    Lang, C. B. [Graz U.; Leskovec, Luka [Stefan Inst., Ljubljana; Mohler, Daniel [Fermilab; Prelovsek, Sasa [Stefan Inst., Ljubljana; Woloshyn, R. M. [TRIUMF

    2015-05-20

    We study the three $D_s$ quantum channels $J^P = 0^+$, $1^+$ and $2^+$ where experiments have identified the charm-strange states $D^*_{s0} (2317)$, $D_{s1}(2460)$, $D_{s1}(2536)$ near the $DK$ and $D^*K$ thresholds, and $D^*_{s2}(2573)$. We consider correlation functions for sets of $\\overline q q$ operators and, for $J^P = 0^+$, $1^+$, also the $DK$ and $D^*K$ meson-meson interpolators and determine for these cases values of the elastic scattering amplitude. Constructing the full set of correlators requires propagators which connect any pair of lattice sites. For one ensemble of gauge configurations ($32^3\\times 64$, $m_\\pi\\approx 156$ MeV) a stochastic distillation variant is employed and for another ensemble ($16^3\\times 32$, $m_\\pi\\approx 266$ MeV) we use the full distillation method. Both, $D^*_{s0} (2317)$ and $D_{s1}(2460)$, are found as bound states below threshold, whereas $D_{s1}(2536)$, and $D^*_{s2}(2573)$ are identified as narrow resonances close to the experimental masses.

  10. $DK$ and $D^* K$ scattering near threshold

    CERN Document Server

    Lang, C B; Mohler, Daniel; Prelovsek, Sasa; Woloshyn, R M

    2014-01-01

    We study the three $D_s$ quantum channels $J^P = 0^+$, $1^+$ and $2^+$ where experiments have identified the charm-strange states $D^*_{s0} (2317)$, $D_{s1}(2460)$, $D_{s1}(2536)$ near the $DK$ and $D^*K$ thresholds, and $D^*_{s2}(2573)$. We consider correlation functions for sets of $\\overline q q$ operators and, for $J^P = 0^+$, $1^+$, also the $DK$ and $D^*K$ meson-meson interpolators and determine for these cases values of the elastic scattering amplitude. Constructing the full set of correlators requires propagators which connect any pair of lattice sites. For one ensemble of gauge configurations ($32^3\\times 64$, $m_\\pi\\approx 156$ MeV) a stochastic distillation variant is employed and for another ensemble ($16^3\\times 32$, $m_\\pi\\approx 266$ MeV) we use the full distillation method. Both, $D^*_{s0} (2317)$ and $D_{s1}(2460)$, are found as bound states below threshold, whereas $D_{s1}(2536)$, and $D^*_{s2}(2573)$ are identified as narrow resonances close to the experimental masses.

  11. AcEST: DK946666 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0013_F10 131 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_F1...0. 5' end sequence. DK946666 - Show DK946666 Clone id YMU02A01NGRL0013_F10 Library YMU02 Length 131 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_F10. 5' end sequence. Accession DK946666 Tissue t

  12. AcEST: DK944034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK944034 - Show DK944034 Clone id YMU02A01NGRL0004_M12 Library YMU02 Length 108 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_M12. 5' end sequence. Accession DK944034 Tissue t...YMU02A01NGRL0004_M12 108 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_M1

  13. A Virtual Field Trip to the Real World of Cap and Trade: Environmental Economics and the EPA SO[subscript 2] Allowance Auction

    Science.gov (United States)

    Lewis, Lynne Y.

    2011-01-01

    In the spring of 2001, Bates College Environmental Economics classes bought their first sulfur dioxide emissions allowance at U.S. Environmental Protection Agency's annual auction, then conducted by the Chicago Board of Trade. In the spring of 2010, they bought their 22nd through 34th allowances. This article describes a three-part method for…

  14. Executive Order 12898 and Social, Economic, and Sociopolitical Factors Influencing Toxic Release Inventory Facility Location in EPA Region 6: A Multi-Scale Spatial Assessment of Environmental Justice

    Science.gov (United States)

    Moore, Andrea Lisa

    2013-01-01

    Toxic Release Inventory facilities are among the many environmental hazards shown to create environmental inequities in the United States. This project examined four factors associated with Toxic Release Inventory, specifically, manufacturing facility location at multiple spatial scales using spatial analysis techniques (i.e., O-ring statistic and…

  15. Executive Order 12898 and Social, Economic, and Sociopolitical Factors Influencing Toxic Release Inventory Facility Location in EPA Region 6: A Multi-Scale Spatial Assessment of Environmental Justice

    Science.gov (United States)

    Moore, Andrea Lisa

    2013-01-01

    Toxic Release Inventory facilities are among the many environmental hazards shown to create environmental inequities in the United States. This project examined four factors associated with Toxic Release Inventory, specifically, manufacturing facility location at multiple spatial scales using spatial analysis techniques (i.e., O-ring statistic and…

  16. Green Roof Research through EPA's Regional Applied Research Effort - slides

    Science.gov (United States)

    The U.S. Environmental Protection Agency’s (EPA) Regional Applied Research Effort (RARE) allows the Regions of the EPA to choose research projects to be performed in partnership with EPA’s Office of Research and Development (ORD). Over the last decade, several green roof projects...

  17. Green Roof Research through EPA's Regional Applied Research Effort

    Science.gov (United States)

    ABSTRACT The U.S. Environmental Protection Agency’s (EPA) Regional Applied Research Effort (RARE) allows the Regions of the EPA to choose research projects to be performed in partnership with EPA’s Office of Research and Development (ORD). Over the last decade, several green roo...

  18. University of New Mexico and EPA fight Climate Change

    Science.gov (United States)

    Nationally EPA will provide $8.5 million to 12 universities DALLAS - (April 7, 2016) The U.S. Environmental Protection Agency (EPA) is providing $335,605 to the University of New Mexico to research challenges associated with protecting t

  19. 75 FR 56528 - EPA's Role in Advancing Sustainable Products

    Science.gov (United States)

    2010-09-16

    ... AGENCY EPA's Role in Advancing Sustainable Products AGENCY: Environmental Protection Agency (EPA). ACTION... in the ``green'' or sustainable products movement. The Agency will consider the information gathered... of sustainable products. DATES: Comments must be received on or before October 19, 2010....

  20. 78 FR 49752 - National Environmental Education Advisory Council

    Science.gov (United States)

    2013-08-15

    ... AGENCY National Environmental Education Advisory Council AGENCY: Environmental Protection Agency (EPA... series of teleconference meetings of the National Environmental Education Advisory Council (NEEAC). The... EPA under the National Environmental Education Act (the Act). The purpose of these...

  1. 78 FR 12056 - National Environmental Education Advisory Council

    Science.gov (United States)

    2013-02-21

    ... AGENCY National Environmental Education Advisory Council AGENCY: Environmental Protection Agency (EPA... series of teleconference meetings of the National Environmental Education Advisory Council (NEEAC). The... EPA under the National Environmental Education Act (the Act). The purpose of these...

  2. AcEST: DK961004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK961004 CL497Contig1 Show DK961004 Clone id TST39A01NGRL0008_P04 Library TST39 Length 6...80 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_P04. 5' end sequence. Accession DK96100...ucleic Acids Res. 25:3389-3402. Query= DK961004|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0008_P04,... RIM+S RDP++RK+G N+FIKNLD IDNKALHDTF Sbjct: 100 ADGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDAAIDNKALHDTF 15...bjct: 41 PNASQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNNT 100 Query: 508 PDATRAMEVLNFTEVNGKLMRIM

  3. AcEST: DK962206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK962206 CL445Contig1 Show DK962206 Clone id TST39A01NGRL0013_D21 Library TST39 Length 6...33 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_D21. 5' end sequence. Accession DK96220... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96220...Putative ribonucleoprotein At2g37220, chlor... 62 2e-09 sp|Q8BG81|PDIP3_MOUSE Pol...80 (54%), Gaps = 8/180 (4%) Frame = +2 Query: 41 QWDHDLYEEGASVAPLRPNTGIETGTKLFISNLDFGVSNEDIKELFSEIGDIKRSTVHYD 220

  4. AcEST: DK962003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK962003 CL3Contig1 Show DK962003 Clone id TST39A01NGRL0011_L02 Library TST39 Length 704... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0011_L02. 5' end sequence. Accession DK962003...value 3.0e-81 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandr...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96200...168 (91%) Frame = +2 Query: 200 GSYADELVKTANSIASKGRGILAMDESNATCGKRLASIGLENTEANRQAYRQLLCTAPGL 379 GSYADELVKTA

  5. AcEST: DK952002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK952002 - Show DK952002 Clone id TST38A01NGRL0012_O18 Library TST38 Length 616 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_O18. 5' end sequence. Accession DK952002 Tissue t...OS=Arabidopsis thaliana Align length 183 Score (bit) 78.6 E-value 2.0e-14 Report BLASTX 2.2.19 [Nov-02-2008]...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952002|Adiantum capillus-vene...VFVGNALVAMYSRCRSLSDARKVFDEMSVWD-VVSWNSII------------------- 200 Query: 225 AKQWCRSRCNHMRLDLEGKGQLQAGISPNATTY

  6. AcEST: DK955553 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_G13 495 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_G1...3. 5' end sequence. DK955553 - Show DK955553 Clone id TST39A01NGRL0023_G13 Library TST39 Length 495 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_G13. 5' end sequence. Accession DK955553 Tissue t...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955553|Adiantum cap...SSYDRRFTTRSY-MTQGLVNGGI---NVPM 63 Query: 185 YLSTPVFVAAPTEK---SFAVDFLMSGXXXXXXXXXXXXXXRVKLFIHNQDDMLKSGRLP 355

  7. AcEST: DK944403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK944403 - Show DK944403 Clone id YMU02A01NGRL0005_P03 Library YMU02 Length 271 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_P03. 5' end sequence. Accession DK944403 Tissue t...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK944403|Adian

  8. AcEST: DK953500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK953500 - Show DK953500 Clone id TST39A01NGRL0017_O23 Library TST39 Length 480 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_O23. 5' end sequence. Accession DK953500 Tissue t...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953500

  9. AcEST: DK950019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_I17 718 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_I1...7. 5' end sequence. DK950019 - Show DK950019 Clone id TST38A01NGRL0007_I17 Library TST38 Length 718 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_I17. 5' end sequence. Accession DK950019 Tissue t...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK9500... AA G ++LLL+ Sbjct: 496 NSEELERAREVKEKDAALCLEFLLQNDANPSI--RDKEGYNSIHYAAAYGHRQCLELLLE 553 Query: 500 ALAATPHG

  10. AcEST: DK960860 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0008_I20 663 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_I2...0. 5' end sequence. DK960860 CL1354Contig1 Show DK960860 Clone id TST39A01NGRL0008_I20 Library TST39 Length ...663 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_I20. 5' end sequence. Accession DK960860...ucleic Acids Res. 25:3389-3402. Query= DK960860|Adiantum capillus-veneris mRNA, c...+ LGFD++ S E SS Sbjct: 1 MAWFSGKVSLGGFPDLTGAVNKFQESVKNIEKNFDNALGFDDKSDSAAEDAASSMWPPAV 60 Query: 508 EKLSLFEP

  11. AcEST: DK949432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK949432 CL2Contig2 Show DK949432 Clone id TST38A01NGRL0005_P15 Library TST38 Length 698... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_P15. 5' end sequence. Accession DK949432...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949432|Ad...IGSVYREHFHGSGYYDGRYWVMWKLPMFGCQDAAAVL 432 ++K++D+++R W PC+EF+ + G VYREH H GYYDGRYW MWKLPMFGC D+A V+ Sbjct: 8...WPPFGNPKFETLSYLPTLTE 74 Query: 253 EQIAKQVDFMVRKGWTPCIEFDKIGSVYREHFHGSGYYDGRYWVMWKLPMFGCQDAAAVL 432 EQ+ K+V+

  12. AcEST: DK950050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0007_K02 665 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_K0...2. 5' end sequence. DK950050 - Show DK950050 Clone id TST38A01NGRL0007_K02 Library TST38 Length 665 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_K02. 5' end sequence. Accession DK950050 Tissue t...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK950050|Adian...LESALLGPDGEAVESVEFSGENNSSFWTELLDEVTPATRQQTTNEITAN 467 D++ M++ ++ELE ALLG + + + + + L E+ Q +E Sbjct: 150

  13. AcEST: DK959526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_O23 641 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O23. 5' end sequence. DK95...9526 CL2219Contig1 Show DK959526 Clone id TST39A01NGRL0004_O23 Library TST39 Length ...641 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O23. 5' end sequence. Accession DK9595...search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959526|Adiantum capill...LSAGPLPSSGGKLEAIATKIGVAIAR 343 V PA++AVD + E++ G S+ + L + + +L+ + +IG AI Sbjct: 95 VRVPAVYAVDESAGWLMLEWVSGGP

  14. AcEST: DK958954 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0003_G02 663 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_G02. 5' end sequence. DK95...8954 CL1475Contig1 Show DK958954 Clone id TST39A01NGRL0003_G02 Library TST39 Length ...663 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0003_G02. 5' end sequence. Accession DK95895... Res. 25:3389-3402. Query= DK958954|Adiantum capillus-veneris mRNA, clone: TST39A...EDAARVARFVTHVSDWGALATISTLEAVRGRPFADVLSLSDGP 95 Query: 298 DGNSTGVPYFYMSTLDPTPKDLA

  15. AcEST: DK959546 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_P21 665 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_P21. 5' end sequence. DK95...9546 CL142Contig1 Show DK959546 Clone id TST39A01NGRL0004_P21 Library TST39 Length 6...65 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_P21. 5' end sequence. Accession DK9595...se search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959546|Adiantum cap...uctoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1 Length = 595

  16. AcEST: DK950954 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0010_B12 681 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_B12. 5' end sequence. DK95...0954 CL2028Contig1 Show DK950954 Clone id TST38A01NGRL0010_B12 Library TST38 Length ...681 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_B12. 5' end sequence. Accession DK95095... Res. 25:3389-3402. Query= DK950954|Adiantum capillus-veneris mRNA, clone: TST38A...QSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKS 251 Query: 440 CAWNKGKPRSEETKEKISARTRQAMEDPKIRERLRKAREGSTQSSETKLRIK 595

  17. AcEST: DK959582 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0005_B12 642 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_B12. 5' end sequence. DK95...9582 CL167Contig1 Show DK959582 Clone id TST39A01NGRL0005_B12 Library TST39 Length 6...42 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_B12. 5' end sequence. Accession DK9595...Res. 25:3389-3402. Query= DK959582|Adiantum capillus-veneris mRNA, clone: TST39A0...SEAVREAISSIITHCKETKPRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHVPR 60 Query: 216 PKMKVCMLGDAQHVEEAEKIGLDCMDVDXXXXXXXXXX

  18. AcEST: DK959519 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0004_O16 666 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O16. 5' end sequence. DK95...9519 CL3313Contig1 Show DK959519 Clone id TST39A01NGRL0004_O16 Library TST39 Length ...666 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_O16. 5' end sequence. Accession DK9595... database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK959519|Adian...ACGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQV 92 Query: 595 AIWFQNRRARWKTQQLEQDYESLK 666 A+WFQNRRARWKT+Q

  19. AcEST: DK954195 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0019_M20 521 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_M20. 5' end sequence. DK95...4195 - Show DK954195 Clone id TST39A01NGRL0019_M20 Library TST39 Length 521 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_M20. 5' end sequence. Accession DK954195 Tissue t... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954195...VQ+VEFV D Sbjct: 336 VEQMDMPPRGVRQTLLFSATFPREIQRLAADFLANYIFLAVGRVGSSTDLIVQRVEFVLD 395 Query: 365 HDKRSMLMDLI

  20. AcEST: DK954007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK954007 - Show DK954007 Clone id TST39A01NGRL0019_E18 Library TST39 Length 440 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_E18. 5' end sequence. Accession DK954007 Tissue t...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954007|A...TST39A01NGRL0019_E18 440 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_E1

  1. AcEST: DK949400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK949400 - Show DK949400 Clone id TST38A01NGRL0005_O07 Library TST38 Length 691 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_O07. 5' end sequence. Accession DK949400 Tissue t...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK949400|Adiantum capillus-veneris...L+AEPT A+SMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFG Sbjct: 400 DLANQVRPLPELVAEPTDAR...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25

  2. Aspectos do licenciamento ambiental da carcinicultura na APA do Delta do Parnaíba Aspects of environmental licensing for carciniculture in EPA of the Delta of Parnaíba River

    Directory of Open Access Journals (Sweden)

    Hamilton Gondim de Alencar Araripe

    2006-12-01

    Full Text Available O presente trabalho tem como foco uma análise do valor do licenciamento ambiental da carcinicultura na APA do Delta do Parnaíba. Realizou-se visitas técnicas a todos empreendimentos instalados até o primeiro semestre de 2004, levantou-se a legislação pertinente, avaliou-se estudos ambientais e relatórios de vistorias técnicas realizadas pelo IBAMA. Concluiu-se que o enquadramento feito pelo IBAMA no processo de licenciamento do que seja área de preservação permanente (APP no manguezal é o ponto crítico para a atividade de carcinicultura.The present research examines the environmental matter in the Environmental Protection Area (EPA of the Delta of the Parnaíba River, focusing on the ambient licensing value. Technical visits to all companies installed in the area until the first semester of 2004 and non-structured interviews were carried out; the existing legislation was raised; and the environmental studies and reports of technical inspections performed by IBAMA were evaluated. The conclusion was that the adjustment made by IBAMA in the ambient licensing process of what is an Area of Permanent Preservation (APP in the mangrove is the critical point to the carciniculture activity.

  3. EPA's science blog: "It All Starts with Science"; Article title: "EPA's Solvent Substitution Software Tool, PARIS III"

    Science.gov (United States)

    EPA's solvent substitution software tool, PARIS III is provided by the EPA for free, and can be effective and efficiently used to help environmentally-conscious individuals find better and greener solvent mixtures for many different common industrial processes. People can downlo...

  4. EPA's science blog: "It All Starts with Science"; Article title: "EPA's Solvent Substitution Software Tool, PARIS III"

    Science.gov (United States)

    EPA's solvent substitution software tool, PARIS III is provided by the EPA for free, and can be effective and efficiently used to help environmentally-conscious individuals find better and greener solvent mixtures for many different common industrial processes. People can downlo...

  5. WAsP engineering DK

    Energy Technology Data Exchange (ETDEWEB)

    Mann, J.; Astrup, P.; Kristensen, L.; Rathmann, O.; Hauge Madsen, P.; Heathfield, D.

    2000-05-01

    This report summarizes the findings of the EFP project WAsP Engineering Version 1.0 DK - Vindforhold for vindmoelledesign. WAsP Engineering is a series of experimental and theoretical activities concerning properties of the winds in moderately complex terrain with relevance for loads on wind turbines and other large structures. These properties include extreme winds, wind shear and turbulence. Most of the models have been integrated in a windows program prototype, also called WAsP Engineering. The basic mean flow model LINCOM has been changed in several respects to accommodate the demands from load calculations. The most important change is the inclusion of a complex model for the roughness length on water bodies. This is particularly important for the estimation of extreme winds in the vicinity of sea shores. A second addition is the calculation of spatial derivatives of the mean flow to be used for the modeling of turbulence. The turbulence structure on hills is modeled by perturbing the flat, homogeneous terrain turbulence using Rapid Distortion Theory. A simple model for the adjustment of turbulence to roughness changes is also applied. Second order turbulence statistics such as turbulence intensities, spectra and cross-spectra can be estimated at user-chosen positions in the terrain. A program for simulation of turbulence with the calculated statistics has been developed. However, it has not yet been integrated into the windows interface. Climatological series of wind speed have been analyzed to establish the extreme wind climate over Denmark. The extreme wind climate contains directional information and is used for estimating the extreme winds at an arbitrary position in complex terrain. A net of high precision pressure sensors covering Denmark has been established in order to obtain a climatology of the geostrophic wind. A tentative conclusion from only one year of data is that, statistically , the geostrophic wind decreases when going from west toward east

  6. EPA Challenges & Prizes

    Science.gov (United States)

    EPA is a government leader in tapping the power of contributions from the public to help solve difficult problems that affect the environment and public health. Prize competitions allow federal agencies to pay only for successful solutions.

  7. Science Inventory | US EPA

    Science.gov (United States)

    The Science Inventory is a searchable database of research products primarily from EPA's Office of Research and Development. Science Inventory records provide descriptions of the product, contact information, and links to available printed material or websites.

  8. EPA Recognizes Charleston County School District for Reducing Food Waste

    Science.gov (United States)

    ATLANTA - Today, U.S. Environmental Protection Agency (EPA) recognized the Charleston County School District for the District's achievements in reducing food waste. The District cultivated one of the state's first student-driven commercial compostin

  9. EPA Announces Toyota Motor Manufacturing Achieved 2015 ENERGY STAR Certification

    Science.gov (United States)

    (02/24/16 - ATLANTA ) -- The U.S. Environmental Protection Agency (EPA) announced today that Toyota Motor Manufacturing in Kentucky is among 70 manufacturing plants to have achieved Energy Star certification for their superior energy performance in 2

  10. EPA Facility Registry Service (FRS): RCRA_ACTIVE

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of active hazardous...

  11. EPA Facility Registry Service (FRS): CERCLIS_NPL

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that are...

  12. EPA Facility Registry Service (FRS): RCRA_TSD

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of Hazardous Waste...

  13. EPA Facility Registry Service (FRS): Facility Interests Dataset - Intranet Download

    Data.gov (United States)

    U.S. Environmental Protection Agency — This downloadable data package consists of location and facility identification information from EPA's Facility Registry Service (FRS) for all sites that are...

  14. EPA Facility Registry Service (FRS): ER_CERCLIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  15. EPA Facility Registry Service (FRS): ER_WWTP_NPDES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of Waste Water Treatment...

  16. EPA Facility Registry Service (FRS): AIRS_AFS Sub Facilities

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Air Facility System (AFS) contains compliance and permit data for stationary sources regulated by EPA, state and local air pollution agencies. The sub facility...

  17. Assistance Administration Manual 5700: Subawards Under EPA Assistance Agreements

    Science.gov (United States)

    The purpose of this Directive is to strengthen the management of subawards made by recipients under Environmental Protection Agency (EPA) assistance agreements, i.e., grants and cooperative agreements.

  18. EPA Facility Registry Service (FRS): ER_RMP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  19. Sampling Stations, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  20. Roof Catchments, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  1. EPA Facility Registry Service (FRS): AIRS_AFS_MAJOR

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  2. US EPA Region 9 Coal-Fired Power Plants

    Data.gov (United States)

    U.S. Environmental Protection Agency — Approximate locations of active coal-fired power plants located in US EPA's Region 9. Emission counts from the 2005 National Emissions Inventory (NEI) are included...

  3. EPA Region 1 - New England Towns, with Population

    Data.gov (United States)

    U.S. Environmental Protection Agency — The New England Town Boundary coverage is a compilation of coverages received from the six New England State GIS Offices. The EPA New England GIS Center appended the...

  4. EPA Facility Registry Service (FRS): ER_RCRATSD

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  5. EPA Facility Registry Service (FRS): AIRS_AQS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  6. EPA Facility Registry Service (FRS): PCS_NPDES

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  7. EPA Facility Registry Service (FRS): PCS_NPDES_MAJOR

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that are...

  8. EPA Facility Registry Service (FRS): RCRA_LQG

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  9. Other SDWIS Facilities, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  10. Pumping Facilities, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  11. EPA Facility Registry Service (FRS): ALL FRS INTERESTS LAYER

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data provides location and attribute information on all facilities in EPA's Facility Registry Service (FRS) for a internet web feature service . The FRS is an...

  12. EPA proposes St. Regis Paper Co. Cleanup Plan, accepting comments

    Science.gov (United States)

    For Immediate Release No.16-OPA006 EPA proposes St. Regis Paper Co. Cleanup Plan; accepting comments CHICAGO (March 30, 2016) -- U.S. Environmental Protection Agency is issuing a proposed plan to clean up soil contamin

  13. Treatment Plants, US EPA Region 9, 2013, SDWIS

    Data.gov (United States)

    U.S. Environmental Protection Agency — EPAâ??s Safe Drinking Water Information System (SDWIS) databases store information about drinking water. The federal version (SDWIS/FED) stores the information EPA...

  14. EPA Facility Registry Service (FRS): AIRS_AFS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  15. US EPA Region 9 and US Coast Guard Jurisdictional Boundary

    Data.gov (United States)

    U.S. Environmental Protection Agency — This line feature represents the jurisdictional boundary along the California coastline that defines EPA (Inland Zone) and Coast Guard (Coastal Zone) emergency...

  16. EPA Facility Registry Service (FRS): ER_TSCA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  17. EPA Facility Registry Service (FRS): ER_TRI

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  18. EPA Facility Registry Service (FRS): Facility Interests Dataset - Intranet

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service consists of location and facility identification information from EPA's Facility Registry Service (FRS) for all sites that are available in...

  19. EPA Facility Registry Service (FRS): Facility Interests Dataset Download

    Data.gov (United States)

    U.S. Environmental Protection Agency — This downloadable data package consists of location and facility identification information from EPA's Facility Registry Service (FRS) for all sites that are...

  20. EPA Facility Registry Service (FRS): ER_FRP

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link to Facility...

  1. EPA Facility Registry Service (FRS): RCRA_TRANS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of facilities that link...

  2. EPA Facility Registry Service (FRS): RCRA_INACTIVE

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry Service (FRS) for the subset of hazardous waste...

  3. US EPA Region 9 1-Hour Ozone NAAQS Designations

    Data.gov (United States)

    U.S. Environmental Protection Agency — Esri polygon shapefile of 1-hour ozone designated areas in US EPA Region 9. Nonattainment areas are geographic areas which have not met National Ambient Air Quality...

  4. EPA Facility Registry Service (FRS): Facility Interests Dataset

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service consists of location and facility identification information from EPA's Facility Registry Service (FRS) for all sites that are available in...

  5. Air Quality System (AQS) Monitoring Network, EPA OAR OAQPS

    Data.gov (United States)

    U.S. Environmental Protection Agency — This GIS dataset contains points which depict air quality monitors within EPA's Air Quality System (AQS) monitoring network. This dataset is updated weekly to...

  6. Meet EPA Chemist Quincy Teng, Ph.D.

    Science.gov (United States)

    EPA research chemist Quincy Teng, Ph.D., focuses on the application of metabolomics—a relatively new, specialized field of biochemistry focused on studying small molecules known as metabolites—on environmental and life sciences.

  7. EPA Facility Registry Service (FRS): ER_EPLAN

    Data.gov (United States)

    U.S. Environmental Protection Agency — This web feature service contains location and facility identification information from EPA's Facility Registry System (FRS) for the subset of facilities that link...

  8. EPA Region 2 ICIS-NPDES PERMITS GIS Layer

    Data.gov (United States)

    U.S. Environmental Protection Agency — This ArcGIS 10.2 point feature class contains identification, location and status information for EPA Region 2 facilities (NYS, NJ, Puerto Rico and the US Virgin...

  9. 40 CFR 33.208 - How long does an MBE or WBE certification from EPA last?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false How long does an MBE or WBE... ENVIRONMENTAL PROTECTION AGENCY PROGRAMS Certification § 33.208 How long does an MBE or WBE certification from EPA last? Once EPA OSDBU certifies an entity to be an MBE or WBE by placing it on the EPA OSDBU...

  10. EPA Recognizes Rooms to Go in Suwanee, Georgia for Outstanding Waste Reduction Efforts

    Science.gov (United States)

    ATLANTA --- Today, the U.S. Environmental Protection Agency (EPA) recognizes the waste reduction accomplishments of Rooms to Go in Suwanee, Ga. along with the other 28 participants in and endorsers of EPA's Waste Wise program and EPA's Food Recovery Challe

  11. AcEST: DK946525 [AcEST

    Lifescience Database Archive (English)

    Full Text Available I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK946..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search prog...rams, Nucleic Acids Res. 25:3389-3402. Query= DK946525|Adiantum capillus-veneris mR

  12. AcEST: DK954550 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK954550 - Show DK954550 Clone id TST39A01NGRL0020_L19 Library TST39 Length 109 Definition...s-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length -...e too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  13. AcEST: DK946291 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK946291 - Show DK946291 Clone id YMU02A01NGRL0012_C02 Library YMU02 Length 141 Definition...ss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length ...ce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  14. AcEST: DK944711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK944711 - Show DK944711 Clone id YMU02A01NGRL0006_P12 Library YMU02 Length 139 Definition...-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - ... too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  15. AcEST: DK960767 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK960767 - Show DK960767 Clone id TST39A01NGRL0008_E20 Library TST39 Length 123 Definition...X Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition -...ast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  16. AcEST: DK946187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK946187 - Show DK946187 Clone id YMU02A01NGRL0011_M06 Library YMU02 Length 150 Definition...ult : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Alig...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: DK947281 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK947281 - Show DK947281 Clone id YMU02A01NGRL0015_G09 Library YMU02 Length 140 Definition...s-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length -...e too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: DK946983 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK946983 - Show DK946983 Clone id YMU02A01NGRL0014_G06 Library YMU02 Length 145 Definition... Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align len...quence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. DanBib og bibliotek.dk - visioner og udviklingsplaner

    DEFF Research Database (Denmark)

    Pedersen, Claus Vesterager

    2002-01-01

    I artiklen beskrives de fremtidige brugerkrav, der vil blive stillet til bibliotekernes informationsservice, og dermed også til DanBib og bibliotek.dk......I artiklen beskrives de fremtidige brugerkrav, der vil blive stillet til bibliotekernes informationsservice, og dermed også til DanBib og bibliotek.dk...

  20. National Pollution Discharge Elimination System (NPDES) Facility Points, Region 9, 2007, US EPA Region 9

    Data.gov (United States)

    U.S. Environmental Protection Agency — Point geospatial dataset representing locations of NPDES Facilities. NPDES (National Pollution Discharge Elimination System) is an EPA permit program that regulates...

  1. AcEST: DK952471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK952471 - Show DK952471 Clone id TST38A01NGRL0014_C21 Library TST38 Length 625 Definiti...on Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C21. 5' end sequence. Accession DK952471 Tissue t...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952471|Adiantum capillu...rams, Nucleic Acids Res. 25:3389-3402. Query= DK952471|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL00...TST38A01NGRL0014_C21 625 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C2

  2. AcEST: DK962473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK962473 - Show DK962473 Clone id TST39A01NGRL0013_P14 Library TST39 Length 491 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P14. 5' end sequence. Accession DK962473 Tissue t...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962473|Adiantum capillus-veneris mRNA, cl...eic Acids Res. 25:3389-3402. Query= DK962473|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0013_P14, 5'...TST39A01NGRL0013_P14 491 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  3. AcEST: DK962472 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK962472 CL3Contig1 Show DK962472 Clone id TST39A01NGRL0013_P13 Library TST39 Length 629... Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P13. 5' end sequence. Accession DK962472... 25:3389-3402. Query= DK962472|Adiantum capillus-veneris mRNA, clone: TST39A01NGR...grams, Nucleic Acids Res. 25:3389-3402. Query= DK962472|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0...TST39A01NGRL0013_P13 629 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  4. AcEST: DK962475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6. 5' end sequence. DK962475 CL12Contig1 Show DK962475 Clone id TST39A01NGRL0013_P16 Library TST39 Length 65...0 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P16. 5' end sequence. Accession DK96247...database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962475|Adiant... binding protein 151, chloro... 314 2e-85 sp|P15193|CB2A_PINSY Chlorophyll a-b binding protein type 2 memb... 314 3e-85 sp|P1247...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96247

  5. AcEST: DK962474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK962474 CL52Contig1 Show DK962474 Clone id TST39A01NGRL0013_P15 Library TST39 Length 66...7 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P15. 5' end sequence. Accession DK96247...grams, Nucleic Acids Res. 25:3389-3402. Query= DK962474|Adiantum capillus-veneris...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96247...TST39A01NGRL0013_P15 667 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  6. AcEST: DK952479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK952479 CL3715Contig1 Show DK952479 Clone id TST38A01NGRL0014_D05 Library TST38 Length ...591 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D05. 5' end sequence. Accession DK95247...rograms, Nucleic Acids Res. 25:3389-3402. Query= DK952479|Adiantum capillus-veneris mRNA, clone: TST38A01NGR... 25:3389-3402. Query= DK952479|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0014_D05, 5' (591 letters)...TST38A01NGRL0014_D05 591 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D0

  7. AcEST: DK955247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK955247 CL31Contig1 Show DK955247 Clone id TST39A01NGRL0022_J09 Library TST39 Length 49...3 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_J09. 5' end sequence. Accession DK955247...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955247|Adiantum capillus-ve...SFETIHVQDATGHEFATRLGNVFTIGKGTKPWVS 233 Query: 361 LPRGKGIKLSIVEE 402 LP+GKGIKL+I+EE Sbjct: 234 LPKGKGIKLTILEE 247... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK955247

  8. AcEST: DK952473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK952473 CL1548Contig1 Show DK952473 Clone id TST38A01NGRL0014_C23 Library TST38 Length ...624 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C23. 5' end sequence. Accession DK95247...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952473|Adiantum...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952473|A...TST38A01NGRL0014_C23 624 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C2

  9. AcEST: DK952477 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK952477 CL1757Contig1 Show DK952477 Clone id TST38A01NGRL0014_D03 Library TST38 Length ...734 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D03. 5' end sequence. Accession DK95247...es. 25:3389-3402. Query= DK952477|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0014_D03, 5' (706 lette...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95247...TST38A01NGRL0014_D03 734 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D0

  10. AcEST: DK962479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK962479 CL3352Contig1 Show DK962479 Clone id TST39A01NGRL0013_P20 Library TST39 Length ...605 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P20. 5' end sequence. Accession DK96247... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96247...PCC13-62 OS=Craterostigma plantagineum PE=2 SV=1 Length = 313 Score = 99.8 bits (247), Expect = 1e-20 Identi...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962479|Adiantum capillus-

  11. AcEST: DK962478 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9. 5' end sequence. DK962478 CL708Contig1 Show DK962478 Clone id TST39A01NGRL0013_P19 Library TST39 Length 5...82 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P19. 5' end sequence. Accession DK96247...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962478|Adi...programs, Nucleic Acids Res. 25:3389-3402. Query= DK962478|Adiantum capillus-veneris mRNA, clone: TST39A01NG...TST39A01NGRL0013_P19 582 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  12. AcEST: DK952474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK952474 CL3137Contig1 Show DK952474 Clone id TST38A01NGRL0014_C24 Library TST38 Length ...604 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C24. 5' end sequence. Accession DK95247...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952474|Adiantum capillus-veneris m...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95247...tr|A7PK53|A7PK53_VITVI Chromosome chr15 scaffold_19, whole genom... 247 4e-64 tr|B7FK13|B7FK13_MEDTR Putativ

  13. AcEST: DK962471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK962471 CL18Contig1 Show DK962471 Clone id TST39A01NGRL0013_P12 Library TST39 Length 40...8 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P12. 5' end sequence. Accession DK96247...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962471|A...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96247...TST39A01NGRL0013_P12 408 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  14. AcEST: DK952478 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK952478 CL451Contig1 Show DK952478 Clone id TST38A01NGRL0014_D04 Library TST38 Length 7...95 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D04. 5' end sequence. Accession DK95247...e search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952478|Adiantum capillus-veneris mRNA, clone: T...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95247...TST38A01NGRL0014_D04 795 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D0

  15. AcEST: DK962477 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8. 5' end sequence. DK962477 CL452Contig1 Show DK962477 Clone id TST39A01NGRL0013_P18 Library TST39 Length 6...52 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P18. 5' end sequence. Accession DK96247... Acids Res. 25:3389-3402. Query= DK962477|Adiantum capillus-veneris mRNA, clone: ...s. 25:3389-3402. Query= DK962477|Adiantum capillus-veneris mRNA, clone: TST39A01N...TST39A01NGRL0013_P18 652 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  16. AcEST: DK952476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2. 5' end sequence. DK952476 CL2678Contig1 Show DK952476 Clone id TST38A01NGRL0014_D02 Library TST38 Length ...549 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D02. 5' end sequence. Accession DK95247...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952476|Adi...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK952476|Adiantum ca...TST38A01NGRL0014_D02 549 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D0

  17. AcEST: DK952475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1. 5' end sequence. DK952475 CL3Contig1 Show DK952475 Clone id TST38A01NGRL0014_D01 Library TST38 Length 663... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D01. 5' end sequence. Accession DK952475...eic Acids Res. 25:3389-3402. Query= DK952475|Adiantum capillus-veneris mRNA, clon...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95247...TST38A01NGRL0014_D01 663 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_D0

  18. AcEST: DK961247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK961247 CL124Contig1 Show DK961247 Clone id TST39A01NGRL0009_J13 Library TST39 Length 4...19 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_J13. 5' end sequence. Accession DK961247...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961247...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK961247|Adiantum capillus-veneris mRNA...r|B3N7Q2|B3N7Q2_DROER GG24717 OS=Drosophila erecta GN=GG24717 P... 41 0.026 tr|B6T0Z6|B6T0Z6_MAIZE 60S acidi

  19. AcEST: DK962476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7. 5' end sequence. DK962476 CL16Contig1 Show DK962476 Clone id TST39A01NGRL0013_P17 Library TST39 Length 57...1 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P17. 5' end sequence. Accession DK96247...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK962476|Adiantum capillus-veneris mRNA,...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK96247...TST39A01NGRL0013_P17 571 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_P1

  20. AcEST: DK952470 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0. 5' end sequence. DK952470 CL329Contig1 Show DK952470 Clone id TST38A01NGRL0014_C20 Library TST38 Length 6...93 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C20. 5' end sequence. Accession DK95247...arch programs, Nucleic Acids Res. 25:3389-3402. Query= DK952470|Adiantum capillus...es. 25:3389-3402. Query= DK952470|Adiantum capillus-veneris mRNA, clone: TST38A01...TST38A01NGRL0014_C20 693 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_C2