Recursion Operators for Dispersionless KP Hierarchy
International Nuclear Information System (INIS)
Cheng Qiusheng; He Jingsong
2012-01-01
Based on the corresponding theorem between dispersionless KP (dKP) hierarchy and ħ-dependent KP (ħKP) hierarchy, a general formal representation of the recursion operators for dKP hierarchy under n-reduction is given in a systematical way from the corresponding ħKP hierarchy. To illustrate this method, the recursion operators for dKP hierarchy under 2-reduction and 3-reduction are calculated in detail.
Topological Landau-Ginzburg theory with a rational potential and the dispersionless KP hierarchy
International Nuclear Information System (INIS)
Aoyama, S.; Kodama, Y.
1996-01-01
Based on the dispersionless KP (dKP) theory, we study a topological Landau-Ginzburg (LG) theory characterized by a rational potential. Writing the dKP hierarchy in a general form treating all the primaries in an equal basis, we find that the hierarchy naturally includes the dispersionless (continuous) limit of Toda hierarchy and its generalizations having a finite number of primaries. Several flat solutions of the topological LG theory are obtained in this formulation, and are identified with those discussed by Dubrovin. We explicitly construct gravitational descendants for all the primary fields. Giving a residue formula for the 3-point functions of the fields, we show that these 3-point functions satisfy the topological recursion relation. The string equation is obtained as the generalized hodograph solutions of the dKP hierarchy, which show that all the gravitational effects to the constitutive equations (2-point functions) can be renormalized into the coupling constants in the small phase space. (orig.)
Integrable Hierarchies and Dispersionless Limit
Takasaki, Kanehisa; Takebe, Takashi
1994-01-01
Analogues of the KP and the Toda lattice hierarchy called dispersionless KP and Toda hierarchy are studied. Dressing operations in the dispersionless hierarchies are introduced as a canonical transformation, quantization of which is dressing operators of the ordinary KP and Toda hierarchy. An alternative construction of general solutions of the ordinary KP and Toda hierarchy is given as twistor construction which is quatization of the similar construction of solutions of dispersionless hierar...
The multicomponent 2D Toda hierarchy: dispersionless limit
International Nuclear Information System (INIS)
Mañas, Manuel; Alonso, Luis Martínez
2009-01-01
The factorization problem of the multi-component 2D Toda hierarchy is used to analyze the dispersionless limit of this hierarchy. A dispersive version of the Whitham hierarchy defined in terms of scalar Lax and Orlov–Schulman operators is introduced and the corresponding additional symmetries and string equations are discussed. Then, it is shown how KP and Toda pictures of the dispersionless Whitham hierarchy emerge in the dispersionless limit. Moreover, the additional symmetries and string equations for the dispersive Whitham hierarchy are studied in this limit
Non-Hamiltonian generalizations of the dispersionless 2DTL hierarchy
International Nuclear Information System (INIS)
Bogdanov, L V
2010-01-01
We consider two-component integrable generalizations of the dispersionless two-dimensional Toda lattice (2DTL) hierarchy connected with non-Hamiltonian vector fields, similar to the Manakov-Santini hierarchy generalizing the dKP hierarchy. They form a one-parametric family connected by hodograph-type transformations. Generating equations and Lax-Sato equations are introduced, and a dressing scheme based on the vector nonlinear Riemann problem is formulated. The simplest two-component generalization of the dispersionless 2DTL equation is derived, and its differential reduction analogous to the Dunajski interpolating system is presented. A symmetric two-component generalization of the dispersionless elliptic 2DTL equation is also constructed.
Einstein-Weyl spaces and dispersionless Kadomtsev-Petviashvili equation from Painleve I and II
International Nuclear Information System (INIS)
Dunajski, Maciej; Tod, Paul
2002-01-01
We present two constructions of new solutions to the dispersionless KP (dKP) equation arising from the first two Painleve transcendents. The first construction is a hodograph transformation based on Einstein-Weyl geometry, the generalized Nahm's equation and the isomonodromy problem. The second construction, motivated by the first, is a direct characterization of solutions to dKP which are constant on a central quadric. We show how the solutions to the dKP equations can be used to construct some three-dimensional Einstein-Weyl structures, and four-dimensional anti-self-dual null-Kaehler metrics
Self-Consistent Sources Extensions of Modified Differential-Difference KP Equation
Gegenhasi; Li, Ya-Qian; Zhang, Duo-Duo
2018-04-01
In this paper, we investigate a modified differential-difference KP equation which is shown to have a continuum limit into the mKP equation. It is also shown that the solution of the modified differential-difference KP equation is related to the solution of the differential-difference KP equation through a Miura transformation. We first present the Grammian solution to the modified differential-difference KP equation, and then produce a coupled modified differential-difference KP system by applying the source generation procedure. The explicit N-soliton solution of the resulting coupled modified differential-difference system is expressed in compact forms by using the Grammian determinant and Casorati determinant. We also construct and solve another form of the self-consistent sources extension of the modified differential-difference KP equation, which constitutes a Bäcklund transformation for the differential-difference KP equation with self-consistent sources. Supported by the National Natural Science Foundation of China under Grant Nos. 11601247 and 11605096, the Natural Science Foundation of Inner Mongolia Autonomous Region under Grant Nos. 2016MS0115 and 2015MS0116 and the Innovation Fund Programme of Inner Mongolia University No. 20161115
On a direct approach to quasideterminant solutions of a noncommutative modified KP equation
International Nuclear Information System (INIS)
Gilson, C R; Nimmo, J J C; Sooman, C M
2008-01-01
A noncommutative version of the modified KP equation and a family of its solutions expressed as quasideterminants are discussed. The origin of these solutions is explained by means of Darboux transformations and the solutions are verified directly. We also verify directly an explicit connection between quasideterminant solutions of the noncommutative mKP equation and the noncommutative KP equation arising from the Miura transformation
A note on the extended dispersionless Toda hierarchy
Lee, Niann-Chern; Tu, Ming-Hsien
2013-04-01
We derive dispersionless Hirota equations for the extended dispersionless Toda hierarchy. We show that the dispersionless Hirota equations are just a direct consequence of the genus-zero topological recurrence relation for the topological ℂP1 model. Using the dispersionless Hirota equations, we compute the twopoint functions and express the result in terms of Catalan numbers
Dispersionless wave packets in Dirac materials
International Nuclear Information System (INIS)
Jakubský, Vít; Tušek, Matěj
2017-01-01
We show that a wide class of quantum systems with translational invariance can host dispersionless, soliton-like, wave packets. We focus on the setting where the effective, two-dimensional Hamiltonian acquires the form of the Dirac operator. The proposed framework for construction of the dispersionless wave packets is illustrated on silicene-like systems with topologically nontrivial effective mass. Our analytical predictions are accompanied by a numerical analysis and possible experimental realizations are discussed.
International Nuclear Information System (INIS)
Manakov, S V; Santini, P M
2008-01-01
We have recently solved the inverse scattering problem for one-parameter families of vector fields, and used this result to construct the formal solution of the Cauchy problem for a class of integrable nonlinear partial differential equations in multidimensions, including the second heavenly equation of Plebanski and the dispersionless Kadomtsev-Petviashvili (dKP) equation. We showed, in particular, that the associated inverse problems can be expressed in terms of nonlinear Riemann-Hilbert problems on the real axis. In this paper, we make use of the nonlinear Riemann-Hilbert problem of dKP (i) to construct the longtime behaviour of the solutions of its Cauchy problem; (ii) to characterize a class of implicit solutions; (iii) to elucidate the spectral mechanism causing the gradient catastrophe of localized solutions of dKP, at finite time as well as in the longtime regime, and the corresponding universal behaviours near breaking
Energy Technology Data Exchange (ETDEWEB)
Manakov, S V [Landau Institute for Theoretical Physics, Moscow (Russian Federation); Santini, P M [Dipartimento di Fisica, Universita di Roma ' La Sapienza' , and Istituto Nazionale di Fisica Nucleare, Sezione di Roma 1, Piazz.le Aldo Moro 2, I-00185 Rome (Italy)
2008-02-08
We have recently solved the inverse scattering problem for one-parameter families of vector fields, and used this result to construct the formal solution of the Cauchy problem for a class of integrable nonlinear partial differential equations in multidimensions, including the second heavenly equation of Plebanski and the dispersionless Kadomtsev-Petviashvili (dKP) equation. We showed, in particular, that the associated inverse problems can be expressed in terms of nonlinear Riemann-Hilbert problems on the real axis. In this paper, we make use of the nonlinear Riemann-Hilbert problem of dKP (i) to construct the longtime behaviour of the solutions of its Cauchy problem; (ii) to characterize a class of implicit solutions; (iii) to elucidate the spectral mechanism causing the gradient catastrophe of localized solutions of dKP, at finite time as well as in the longtime regime, and the corresponding universal behaviours near breaking.
The dispersionless Lax equations and topological minimal models
International Nuclear Information System (INIS)
Krichever, I.
1992-01-01
It is shown that perturbed rings of the primary chiral fields of the topological minimal models coincide with some particular solutions of the dispersionless Lax equations. The exact formulae for the tree level partition functions, of A n topological minimal models are found. The Virasoro constraints for the analogue of the τ-function of the dispersionless Lax equation corresponding to these models are proved. (orig.)
An extended integrable fractional-order KP soliton hierarchy
International Nuclear Information System (INIS)
Li Li
2011-01-01
In this Letter, we consider the modified derivatives and integrals of fractional-order pseudo-differential operators. A sequence of Lax KP equations hierarchy and extended fractional KP (fKP) hierarchy are introduced, and the fKP hierarchy has Lax presentations with the extended Lax operators. In the case of the extension with the half-order pseudo-differential operators, a new integrable fKP hierarchy is obtained. A few particular examples of fractional order will be listed, together with their Lax pairs.
An extended integrable fractional-order KP soliton hierarchy
Energy Technology Data Exchange (ETDEWEB)
Li Li, E-mail: li07099@163.co [College of Maths and Systematic Science, Shenyang Normal University, Shenyang 110034 (China)
2011-01-17
In this Letter, we consider the modified derivatives and integrals of fractional-order pseudo-differential operators. A sequence of Lax KP equations hierarchy and extended fractional KP (fKP) hierarchy are introduced, and the fKP hierarchy has Lax presentations with the extended Lax operators. In the case of the extension with the half-order pseudo-differential operators, a new integrable fKP hierarchy is obtained. A few particular examples of fractional order will be listed, together with their Lax pairs.
Hierarchies of multi-component mKP equations and theirs integrable couplings
International Nuclear Information System (INIS)
Ji Jie; Yao Yuqin; Zhu Fubo; Chen Dengyuan
2008-01-01
First, a new multi-component modified Kadomtsev-Petviashvill (mKP) spectral problem is constructed by k-constraint imposed on a general pseudo-differential operator. Then, two hierarchies of multi-component mKP equations are derived, including positive non-isospectral mKP hierarchy and negative non-isospectral mKP hierarchy. Moreover, new integrable couplings of the resulting mKP soliton hierarchies are constructed by enlarging the associated matrix spectral problem
Block (or Hamiltonian) Lie Symmetry of Dispersionless D-Type Drinfeld–Sokolov Hierarchy
International Nuclear Information System (INIS)
Li Chuan-Zhong; He Jing-Song; Su Yu-Cai
2014-01-01
In this paper, the dispersionless D-type Drinfeld–Sokolov hierarchy, i.e. a reduction of the dispersionless two-component BKP hierarchy, is studied. The additional symmetry flows of this hierarchy are presented. These flows form an infinite-dimensional Lie algebra of Block type as well as a Lie algebra of Hamiltonian type
q-Deformed KP Hierarchy and q-Deformed Constrained KP Hierarchy
He, Jingsong; Li, Yinghua; Cheng, Yi
2006-01-01
Using the determinant representation of gauge transformation operator, we have shown that the general form of $au$ function of the $q$-KP hierarchy is a $q$-deformed generalized Wronskian, which includes the $q$-deformed Wronskian as a special case. On the basis of these, we study the $q$-deformed constrained KP ($q$-cKP) hierarchy, i.e. $l$-constraints of $q$-KP hierarchy. Similar to the ordinary constrained KP (cKP) hierarchy, a large class of solutions of $q$-cKP hierarchy can be represent...
Evolution of the dispersionless injection boundary associated with substorms
Directory of Open Access Journals (Sweden)
T. Sarris
2005-03-01
Full Text Available One manifestation of energetic particle acceleration during magnetospheric substorms is the sudden appearance of particle injections into the inner magnetosphere, often observed near geosynchronous orbit. Injections that show simultaneous flux increases in all energy ranges of a detector are called dispersionless injections, and are most often observed in a narrow region around local midnight. In these events it is assumed that the satellite is located close to or inside the region where acceleration and/or transport processes are taking place, called the injection region. We present a study of the location, extent and temporal evolution of the injection region, based on simulation results of a model of the expansion of the electric and magnetic fields associated with a substorm. The model simulates the fields during a substorm onset with an electric field and consistent magnetic field pulse that propagates towards the Earth with a decreasing speed. Our simulation shows that the dispersionless injection boundary can be considered coincident with the leading edge of the pulse field, which transports particles toward the Earth across a certain range of local time. Under the same model field, the dispersionless injection boundary shifts eastward for electrons and westward for protons, consistent with the observation results deduced from statistical analysis of multiple spacecraft measurements.
Scattering Behavior of Waveguide Channels of a New Coupled Integrable Dispersionless System
International Nuclear Information System (INIS)
Souleymanou, Abbagari; Kuetche, Victor K.; Bouetou, Thomas B.; Kofane, Timoleon C.
2011-01-01
Based upon the powerful Hirota method for unearthing soliton solutions to nonlinear partial differential evolution equations, we investigate the scattering properties of a new coupled integrable dispersionless system while surveying the interactions between its self-confined travelling wave solutions. As a result, we ascertain three types of scattering features depending strongly upon a characteristic parameter. Using such findings to depict soliton solutions with nonzero angular momenta, we derive an extended form of the dispersionless system, which is valuable for further physical applications. (general)
Traveling Wave-Guide Channels of a New Coupled Integrable Dispersionless System
International Nuclear Information System (INIS)
Souleymanou, Abbagari; Kuetche, Victor K.; Bouetou, Thomas B.; Kofane, Timoleon C.
2012-01-01
In the wake of the recent investigation of new coupled integrable dispersionless equations by means of the Darboux transformation [Zhaqilao, et al., Chin. Phys. B 18 (2009) 1780], we carry out the initial value analysis of the previous system using the fourth-order Runge-Kutta's computational scheme. As a result, while depicting its phase portraits accordingly, we show that the above dispersionless system actually supports two kinds of solutions amongst which the localized traveling wave-guide channels. In addition, paying particular interests to such localized structures, we construct the bilinear transformation of the current system from which scattering amongst the above waves can be deeply studied. (general)
The energetic ion substorm injection boundary
International Nuclear Information System (INIS)
Lopez, R.E.; Sibeck, D.G.; McEntire, R.W.; Krimigis, S.M.
1990-01-01
The substorm injection boundary model has enjoyed considerable success in explaining plasma signatures in the near-geosynchronous region. However, the injection boundary has remained primarily a phenomenological model. In this paper the authors examine 167 dispersionless energetic ion injections which were observed by AMPTE CCE. The radial and local time distribution of the events as a function of Kp is qualitatively similar to that envisioned in the injection boundary model of Mauk and McIlwain (1974). They argue that particles observed during dispersionless injections are locally energized during the disruption of the cross-tail current sheet. Therefore they identify the injection boundary, as derived from the spatial distribution of dispersionless injections, with the earthward edge of the region of the magnetotail which undergoes current sheet disruption during the substorm expansion phase. The authors show that this qualitative model for the generation of the injection boundary can provide an explanation for the dispersionless nature, the double spiral shape, and the Kp dependence of the boundary
The q-deformed mKP hierarchy with self-consistent sources, Wronskian solutions and solitons
International Nuclear Information System (INIS)
Lin Runliang; Peng Hua; Manas, Manuel
2010-01-01
Based on the eigenfunction symmetry constraint of the q-deformed modified KP hierarchy, a q-deformed mKP hierarchy with self-consistent sources (q-mKPHSCSs) is constructed. The q-mKPHSCSs contain two types of q-deformed mKP equation with self-consistent sources. By the combination of the dressing method and the method of variation of constants, a generalized dressing approach is proposed to solve the q-deformed KP hierarchy with self-consistent sources (q-KPHSCSs). Using the gauge transformation between the q-KPHSCSs and the q-mKPHSCSs, the q-deformed Wronskian solutions for the q-KPHSCSs and the q-mKPHSCSs are obtained. The one-soliton solutions for the q-deformed KP (mKP) equation with a source are given explicitly.
The hamiltonian structures of the KP hierarchy
International Nuclear Information System (INIS)
Das, A.; Panda, S.; Huang Wenjui
1991-01-01
We obtain the two hamiltonian structures of the KP hierarchy following the method of Drinfeld and Sokolov. We point out how the second structure of Drinfeld and Sokolov needs to be modified in the present case. We briefly comment on the connection between these structures and the W 1+∞ algebra. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Constant, E.; Mevel, E.; Zair, A.; Bagnoud, V.; Salin, F. [Bordeaux-1 Univ., Talence (FR). Centre Lasers Intenses et Applications (CELIA)
2001-07-01
We designed a dispersionless autocorrelator with a sub-femtosecond resolution suitable for the characterization of ultrashort X-UV pulses. We present a proof of feasibility experiment with 11 fs infrared pulses. (orig.)
The Hamiltonian structures of the KP hierarchy
International Nuclear Information System (INIS)
Das, A.; Panda, S.; Huang Wenjui
1991-08-01
We obtain the two Hamiltonian structures of the KP hierarchy following the method of Drinfeld and Sokolov. We point out how the second structure of Drinfeld and Sokolov needs to be modified in the present case. We briefly comment on the connection between these structures and the W 1+∞ algebra. (author). 18 refs
Algebraic structure of a generalized coupled dispersionless system
International Nuclear Information System (INIS)
Victor, Kuetche Kamgang; Thomas, Bouetou Bouetou; Kofane, Timoleon Crepin
2006-01-01
We study a physical model of the O(3)-invariant coupled integrable dispersionless equations that describes the dynamic of a focused system within the background of a plane gravitational field. The investigation is carried out both numerically and analytically, and realized beneath some assumptions superseding the structure constant with the structure function implemented in Lie algebra and quasigroup theory, respectively. The energy density and topological structures such as loop soliton are examined
New Exact Solutions for (1 + 1)-Dimensional Dispersion-Less System
International Nuclear Information System (INIS)
Naranmandula; Hu Jianguo; Bao Gang; Tubuxin
2008-01-01
Using improved homogeneous balance method, we obtain complex function form new exact solutions for the (1+1)-dimensional dispersion-less system, and from the exact solutions we derive real function form solution of the field u. Based on this real function form solution, we find some new interesting coherent structures by selecting arbitrary functions appropriately
Gauge equivalence between two-boson KP hierarchies
International Nuclear Information System (INIS)
Aratyn, H.
1994-01-01
In this paper it is explained the status of the two-boson KP hierarchy, which appears in this setting as an invariant subspace of the coadjoint orbit within the KP l=1 hierarchy. We will work with two main cases of two-boson KP hierarchies, one defined within KP l=1 hierarchy will be called Faa di Bruno KP hierarchy, while the second defined within KP hierarchy for a quadratic two-boson KP hierarchy. It will be established for them the gauge invariance playing the role of generalized Miura transformations. It is emphasized the symplectic character of equivalence of KP l=1 and KP. It is also made a point that the gauge equivalence established for two-boson systems is valid for an arbitrary n-th Poisson bracket structure and not only the first Poisson bracket structure. (author). 7 refs
Explorations of the extended ncKP hierarchy
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2004-01-01
A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities
Far-Field Focus and Dispersionless Anticrossing Bands in Two-Dimensional Photonic Crystals
Directory of Open Access Journals (Sweden)
Xiaoshuang Chen
2007-01-01
Full Text Available We review the simulation work for the far-field focus and dispersionless anticrossing bands in two-dimensional (2D photonic crystals. In a two-dimensional photonic-crystal-based concave lens, the far-field focus of a plane wave is given by the distance between the focusing point and the lens. Strong and good-quality far-field focusing of a transmitted wave, explicitly following the well-known wave-beam negative refraction law, can be achieved. The spatial frequency information of the Bloch mode in multiple Brillouin zones (BZs is investigated in order to indicate the wave propagation in two different regions. When considering the photonic transmission in a 2D photonic crystal composed of a negative phase-velocity medium (NPVM, it is shown that the dispersionless anticrossing bands are generated by the couplings among the localized surface polaritons of the NPVM rods. The photonic band structures of the NPVM photonic crystals are characterized by a topographical continuous dispersion relationship accompanied by many anticrossing bands.
Stability of Modified K-dV soliton in plasma with negative ion
International Nuclear Information System (INIS)
Matsukawa, Michiaki; Watanabe, Shinsuke
1988-01-01
The K-P and Modified K-P equations for ion acoustic wave are derived from the fluid equations for plasma with negative ion. At the critical density of the negative ion where the nonlinearity of the K-P equation vanishes, the ion acoustic soliton is described by the Modified K-P equation. The stability of Modified K-dV soliton against bending are investigated by using the Modified K-P equation. It is found that the soliton is stable, independent of the sign of amplitude. (author)
International Nuclear Information System (INIS)
Depireux, D.A.
1992-01-01
In this paper, given the two boson representation of the conformal algebra W ∞ , the second Hamiltonian structure of the KP hierarchy, the author constructs a bi-Hamiltonian hierarchy for the two associated currents. The KP hierarchy appears as a composite of this new and simpler system. The bi-Hamiltonian structure of the new hierarchy gives naturally all the Hamiltonian structures of the KP system
BKP and CKP revisited: the odd KP system
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Müller-Hoissen, Folkert
2009-01-01
By restricting a linear system for the KP hierarchy to those independent variables t n with odd n, its compatibility (Zakharov-Shabat conditions) leads to the 'odd KP hierarchy'. The latter consists of pairs of equations for two dependent variables, taking values in an (typically noncommutative) associative algebra. If the algebra is commutative, the odd KP hierarchy is known to admit reductions to the BKP and the CKP hierarchy. We approach the odd KP hierarchy and its relation to BKP and CKP in different ways, and address the question of whether noncommutative versions of the BKP and the CKP equation (and some of their reductions) exist. In particular, we derive a functional representation of a linear system for the odd KP hierarchy, which in the commutative case produces functional representations of the BKP and CKP hierarchies in terms of a tau function. Furthermore, we consider a functional representation of the KP hierarchy that involves a second (auxiliary) dependent variable and features the odd KP hierarchy directly as a subhierarchy. A method to generate large classes of exact solutions to the KP hierarchy from solutions to a linear matrix ODE system, via a hierarchy of matrix Riccati equations, then also applies to the odd KP hierarchy, and this in turn can be exploited, in particular, to obtain solutions to the BKP and CKP hierarchies
Affine Lie algebraic origin of constrained KP hierarchies
International Nuclear Information System (INIS)
Aratyn, H.; Gomes, J.F.; Zimerman, A.H.
1994-07-01
It is presented an affine sl(n+1) algebraic construction of the basic constrained KP hierarchy. This hierarchy is analyzed using two approaches, namely linear matrix eigenvalue problem on hermitian symmetric space and constrained KP Lax formulation and we show that these approaches are equivalent. The model is recognized to be generalized non-linear Schroedinger (GNLS) hierarchy and it is used as a building block for a new class of constrained KP hierarchies. These constrained KP hierarchies are connected via similarity-Backlund transformations and interpolate between GNLS and multi-boson KP-Toda hierarchies. The construction uncovers origin of the Toda lattice structure behind the latter hierarchy. (author). 23 refs
Two-reduction of the super-KP hierarchy
International Nuclear Information System (INIS)
McArthur, I.N.
1994-01-01
Recursion relations are established for the residues of fractional powers of a two-reduced super-KP operator making use of the Baker-Akhiezer function. These show the integrability of the two-reduced even (or bosonic) flows of the super-KP hierarchy. Similar recursion relations are also proven for the residues of operators associated with the odd (or fermionic) flows of the Mulase-Rabin super-KP hierarchy. Due to the presence of a spectral parameter and itts fermionic partner in the Baker-Akhiezer function, these recursion relations should be relevant to any attempt to prove or disprove a recent proposal that the integrable hierarchy underlying two-dimensional quantum supergravity is the Mulase-Rabin super-KP hierarchy. (orig.)
On Recursion Operator of the q -KP Hierarchy
International Nuclear Information System (INIS)
Tian Ke-Lei; Zhu Xiao-Ming; He Jing-Song
2016-01-01
It is the aim of the present article to give a general expression of flow equations of the q-KP hierarchy. The distinct difference between the q-KP hierarchy and the KP hierarchy is due to q-binomial and the action of q-shift operator θ, which originates from the Leibnitz rule of the quantum calculus. We further show that the n-reduction leads to a recursive scheme for these flow equations. The recursion operator for the flow equations of the q-KP hierarchy under the n-reduction is also derived. (paper)
Lie symmetries of a generalized Kuznetsov-Zabolotskaya-Khoklov equation
Gungor, F.; Ozemir, C.
2014-01-01
We consider a class of generalized Kuznetsov--Zabolotskaya--Khokhlov (gKZK) equations and determine its equivalence group, which is then used to give a complete symmetry classification of this class. The infinite-dimensional symmetry is used to reduce such equations to (1+1)-dimensional PDEs. Special attention is paid to group-theoretical properties of a class of generalized dispersionless KP (gdKP) or Zabolotskaya--Khokhlov equations as a subclass of gKZK equations. The conditions are determ...
Seadawy, A. R.; El-Rashidy, K.
2018-03-01
The Kadomtsev-Petviashvili (KP) and modified KP equations are two of the most universal models in nonlinear wave theory, which arises as a reduction of system with quadratic nonlinearity which admit weakly dispersive waves. The generalized extended tanh method and the F-expansion method are used to derive exact solitary waves solutions of KP and modified KP equations. The region of solutions are displayed graphically.
Directory of Open Access Journals (Sweden)
D. Ponta
2007-08-01
Full Text Available KP-Lab is an EU Integrated Project envisioning a learning system that facilitates innovative practices of sharing, creating and working with knowledge in education and workplaces. The project exploits a novel pedagogical view, the knowledge-creation metaphor of learning. According to such “trialogical” approach, cognition arises through collaborative work in systematically developing shared “knowledge artefacts”, such as concepts, plans, material products, or social practices. The paper presents the plan of a pilot course to test the KP-Lab methodologies and tools in the field of Digital Design.
International Nuclear Information System (INIS)
Abbagari, Souleymanou; Bouetou, Thomas B.; Kofane, Timoleon C.
2013-01-01
The prolongation structure methodologies of Wahlquist—Estabrook [H.D. Wahlquist and F.B. Estabrook, J. Math. Phys. 16 (1975) 1] for nonlinear differential equations are applied to a more general set of coupled integrable dispersionless system. Based on the obtained prolongation structure, a Lie-Algebra valued connection of a closed ideal of exterior differential forms related to the above system is constructed. A Lie-Algebra representation of some hidden structural symmetries of the previous system, its Bäcklund transformation using the Riccati form of the linear eigenvalue problem and their general corresponding Lax-representation are derived. In the wake of the previous results, we extend the above prolongation scheme to higher-dimensional systems from which a new (2 + 1)-dimensional coupled integrable dispersionless system is unveiled along with its inverse scattering formulation, which applications are straightforward in nonlinear optics where additional propagating dimension deserves some attention. (general)
N'tcha, Christine; Sina, Haziz; Kayodé, Adéchola Pierre Polycarpe; Gbenou, Joachim D; Baba-Moussa, Lamine
2017-01-01
The aim of this study was to investigate the antibacterial effect of the crude starter " kpètè-kpètè " and lactic acid bacteria used during the production of "tchoukoutou." To achieve this, a total of 11 lactic acid bacteria and 40 starter samples were collected from four communes. The samples were tested on 29 gram + and - strains by disk diffusion method. The minimum inhibitory and bactericidal concentrations of starter and lactic acid bacteria were determined by conventional methods. Organic acids, sugar, and volatile compounds were determined using the HPLC method. The "kpètè-kpètè" displays a high antibacterial activity against the tested strains. The most sensitive strain was S. epidermidis (12.5 mm) whereas the resistance strain was Proteus mirabilis (8 mm). All the tested ferment has not any inhibitory effect on Enterococcus faecalis . The lactic acid bacteria isolates of Parakou showed the highest (17.48 mm) antibacterial activity whereas the smallest diameter was obtained with the ferment collected from Boukoumbé (9.80 mm). The starters' chemical screening revealed the presence of tannins, anthocyanin flavonoids, triterpenes, steroids, reducing compounds, and mucilage O-glycosides. These compounds are probably the source of recorded inhibition effect. The lactic acid bacteria of the "kpètè-kpètè" could be used to develop a food ingredient with probiotic property.
Biodegradation of naphthalene and phenanthren by Bacillus subtilis 3KP
Ni'matuzahroh, Trikurniadewi, N.; Pramadita, A. R. A.; Pratiwi, I. A.; Salamun, Fatimah, Sumarsih, Sri
2017-06-01
The purposes of this research were to know growth response, degradation ability, and uptake mechanism of naphthalene and phenanthrene by Bacillus subtilis 3KP. Bacillus subtilis 3KP was grown on Mineral Synthetic (MS) medium with addition of 1% yeast extract and naphthalene and phenanthrene respectively 200 ppm in different cultures. Bacillus subtilis 3KP growth response was monitored by Total Plate Count (TPC) method, the degradation ability was monitored by UV-Vis spectrophotometer, and the uptake mechanism of hydrocarbon was monitored by emulsification activity, decrease of surface tension, and activity of Bacterial Adherence to Hydrocarbon (BATH). Bacillus subtilis 3KP was able to grow and show biphasic growth pattern on both of substrates. Naphthalene and phenanthrene were used as a carbon source for Bacillus subtilis 3KP growth that indicated by the reduction of substrate concomitant with the growth. At room temperature conditions (± 30°C) and 90 rpm of agitation for 7 days, Bacillus subtilis 3KP could degrade naphthalene in the amount of 70.5% and phenanthrene in the amount of 24.8%. Based on the analysis of UV-Vis spectrophotometer, three metabolites, 1-hydroxy-2-naphthoic acid, salicylic acid, and pyrocatechol were found in both cultures. The metabolite identification became basis of propose degradation pathway of naphthalene and phenanthrene by Bacillus subtilis 3KP. The results of hydrocarbon uptake mechanism test show that Bacillus subtilis 3KP used all of the mechanism to degrade naphthalene and phenanthrene.
Wronskian type solutions for the vector k-constrained KP hierarchy
International Nuclear Information System (INIS)
Zhang Youjin.
1995-07-01
Motivated by a relation of the 1-constrained Kadomtsev-Petviashvili (KP) hierarchy with the 2 component KP hierarchy, the tau-conditions of the vector k-constrained KP hierarchy are constructed by using an analogue of the Baker-Akhiezer (m + 1)-point function. These tau functions are expressed in terms of Wronskian type determinants. (author). 20 refs
Mennillo, Elvira; Krøkje, Åse; Pretti, Carlo; Meucci, Valentina; Arukwe, Augustine
2018-03-30
Pharmaceuticals such as racemate ketoprofen (RS-KP) and its enantiomer, dexketoprofen (S(+)-KP) are highly detectable non-steroidal anti-inflammatory drugs (NSAIDs) in the aquatic environment and therefore are designated as one of the most emerging groups of pollutants that can affect environmental and human health. The potential impact of these pharmaceuticals was assessed for the first time in vitro using a rat hepatocellular carcinoma cell line (H4IIE). Cells were exposed to low and high concentrations of these drugs. Cytotoxicity was determined by MTT reduction assay; CYP1A1 transcriptional and enzymatic levels together with canonical oxidative stress responsive markers (GPx, GR, GST and CAT) were also investigated. Cells exposed to RS-KP and S(+)-KP did not show cytotoxicity effect at the concentrations tested. However, this study highlighted differences between RS-KP and S(+)-KP in most of the evaluated markers, showing compound-, concentration- and time-specific effect patterns which suggest a potential stereo-selective toxicity of these drugs. Copyright © 2018 Elsevier B.V. All rights reserved.
Supersymmetric KP hierarchy in N=1 superspace and its N=2 reductions
International Nuclear Information System (INIS)
Lechtenfeld, O.; Sorin, A.
2000-01-01
A wide class of N=2 reductions of the supersymmetric KP hierarchy in N=1 superspace is described. This class includes a new N=2 supersymmetric generalization of the Toda chain hierarchy. The Lax pair representations of the bosonic and fermionic flows, local and non-local Hamiltonians, finite and infinite discrete symmetries, first two Hamiltonian structures and the recursion operator of this hierarchy are constructed. Its secondary reduction to new N=2 supersymmetric modified KdV hierarchy is discussed
Supersymmetric KP hierarchy in N=1 superspace and its N=2 reductions
International Nuclear Information System (INIS)
Lechtenfeld, O.; Sorin, A.
1999-01-01
A wide class of N=2 reductions of the supersymmetric KP hierarchy in N=1 superspace is described. This class includes a new N=2 supersymmetric generalization of the Toda chain hierarchy. The Lax pair representations of the bosonic and fermionic flows, local and nonlocal Hamiltonians, finite and infinite discrete symmetries, first two Hamiltonian structures and the recursion operator of this hierarchy are constructed. Its secondary reduction to new N=2 supersymmetric modified KdV hierarchy is discussed
10KP: A phylodiverse genome sequencing plan.
Cheng, Shifeng; Melkonian, Michael; Smith, Stephen A; Brockington, Samuel; Archibald, John M; Delaux, Pierre-Marc; Li, Fay-Wei; Melkonian, Barbara; Mavrodiev, Evgeny V; Sun, Wenjing; Fu, Yuan; Yang, Huanming; Soltis, Douglas E; Graham, Sean W; Soltis, Pamela S; Liu, Xin; Xu, Xun; Wong, Gane Ka-Shu
2018-03-01
Understanding plant evolution and diversity in a phylogenomic context is an enormous challenge due, in part, to limited availability of genome-scale data across phylodiverse species. The 10KP (10,000 Plants) Genome Sequencing Project will sequence and characterize representative genomes from every major clade of embryophytes, green algae, and protists (excluding fungi) within the next 5 years. By implementing and continuously improving leading-edge sequencing technologies and bioinformatics tools, 10KP will catalogue the genome content of plant and protist diversity and make these data freely available as an enduring foundation for future scientific discoveries and applications. 10KP is structured as an international consortium, open to the global community, including botanical gardens, plant research institutes, universities, and private industry. Our immediate goal is to establish a policy framework for this endeavor, the principles of which are outlined here.
10KP: A phylodiverse genome sequencing plan
Cheng, Shifeng; Melkonian, Michael; Brockington, Samuel; Archibald, John M; Delaux, Pierre-Marc; Melkonian, Barbara; Mavrodiev, Evgeny V; Sun, Wenjing; Fu, Yuan; Yang, Huanming; Soltis, Douglas E; Graham, Sean W; Soltis, Pamela S; Liu, Xin; Xu, Xun
2018-01-01
Abstract Understanding plant evolution and diversity in a phylogenomic context is an enormous challenge due, in part, to limited availability of genome-scale data across phylodiverse species. The 10KP (10,000 Plants) Genome Sequencing Project will sequence and characterize representative genomes from every major clade of embryophytes, green algae, and protists (excluding fungi) within the next 5 years. By implementing and continuously improving leading-edge sequencing technologies and bioinformatics tools, 10KP will catalogue the genome content of plant and protist diversity and make these data freely available as an enduring foundation for future scientific discoveries and applications. 10KP is structured as an international consortium, open to the global community, including botanical gardens, plant research institutes, universities, and private industry. Our immediate goal is to establish a policy framework for this endeavor, the principles of which are outlined here. PMID:29618049
Directory of Open Access Journals (Sweden)
Christine N’tcha
2017-01-01
Full Text Available The aim of this study was to investigate the antibacterial effect of the crude starter “kpètè-kpètè” and lactic acid bacteria used during the production of “tchoukoutou.” To achieve this, a total of 11 lactic acid bacteria and 40 starter samples were collected from four communes. The samples were tested on 29 gram + and − strains by disk diffusion method. The minimum inhibitory and bactericidal concentrations of starter and lactic acid bacteria were determined by conventional methods. Organic acids, sugar, and volatile compounds were determined using the HPLC method. The “kpètè-kpètè” displays a high antibacterial activity against the tested strains. The most sensitive strain was S. epidermidis (12.5 mm whereas the resistance strain was Proteus mirabilis (8 mm. All the tested ferment has not any inhibitory effect on Enterococcus faecalis. The lactic acid bacteria isolates of Parakou showed the highest (17.48 mm antibacterial activity whereas the smallest diameter was obtained with the ferment collected from Boukoumbé (9.80 mm. The starters’ chemical screening revealed the presence of tannins, anthocyanin flavonoids, triterpenes, steroids, reducing compounds, and mucilage O-glycosides. These compounds are probably the source of recorded inhibition effect. The lactic acid bacteria of the “kpètè-kpètè” could be used to develop a food ingredient with probiotic property.
N'tcha, Christine; Sina, Haziz; Kayodé, Adéchola Pierre Polycarpe; Gbenou, Joachim D.
2017-01-01
The aim of this study was to investigate the antibacterial effect of the crude starter “kpètè-kpètè” and lactic acid bacteria used during the production of “tchoukoutou.” To achieve this, a total of 11 lactic acid bacteria and 40 starter samples were collected from four communes. The samples were tested on 29 gram + and − strains by disk diffusion method. The minimum inhibitory and bactericidal concentrations of starter and lactic acid bacteria were determined by conventional methods. Organic acids, sugar, and volatile compounds were determined using the HPLC method. The “kpètè-kpètè” displays a high antibacterial activity against the tested strains. The most sensitive strain was S. epidermidis (12.5 mm) whereas the resistance strain was Proteus mirabilis (8 mm). All the tested ferment has not any inhibitory effect on Enterococcus faecalis. The lactic acid bacteria isolates of Parakou showed the highest (17.48 mm) antibacterial activity whereas the smallest diameter was obtained with the ferment collected from Boukoumbé (9.80 mm). The starters' chemical screening revealed the presence of tannins, anthocyanin flavonoids, triterpenes, steroids, reducing compounds, and mucilage O-glycosides. These compounds are probably the source of recorded inhibition effect. The lactic acid bacteria of the “kpètè-kpètè” could be used to develop a food ingredient with probiotic property. PMID:28367445
On two-current realization of KP hierarchy
International Nuclear Information System (INIS)
Aratyn, H.; Ferreira, L.A.; Gomes, J.F.; Zimerman, A.H.
1992-06-01
A simple description of the KP hierarchy and its multi-Hamiltonian structure is given in terms of two Bose currents. A deformation scheme connecting various W-infinity algebras and relation between two fundamental nonlinear structures are discussed. Properties of Faa di Bruno polynomials are extensively explored in this construction. Applications of our method are given for the Conformal Affine Toda model, WZNW models and discrete KP approach to Toda lattice chain. (author)
On the solutions of the second heavenly and Pavlov equations
Manakov, S. V.; Santini, P. M.
2009-10-01
We have recently solved the inverse scattering problem for one-parameter families of vector fields, and used this result to construct the formal solution of the Cauchy problem for a class of integrable nonlinear partial differential equations connected with the commutation of multidimensional vector fields, such as the heavenly equation of Plebanski, the dispersionless Kadomtsev-Petviashvili (dKP) equation and the two-dimensional dispersionless Toda (2ddT) equation, as well as with the commutation of one-dimensional vector fields, such as the Pavlov equation. We also showed that the associated Riemann-Hilbert inverse problems are powerful tools to establish if the solutions of the Cauchy problem break at finite time, to construct their long-time behaviour and characterize classes of implicit solutions. In this paper, using the above theory, we concentrate on the heavenly and Pavlov equations, (i) establishing that their localized solutions evolve without breaking, unlike the cases of dKP and 2ddT; (ii) constructing the long-time behaviour of the solutions of their Cauchy problems; (iii) characterizing a distinguished class of implicit solutions of the heavenly equation.
On the solutions of the second heavenly and Pavlov equations
International Nuclear Information System (INIS)
Manakov, S V; Santini, P M
2009-01-01
We have recently solved the inverse scattering problem for one-parameter families of vector fields, and used this result to construct the formal solution of the Cauchy problem for a class of integrable nonlinear partial differential equations connected with the commutation of multidimensional vector fields, such as the heavenly equation of Plebanski, the dispersionless Kadomtsev-Petviashvili (dKP) equation and the two-dimensional dispersionless Toda (2ddT) equation, as well as with the commutation of one-dimensional vector fields, such as the Pavlov equation. We also showed that the associated Riemann-Hilbert inverse problems are powerful tools to establish if the solutions of the Cauchy problem break at finite time, to construct their long-time behaviour and characterize classes of implicit solutions. In this paper, using the above theory, we concentrate on the heavenly and Pavlov equations, (i) establishing that their localized solutions evolve without breaking, unlike the cases of dKP and 2ddT; (ii) constructing the long-time behaviour of the solutions of their Cauchy problems; (iii) characterizing a distinguished class of implicit solutions of the heavenly equation.
Constrained KP models as integrable matrix hierarchies
International Nuclear Information System (INIS)
Aratyn, H.; Ferreira, L.A.; Gomes, J.F.; Zimerman, A.H.
1997-01-01
We formulate the constrained KP hierarchy (denoted by cKP K+1,M ) as an affine [cflx sl](M+K+1) matrix integrable hierarchy generalizing the Drinfeld endash Sokolov hierarchy. Using an algebraic approach, including the graded structure of the generalized Drinfeld endash Sokolov hierarchy, we are able to find several new universal results valid for the cKP hierarchy. In particular, our method yields a closed expression for the second bracket obtained through Dirac reduction of any untwisted affine Kac endash Moody current algebra. An explicit example is given for the case [cflx sl](M+K+1), for which a closed expression for the general recursion operator is also obtained. We show how isospectral flows are characterized and grouped according to the semisimple non-regular element E of sl(M+K+1) and the content of the center of the kernel of E. copyright 1997 American Institute of Physics
International Nuclear Information System (INIS)
Konopelchenko, B; Alonso, L MartInez; Medina, E
2010-01-01
It is shown that the hodograph solutions of the dispersionless coupled KdV (dcKdV) hierarchies describe critical and degenerate critical points of a scalar function which obeys the Euler-Poisson-Darboux equation. Singular sectors of each dcKdV hierarchy are found to be described by solutions of higher genus dcKdV hierarchies. Concrete solutions exhibiting shock-type singularities are presented.
de Lara-Castells, María Pilar; Stoll, Hermann; Mitrushchenkov, Alexander O
2014-08-21
As a prototypical dispersion-dominated physisorption problem, we analyze here the performance of dispersionless and dispersion-accounting methodologies on the helium interaction with cluster models of the TiO2(110) surface. A special focus has been given to the dispersionless density functional dlDF and the dlDF+Das construction for the total interaction energy (K. Pernal, R. Podeswa, K. Patkowski, and K. Szalewicz, Phys. Rev. Lett. 2009, 109, 263201), where Das is an effective interatomic pairwise functional form for the dispersion. Likewise, the performance of symmetry-adapted perturbation theory (SAPT) method is evaluated, where the interacting monomers are described by density functional theory (DFT) with the dlDF, PBE, and PBE0 functionals. Our benchmarks include CCSD(T)-F12b calculations and comparative analysis on the nuclear bound states supported by the He-cluster potentials. Moreover, intra- and intermonomer correlation contributions to the physisorption interaction are analyzed through the method of increments (H. Stoll, J. Chem. Phys. 1992, 97, 8449) at the CCSD(T) level of theory. This method is further applied in conjunction with a partitioning of the Hartree-Fock interaction energy to estimate individual interaction energy components, comparing them with those obtained using the different SAPT(DFT) approaches. The cluster size evolution of dispersionless and dispersion-accounting energy components is then discussed, revealing the reduced role of the dispersionless interaction and intramonomer correlation when the extended nature of the surface is better accounted for. On the contrary, both post-Hartree-Fock and SAPT(DFT) results clearly demonstrate the high-transferability character of the effective pairwise dispersion interaction whatever the cluster model is. Our contribution also illustrates how the method of increments can be used as a valuable tool not only to achieve the accuracy of CCSD(T) calculations using large cluster models but also to
Third Order Reconstruction of the KP Scheme for Model of River Tinnelva
Directory of Open Access Journals (Sweden)
Susantha Dissanayake
2017-01-01
Full Text Available The Saint-Venant equation/Shallow Water Equation is used to simulate flow of river, flow of liquid in an open channel, tsunami etc. The Kurganov-Petrova (KP scheme which was developed based on the local speed of discontinuity propagation, can be used to solve hyperbolic type partial differential equations (PDEs, hence can be used to solve the Saint-Venant equation. The KP scheme is semi discrete: PDEs are discretized in the spatial domain, resulting in a set of Ordinary Differential Equations (ODEs. In this study, the common 2nd order KP scheme is extended into 3rd order scheme while following the Weighted Essentially Non-Oscillatory (WENO and Central WENO (CWENO reconstruction steps. Both the 2nd order and 3rd order schemes have been used in simulation in order to check the suitability of the KP schemes to solve hyperbolic type PDEs. The simulation results indicated that the 3rd order KP scheme shows some better stability compared to the 2nd order scheme. Computational time for the 3rd order KP scheme for variable step-length ode solvers in MATLAB is less compared to the computational time of the 2nd order KP scheme. In addition, it was confirmed that the order of the time integrators essentially should be lower compared to the order of the spatial discretization. However, for computation of abrupt step changes, the 2nd order KP scheme shows a more accurate solution.
Dunajski–Tod equation and reductions of the generalized dispersionless 2DTL hierarchy
Energy Technology Data Exchange (ETDEWEB)
Bogdanov, L.V., E-mail: leonid@landau.ac.ru [L.D. Landau ITP RAS, Moscow (Russian Federation)
2012-10-01
We transfer the scheme for constructing differential reductions recently developed for the Manakov–Santini hierarchy to the case of the two-component generalization of dispersionless 2DTL hierarchy. We demonstrate that the equation arising as a result of the simplest reduction is equivalent (up to a Legendre type transformation) to the Dunajski–Tod equation, locally describing general ASD vacuum metric with conformal symmetry. We consider higher reductions and corresponding reduced hierarchies also. -- Highlights: ► We introduce a differential reduction for the two-component d2DTL equation. ► We demonstrate that it is connected with ASD vacuum metric with conformal symmetry. ► We construct higher reductions and the reduced hierarchies.
The zero curvature formulation of the KP and the sKP equations
International Nuclear Information System (INIS)
Barcelos Neto, J.; Das, A.; Panda, S.; Roy, S.
1992-01-01
The Kadomtsev-Petviashvili equation is derived from the zero curvature condition associated with the gauge group SL(2,R) in 2+1 dimensions. A fermionic extension of the KP equation is also obtained using the zero curvature condition of the super group OS p (2/1), which reduces upon appropriate restriction to the Kupershmidt equation. (author). 17 refs
Quijano, Carolina Diaz; Wichmann, Fabienne; Schlaich, Thomas; Fammartino, Alessandro; Huckauf, Jana; Schmidt, Kerstin; Unger, Christoph; Broer, Inge; Sautter, Christof
2016-09-01
Ustilago tritici causes loose smut, which is a seed-borne fungal disease of wheat, and responsible for yield losses up to 40%. Loose smut is a threat to seed production in developing countries where small scale farmers use their own harvest as seed material. The killer protein 4 (KP4) is a virally encoded toxin from Ustilago maydis and inhibits growth of susceptible races of fungi from the Ustilaginales. Enhanced resistance in KP4 wheat to stinking smut, which is caused by Tilletia caries, had been reported earlier. We show that KP4 in genetically engineered wheat increased resistance to loose smut up to 60% compared to the non-KP4 control under greenhouse conditions. This enhanced resistance is dose and race dependent. The overexpression of the transgene kp4 and its effect on fungal growth have indirect effects on the expression of endogenous pathogen defense genes.
Directory of Open Access Journals (Sweden)
Carolina Diaz Quijano
2016-09-01
Full Text Available Ustilago tritici causes loose smut, which is a seed-borne fungal disease of wheat, and responsible for yield losses up to 40%. Loose smut is a threat to seed production in developing countries where small scale farmers use their own harvest as seed material. The killer protein 4 (KP4 is a virally encoded toxin from Ustilago maydis and inhibits growth of susceptible races of fungi from the Ustilaginales. Enhanced resistance in KP4 wheat to stinking smut, which is caused by Tilletia caries, had been reported earlier. We show that KP4 in genetically engineered wheat increased resistance to loose smut up to 60% compared to the non-KP4 control under greenhouse conditions. This enhanced resistance is dose and race dependent. The overexpression of the transgene kp4 and its effect on fungal growth have indirect effects on the expression of endogenous pathogen defense genes.
Symmetries of supersymmetric integrable hierarchies of KP type
International Nuclear Information System (INIS)
Nissimov, E.; Pacheva, S.
2002-01-01
This article is devoted to the systematic study of additional (non-isospectral) symmetries of constrained (reduced) supersymmetric integrable hierarchies of KP type--the so-called SKP (R;M B ,M F ) models. The latter are supersymmetric extensions of ordinary constrained KP hierarchies which contain as special cases basic integrable systems such as (m)KdV, AKNS, Fordy-Kulish, Yajima-Oikawa, etc. As a first main result it is shown that any SKP (R;M B ,M F ) hierarchy possesses two different mutually (anti-)commuting types of superloop superalgebra additional symmetries corresponding to the positive- and negative-grade parts of certain superloop superalgebras. The second main result is the systematic construction of the full algebra of additional Virasoro symmetries of SKP (R;M B ,M F ) hierarchies, which requires nontrivial modifications of the Virasoro flows known from the general case of unconstrained Manin-Radul super-KP hierarchies (the latter flows do not define symmetries for constrained SKP (R;M B ,M F ) hierarchies). As a third main result we provide systematic construction of the supersymmetric analogs of multi-component (matrix) KP hierarchies and show that the latter contain, among others, the supersymmetric version of the Davey-Stewartson system. Finally, we present an explicit derivation of the general Darboux-Baecklund solutions for the SKP (R;M B ,M F ) super-tau functions (supersymmetric 'soliton'-like solutions) which preserve the additional (non-isospectral) symmetries
Riemann-Liouville integrals of fractional order and extended KP hierarchy
International Nuclear Information System (INIS)
Kamata, Masaru; Nakamula, Atsushi
2002-01-01
An attempt to formulate the extensions of the KP hierarchy by introducing fractional-order pseudo-differential operators is given. In the case of the extension with the half-order pseudo-differential operators, a system analogous to the supersymmetric extensions of the KP hierarchy is obtained. Unlike the supersymmetric extensions, no Grassmannian variable appears in the hierarchy considered here. More general hierarchies constructed by the 1/Nth-order pseudo-differential operators, their integrability and the reduction procedure are also investigated. In addition to finding the new extensions of the KP hierarchy, a brief introduction to the Riemann-Liouville integral is provided to yield a candidate for the fractional-order pseudo-differential operators
The super W∞ symmetry of the Manin-Radul super KP hierarchy
International Nuclear Information System (INIS)
Das, A.; Sin, S.J.
1991-11-01
We show that the Manin-Radul super KP hierarchy is invariant under super W ∞ transformations. These transformations are characterized by time dependent flows which commute with the usual flows generated by the conserved quantities of the super KP hierarchy. (author). 16 refs
On Segal-Wilson's construction for the τ-functions of the constrained KP hierarchies
International Nuclear Information System (INIS)
Zhang You-jin.
1994-06-01
In this letter we study the constrained KP hierachies by employing Segal-Wilson's theory on the τ-functions of the KP hierarchy. We first describe the elements of the Grassmannian which correspond to solutions of the constrained KP hierarchy, and then we show how to construct its rational and soliton solutions from these elements of the Grassmannian. (author). 10 refs
On the huge Lie superalgebra of pseudo superdifferential operators and super KP-hierarchies
International Nuclear Information System (INIS)
Sedra, M.B.
1995-08-01
Lie superalgebraic methods are used to establish a connection between the huge Lie superalgebra Ξ of super (pseudo) differential operators and various super KP-hierarchies. We show in particular that Ξ splits into 5 = 2 x 2 + 1 graded algebras expected to correspond to five classes of super KP-hierarchies generalizing the well-known Manin-Radul and Figueroa O'Farrill-Ramos supersymmetric KP-hierarchies. (author). 10 refs
Rational Degenerations of M-Curves, Totally Positive Grassmannians and KP2-Solitons
Abenda, Simonetta; Grinevich, Petr G.
2018-03-01
We establish a new connection between the theory of totally positive Grassmannians and the theory of M-curves using the finite-gap theory for solitons of the KP equation. Here and in the following KP equation denotes the Kadomtsev-Petviashvili 2 equation [see (1)], which is the first flow from the KP hierarchy. We also assume that all KP times are real. We associate to any point of the real totally positive Grassmannian Gr^{tp} (N,M) a reducible curve which is a rational degeneration of an M-curve of minimal genus {g=N(M-N)} , and we reconstruct the real algebraic-geometric data á la Krichever for the underlying real bounded multiline KP soliton solutions. From this construction, it follows that these multiline solitons can be explicitly obtained by degenerating regular real finite-gap solutions corresponding to smooth M-curves. In our approach, we rule the addition of each new rational component to the spectral curve via an elementary Darboux transformation which corresponds to a section of a specific projection Gr^{tp} (r+1,M-N+r+1)\\mapsto Gr^{tp} (r,M-N+r).
Dependence of Energetic Electron Precipitation on the Geomagnetic Index Kp and Electron Energy
Directory of Open Access Journals (Sweden)
Mi-Young Park
2013-12-01
Full Text Available It has long been known that the magnetospheric particles can precipitate into the atmosphere of the Earth. In this paper we examine such precipitation of energetic electrons using the data obtained from low-altitude polar orbiting satellite observations. We analyze the precipitating electron flux data for many periods selected from a total of 84 storm events identified for 2001-2012. The analysis includes the dependence of precipitation on the Kp index and the electron energy, for which we use three energies E1 > 30 keV, E2 > 100 keV, E3 > 300 keV. We find that the precipitation is best correlated with Kp after a time delay of < 3 hours. Most importantly, the correlation with Kp is notably tighter for lower energy than for higher energy in the sense that the lower energy precipitation flux increases more rapidly with Kp than does the higher energy precipitation flux. Based on this we suggest that the Kp index reflects excitation of a wave that is responsible for scattering of preferably lower energy electrons. The role of waves of other types should become increasingly important for higher energy, for which we suggest to rely on other indicators than Kp if one can identify such an indicator.
Soliton-like structures and the connection between the Bq and KP equations
International Nuclear Information System (INIS)
Bernal, J.; Agueero, Maximo A.; Flores-Romero, Erick
2003-01-01
We study the (2+1)-dimensional model proposed by Kadomtsev and Petviashvili (KP) to describe slowly varying nonlinear waves in a dispersive medium. Applying an appropriate Lie transformation and following the method introduced by Tajiri et al., the KP equation is reduced to a one-dimensional equation, that is, to a certain version of the Boussinesq equation (BqE). Then, we solve the BqE by the Hirota method, and finally we use the inverse transformation in order to obtain de KP solutions. We analyze some remarkable properties of the solutions found in this work
Soliton-like structures and the connection between the Bq and KP equations
Bernal, J; Flores-Romero, E
2003-01-01
We study the (2+1)-dimensional model proposed by Kadomtsev and Petviashvili (KP) to describe slowly varying nonlinear waves in a dispersive medium. Applying an appropriate Lie transformation and following the method introduced by Tajiri et al., the KP equation is reduced to a one-dimensional equation, that is, to a certain version of the Boussinesq equation (BqE). Then, we solve the BqE by the Hirota method, and finally we use the inverse transformation in order to obtain de KP solutions. We analyze some remarkable properties of the solutions found in this work.
Domain wall partition functions and KP
International Nuclear Information System (INIS)
Foda, O; Wheeler, M; Zuparic, M
2009-01-01
We observe that the partition function of the six-vertex model on a finite square lattice with domain wall boundary conditions is (a restriction of) a KP τ function and express it as an expectation value of charged free fermions (up to an overall normalization)
Explicit flow equations and recursion operator of the ncKP hierarchy
International Nuclear Information System (INIS)
He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong
2011-01-01
The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)
Integrable KP Coupling and Its Exact Solution
International Nuclear Information System (INIS)
Peng Ling; Yang Xuxong; Lou Senyue
2012-01-01
The integrable coupling is one of the most important topics in the nonlinear physics. This paper creates a novel integrable KP coupling and solves it via a recently-developed dark parameterization procedure. (general)
International Nuclear Information System (INIS)
Liu Shaowei; Cheng Yi
2010-01-01
Two kinds of symmetries, Sato's Baecklund transformations and additional symmetries, for the discrete KP (dKP) hierarchy are introduced, and the ASvM formula which demonstrates the equivalence of these two kinds of symmetries is obtained. In this process the Fay identity and the difference Fay identity of the dKP hierarchy are introduced and the ASvM formula in the form of tau function is calculated.
Grassmannian approach to super-KP hierarchies
International Nuclear Information System (INIS)
Takama, Michiaki.
1995-06-01
We present a theory of 'maximal' super-KP (SKP) hierarchy whose flows are maximally extended to include all those of known SKP hierarchies, including, for example, the MRSKP hierarchy of Manin and Radul and the Jacobian SKP (JSKP) introduced by Mulase and Rabin. It is shown that SKP hierarchies has a natural field theoretic description in terms of the B-C system, in analogous way as the ordinary KP hierarchy. For this SKP hierarchy, we construct the vertex operators by using Kac-van de Leur superbosonization. The vertex operators act on the τ-function and then produce the wave function and the dual wave function of the hierarchy. Thereby we achieve the description of the 'maximal' SKP hierarchy in terms of the τ-function, which seemed to be lacking till now. Mutual relations among the SKP hierarchies are clarified. The MRSKP and the JSKP hierarchies are obtained as special cases when the time variables are appropriately restricted. (author)
Analytic study of solutions for a (3 + 1) -dimensional generalized KP equation
Gao, Hui; Cheng, Wenguang; Xu, Tianzhou; Wang, Gangwei
2018-03-01
The (3 + 1) -dimensional generalized KP (gKP) equation is an important nonlinear partial differential equation in theoretical and mathematical physics which can be used to describe nonlinear wave motion. Through the Hirota bilinear method, one-solition, two-solition and N-solition solutions are derived via symbolic computation. Two classes of lump solutions, rationally localized in all directions in space, to the dimensionally reduced cases in (2 + 1)-dimensions, are constructed by using a direct method based on the Hirota bilinear form of the equation. It implies that we can derive the lump solutions of the reduced gKP equation from positive quadratic function solutions to the aforementioned bilinear equation. Meanwhile, we get interaction solutions between a lump and a kink of the gKP equation. The lump appears from a kink and is swallowed by it with the change of time. This work offers a possibility which can enrich the variety of the dynamical features of solutions for higher-dimensional nonlinear evolution equations.
Directory of Open Access Journals (Sweden)
Zeliha Yıldırım
2014-01-01
Full Text Available In this study, the effects of food preservative p-hydroxybenzoic acid and propyl-paraben on the inhibitory activity of enterocin KP produced by Enterococcus faecalis KP were determined. Staphylococcus aureus, Escherichia coli O157:H7 and Salmonella Typhimurium, resistant to enterocin KP bacteriocin, were used as target organisms. The inhibitor activity of enterosin KP (1600 AU/ml alone or in combination with p-hydroxybenzoic acid (%0.1-0.3 and propyl-paraben (%0.008-0.16 on the growth of Staphylococcus aureus, Escherichia coli O157:H7 and Salmonella Typhimurium were determined. The inhibitory activity of enterocin KP was increased when used in combination with p-hydroxybenzoic acid and propyl-paraben at concentrations of 0.1-0.3% and 0.008-0.016%, respectively. Furthermore, Staphylococcus aureus, E. coli O157:H7 and Salmonella Typhimurium became sensitive to enterocin KP. In conclusion, the use of enterocin KP in combination with other food preservatives principles resulted in an increase in its inhibitory activity and spectrum.
Wintoft, Peter; Wik, Magnus; Matzka, Jürgen; Shprits, Yuri
2017-11-01
We have developed neural network models that predict Kp from upstream solar wind data. We study the importance of various input parameters, starting with the magnetic component Bz, particle density n, and velocity V and then adding total field B and the By component. As we also notice a seasonal and UT variation in average Kp we include functions of day-of-year and UT. Finally, as Kp is a global representation of the maximum range of geomagnetic variation over 3-hour UT intervals we conclude that sudden changes in the solar wind can have a big effect on Kp, even though it is a 3-hour value. Therefore, 3-hour solar wind averages will not always appropriately represent the solar wind condition, and we introduce 3-hour maxima and minima values to some degree address this problem. We find that introducing total field B and 3-hour maxima and minima, derived from 1-minute solar wind data, have a great influence on the performance. Due to the low number of samples for high Kp values there can be considerable variation in predicted Kp for different networks with similar validation errors. We address this issue by using an ensemble of networks from which we use the median predicted Kp. The models (ensemble of networks) provide prediction lead times in the range 20-90 min given by the time it takes a solar wind structure to travel from L1 to Earth. Two models are implemented that can be run with real time data: (1) IRF-Kp-2017-h3 uses the 3-hour averages of the solar wind data and (2) IRF-Kp-2017 uses in addition to the averages, also the minima and maxima values. The IRF-Kp-2017 model has RMS error of 0.55 and linear correlation of 0.92 based on an independent test set with final Kp covering 2 years using ACE Level 2 data. The IRF-Kp-2017-h3 model has RMSE = 0.63 and correlation = 0.89. We also explore the errors when tested on another two-year period with real-time ACE data which gives RMSE = 0.59 for IRF-Kp-2017 and RMSE = 0.73 for IRF-Kp-2017-h3. The errors as function
KP solitons and the Grassmannians combinatorics and geometry of two-dimensional wave patterns
Kodama, Yuji
2017-01-01
This is the first book to treat combinatorial and geometric aspects of two-dimensional solitons. Based on recent research by the author and his collaborators, the book presents new developments focused on an interplay between the theory of solitons and the combinatorics of finite-dimensional Grassmannians, in particular, the totally nonnegative (TNN) parts of the Grassmannians. The book begins with a brief introduction to the theory of the Kadomtsev–Petviashvili (KP) equation and its soliton solutions, called the KP solitons. Owing to the nonlinearity in the KP equation, the KP solitons form very complex but interesting web-like patterns in two dimensions. These patterns are referred to as soliton graphs. The main aim of the book is to investigate the detailed structure of the soliton graphs and to classify these graphs. It turns out that the problem has an intimate connection with the study of the TNN part of the Grassmannians. The book also provides an elementary introduction to the recent development of ...
An algebraic scheme associated with the non-commutative KP hierarchy and some of its extensions
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2005-01-01
A well-known ansatz ('trace method') for soliton solutions turns the equations of the (non-commutative) KP hierarchy, and those of certain extensions, into families of algebraic sum identities. We develop an algebraic formalism, in particular involving a (mixable) shuffle product, to explore their structure. More precisely, we show that the equations of the non-commutative KP hierarchy and its extension (xncKP) in the case of a Moyal-deformed product, as derived in previous work, correspond to identities in this algebra. Furthermore, the Moyal product is replaced by a more general associative product. This leads to a new even more general extension of the non-commutative KP hierarchy. Relations with Rota-Baxter algebras are established
Directory of Open Access Journals (Sweden)
Ichi Langlang Buana Machmud
2017-05-01
Full Text Available This study aims to (1 analyze the impact of Permen KP RI No. 1/PERMEN-KP/2015 against the decrease/increase of the amount of volume, frequency and value of interprovincial domestic trade of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities; (2 to analyze the causes of the offense of smuggling attempts by large inter-provincial traders of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities; and (3 to analyze the impact of Permen KP RI No.1/PERMEN-KP/2015 against the marketing channels of trade of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities and trade organizations involved in domestic trade of the three commodities. This thesis study activities were carried out in the province of South Kalimantan. The data collected were data sourced directly from the observation in the study site, and other supporting data relating to the object of study. The results of this study: (1 Impact of Permen KP RI No. 1/PERMEN-KP/2015 are as follows: (a it has an effect of significantly reducing the volume, frequency and value of inter-provincial domestic trade of live crab (Scylla serrata and small fresh crab (Portunus pelagicus commodities, (b it has an effect of significantly reducing the volume and value of trade and has no significant effect on the frequency of inter-provincial domestic trade of soft-shelled crab commodity (Scylla serrata; (c it has no impact on inter-provincial domestic trade of fresh/frozen lobster commodities (Panulirus spp; (d it has no significant effect on the volume, frequency and value of inter-provincial domestic trade of crab meat (Scylla serrata, small crab meat (Portunus pelagicus, fresh/boiled crab (Scylla serrata and live lobsters (Panulirus spp commodities. (2 The occurrence of repeated violations in the form of an attempt smuggling by entrepreneurs (wholesalers of inter-provincial domestic sender of
International Nuclear Information System (INIS)
Foda, O.; Wheeler, M.; Zuparic, M.
2009-01-01
Using a Jacobi-Trudi-type identity, we show that the scalar product of a general state and a Bethe eigenstate in a finite-length XXZ spin-1/2 chain is (a restriction of) a KP τ function. This leads to a correspondence between the eigenstates and points on Sato's Grassmannian. Each of these points is a function of the rapidities of the corresponding eigenstate, the inhomogeneity variables of the spin chain and the crossing parameter.
Energy Technology Data Exchange (ETDEWEB)
Foda, O. [Department of Mathematics and Statistics, University of Melbourne, Parkville, Victoria 3010 (Australia)], E-mail: foda@ms.unimelb.edu.au; Wheeler, M. [Department of Mathematics and Statistics, University of Melbourne, Parkville, Victoria 3010 (Australia)], E-mail: mwheeler@ms.unimelb.edu.au; Zuparic, M. [Department of Mathematics and Statistics, University of Melbourne, Parkville, Victoria 3010 (Australia)], E-mail: mzup@ms.unimelb.edu.au
2009-10-21
Using a Jacobi-Trudi-type identity, we show that the scalar product of a general state and a Bethe eigenstate in a finite-length XXZ spin-1/2 chain is (a restriction of) a KP {tau} function. This leads to a correspondence between the eigenstates and points on Sato's Grassmannian. Each of these points is a function of the rapidities of the corresponding eigenstate, the inhomogeneity variables of the spin chain and the crossing parameter.
Exact multi-line soliton solutions of noncommutative KP equation
International Nuclear Information System (INIS)
Wang, Ning; Wadati, Miki
2003-01-01
A method of solving noncommutative linear algebraic equations plays a key role in the extension of the ∂-bar -dressing on the noncommutative space-time manifold. In this paper, a solution-generating method of noncommutative linear algebraic equations is proposed. By use of the proposed method, a class of multi-line soliton solutions of noncommutative KP (ncKP) equation is constructed explicitly. The method is expected to be of use for constructions of noncommutative soliton equations. The significance of the noncommutativity of coordinates is investigated. It is found that the noncommutativity of the space-time coordinate has a role to split the spatial waveform of the classical multi-line solitons and reform it to a new configuration. (author)
Energy conversion through mass loading of escaping ionospheric ions for different Kp values
Yamauchi, Masatoshi; Slapak, Rikard
2018-01-01
By conserving momentum during the mixing of fast solar wind flow and slow planetary ion flow in an inelastic way, mass loading converts kinetic energy to other forms - e.g. first to electrical energy through charge separation and then to thermal energy (randomness) through gyromotion of the newly born cold ions for the comet and Mars cases. Here, we consider the Earth's exterior cusp and plasma mantle, where the ionospheric origin escaping ions with finite temperatures are loaded into the decelerated solar wind flow. Due to direct connectivity to the ionosphere through the geomagnetic field, a large part of this electrical energy is consumed to maintain field-aligned currents (FACs) toward the ionosphere, in a similar manner as the solar wind-driven ionospheric convection in the open geomagnetic field region. We show that the energy extraction rate by the mass loading of escaping ions (ΔK) is sufficient to explain the cusp FACs, and that ΔK depends only on the solar wind velocity accessing the mass-loading region (usw) and the total mass flux of the escaping ions into this region (mloadFload), as ΔK ˜ -mloadFloadu2sw/4. The expected distribution of the separated charges by this process also predicts the observed flowing directions of the cusp FACs for different interplanetary magnetic field (IMF) orientations if we include the deflection of the solar wind flow directions in the exterior cusp. Using empirical relations of u0 ∝ Kp + 1.2 and Fload ∝ exp(0.45Kp) for Kp = 1-7, where u0 is the solar wind velocity upstream of the bow shock, ΔK becomes a simple function of Kp as log10(ΔK) = 0.2 ṡ Kp + 2 ṡ log10(Kp + 1.2) + constant. The major contribution of this nearly linear increase is the Fload term, i.e. positive feedback between the increase of ion escaping rate Fload through the increased energy consumption in the ionosphere for high Kp, and subsequent extraction of more kinetic energy ΔK from the solar wind to the current system by the increased
Directory of Open Access Journals (Sweden)
R. J. England
2005-01-01
Full Text Available We examine the use of sextupole magnets to correct nonlinearities in the longitudinal phase space transformation of a relativistic beam of charged particles in a dispersionless translating section, or dogleg. Through heuristic analytical arguments and examples derived from recent experimental efforts, augmented by simulations using the particle tracking codes PARMELA and ELEGANT, sextupole corrections are found to be effective in optimizing the use of such structures for beam compression or for shaping the current profile of the beam, by manipulation of the second-order longitudinal dispersion. Recent experimental evidence of the use of sextupoles to manipulate second-order horizontal and longitudinal dispersion of the beam is presented. The theoretical and experimental results indicate that these manipulations can be used to create an electron bunch with a current profile having a long ramp followed by a sharp cutoff, which is optimal for driving large-amplitude wake fields in a plasma wake field accelerator.
A Modified Homogeneous Balance Method and Its Applications
International Nuclear Information System (INIS)
Liu Chunping
2011-01-01
A modified homogeneous balance method is proposed by improving some key steps in the homogeneous balance method. Bilinear equations of some nonlinear evolution equations are derived by using the modified homogeneous balance method. Generalized Boussinesq equation, KP equation, and mKdV equation are chosen as examples to illustrate our method. This approach is also applicable to a large variety of nonlinear evolution equations. (general)
Additional symmetries of supersymmetric KP hierarchies
International Nuclear Information System (INIS)
Stanciu, S.
1994-01-01
We investigate the additional symmetries of several supersymmetric KP hierarchies: the SKP hierarchy of Manin and Radul, the SKP 2 hierarchy, and the Jacobian SKP hierarchy. In all three cases we find that the algebra of symmetries is isomorphic to the algebra of superdifferential operators, or equivalently SW 1+∞ . These results seem to suggest that despite their realization depending on the dynamics, the additional symmetries are kinematical in nature. (orig.)
Mutation of HIV-1 Genomes in a Clinical Population Treated with the Mutagenic Nucleoside KP1461
Mullins, James I.; Heath, Laura; Hughes, James P.; Kicha, Jessica; Styrchak, Sheila; Wong, Kim G.; Rao, Ushnal; Hansen, Alexis; Harris, Kevin S.; Laurent, Jean-Pierre; Li, Deyu; Simpson, Jeffrey H.; Essigmann, John M.; Loeb, Lawrence A.; Parkins, Jeffrey
2011-01-01
The deoxycytidine analog KP1212, and its prodrug KP1461, are prototypes of a new class of antiretroviral drugs designed to increase viral mutation rates, with the goal of eventually causing the collapse of the viral population. Here we present an extensive analysis of viral sequences from HIV-1 infected volunteers from the first "mechanism validation" phase II clinical trial of a mutagenic base analog in which individuals previously treated with antiviral drugs received 1600 mg of KP1461 twic...
Generalized Miura transformations, two-bosons KP hierarchies and their reduction to KdV hierarchies
International Nuclear Information System (INIS)
Aratyn, H.; Ferreira, L.A.; Gomes, J.F.; Medeiros, R.T.; Zimerman, A.H.
1993-02-01
Bracket preserving gauge equivalence is established between several two-boson generated KP type of hierarchies. These KP hierarchies reduce under symplectic reduction (via Dirac constraints) to KdV and Schwarzian KdV hierarchies. Under this reduction the gauge equivalence is taking form of the conventional Miura maps between the above KdV type of hierarchies. (author). 16 refs
Generalized Miura transformations, two-bosons KP hierarchies and their reduction to KdV hierarchies
Energy Technology Data Exchange (ETDEWEB)
Aratyn, H. [Illinois Univ., Chicago, IL (United States). Dept. of Physics; Ferreira, L.A.; Gomes, J.F.; Medeiros, R.T.; Zimerman, A.H.
1993-02-01
Bracket preserving gauge equivalence is established between several two-boson generated KP type of hierarchies. These KP hierarchies reduce under symplectic reduction (via Dirac constraints) to KdV and Schwarzian KdV hierarchies. Under this reduction the gauge equivalence is taking form of the conventional Miura maps between the above KdV type of hierarchies. (author). 16 refs.
The master T-operator for the Gaudin model and the KP hierarchy
International Nuclear Information System (INIS)
Alexandrov, Alexander; Leurent, Sebastien; Tsuboi, Zengo; Zabrodin, Anton
2014-01-01
Following the approach of [1], we construct the master T-operator for the quantum Gaudin model with twisted boundary conditions and show that it satisfies the bilinear identity and Hirota equations for the classical KP hierarchy. We also characterize the class of solutions to the KP hierarchy that correspond to eigenvalues of the master T-operator and study dynamics of their zeros as functions of the spectral parameter. This implies a remarkable connection between the quantum Gaudin model and the classical Calogero–Moser system of particles
Peng, Chunte Sam; Fedeles, Bogdan I; Singh, Vipender; Li, Deyu; Amariuta, Tiffany; Essigmann, John M; Tokmakoff, Andrei
2015-03-17
Antiviral drugs designed to accelerate viral mutation rates can drive a viral population to extinction in a process called lethal mutagenesis. One such molecule is 5,6-dihydro-5-aza-2'-deoxycytidine (KP1212), a selective mutagen that induces A-to-G and G-to-A mutations in the genome of replicating HIV. The mutagenic property of KP1212 was hypothesized to originate from its amino-imino tautomerism, which would explain its ability to base pair with either G or A. To test the multiple tautomer hypothesis, we used 2D IR spectroscopy, which offers subpicosecond time resolution and structural sensitivity to distinguish among rapidly interconverting tautomers. We identified several KP1212 tautomers and found that >60% of neutral KP1212 is present in the enol-imino form. The abundant proportion of this traditionally rare tautomer offers a compelling structure-based mechanism for pairing with adenine. Additionally, the pKa of KP1212 was measured to be 7.0, meaning a substantial population of KP1212 is protonated at physiological pH. Furthermore, the mutagenicity of KP1212 was found to increase dramatically at pH KP1212 molecules. Overall, our data reveal that the bimodal mutagenic properties of KP1212 result from its unique shape shifting ability that utilizes both tautomerization and protonation.
Hamiltonian structure, (anti-)self-adjoint flows in the KP hierarchy and the W1+∞ and W∞ algebras
International Nuclear Information System (INIS)
Yu Feng; Wu Yongshi
1991-01-01
The extended conformal W N algebras are known to be related to the generalized KdV hierarchies through their second hamiltonian structure. In this letter we discuss the relationship between the large-N limits of the W N algebras and the KP hierarchy which contains all generalized KdV hierarchies. We show that the Poisson bracket algebra corresponding to the hamiltonian structure found by Watanabe for the KP hierarchy is isomorphic to the classical (or centerless) W 1+∞ algebra, and it contains a subalgebra which is isomorphic to the W ∞ algebra. Moreover, the usual generators of W 1+∞ and W ∞ are explicitly expressed in terms of the KP currents, and are shown to relate in a simple way to certain KP flows satisfying a sort of (anti-)self-duality. Our results not only clarify the underlying algebraic structure of the KP hierarchy, but also hint about a possible relationship between the latter and 4D self-dual Yang-Mills equations or gravity. (orig.)
Non-isospectral flows of noncommutative differential-difference KP equation
International Nuclear Information System (INIS)
Huang, Lin; Ilangovane, R.; Tamizhmani, K.M.; Zhang, Da-jun
2013-01-01
We present master symmetries of noncommutative differential-difference KP equation by considering Sato approach, where the field variables are defined over associative algebras. The Lie algebraic structures of generalized and master symmetries are given. They form a Virasoro Lie algebraic structure
Energy Technology Data Exchange (ETDEWEB)
Ramirez-Nicolas, M.
2011-07-01
The structure of the Earth is characterized by a number of regions which have different physical properties. For their study one uses models such PREM or IASPEI91. These models describe the internal structure of the Earth providing us the theoretical values of the velocity of the waves that pass through each of these regions. In this paper we focus on the waves that cross the inner core (PKIKP), and the reflected waves on the surface of the inner core (PKiKP). The aim of this study is to identify the PKiKP and PKIKP phases in a seismogram and compare them with the theoretical values obtained from the models. Another objective of this work is to propose an expression for the propagation velocity of seismic waves at the discontinuity between the outer and inner core from the minimization of waste of time (time difference between the arrival of the wave PKIKP and PKiKP). For this study we have selected two earthquakes, one occurred in Colombia, 04/26/1999 (Mw 5.9) and the other in Peru-Ecuador 16/11/2007 (Mw = 6.8). We have analyzed only the seismograms from stations with epicentral distances between 130 degree centigrade and 140 degree centigrade, because of the interference phenomena between the PKIKP and the PKiKP for epicentral distances less than 130 degree centigrade. (Author) 14 refs.
Time variations of geomagnetic activity indices Kp and Ap: an update
Directory of Open Access Journals (Sweden)
G. K. Rangarajan
1997-10-01
Full Text Available Kp and Ap indices covering the period 1932 to 1995 are analysed in a fashion similar to that attempted by Bartels for the 1932–1961 epoch to examine the time variations in their characteristics. Modern analysis techniques on the extended data base are used for further insight. The relative frequencies of occurrence of Kp with different magnitudes and the seasonal and solar cycle dependences are seen to be remarkably consistent despite the addition of 35 years of observations. Many of the earlier features seen in the indices and special intervals are shown to be replicated in the present analysis. Time variations in the occurrence of prolonged periods of geomagnetic calm or of enhanced activity are presented and their relation to solar activity highlighted. It is shown that in the declining phase the occurrence frequencies of Kp = 4–5 (consecutively over 4 intervals can be used as a precursor for the maximum sunspot number to be expected in the next cycle. The semi-annual variation in geomagnetic activity is re-examined utilising not only the Ap index but also the occurrence frequencies of Kp index with different magnitudes. Lack of dependence of the amplitude of semi-annual variation on sunspot number is emphasised. Singular spectrum analysis of the mean monthly Ap index shows some distinct periodic components. The temporal evolution of ~44 month, ~21 month and ~16 month oscillations are examined and it is postulated that while QBO and the 16 month oscillations could be attributed to solar wind and IMF oscillations with analogous periodicity, the 44 month variation is associated with a similar periodicity in recurrent high speed stream caused by sector boundary passage. It is reconfirmed that there could have been only one epoch around 1940 when solar wind speed could have exhibited a 1.3-year periodicity comparable to that seen during the post-1986 period.
Time variations of geomagnetic activity indices Kp and Ap: an update
Directory of Open Access Journals (Sweden)
G. K. Rangarajan
Full Text Available Kp and Ap indices covering the period 1932 to 1995 are analysed in a fashion similar to that attempted by Bartels for the 1932–1961 epoch to examine the time variations in their characteristics. Modern analysis techniques on the extended data base are used for further insight. The relative frequencies of occurrence of Kp with different magnitudes and the seasonal and solar cycle dependences are seen to be remarkably consistent despite the addition of 35 years of observations. Many of the earlier features seen in the indices and special intervals are shown to be replicated in the present analysis. Time variations in the occurrence of prolonged periods of geomagnetic calm or of enhanced activity are presented and their relation to solar activity highlighted. It is shown that in the declining phase the occurrence frequencies of Kp = 4–5 (consecutively over 4 intervals can be used as a precursor for the maximum sunspot number to be expected in the next cycle. The semi-annual variation in geomagnetic activity is re-examined utilising not only the Ap index but also the occurrence frequencies of Kp index with different magnitudes. Lack of dependence of the amplitude of semi-annual variation on sunspot number is emphasised. Singular spectrum analysis of the mean monthly Ap index shows some distinct periodic components. The temporal evolution of ~44 month, ~21 month and ~16 month oscillations are examined and it is postulated that while QBO and the 16 month oscillations could be attributed to solar wind and IMF oscillations with analogous periodicity, the 44 month variation is associated with a similar periodicity in recurrent high speed stream caused by sector boundary passage. It is reconfirmed that there could have been only one epoch around 1940 when solar wind speed could have exhibited a 1.3-year periodicity comparable to that seen during the post-1986 period.
Directory of Open Access Journals (Sweden)
Grażyna Majkowska-Skrobek
2016-12-01
Full Text Available The rise of antibiotic-resistant Klebsiella pneumoniae, a leading nosocomial pathogen, prompts the need for alternative therapies. We have identified and characterized a novel depolymerase enzyme encoded by Klebsiella phage KP36 (depoKP36, from the Siphoviridae family. To gain insights into the catalytic and structural features of depoKP36, we have recombinantly produced this protein of 93.4 kDa and showed that it is able to hydrolyze a crude exopolysaccharide of a K. pneumoniae host. Using in vitro and in vivo assays, we found that depoKP36 was also effective against a native capsule of clinical K. pneumoniae strains, representing the K63 type, and significantly inhibited Klebsiella-induced mortality of Galleria mellonella larvae in a time-dependent manner. DepoKP36 did not affect the antibiotic susceptibility of Klebsiella strains. The activity of this enzyme was retained in a broad range of pH values (4.0–7.0 and temperatures (up to 45 °C. Consistently, the circular dichroism (CD spectroscopy revealed a highly stability with melting transition temperature (Tm = 65 °C. In contrast to other phage tailspike proteins, this enzyme was susceptible to sodium dodecyl sulfate (SDS denaturation and proteolytic cleavage. The structural studies in solution showed a trimeric arrangement with a high β-sheet content. Our findings identify depoKP36 as a suitable candidate for the development of new treatments for K. pneumoniae infections.
Additional symmetries of supersymmetric KP hierarchies
International Nuclear Information System (INIS)
Stanciu, S.
1993-09-01
We investigate the additional symmetries of several supersymmetric KP hierarchies: The SKP hierarchy of Manin and Radul, the SKP 2 hierarchy, and the Jacobian SKP hierarchy. The main technical tool is the supersymmetric generalisation of a map originally due to Radul between the Lie algebra of superdifferential operators and the Lie algebra of vector fields on the space of supersymmetric Lax operators. In the case of the Manin-Radul SKP hierarchy we identify additional symmetries which form an algebra isomorphic to a subalgebra of superdifferential operators; whereas in the case of the Jacobian SKP, the (additional) symmetries are identified with the algebra itself. (orig.)
Verification of short lead time forecast models: applied to Kp and Dst forecasting
Wintoft, Peter; Wik, Magnus
2016-04-01
In the ongoing EU/H2020 project PROGRESS models that predicts Kp, Dst, and AE from L1 solar wind data will be used as inputs to radiation belt models. The possible lead times from L1 measurements are shorter (10s of minutes to hours) than the typical duration of the physical phenomena that should be forecast. Under these circumstances several metrics fail to single out trivial cases, such as persistence. In this work we explore metrics and approaches for short lead time forecasts. We apply these to current Kp and Dst forecast models. This project has received funding from the European Union's Horizon 2020 research and innovation programme under grant agreement No 637302.
Exact solutions of (3 + 1-dimensional generalized KP equation arising in physics
Directory of Open Access Journals (Sweden)
Syed Tauseef Mohyud-Din
Full Text Available In this work, we have obtained some exact solutions to (3 + 1-dimensional generalized KP Equation. The improved tanϕ(ξ2-expansion method has been introduced to construct the exact solutions of nonlinear evolution equations. The obtained solutions include hyperbolic function solutions, trigonometric function solutions, exponential solutions, and rational solutions. Our study has added some new varieties of solutions to already available solutions. It is also worth mentioning that the computational work has been reduced significantly. Keywords: Improved tanϕ(ξ2-expansion method, Hyperbolic function solution, Trigonometric function solution, Rational solution, (3 + 1-dimensional generalized KP equation
Nonlinearly deformed W∞ algebra and second hamiltonian structure of KP hierarchy
International Nuclear Information System (INIS)
Yu Feng; Wu Yongshi
1992-01-01
The characteristic nonlinearity of W N algebras, appropriate for their many applications in two-dimensional quantum physics, is lost in the usual large-N limits. In this paper we search for nonlinear extensions of the Virasoro algebra that incorporate all higher-spin currents with spin s≥2. We show that under certain natural homogeneity requirements, the Jacobi identities lead to a unique nonlinear, centerless deformation of classical w ∞ and W ∞ . The latter, which we call dW/dt ∞ , constitutes a universal W-algebra which is very likely to contain all W N algebras by reduction. Also it is closely related to the linear W 1+∞ by a set of interesting recursion relations, which suggests the isomorphism of dW/dt ∞ to the second hamiltonian structure of the KP hierarchy proposed by Dickey. The implications for the symmetries in two-dimensional quantum gravity and noncritical c≤1 strings in the context of the KP approach are discussed. (orig.)
New dyrosaurid crocodylomorph and evidences for faunal turnover at the K-P transition in Brazil.
Barbosa, José Antonio; Kellner, Alexander Wilhelm Armin; Viana, Maria Somália Sales
2008-06-22
The discovery of a new dyrosaurid crocodylomorph from the well-dated Palaeocene deposits of northeastern Brazil sheds new light on the evolutionary history of this extinct group of marine crocodylomorphs that have survived the Cretaceous-Palaeogene (K-P) extinction crisis. Guarinisuchus munizi, the most complete member of this group collected in South America so far, is closely related to the African forms, and this fact suggests that dyrosaurids had crossed the Atlantic Ocean before the K-P boundary and dispersed from there to North America and other parts of South America. This discovery also suggests that on the coast of northeastern Brazil, dyrosaurids replaced the pre-existing Late Cretaceous fauna of diversified mosasaurs, a group of marine lizards, after the K-P extinction event, becoming the main predators, together with sharks, in shallow marine Palaeocene environments. More detailed stratigraphic records and detailed dating of the deposits with dyrosaurids are necessary to correlate this particular pattern found in the ancient northeastern Brazilian coast within the evolution of the group, especially in Africa.
The string difference equation of the D = 1 matrix model and W1+∞ symmetry of the KP hierarchy
International Nuclear Information System (INIS)
Awada, M.A.; Sin, S.J.
1992-01-01
In this paper, the authors give a connection between the D = 1 matrix model and the generalized KP hierarchy. First, the authors find a difference equation satisfied by F, the Legendre transformation of the free energy of the D = 1 matrix model on a circle of radius R. Then the authors show that it is a special case of the difference equation of the generalized KP hierarchy with its zero mode identified with the scaling variable of the D = 1 string theory. The authors propose that the massive D = 1 matrix model is described by the generalized KP hierarchy, which implies the manifest integrability of D = 1 string theory. The authors also show that the (generalized) KP hierarchy has an underlying W 1 + ∞ symmetry. By reduction, we prove that the generalized KdV hierarchy has a subalgebra of the above symmetry which again forms a W 1+ ∞ . The authors argue that there are no W constraints in D = 1 string theory, which is in contrast to D 1 + ∞ constraints
In vitro assessment of Pediococcus acidilactici Kp10 for its potential use in the food industry.
Abbasiliasi, Sahar; Tan, Joo Shun; Bashokouh, Fatemeh; Ibrahim, Tengku Azmi Tengku; Mustafa, Shuhaimi; Vakhshiteh, Faezeh; Sivasamboo, Subhashini; Ariff, Arbakariya B
2017-05-23
Selection of a microbial strain for the incorporation into food products requires in vitro and in vivo evaluations. A bacteriocin-producing lactic acid bacterium (LAB), Pediococcus acidilactici Kp10, isolated from a traditional dried curd was assessed in vitro for its beneficial properties as a potential probiotic and starter culture. The inhibitory spectra of the bacterial strain against different gram-positive and gram-negative bacteria, its cell surface hydrophobicity and resistance to phenol, its haemolytic, amylolytic and proteolytic activities, ability to produce acid and coagulate milk together with its enzymatic characteristics and adhesion property were all evaluated in vitro. P. acidilactici Kp10 was moderately tolerant to phenol and adhere to mammalian epithelial cells (Vero cells and ileal mucosal epithelium). The bacterium also exhibited antimicrobial activity against several gram-positive and gram-negative food-spoilage and food-borne pathogens such as Listeria monocytgenes ATCC 15313, Salmonella enterica ATCC 13311, Shigella sonnei ATCC 9290, Klebsiella oxytoca ATCC 13182, Enterobacter cloaca ATCC 35030 and Streptococcus pyogenes ATCC 12378. The absence of haemolytic activity and proteinase (trypsin) and the presence of a strong peptidase (leucine-arylamidase) and esterase-lipase (C4 and C8) were observed in this LAB strain. P. acidilactici Kp10 also produced acid, coagulated milk and has demonstrated proteolytic and amylolactic activities. The properties exhibited by P. acidilactici Kp10 suggested its potential application as probiotic and starter culture in the food industry.
(KP) equation in warm dusty plasma with variable dust charge, two ...
Indian Academy of Sciences (India)
In this work, the propagation of nonlinear waves in warm dusty plasmas with variable dust charge, two-temperature ion and nonthermal electron is studied. By using the reductive perturbation theory, the Kadomstev–Petviashvili (KP) equation is derived. The energy of the soliton and the linear dispersion relation are obtained ...
Matrix integral solutions to the discrete KP hierarchy and its Pfaffianized version
International Nuclear Information System (INIS)
Lafortune, Stéphane; Li, Chun-Xia
2016-01-01
Matrix integrals used in random matrix theory for the study of eigenvalues of Hermitian ensembles have been shown to provide τ -functions for several hierarchies of integrable equations. In this article, we extend this relation by showing that such integrals can also provide τ -functions for the discrete KP hierarchy and a coupled version of the same hierarchy obtained through the process of Pfaffianization. To do so, we consider the first equation of the discrete KP hierarchy, the Hirota–Miwa equation. We write the Wronskian determinant solutions to the Hirota–Miwa equation and consider a particular form of matrix integrals, which we show is an example of those Wronskian solutions. The argument is then generalized to the whole hierarchy. A similar strategy is used for the Pfaffianized version of the hierarchy except that in that case, the solutions are written in terms of Pfaffians rather than determinants. (paper)
Sadafi, Fabrizio-Zagros; Massai, Lara; Bartolommei, Gianluca; Moncelli, Maria Rosa; Messori, Luigi; Tadini-Buoninsegni, Francesco
2014-08-01
Sarco-endoplasmic reticulum Ca2+-ATPase (SERCA), a P-type ATPase that sustains Ca2+ transport and plays a major role in intracellular Ca2+ homeostasis, represents a therapeutic target for cancer therapy. Here, we investigated whether ruthenium-based anticancer drugs, namely KP1019 (indazolium [trans-tetrachlorobis(1H-indazole)ruthenate(III)]), NAMI-A (imidazolium [trans-tetrachloro(1H-imidazole)(S-dimethylsulfoxide)ruthenate(III)]) and RAPTA-C ([Ru(η6-p-cymene)dichloro(1,3,5-triaza-7-phosphaadamantane)]), and cisplatin (cis-diammineplatinum(II) dichloride) might act as inhibitors of SERCA. Charge displacement by SERCA adsorbed on a solid-supported membrane was measured after ATP or Ca2+ concentration jumps. Our results show that KP1019, in contrast to the other metal compounds, is able to interfere with ATP-dependent translocation of Ca2+ ions. An IC50 value of 1 μM was determined for inhibition of calcium translocation by KP1019. Conversely, it appears that KP1019 does not significantly affect Ca2+ binding to the ATPase from the cytoplasmic side. Inhibition of SERCA at pharmacologically relevant concentrations may represent a crucial aspect in the overall pharmacological and toxicological profile of KP1019. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The master symmetry and time dependent symmetries of the differential–difference KP equation
International Nuclear Information System (INIS)
Khanizadeh, Farbod
2014-01-01
We first obtain the master symmetry of the differential–difference KP equation. Then we show how this master symmetry, through sl(2,C)-representation of the equation, can construct generators of time dependent symmetries. (paper)
Higher-spin and W∞(J) algebras in Virasoro-constrained KP and N-KdV hierarchies
International Nuclear Information System (INIS)
Semikhatov, A.M.
1991-02-01
Virasoro constraints on the KP hierarchy, arising in matrix models, are studied by reexpressing them in terms of dressing operators of the hierarchy. There exists a one-parameter family of Virasoro representations on the KP hierarchy (depending on a number J which can be identified as the conformal weight of an abstract bc system). The respective full invariance algebra is the ''Borel'' subalgebra of W ∞ (J), which we describe as an extension of the ''wedge'', or higher spin, algebra B λ=J-J 2 by the L 2 Virasoro generator. Reductions of these structures to the N-KdV hierarchies are performed explicitly. (author). 26 refs
Gaussian solitary waves for the logarithmic-KdV and the logarithmic-KP equations
International Nuclear Information System (INIS)
Wazwaz, Abdul-Majid
2014-01-01
We investigate the logarithmic-KdV equation for more Gaussian solitary waves. We extend this work to derive the logarithmic-KP (Kadomtsev–Petviashvili) equation. We show that both logarithmic models are characterized by their Gaussian solitons. (paper)
International Nuclear Information System (INIS)
Figueroa-O'Farrill, J.M.; Mas, J.; Ramos, E.
1993-01-01
The KP hierarchy is hamiltonian relative to a one-parameter family of Poisson structures obtained from a generalized Adler map in the space of formal pseudodifferential symbols with noninteger powers. The resulting W-algebra is a one-parameter deformation of W KP admitting a central extension for generic values of the parameter, reducing naturally to W n for special values of the parameter, and contracting to the centrally extended W 1+∞ , W ∞ and further truncations. In the classical limit, all algebras in the one-parameter family are equivalent and isomorphic to W KP . The reduction induced by setting the spin-one field to zero yields a one-parameter deformation of W ∞ which contracts to a new nonlinear algebra of the W ∞ -type. (orig.)
Deb, Debasish; Shrestha, Ankita; Maiti, Indu B.; Dey, Nrisingha
2018-01-01
Development of disease-resistant plant varieties achieved by engineering anti-microbial transgenes under the control of strong promoters can suffice the inhibition of pathogen growth and simultaneously ensure enhanced crop production. For evaluating the prospect of such strong promoters, we comprehensively characterized the full-length transcript promoter of Cassava Vein Mosaic Virus (CsVMV; -565 to +166) and identified CsVMV8 (-215 to +166) as the highest expressing fragment in both transient and transgenic assays. Further, we designed a new chimeric promoter ‘MUASCsV8CP’ through inter-molecular hybridization among the upstream activation sequence (UAS) of Mirabilis Mosaic Virus (MMV; -297 to -38) and CsVMV8, as the core promoter (CP). The MUASCsV8CP was found to be ∼2.2 and ∼2.4 times stronger than the CsVMV8 and CaMV35S promoters, respectively, while its activity was found to be equivalent to that of the CaMV35S2 promoter. Furthermore, we generated transgenic tobacco plants expressing the totiviral ‘Killer protein KP4’ (KP4) under the control of the MUASCsV8CP promoter. Recombinant KP4 was found to accumulate both in the cytoplasm and apoplast of plant cells. The agar-based killing zone assays revealed enhanced resistance of plant-derived KP4 against two deuteromycetous foliar pathogenic fungi viz. Alternaria alternata and Phoma exigua var. exigua. Also, transgenic plants expressing KP4 inhibited the growth progression of these fungi and conferred significant fungal resistance in detached-leaf and whole plant assays. Taken together, we establish the potential of engineering “in-built” fungal stress-tolerance in plants by expressing KP4 under a novel chimeric caulimoviral promoter in a transgenic approach. PMID:29556246
Unique continuation property for the Kadomtsev-Petviashvili (KP-II equation
Directory of Open Access Journals (Sweden)
Mahendra Panthee
2005-06-01
Full Text Available We generalize a method introduced by Bourgain in cite{Borg} based on complex analysis to address two spatial dimensional models and prove that if a sufficiently smooth solution to the initial value problem associated with the Kadomtsev-Petviashvili (KP-II equation $$ (u_t+u_{xxx}+uu_{x}_{x} +u_{yy}=0, quad (x, y in mathbb{R}^2, ;tinmathbb{R}, $$ is supported compactly in a nontrivial time interval then it vanishes identically.
On the central quadric ansatz: integrable models and Painlevé reductions
International Nuclear Information System (INIS)
Ferapontov, E V; Huard, B; Zhang, A
2012-01-01
It was observed by Tod (1995 Class. Quantum Grav.12 1535–47) and later by Dunajski and Tod (2002 Phys. Lett. A 303 253–64) that the Boyer–Finley (BF) and the dispersionless Kadomtsev–Petviashvili (dKP) equations possess solutions whose level surfaces are central quadrics in the space of independent variables (the so-called central quadric ansatz). It was demonstrated that generic solutions of this type are described by Painlevé equations P III and P II , respectively. The aim of our paper is threefold: (1) Based on the method of hydrodynamic reductions, we classify integrable models possessing the central quadric ansatz. This leads to the five canonical forms (including BF and dKP). (2) Applying the central quadric ansatz to each of the five canonical forms, we obtain all Painlevé equations P I –P VI , with P VI corresponding to the generic case of our classification. (3) We argue that solutions coming from the central quadric ansatz constitute a subclass of two-phase solutions provided by the method of hydrodynamic reductions. (paper)
Brumbaugh, J E; Morgan, S; Beck, J C; Zantek, N; Kearney, S; Bendel, C M; Roberts, K D
2011-05-01
Hemolytic disease of the fetus and newborn occurs when maternal IgG antibodies cross the placenta and cause hemolysis of fetal red blood cells. Kp(a) is a low frequency red blood cell antigen that has rarely been implicated in hemolytic disease of the fetus and newborn. The few reported cases attributed to anti-Kp(a) have typically had minimal clinical consequences. We report a critically ill neonate who presented with purpura, respiratory failure, severe liver dysfunction, hyperbilirubinemia, hypoglycemia and anemia. This case report broadens the spectrum of neonatal disease associated with anti-Kp(a), addresses the evaluation of hemolysis with liver failure in a neonate, and emphasizes the importance of screening for antibodies to low frequency red blood cell antigens in suspected hemolytic disease of the fetus and newborn.
Abenda, Simonetta
2017-09-01
We continue the program started in Abenda and Grinevich (2015) of associating rational degenerations of M-curves to points in GrTNN(k , n) using KP theory for real finite gap solutions. More precisely, we focus on the inverse problem of characterizing the soliton data which produce Krichever divisors compatible with the KP reality condition when Γ is a certain rational degeneration of a hyperelliptic M-curve. Such choice is motivated by the fact that Γ is related to the curves associated to points in GrTP(1 , n) and in GrTP(n - 1 , n) in Abenda and Grinevich (2015). We prove that the reality condition on the Krichever divisor on Γ singles out a special family of KP multi-line solitons (T-hyperelliptic solitons) in GrTP(k , n) , k ∈ [ n - 1 ] , naturally connected to the finite non-periodic Toda hierarchy. We discuss the relations between the algebraic-geometric description of KP T-hyperelliptic solitons and of the open Toda system. Finally, we also explain the effect of the space-time transformation which conjugates soliton data in GrTP(k , n) to soliton data in GrTP(n - k , n) on the Krichever divisor for such KP solitons.
Integrability and symmetry algebra associated with N=2 KP flows
International Nuclear Information System (INIS)
Ghosh, Sasanka; Sarma, Debojit
2001-01-01
We show the complete integrability of N=2 nonstandard KP flows establishing the bi-Hamiltonian structures. One of Hamiltonian structures is shown to be isomorphic to the nonlinear N=2 W ∞ algebra with the bosonic sector having W 1+∞ ·W ∞ structure. A consistent free field representation of the super conformal algebra is obtained. The bosonic generators are found to be an admixture of free fermions and free complex bosons, unlike the linear one. The fermionic generators become exponential in free fields, in general
On the Lax representation of the 2-component KP and 2D Toda hierarchies
International Nuclear Information System (INIS)
Carlet, Guido; Manas, Manuel
2010-01-01
The Lax formulation of the multicomponent Kadomtsev-Petviashvili (KP) and 2D Toda hierarchies involves several implicit constraints. We show that, at least in the 2-component case, it is possible to explicitly solve such constraints and identify a set of free dependent variables for such hierarchies.
Energy Technology Data Exchange (ETDEWEB)
Lara-Castells, María Pilar de, E-mail: Pilar.deLara.Castells@csic.es; Bartolomei, Massimiliano [Instituto de Física Fundamental (C.S.I.C.), Serrano 123, E-28006 Madrid (Spain); Mitrushchenkov, Alexander O. [Laboratoire Modélisation et Simulation Multi Echelle, Université Paris-Est, MSME UMR 8208 CNRS, 5 bd Descartes, 77454 Marne-la-Vallée (France); Stoll, Hermann [Institut für Theoretische Chemie, Universität Stuttgart, D-70550 Stuttgart (Germany)
2015-11-21
The accuracy and transferability of the electronic structure approach combining dispersionless density functional theory (DFT) [K. Pernal et al., Phys. Rev. Lett. 103, 263201 (2009)] with the method of increments [H. Stoll, J. Chem. Phys. 97, 8449 (1992)], are validated for the interaction between the noble-gas Ne, Ar, Kr, and Xe atoms and coronene/graphene/graphite surfaces. This approach uses the method of increments for surface cluster models to extract intermonomer dispersion-like (2- and 3-body) correlation terms at coupled cluster singles and doubles and perturbative triples level, while periodic dispersionless density functionals calculations are performed to estimate the sum of Hartree-Fock and intramonomer correlation contributions. Dispersion energy contributions are also obtained using DFT-based symmetry-adapted perturbation theory [SAPT(DFT)]. An analysis of the structure of the X/surface (X = Ne, Ar, Kr, and Xe) interaction energies shows the excellent transferability properties of the leading intermonomer correlation contributions across the sequence of noble-gas atoms, which are also discussed using the Drude oscillator model. We further compare these results with van der Waals-(vdW)-corrected DFT-based approaches. As a test of accuracy, the energies of the low-lying nuclear bound states supported by the laterally averaged X/graphite potentials (X = {sup 3}He, {sup 4}He, Ne, Ar, Kr, and Xe) are calculated and compared with the best estimations from experimental measurements and an atom-bond potential model using the ab initio-assisted fine-tuning of semiempirical parameters. The bound-state energies determined differ by less than 6–7 meV (6%) from the atom-bond potential model. The crucial importance of including incremental 3-body dispersion-type terms is clearly demonstrated, showing that the SAPT(DFT) approach effectively account for these terms. With the deviations from the best experimental-based estimations smaller than 2.3 meV (1.9%), the
Energy Technology Data Exchange (ETDEWEB)
Kim, Seong O.; Hwang, Young Dong; Kim, Young In; Chang, Moon Hee
1997-03-01
This study was performed to establish the design concepts and to evaluate the performance of safety features of large capacity passive reactor (1000 MWe grade). The design concepts of the large capacity passive reactor `KP1000` were established to generate 1000 MW electric power based on the AP600 of Westinghouse by increasing the number of reactor coolant loop and by increasing the size of reactor internals/core. To implement the analysis of the LBLOCA for KP1000, various kinds of computer codes being considered, it was concluded that RELAP5 was the most appropriate one in availability and operations in present situation. By the analysis of the computer code `RELAP5/Mod3.2.1.2`, following conclusions were derived as described below. First, by spectrum analysis of the discharge factor of the berak part, the most conservative discharge factor C{sub D}=1.2 and the PCT value of KP1000 was 1254F, which is slightly higher than the value of AP600 but is much less than the existing active reactor `Kori 3 and 4` where blowdown PCT value is 1693.4 deg F and reflooding PCT is 1918.4 deg F. Second, after the 200 seconds from the initiation of LBLOCA, IRWST water was supplied in a stable state and the maximum temperature of clad were maintained in a saturated condition. Therefore, it was concluded that the passive safety features of KP1000 keep reactor core from being damaged for large break LOCA. (author). 11 refs., 28 tabs., 37 figs.
Corcione, Silvia; Angilletta, Roberto; Raviolo, Stefania; Filippini, Claudia; Fossati, Lucina; Di Perri, Giovanni; Cavallo, Rossana; De Rosa, Francesco Giuseppe
2018-02-01
The incidence of C. difficile infection (CDI) and of bloodstream infection (BSI) caused by Candida spp., ESBL-E-producing Enterobacteriaceae (ESBL-E) and carbapenemase-producing K. pneumoniae (CP-Kp) is associated with high mortality. We conducted a single centre retrospective study on patients admitted to Molinette Hospital, Turin, Italy, from January 2013 to April 2015 with CDI or BSI caused by Candida, ESBL-E or CP-Kp. For each patient demographic, clinical and microbiological data were collected. Aims of this study were to describe epidemiology and to evaluate risk factors for in-hospital mortality in this group of patients. Seven hundred-eighty six cases were analyzed: 398 CDI, 137 candidemia, 125 ESBL-E BSI and 126 CP-Kp BSI. CDI, candidemia and ESBL-E BSI were more frequently reported in internal medicine wards (IMW), whilst CP-Kp were more described in intensive care unit (ICU). Sixty-six percent of patients had a previous hospitalization and the majority of patients had several medical comorbidities. In-hospital death occurred in 23.4%. Independent risk factors for mortality were antibiotic therapy before hospital admission, cardiovascular diseases, neutropenia, urinary catheter, total parenteral nutrition, SIRS and higher creatinine levels at diagnosis. Previous abdominal surgery, inflammatory bowel disease, higher serum albumin levels at the admission and fever at diagnosis were significantly associated with survival. Our data showed that CDI, ESBL-E BSI and candidemia are more frequent in frail patients, admitted to IMW, with chronic comorbidities and broad exposure to antibiotic therapies, with the exception for CP-Kp BSI, still more common in the ICU. Copyright © 2017 European Federation of Internal Medicine. Published by Elsevier B.V. All rights reserved.
Peng, Chunte Sam; Fedeles, Bogdan I.; Singh, Vipender; Li, Deyu; Amariuta, Tiffany; Essigmann, John M.; Tokmakoff, Andrei
2015-01-01
The anti-HIV drug KP1212 was designed to intentionally increase the mutation rate of HIV, thereby causing viral population collapse. Its mutagenicity and thus antiviral activity was proposed to be the result of tautomerization. We used 2D IR spectroscopy to identify rapidly interconverting tautomers under physiological conditions. The traditionally rare enol–imino tautomer for nucleobases was found to be the major species for KP1212, providing a structural support for the tautomer hypothesis....
Feed forward neural networks modeling for K-P interactions
International Nuclear Information System (INIS)
El-Bakry, M.Y.
2003-01-01
Artificial intelligence techniques involving neural networks became vital modeling tools where model dynamics are difficult to track with conventional techniques. The paper make use of the feed forward neural networks (FFNN) to model the charged multiplicity distribution of K-P interactions at high energies. The FFNN was trained using experimental data for the multiplicity distributions at different lab momenta. Results of the FFNN model were compared to that generated using the parton two fireball model and the experimental data. The proposed FFNN model results showed good fitting to the experimental data. The neural network model performance was also tested at non-trained space and was found to be in good agreement with the experimental data
The geometry of the super KP flows
International Nuclear Information System (INIS)
Rabin, J.M.
1991-01-01
A supersymmetric generalization of the Krichever map is used to construct algebro-geometric solutions to the various super Kadomtsev-Petviashvili (SKP) hierarchies. The geometric data required consist of a suitable algebraic supercurve of genus g (generally not a super Riemann surface) with a distinguished point and local coordinates (z, θ) there, and a generic line bundle of degree g-1 with a local trivialization near the point. The resulting solutions to the Manin-Radul SKP system describe coupled deformations of the line bundle and the supercurve itself, in contrast to the ordinary KP system which deforms line bundles but not curves. Two new SKP systems are introduced: An integrable 'Jacobian' system whose solutions describe genuine Jacobian flows, deforming the bundle but not the curve; and a nonintegrable 'maximal' system describing independent deformations of bundle and curve. The Kac-van de Leur SKP system describes the same deformations as the maximal system, but in a different parametrization. (orig.)
Spin Calogero Particles and Bispectral Solutions of the Matrix KP Hierarchy
International Nuclear Information System (INIS)
Bergvelt, Maarten; Gekhtman, Michael; Kasman, Alex
2009-01-01
Pairs of nxn matrices whose commutator differ from the identity by a matrix of rank r are used to construct bispectral differential operators with rxr matrix coefficients satisfying the Lax equations of the Matrix KP hierarchy. Moreover, the bispectral involution on these operators has dynamical significance for the spin Calogero particles system whose phase space such pairs represent. In the case r = 1, this reproduces well-known results of Wilson and others from the 1990's relating (spinless) Calogero-Moser systems to the bispectrality of (scalar) differential operators
The bi-Hamiltonian structures of the Manin-Radul super KP hierarchy
International Nuclear Information System (INIS)
Panda, S.; Roy, S.
1992-05-01
We consider the ''even-time'' flow of the Manin-Radul supersymmetric KP hierarchy and show that it possesses bi-Hamiltonian structures by deriving two distinct Gelfand-Dikii brackets corresponding to two successive Hamiltonians of the system. A recursion relation involving them is also obtained. We observe that the first Hamiltonian structure defines a supersymmetric Lie algebra since it is a linear algebra among the super fields appearing in the Lax operator whereas the second Hamiltonian structure is a non-linear algebra and so it does not define a Lie algebra. (author). 25 refs
Molybdenum x-ray absorption studies of the mutant Kp nifV of nitrogenase MO-FE protein
International Nuclear Information System (INIS)
Eidsness, M.K.; Smith, B.E.; Flood, A.C.; Garner, C.D.; Cramer, S.P.
1985-01-01
The nifV mutant nitrogenase enzyme of Klebsiella pheumoniae exhibits altered substrate reducing activity. This nitrogenase mutant cannot fix N 2 in vivo but can reduce C 2 H 2 to C 2 H 4 . The nifV mutant enzyme differs further from the wild-type enzyme by CO inhibition of its H 2 evolution activity, up to 80%. The NifV - phenotype (NifV - Kp1) has been shown to be associated with the iron-molybdenum cofactor (FeMoco) in the Mo Fe protein which is generally accepted as the site for substrate reduction. An X-Ray absorption study of the Mo site in this mutant may reveal a difference in its FeMoco structure. The authors report here a comparison of Mo X-Ray absorption data from the nitrogenase enzymes of the wild-type and NifV - strains in three different forms: (1) as isolated, (2) dye-oxidized, and (3) fixing enzyme systems. Mo edge structure of NifV - Kp1 and wild-type enzymes are nearly identical. Small shifts to higher energies are observed in the oxidized and fixing states. Mo EXAFS of NifV - Kp1 and wild-type in the ''as isolated'' state appear indistinguishable. Curve fitting results best describe the molybdenum in FeMoco as bound by 4-5 S atoms at 2.36 A ,3 Fe atoms at 2.69 A, and 0-2 O(N) atoms at 2.19 A. The spectral similarity of these results concerning the nifV mutant FeMoco structure is discussed
Genome Sequence of Klebsiella pneumoniae KpQ3, a DHA-1 β-Lactamase-Producing Nosocomial Isolate
Tobes, Raquel; Codoñer, Francisco M.; López-Camacho, Elena; Salanueva, Iñigo J.; Manrique, Marina; Brozynska, Marta; Gómez-Gil, Rosa; Martínez-Blanch, Juan F.; Álvarez-Tejado, Miguel; Pareja, Eduardo
2013-01-01
Klebsiella pneumoniae KpQ3 is a multidrug-resistant isolate obtained from a blood culture of a patient in a burn unit in the Hospital Universitario La Paz (Madrid, Spain) in 2008. The genome contains multiple antibiotic resistance genes, including a plasmid-mediated DHA-1 cephalosporinase gene. PMID:23469341
Using PKiKP coda to study heterogeneity in the top layer of the inner core's western hemisphere
Wu, Wenbo; Irving, Jessica C. E.
2017-05-01
Significant lateral and depth variations of the inner core's properties, such as the large-scale hemispherical pattern, have been confirmed by a variety of seismological observations. However it is still unclear which dynamic processes in the core are responsible for these variations. Small-scale volumetric heterogeneity has been detected in the top layer of the inner core by PKiKP coda observations. Studies of these small-scale heterogeneities can provide critical information, such as the degree of alignment of iron crystals, the presence of possible partial melt and the grain size of iron crystals, all of which can be used to constrain the dynamic processes of the inner core. However, most previous observations sampled the inner core beneath the Pacific Ocean and Asia, often in the inner core's 'eastern hemisphere'. We use seismic stations in the North America, including the Earthscope Transportable Array, to look at PKiKP and its coda waves. We find 21 events with clear signals. In agreement with previous studies, inner core scattering (ICS), resulting in clear PKiKP coda, is found at epicentral distances of 60°-95°. However, the ICS we observe in these 21 western hemisphere events is weaker than previously reported for the eastern hemisphere. Comparing our observations with numerical simulations, we conclude that this relatively weak ICS indicates small-scale heterogeneity in at least the top layer of the inner core beneath Central America. Combining our clear observations with previous studies suggests either a hemispherical difference, or a regional variation, of small-scale heterogeneity in the inner core.
Stability of line solitons for the KP-II equation in R2
Mizumachi, Tetsu
2015-01-01
The author proves nonlinear stability of line soliton solutions of the KP-II equation with respect to transverse perturbations that are exponentially localized as x\\to\\infty. He finds that the amplitude of the line soliton converges to that of the line soliton at initial time whereas jumps of the local phase shift of the crest propagate in a finite speed toward y=\\pm\\infty. The local amplitude and the phase shift of the crest of the line solitons are described by a system of 1D wave equations with diffraction terms.
Values of Kp Indices, Ap Indices, Cp Indices, C9 Indices, Sunspot Number, and 10.7 cm Flux
National Oceanic and Atmospheric Administration, Department of Commerce — This data file consists of Kp indices, Ap indices, Cp indices, C9 indices, sunspot number, and 10.7 cm flux. The most often requested parameter of this file are the...
Mutation of HIV-1 genomes in a clinical population treated with the mutagenic nucleoside KP1461.
Mullins, James I; Heath, Laura; Hughes, James P; Kicha, Jessica; Styrchak, Sheila; Wong, Kim G; Rao, Ushnal; Hansen, Alexis; Harris, Kevin S; Laurent, Jean-Pierre; Li, Deyu; Simpson, Jeffrey H; Essigmann, John M; Loeb, Lawrence A; Parkins, Jeffrey
2011-01-14
The deoxycytidine analog KP1212, and its prodrug KP1461, are prototypes of a new class of antiretroviral drugs designed to increase viral mutation rates, with the goal of eventually causing the collapse of the viral population. Here we present an extensive analysis of viral sequences from HIV-1 infected volunteers from the first "mechanism validation" phase II clinical trial of a mutagenic base analog in which individuals previously treated with antiviral drugs received 1600 mg of KP1461 twice per day for 124 days. Plasma viral loads were not reduced, and overall levels of viral mutation were not increased during this short-term study, however, the mutation spectrum of HIV was altered. A large number (N = 105 per sample) of sequences were analyzed, each derived from individual HIV-1 RNA templates, after 0, 56 and 124 days of therapy from 10 treated and 10 untreated control individuals (>7.1 million base pairs of unique viral templates were sequenced). We found that private mutations, those not found in more than one viral sequence and likely to have occurred in the most recent rounds of replication, increased in treated individuals relative to controls after 56 (p = 0.038) and 124 (p = 0.002) days of drug treatment. The spectrum of mutations observed in the treated group showed an excess of A to G and G to A mutations (p = 0.01), and to a lesser extent T to C and C to T mutations (p = 0.09), as predicted by the mechanism of action of the drug. These results validate the proposed mechanism of action in humans and should spur development of this novel antiretroviral approach.
Mutation of HIV-1 genomes in a clinical population treated with the mutagenic nucleoside KP1461.
Directory of Open Access Journals (Sweden)
James I Mullins
2011-01-01
Full Text Available The deoxycytidine analog KP1212, and its prodrug KP1461, are prototypes of a new class of antiretroviral drugs designed to increase viral mutation rates, with the goal of eventually causing the collapse of the viral population. Here we present an extensive analysis of viral sequences from HIV-1 infected volunteers from the first "mechanism validation" phase II clinical trial of a mutagenic base analog in which individuals previously treated with antiviral drugs received 1600 mg of KP1461 twice per day for 124 days. Plasma viral loads were not reduced, and overall levels of viral mutation were not increased during this short-term study, however, the mutation spectrum of HIV was altered. A large number (N = 105 per sample of sequences were analyzed, each derived from individual HIV-1 RNA templates, after 0, 56 and 124 days of therapy from 10 treated and 10 untreated control individuals (>7.1 million base pairs of unique viral templates were sequenced. We found that private mutations, those not found in more than one viral sequence and likely to have occurred in the most recent rounds of replication, increased in treated individuals relative to controls after 56 (p = 0.038 and 124 (p = 0.002 days of drug treatment. The spectrum of mutations observed in the treated group showed an excess of A to G and G to A mutations (p = 0.01, and to a lesser extent T to C and C to T mutations (p = 0.09, as predicted by the mechanism of action of the drug. These results validate the proposed mechanism of action in humans and should spur development of this novel antiretroviral approach.
Hyson, Peter; Shapiro, Joshua A; Wien, Michelle W
2015-10-08
Exiguobacterium sp. strain BMC-KP was isolated as part of a student environmental sampling project at Bryn Mawr College, PA. Sequencing of bacterial DNA assembled a 3.32-Mb draft genome. Analysis suggests the presence of genes for tolerance to cold and toxic metals, broad carbohydrate metabolism, and genes derived from phage. Copyright © 2015 Hyson et al.
New Variable Stars in the KP2001 Catalog from the Data Base of the Northern Sky Variability Survey
Petrosyan, G. V.
2018-03-01
The optical variability of stars in the KP2001 catalog is studied. Monitor data from the automatic Northern Sky Variability Survey (NSVS) are used for this purpose. Of the 257 objects that were studied, 5 are Mira Ceti variables (mirids), 33 are semiregular (SR), and 108 are irregular variables (Ir). The light curves of the other objects show no noticeable signs of variability. For the first time, 11 stars are assigned to the semiregular and 105 stars to the irregular variables. Of the irregular variables, the light curves of two, No. 8 and No. 194, are distinct and are similar to the curves for eclipsing variables. The periods and amplitudes of the mirids and semiregular variables are determined using the "VStar" program package from AAVSO. The absolute stellar magnitudes M K and distances are also estimated, along with the mass loss for the mirids. The behavior of stars from KP2001 in 2MASS and WISE color diagrams is examined.
Pankow, James F.
Gas-particle partitioning is examined using a partitioning constant Kp = ( F/ TSP)/ A, where F (ng m -3) and A (ng m -3) are the particulate-associated and gas-phase concentrations, respectively, and TSP is the total suspended particulate matter level (μg m -3). Compound-dependent values of Kp depend on temperature ( T) according to Kp = mp/ T + bp. Limitations in data quality can cause errors in estimates of mp and bp obtained by simple linear regression (SLR). However, within a group of similar compounds, the bp values will be similar. By pooling data, an improved set of mp and a single bp can be obtained by common y-intercept regression (CYIR). SLR estimates for mp and bp for polycyclic aromatic hydrocarbons (PAHs) sorbing to urban Osaka particulate matter are available (Yamasaki et al., 1982, Envir. Sci. Technol.16, 189-194), as are CYIR estimates for the same particulate matter (Pankow, 1991, Atmospheric Environment25A, 2229-2239). In this work, a comparison was conducted of the ability of these two sets of mp and bp to predict A/ F ratios for PAHs based on measured T and TSP values for data obtained in other urban locations, specifically: (1) in and near the Baltimore Harbor Tunnel by Benner (1988, Ph.D thesis, University of Maryland) and Benner et al. (1989, Envir. Sci. Technol.23, 1269-1278); and (2) in Chicago by Cotham (1990, Ph.D. thesis, University of South Carolina). In general, the CYIR estimates for mp and bp obtained for Osaka particulate matter were found to be at least as reliable, and for some compounds more reliable than their SLR counterparts in predicting gas-particle ratios for PAHs. This result provides further evidence of the utility of the CYIR approach in quantitating the dependence of log Kp values on 1/ T.
Directory of Open Access Journals (Sweden)
Yozi Aulia Rahman
2015-12-01
Full Text Available Poverty is a serious problem, it’s happened in all the world, such as Indonesia. In September 2006, BPS announced that the poverty rate in Indonesiahad increased during the period February 2005 to march 2006 from 16.0 percent to 17.75 percent contrast to steady declines in the poverty rate since the crisis. Number of Poverty in Indonesiain 2006 have been reached 35,5 milion people. Government of Indonesiahas implemented programs to reduce poverty until village level. These programs such as IDT, PPK, BLT, etc. But, that programs just a short run programs, not long run programs. As long run program, P2KP has many programs, such as micro credits, infrastructure, and training. In Pepedan and Linggapura village implemented infrastructure programs. Its first priority programs because there many roads in that village are broken and disturbs local economic activities. BKM and KSM managed this program so that is success. Based on SWOT analysis, appropriate strategy to improve the function of P2KP is by intregrated horizontal strategy. It means, Local Government (Brebes Regency Goverment must have policy strategic and must cooperation with BKM, KSM and people in village. Project evaluate (Inputs, Outputs, Outcames, Benefits, Impact needs to know programs running.
Gai, Litao; Bilige, Sudao; Jie, Yingmo
2016-01-01
In this paper, we successfully obtained the exact solutions and the approximate analytic solutions of the (2 + 1)-dimensional KP equation based on the Lie symmetry, the extended tanh method and the homotopy perturbation method. In first part, we obtained the symmetries of the (2 + 1)-dimensional KP equation based on the Wu-differential characteristic set algorithm and reduced it. In the second part, we constructed the abundant exact travelling wave solutions by using the extended tanh method. These solutions are expressed by the hyperbolic functions, the trigonometric functions and the rational functions respectively. It should be noted that when the parameters are taken as special values, some solitary wave solutions are derived from the hyperbolic function solutions. Finally, we apply the homotopy perturbation method to obtain the approximate analytic solutions based on four kinds of initial conditions.
Dömötör, Orsolya; Pelivan, Karla; Borics, Attila; Keppler, Bernhard K; Kowol, Christian R; Enyedy, Éva A
2018-05-30
Binding interactions between human serum albumin (HSA) and four approved epidermal growth factor receptor (EGFR) inhibitors gefitinib (GEF), erlotinib (ERL), afatinib (AFA), osimertinib (OSI), as well as the experimental drug KP2187, were investigated by means of spectrofluorometric and molecular modelling methods. Steady-state and time resolved spectrofluorometric techniques were carried out, including direct quenching of protein fluorescence and site marker displacement measurements. Proton dissociation processes and solvent dependent fluorescence properties were investigated as well. The EGFR inhibitors were predominantly presented in their single protonated form (HL + ) at physiological pH except ERL, which is charge-neutral. Significant solvent dependent fluorescence properties were found for GEF, ERL and KP2187, namely their emission spectra show strong dependence on the polarity and the hydrogen bonding ability of the solvents. The inhibitors proved to be bound at site I of HSA (in subdomain IIA) in a weak-to-moderate fashion (logK' 3.9-4.9) using spectrofluorometry. OSI (logK' 4.3) and KP2187 can additionally bind in site II (in subdomain IIIA), while GEF, ERL and AFA clearly show no interaction here. Docking methods qualitatively confirmed binding site preferences of compounds GEF and KP2187, and indicated that they probably bind to HSA in their neutral forms. Binding constants calculated on the basis of the various experimental data indicate a weak-to-moderate binding on HSA, only OSI exhibits somewhat higher affinity towards this protein. However, model calculations performed at physiological blood concentrations of HSA resulted in high (ca. 90%) bound fractions for the inhibitors, highlighting the importance of plasma protein binding. Copyright © 2018 Elsevier B.V. All rights reserved.
La vie rurale en pays kpélé dans le Togo méridional : une ...
African Journals Online (AJOL)
Il apparaît au regard de nos travaux que le pays kpélé présente des traits identiques au reste des régions de la grande aire culturelle Adja-Tado, mais dispose aussi, de traits originaux dictés par le cadre de vie et la dynamique sociale interne née depuis les périodes d'occupation du milieu. Enfin, l'étude démontre que ...
Overexpression of K-p21Ras play a prominent role in lung cancer
Zhang, Peng-bo; Zhou, Xin-liang; Yang, Ju-lun
2018-06-01
The proto-oncogene ras product, p21Ras, has been found overexpression in many human tumors. However, the subtypes of overexpressed p21Ras still remain unclear. The purpose of this study was to investigate overexpressed isoforms of p21Ras and their roles in the progress of lung cancer. Method: The expression of total p21Ras in normal lung tissues and lung cancers was determined by immunohistochemically staining with monoclonal antibody (Mab) KGHR-1 which could recognize and broad spectrum reaction with the (K/H/N) ras protein. Then, the isoforms of p21Ras was examined by specific Mab for each p21Ras subtypes. Results: Low expression of total p21Ras was found in 26.67% (8/30) of normal lung tissues, and 81.31% (87/107) of adenocarcinoma harbored overexpressed total p21Ras. Besides, 70.00% (35/50) of squamous cell carcinoma were detected overexpressed total p21Ras. In addition, 122 lung cancer tissues from overexpression of total p21Ras protein were selected to detect the expression of each subtype. And all the 122 lung cancer tissues were K-p21Ras overexpression. Moreover, there was a statistical significance difference between the expression level of total p21Ras and differentiation, and the same results were observed between the expression level of total p21Ras and lymph node metastasis (P0.05). Conclusions: Overexpression of K-p21Ras plays a prominent role in the progress of lung cancer and it is suggested that the p21Ras could serve as a promising treatment target in lung cancer.
International Nuclear Information System (INIS)
Barcelos Neto, J.; Ghosh, S.; Roy, S.
1993-07-01
We consider the even parity superLax operator for the supersymmetric KP hierarchy of the form L = D 2 + Σ ∞ i=0 u i-2 D -i+1 and obtain the two Hamiltonian structures following the standard method of Gelfand and Dikii. We observe that the first Hamiltonian structure is local and linear whereas the second Hamiltonian structure is non-local and nonlinear among the superfields appearing in the Lax operator. We discuss briefly on their connections with the super ω ∞ algebra. (author). 23 refs
Karpasitou, Katerina; Drago, Francesca; Crespiatico, Loretta; Paccapelo, Cinzia; Truglio, Francesca; Frison, Sara; Scalamogna, Mario; Poli, Francesca
2008-03-01
Traditionally, blood group typing has been performed with serologic techniques, the classical method being the hemagglutination test. Serotyping, however, may present important limitations such as scarce availability of rare antisera, typing of recently transfused patients, and those with a positive direct antiglobulin test. Consequently, serologic tests are being complemented with molecular methods. The aim of this study was to develop a low-cost, high-throughput method for large-scale genotyping of red blood cells (RBCs). Single-nucleotide polymorphisms associated with some clinically important blood group antigens, as well as with certain rare blood antigens, were evaluated: Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b). Polymerase chain reaction (PCR)-amplified targets were detected by direct hybridization to microspheres coupled to allele-specific oligonucleotides. Cutoff values for each genotype were established with phenotyped and/or genotyped samples. The method was validated with a blind panel of 92 blood donor samples. The results were fully concordant with those provided by hemagglutination assays and/or sequence-specific primer (SSP)-PCR. The method was subsequently evaluated with approximately 800 blood donor and patient samples. This study presents a flexible, quick, and economical method for complete genotyping of large donor cohorts for RBC alleles.
A note on the dispersionless BKP hierarchy
International Nuclear Information System (INIS)
Chen, Y.-T.; Tu, M.-H.
2006-01-01
We study the integrable hierarchy underlying topological Landau-Ginzburg models of D-type proposed by Takasaki. Since this integrable hierarchy contains the dBKP hierarchy as a sub-hierarchy, we refer it to the extended dBKP (EdBKP) hierarchy. We give a dressing formulation to the EdBKP hierarchy and investigate additional symmetries associated with the solution space of the hierarchy. We obtain hodograph solutions of its finite-dimensional reductions via Riemann-Hilbert problem (twistor construction) and derive Baecklund transformations of the (2 + 1)-dimensional dBKP equation from additional flows. Finally, the modified partner of the dBKP hierarchy is also established through a Miura transformation
Energy conversion through mass loading of escaping ionospheric ions for different Kp values
Directory of Open Access Journals (Sweden)
M. Yamauchi
2018-01-01
Full Text Available By conserving momentum during the mixing of fast solar wind flow and slow planetary ion flow in an inelastic way, mass loading converts kinetic energy to other forms – e.g. first to electrical energy through charge separation and then to thermal energy (randomness through gyromotion of the newly born cold ions for the comet and Mars cases. Here, we consider the Earth's exterior cusp and plasma mantle, where the ionospheric origin escaping ions with finite temperatures are loaded into the decelerated solar wind flow. Due to direct connectivity to the ionosphere through the geomagnetic field, a large part of this electrical energy is consumed to maintain field-aligned currents (FACs toward the ionosphere, in a similar manner as the solar wind-driven ionospheric convection in the open geomagnetic field region. We show that the energy extraction rate by the mass loading of escaping ions (ΔK is sufficient to explain the cusp FACs, and that ΔK depends only on the solar wind velocity accessing the mass-loading region (usw and the total mass flux of the escaping ions into this region (mloadFload, as ΔK ∼ −mloadFloadu2sw∕4. The expected distribution of the separated charges by this process also predicts the observed flowing directions of the cusp FACs for different interplanetary magnetic field (IMF orientations if we include the deflection of the solar wind flow directions in the exterior cusp. Using empirical relations of u0 ∝ Kp + 1.2 and Fload ∝ exp(0.45Kp for Kp = 1–7, where u0 is the solar wind velocity upstream of the bow shock, ΔK becomes a simple function of Kp as log10(ΔK = 0.2 ⋅ Kp + 2 ⋅ log10(Kp + 1.2 + constant. The major contribution of this nearly linear increase is the Fload term, i.e. positive feedback between the increase of ion escaping rate Fload through the increased energy consumption in the ionosphere for high Kp, and subsequent extraction of more kinetic energy
Energy Technology Data Exchange (ETDEWEB)
Gladysiewicz, M.; Wartak, M. S. [Faculty of Fundamental Problems of Technology, Wroclaw University of Technology, Wybrzeze Wyspianskiego 27, 50-370 Wroclaw (Poland); Department of Physics and Computer Science, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); Kudrawiec, R. [Faculty of Fundamental Problems of Technology, Wroclaw University of Technology, Wybrzeze Wyspianskiego 27, 50-370 Wroclaw (Poland)
2015-08-07
The electronic band structure and material gain have been calculated for GaAsBi/GaAs quantum wells (QWs) with various bismuth concentrations (Bi ≤ 15%) within the 8-band and 14-band kp models. The 14-band kp model was obtained by extending the standard 8-band kp Hamiltonian by the valence band anticrossing (VBAC) Hamiltonian, which is widely used to describe Bi-related changes in the electronic band structure of dilute bismides. It has been shown that in the range of low carrier concentrations n < 5 × 10{sup 18 }cm{sup −3}, material gain spectra calculated within 8- and 14-band kp Hamiltonians are similar. It means that the 8-band kp model can be used to calculate material gain in dilute bismides QWs. Therefore, it can be applied to analyze QWs containing new dilute bismides for which the VBAC parameters are unknown. Thus, the energy gap and electron effective mass for Bi-containing materials are used instead of VBAC parameters. The electronic band structure and material gain have been calculated for 8 nm wide GaInAsBi QWs on GaAs and InP substrates with various compositions. In these QWs, Bi concentration was varied from 0% to 5% and indium concentration was tuned in order to keep the same compressive strain (ε = 2%) in QW region. For GaInAsBi/GaAs QW with 5% Bi, gain peak was determined to be at about 1.5 μm. It means that it can be possible to achieve emission at telecommunication windows (i.e., 1.3 μm and 1.55 μm) for GaAs-based lasers containing GaInAsBi/GaAs QWs. For GaInAsBi/Ga{sub 0.47}In{sub 0.53}As/InP QWs with 5% Bi, gain peak is predicted to be at about 4.0 μm, i.e., at the wavelengths that are not available in current InP-based lasers.
International Nuclear Information System (INIS)
Zhao, Zhonglong; Zhang, Yufeng; Han, Zhong; Rui, Wenjuan
2014-01-01
In this paper, the simplest equation method is used to construct exact traveling solutions of the (3+1)-dimensional KP equation and generalized Fisher equation. We summarize the main steps of the simplest equation method. The Bernoulli and Riccati equation are used as simplest equations. This method is straightforward and concise, and it can be applied to other nonlinear partial differential equations
Agababian, N M
1998-01-01
A factorial-moment analysis with real (integer and non-integer) phase space partition is applied to $\\pi^+$p and K$^+$p collisions at 250 GeV/$c$. Clear evidence is shown for self-affine rather than self-similar power-law scaling in multiparticle production. The three-dimensional self-affine second-order scaling exponent is determined to be 0.061$\\pm$0.010.
The KP Hierarchy and Aspects of the Painlevé Property
Strampp, W.; Langer, C.
1990-12-01
We are concerned with the conjecture that the Painlevé property is a necessary condition for the integrability of nonlinear equations. Following a suggestion by lietratures (1) D. V. Chudnovsky, G. V. Chudnovsky and M. Tabor, Phys. Lett. 97A (1983), 268, and 2) A. K. Pogrebkov, Inverse Problems 5 (1989), L7), our investigations will be based on the Lax-pair which we use in Sato's sense (3) E. Date, M. Jimbo, M. Kashiwara and T. Miwa in Nonlinear Integrable Systems-Classical and Quantum Theory, ed. M. Jimbo and T. Miwa (World Scientific, Singapore, 1983), p. 39, 4) M. Jimbo and T. Miwa, Publ. RIMS, Kyoto Univ. 19 (1983), 943, 5) Y. Ohta, J. Satsuma, D. Takahashi and T. Tokihiro, Prog. Theor. Phys. Suppl. No. 94 (1988), 210). Leading orders, branch points and resonances are described for the Zakharov-Shabat equations of the KP-hierarchy. The symbolic manipulation system REDUCE, in particular its factorization algorithm for polynomials, is employed for finding the resonances. It is shown that the Painlevé structures of various nonlinear equations, which have been discussed a lot in the literature, follow from our results.
Whitham modulation theory for (2 + 1)-dimensional equations of Kadomtsev–Petviashvili type
Ablowitz, Mark J.; Biondini, Gino; Rumanov, Igor
2018-05-01
Whitham modulation theory for certain two-dimensional evolution equations of Kadomtsev–Petviashvili (KP) type is presented. Three specific examples are considered in detail: the KP equation, the two-dimensional Benjamin–Ono (2DBO) equation and a modified KP (m2KP) equation. A unified derivation is also provided. In the case of the m2KP equation, the corresponding Whitham modulation system exhibits features different from the other two. The approach presented here does not require integrability of the original evolution equation. Indeed, while the KP equation is known to be a completely integrable equation, the 2DBO equation and the m2KP equation are not known to be integrable. In each of the cases considered, the Whitham modulation system obtained consists of five first-order quasilinear partial differential equations. The Riemann problem (i.e. the analogue of the Gurevich–Pitaevskii problem) for the one-dimensional reduction of the m2KP equation is studied. For the m2KP equation, the system of modulation equations is used to analyze the linear stability of traveling wave solutions.
A compilation of K+p --> K0 DELTA++ cross sections below 2 GeV/c
Giacomelli, G; Piccinini, M; Rimondi, F; Serra-Lugaresi, P
1976-01-01
Data published up to June 1976 on the quasi-two-body reaction K+p --> K0 DELTA++, with DELTA++ -->ppi+, are compiled for laboratory momenta from 0.7 to 2 GeV/c. They include integrated cross-sections, differencial cross-sections, average and differential density matrix elements, as well as coefficients of the Legendre polynomial expensions of the production differential distributions. The data are presented in the form og graphs and computer-produced tables. The method of computation is the same as in a previous report (CERN-HERA-75-1) on K+N cross-sections below2 GeV/c, to which the reader is referred for details on cards formats, notations, etc.
Large self-affine fractality in $\\pi^{+}p$ and $K^{+}p$ collisions at 250 GeV/c
Agababian, N M
1996-01-01
Taking into account the anisotropy of phase space in multiparticle production, a self-affine analysis of factorial moments was carried out on the NA22 data for $\\pi^{+}p$ and $K^{+}p$ collisions at 250 GeV/$c$. Within the transverse plane, the Hurst exponents measuring the anisotropy are consistent with unit value (i.e. no anisotropy). They are, however, only half that value when the longitudinal direction is compared to the transverse ones. Fractality, indeed, turns out to be self-affine rather than self-similar in multiparticle production. In three-dimensional phase space, power-law scaling is observed to be better realized in self-affine than in self-similar analysis.
Robo-AO KP: A new era in robotic adaptive optics
Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy
2016-01-01
Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.
International Nuclear Information System (INIS)
Ablowitz, Mark J; Curtis, Christopher W
2011-01-01
The Benney-Luke equation, which arises as a long wave asymptotic approximation of water waves, contains the Kadomtsev-Petviashvilli (KP) equation as a leading-order maximal balanced approximation. The question analyzed is how the Benney-Luke equation modifies the so-called web solutions of the KP equation. It is found that the Benney-Luke equation introduces dispersive radiation which breaks each of the symmetric soliton-like humps well away from the interaction region of the KP web solution into a tail of multi-peaked oscillating profiles behind the main solitary hump. Computation indicates that the wave structure is modified near the center of the interaction region. Both analytical and numerical techniques are employed for working with non-periodic, non-decaying solutions on unbounded domains.
Ablowitz, Mark J.; Curtis, Christopher W.
2011-05-01
The Benney-Luke equation, which arises as a long wave asymptotic approximation of water waves, contains the Kadomtsev-Petviashvilli (KP) equation as a leading-order maximal balanced approximation. The question analyzed is how the Benney-Luke equation modifies the so-called web solutions of the KP equation. It is found that the Benney-Luke equation introduces dispersive radiation which breaks each of the symmetric soliton-like humps well away from the interaction region of the KP web solution into a tail of multi-peaked oscillating profiles behind the main solitary hump. Computation indicates that the wave structure is modified near the center of the interaction region. Both analytical and numerical techniques are employed for working with non-periodic, non-decaying solutions on unbounded domains.
Institute of Scientific and Technical Information of China (English)
杜殿楼; 杨潇
2012-01-01
A (2+1)-dimensional coupled modified Kadomtsev-Petviashvili (CMKP) equation is proposed, and its decomposition is derived by its Lax pair. Based on the theory of algebraic curve, an algebro-geometric solution of the CMKP equation is obtained.%提出一个(2+1)-维耦合的mKP(CMKP)方程,通过其Lax对,实现了该方程的分解.进一步借助代数曲线理论,给出其代数几何解.
Study of the K-barπ system in the 3 bodies final states, produced by 3 GeV/c K-p interactions
International Nuclear Information System (INIS)
Verglas, A.
1966-01-01
The K - p → K * (891) π reaction is a good example of a quasi two-body phenomenon, exhibiting the characteristics of 'peripherism'. The predictions of the 'one meson exchange', and 'absorption' models are compared with the experimental results. Conclusions are drawn concerning the production mechanism of the Kp → K * π reaction, as well as on the validity of the models. Finally, the K * (1400) resonance is studied and its isospin determined. (author) [fr
Uday, Uma Shankar Prasad; Majumdar, Ria; Tiwari, Onkar Nath; Mishra, Umesh; Mondal, Abhijit; Bandyopadhyay, Tarun Kanti; Bhunia, Biswanath
2017-12-01
In the present work, a potent xylanase producing fungal strain Aspergillus niger (KP874102.1) was isolated through cultural and morphological observations from soil sample of Baramura forest, Tripura west, India. 28S rDNA technique was applied for genomic identification of this fungal strain. The isolated strain was found to be phylogenetically closely related to Aspergillus niger. Kinetic constants such as K m and V max for extracellular xylanase were determined using various substrate such as beech wood xylan, oat spelt xylan and CM cellulose through Lineweaver-Burk plot. K m , V max and K cat for beech wood xylan are found to be 2.89mg/ml, 2442U and 426178Umlmg -1 respectively. Crude enzyme did not show also CM cellulose activity. The relative efficiency of oat spelt xylan was found to be 0.819 with respect to beech wood xylan. After acid hydrolysis, enzyme was able to produce reducing sugar with 17.7, 35.5, 50.8 and 65% (w/w) from orange peel after 15, 30, 45 and 60min incubation with cellulase free xylanase and maximum reducing sugar formation rate was found to be 55.96μg/ml/min. Therefore, the Aspergillus niger (KP874102.1) is considered as a potential candidate for enzymatic hydrolysis of orange peel. Copyright © 2017 Elsevier B.V. All rights reserved.
Kirkpatrick, Christine L.; Parsley, Nicole C.; Bartges, Tessa E.; Cooke, Madeline E.; Evans, Wilaysha S.; Heil, Lilian R.; Smith, Thomas J.; Hicks, Leslie M.
2018-05-01
Fungal secondary metabolites represent a rich and largely untapped source for bioactive molecules, including peptides with substantial structural diversity and pharmacological potential. As methods proceed to take a deep dive into fungal genomes, complimentary methods to identify bioactive components are required to keep pace with the expanding fungal repertoire. We developed PepSAVI-MS to expedite the search for natural product bioactive peptides and herein demonstrate proof-of-principle applicability of the pipeline for the discovery of bioactive peptides from fungal secretomes via identification of the antifungal killer toxin KP4 from Ustilago maydis P4. This work opens the door to investigating microbial secretomes with a new lens, and could have broad applications across human health, agriculture, and food safety. [Figure not available: see fulltext.
Alam, Md Nur; Akbar, M Ali
2013-01-01
The new approach of the generalized (G'/G)-expansion method is an effective and powerful mathematical tool in finding exact traveling wave solutions of nonlinear evolution equations (NLEEs) in science, engineering and mathematical physics. In this article, the new approach of the generalized (G'/G)-expansion method is applied to construct traveling wave solutions of the Kadomtsev-Petviashvili-Benjamin-Bona-Mahony (KP-BBM) equation. The solutions are expressed in terms of the hyperbolic functions, the trigonometric functions and the rational functions. By means of this scheme, we found some new traveling wave solutions of the above mentioned equation.
N = 2 local and N = 4 non-local reductions of supersymmetric KP hierarchy in N = 2 superspace
International Nuclear Information System (INIS)
Delduc, F.; Gallot, L.; Sorin, A.
1999-01-01
An N = 4 supersymmetric matrix KP hierarchy is proposed and a wide class of its reductions which are characterized by a finite number of fields are described. This class includes the one-dimensional reduction of the two-dimensional N = (2,2) superconformal Toda lattice hierarchy possessing the N = 4 supersymmetry -- the N = 4 Toda chain hierarchy - which may be relevant in the construction of supersymmetric matrix models. The Lax-pair representations of the bosonic and fermionic flows, corresponding local and non-local Hamiltonians, finite and infinite discrete symmetries, the first two Hamiltonian structures and the recursion operator connecting all evolution equations and the Hamiltonian structures of the N = 4 Toda chain hierarchy are constructed in explicit form. Is secondary reduction to the N 4 supersymmetric α = - 2 KdV hierarchy is
Kuhn, Paul-Steffen
2014-10-20
A one-electron reduction of osmium(IV) complexes trans-[OsIVCl4(Hazole)2], where Hazole = 1H-pyrazole ([1]0), 2H-indazole ([2]0), 1H-imidazole ([3]0), and 1H-benzimidazole ([4]0), afforded a series of eight new complexes as osmium analogues of KP1019, a lead anticancer drug in clinical trials, with the general formula (cation)[trans-OsIIICl4(Hazole)2], where cation = H2pz+ (H2pz[1]), H2ind+ (H2ind[2]), H2im+ (H2im[3]), Ph4P+ (Ph4P[3]), nBu4N+ (nBu4N[3]), H2bzim+ (H2bzim[4]), Ph4P+ (Ph4P[4]), and nBu4N+ (nBu4N[4]). All complexes were characterized by elemental analysis, 1H NMR spectroscopy, electrospray ionization mass spectrometry, UV-vis spectroscopy, cyclic voltammetry, while H2pz[1], H2ind[2], and nBu4[3], in addition, by X-ray diffraction. The reduced species [1]- and [4]- are stable in aqueous media in the absence of air oxygen and do not react with small biomolecules such as amino acids and the nucleotide 5′-dGMP. Cell culture experiments in five different human cancer cell lines (HeLa, A549, FemX, MDA-MB-453, and LS-174) and one noncancerous cell line (MRC-5) were performed, and the results were discussed and compared to those for KP1019 and cisplatin. Benzannulation in complexes with similar structure enhances antitumor activity by several orders of magnitude, implicating different mechanisms of action of the tested compounds. In particular, complexes H2ind[2] and H2bzim[4] exhibited significant antiproliferative activity in vitro when compared to H2pz[1] and H2im[3]. (Chemical Equation Presented).
Kuhn, Paul-Steffen; Büchel, Gabriel E; Jovanović, Katarina K; Filipović, Lana; Radulović, Siniša; Rapta, Peter; Arion, Vladimir B
2014-10-20
A one-electron reduction of osmium(IV) complexes trans-[Os(IV)Cl4(Hazole)2], where Hazole = 1H-pyrazole ([1](0)), 2H-indazole ([2](0)), 1H-imidazole ([3](0)), and 1H-benzimidazole ([4](0)), afforded a series of eight new complexes as osmium analogues of KP1019, a lead anticancer drug in clinical trials, with the general formula (cation)[trans-Os(III)Cl4(Hazole)2], where cation = H2pz(+) (H2pz[1]), H2ind(+) (H2ind[2]), H2im(+) (H2im[3]), Ph4P(+) (Ph4P[3]), nBu4N(+) (nBu4N[3]), H2bzim(+) (H2bzim[4]), Ph4P(+) (Ph4P[4]), and nBu4N(+) (nBu4N[4]). All complexes were characterized by elemental analysis, (1)H NMR spectroscopy, electrospray ionization mass spectrometry, UV-vis spectroscopy, cyclic voltammetry, while H2pz[1], H2ind[2], and nBu4[3], in addition, by X-ray diffraction. The reduced species [1](-) and [4](-) are stable in aqueous media in the absence of air oxygen and do not react with small biomolecules such as amino acids and the nucleotide 5'-dGMP. Cell culture experiments in five different human cancer cell lines (HeLa, A549, FemX, MDA-MB-453, and LS-174) and one noncancerous cell line (MRC-5) were performed, and the results were discussed and compared to those for KP1019 and cisplatin. Benzannulation in complexes with similar structure enhances antitumor activity by several orders of magnitude, implicating different mechanisms of action of the tested compounds. In particular, complexes H2ind[2] and H2bzim[4] exhibited significant antiproliferative activity in vitro when compared to H2pz[1] and H2im[3].
Kuhn, Paul-Steffen; Bü chel, Gabriel E.; Jovanović, Katarina K.; Filipović, Lana; Radulović, Siniša S.; Rapta, Peter; Arion, Vladimir B.
2014-01-01
A one-electron reduction of osmium(IV) complexes trans-[OsIVCl4(Hazole)2], where Hazole = 1H-pyrazole ([1]0), 2H-indazole ([2]0), 1H-imidazole ([3]0), and 1H-benzimidazole ([4]0), afforded a series of eight new complexes as osmium analogues of KP1019, a lead anticancer drug in clinical trials, with the general formula (cation)[trans-OsIIICl4(Hazole)2], where cation = H2pz+ (H2pz[1]), H2ind+ (H2ind[2]), H2im+ (H2im[3]), Ph4P+ (Ph4P[3]), nBu4N+ (nBu4N[3]), H2bzim+ (H2bzim[4]), Ph4P+ (Ph4P[4]), and nBu4N+ (nBu4N[4]). All complexes were characterized by elemental analysis, 1H NMR spectroscopy, electrospray ionization mass spectrometry, UV-vis spectroscopy, cyclic voltammetry, while H2pz[1], H2ind[2], and nBu4[3], in addition, by X-ray diffraction. The reduced species [1]- and [4]- are stable in aqueous media in the absence of air oxygen and do not react with small biomolecules such as amino acids and the nucleotide 5′-dGMP. Cell culture experiments in five different human cancer cell lines (HeLa, A549, FemX, MDA-MB-453, and LS-174) and one noncancerous cell line (MRC-5) were performed, and the results were discussed and compared to those for KP1019 and cisplatin. Benzannulation in complexes with similar structure enhances antitumor activity by several orders of magnitude, implicating different mechanisms of action of the tested compounds. In particular, complexes H2ind[2] and H2bzim[4] exhibited significant antiproliferative activity in vitro when compared to H2pz[1] and H2im[3]. (Chemical Equation Presented).
Energy Technology Data Exchange (ETDEWEB)
Thorneley, R.N.F.; Ashby, G.A.; Drummond, M.H.; Eady, R.R.; Huff, S.; Macdonald, C.J. (Univ. of Sussex, Brighton (United Kingdom)); Abell, C.; Schneier, A. (Univ. Chemical Lab., Cambridge (United Kingdom))
1992-02-04
A strain of Escherichia coli (71-18) that produces ca. 15% of its soluble cytoplasmic protein as a flavodoxin, the Klebsiella pneumoniae nifF gene product, has been constructed. The flavodoxin was purified using FPLC and resolved into two forms, designated KpFldI and KpFldII, which were shown to have identical N-terminal amino acid sequences (30 residues) in agreement with that predicted by the K. pneumoniae nifF DNA sequence. {sup 31}P NMR, electrospray mass spectrometry, UV-visible spectra, and thiol group estimations showed that the single cysteine residue (position 68) of KpFldI is posttranslationally modified in KpFldII by the covalent, mixed disulfide, attachment of coenzyme A. KpFldII was inactive as an electron carrier between the K. pneumoniae nifJ product (a pyruvate-flavodoxin oxidoreductase) and K. pneumoniae nifH product (the Fe-protein of nitrogenase). This novel posttranslational modification of a flavodoxin is discussed in terms of the regulation of nitrogenase activity in vivo in response to the level of dissolved O{sub 2} and the carbon status of diazotrophic cultures.
Directory of Open Access Journals (Sweden)
Mukesh Kumar
2015-09-01
Full Text Available A novel tannase producing bacterial strain was isolated from rhizospheric soil of Acacia species and identified as Klebsiella pneumoniae KP715242. A 3.25-fold increase in tannase production was achieved upon optimization with central composite design using response surface methodology. Four variables namely pH, temperature, incubation period, and agitation speed were used to optimize significant correlation between the effects of these variables on tannase production. A second-order polynomial was fitted to data and validated by ANOVA. The results showed a complex relationship between variables and response given that all factors were significant and could explain 99.6% of the total variation. The maximum production was obtained at 5.2 pH, 34.97 °C temperature, 103.34 rpm agitation speed and 91.34 h of incubation time. The experimental values were in good agreement with the predicted ones and the models were highly significant with a correlation coefficient (R2 of 0.99 and a highly significant F-value of 319.37.
Directory of Open Access Journals (Sweden)
Topouchian J
2014-01-01
Full Text Available Jirar Topouchian,1 Davide Agnoletti,1 Jacques Blacher,1 Ahmed Youssef,1 Mirna N Chahine,2,3 Isabel Ibanez,3 Nathalie Assemani,3 Roland Asmar1–31Centre de Diagnostic, Hôpital Hôtel-Dieu, Paris, France; 2Faculty of Medicine of the Lebanese University, 3Foundation-Medical Research Institutes, Beirut, LebanonBackground: Four oscillometric devices, including the Omron M6 Comfort, Omron HEM-7420, Withings BP-800, and Polygreen KP-7670, designed for self-blood pressure measurement (SBPM were evaluated according to the European Society of Hypertension (ESH International Protocol Revision 2010 in four separate studies.Methods: The four devices measure brachial blood pressure (BP using the oscillometric method. The Withings BP-800 has to be connected to an Apple® iOS device such as an iPhone®, iPad®, or iPod®. The ESH International Protocol Revision 2010 includes a total number of 33 subjects. The difference between observer and device BP values was calculated for each measure. Ninety-nine pairs of BP differences were classified into three categories (≤5 mmHg, ≤10 mmHg, ≤15 mmHg. The protocol procedures were followed precisely in each of the four studies.Results: All four tested devices passed the validation process. The mean differences between the device and mercury readings were: −1.8±5.1 mmHg and −0.4±2.8 mmHg for systolic and diastolic BP, respectively, using the Omron M6 Comfort device; 2.5±4.6 mmHg and −1.2±4.3 mmHg for the Omron HEM-7420 device; −0.2±5.0 mmHg and 0.4±4.2 mmHg for the Withings BP-800 device; and 3.0±5.3 mmHg and 0.3±5.2 mmHg for the Polygreen KP-7670 device.Conclusion: Omron M6 Comfort, Omron HEM-7420, Withings BP-800, and Polygreen KP-7670 readings differing by less than 5 mmHg, 10 mmHg, and 15 mmHg fulfill the ESH International Protocol Revision 2010 requirements, and therefore are suitable for use by patients for SBPM, if used correctly.Keywords: Omron M6 Comfort, Omron HEM-7420, Withings BP-800
Topouchian, Jirar; Agnoletti, Davide; Blacher, Jacques; Youssef, Ahmed; Chahine, Mirna N; Ibanez, Isabel; Assemani, Nathalie; Asmar, Roland
2014-01-01
Four oscillometric devices, including the Omron M6 Comfort, Omron HEM-7420, Withings BP-800, and Polygreen KP-7670, designed for self-blood pressure measurement (SBPM) were evaluated according to the European Society of Hypertension (ESH) International Protocol Revision 2010 in four separate studies. The four devices measure brachial blood pressure (BP) using the oscillometric method. The Withings BP-800 has to be connected to an Apple® iOS device such as an iPhone®, iPad®, or iPod®. The ESH International Protocol Revision 2010 includes a total number of 33 subjects. The difference between observer and device BP values was calculated for each measure. Ninety-nine pairs of BP differences were classified into three categories (≤5 mmHg, ≤10 mmHg, ≤15 mmHg). The protocol procedures were followed precisely in each of the four studies. All four tested devices passed the validation process. The mean differences between the device and mercury readings were: -1.8±5.1 mmHg and -0.4±2.8 mmHg for systolic and diastolic BP, respectively, using the Omron M6 Comfort device; 2.5±4.6 mmHg and -1.2±4.3 mmHg for the Omron HEM-7420 device; -0.2±5.0 mmHg and 0.4±4.2 mmHg for the Withings BP-800 device; and 3.0±5.3 mmHg and 0.3±5.2 mmHg for the Polygreen KP-7670 device. Omron M6 Comfort, Omron HEM-7420, Withings BP-800, and Polygreen KP-7670 readings differing by less than 5 mmHg, 10 mmHg, and 15 mmHg fulfill the ESH International Protocol Revision 2010 requirements, and therefore are suitable for use by patients for SBPM, if used correctly.
El-Hersh, Mohammed S; Saber, WesamEldin I A; El-Fadaly, Husain A; Mahmoud, Mohammed K
Amino acids are important for living organisms, they acting as crucial for metabolic activities and energy generation, wherein the deficiency in these amino acids cause various physiological defects. The aim of this study is to investigate the effect of some nutritional factors on the amino acids production by Mucor mucedo KP736529 during fermentation intervals. Mucor mucedo KP736529 was selected according to proteolytic activity. Corn steep liquor and olive cake were used in the fermented medium during Placket-Burman and central composite design to maximize the production of lysine and glutamic acids. During the screening by Plackett-Burman design, olive cake and Corn Steep Liquor (CSL) had potential importance for the higher production of amino acids. The individual fractionation of total amino acids showed both lysine and glutamic as the major amino acids associated with the fermentation process. Moreover, the Central Composite Design (CCD) has been adopted to explain the interaction between olive cake and CSL on the production of lysine and glutamic acids. The model recorded significant F-value, with high values of R 2, adjusted R 2 and predicted R 2 for both lysine and glutamic, indicating the validity of the data. Solving equation for maximum production of lysine recorded theoretical levels of olive cake and CSL, being 2.58 and 1.83 g L -1, respectively, with predicting value of lysine at 1.470 μg mL -1, whereas the predicting value of glutamic acid reached 0.805 mg mL -1 at levels of 2.49 and 1.93 g L -1 from olive cake and CSL, respectively. The desirability function (D) showed the actual responses being 1.473±0.009 and 0.801±0.004 μg mL -1 for lysine and glutamic acids, respectively. The model showed adequate validity to be applied in a large-scale production of both lysine and glutamic acids.
Gwon, Hyeon-Cheol; Jeon, Dong Woon; Kang, Hyun-Jae; Jang, Jae-Sik; Park, Duk-Woo; Shin, Dong-Ho; Moon, Keon-Woong; Kim, Jung-Sun; Kim, Juhan; Bae, Jang-Whan; Hur, Seung-Ho; Kim, Byung Ok; Choi, Donghoon; Han, Kyoo-Rok; Kim, Hyo-Soo
2017-05-01
Appropriate use criteria (AUC) was developed to improve the quality of percutaneous coronary intervention (PCI). However, these criteria should consider the current practice pattern in the country where they are being applied. The algorithm for the Korean PCI practice pattern (KP3) was developed by modifying the United States-derived AUC in expert consensus meetings. KP3 class A was defined as any strategy with evidence from randomized trials that was more conservative for PCI than medical therapy or coronary artery bypass graft (CABG). Class C was defined as any strategy with less evidence from randomized trials and more aggressive for PCI than medical therapy or CABG. Class B was defined as a strategy that was partly class A and partly class C. We applied the KP3 classification system to the Korean PCI registry. The KP3 class A was noted in 67.7% of patients, class B in 28.8%, and class C in 3.5%. The median proportion of class C cases per center was 2.0%. The distribution of KP3 classes varied significantly depending on clinical and angiographic characteristics. The proportion of KP3 class C cases per center was not significantly dependent on PCI volume, but rather on the percentage of ACS cases in each center. We report the current PCI practice pattern by applying the new KP3 classification in a nationwide PCI registry. The results should be interpreted carefully with due regard for the complex relationships between the determining variables and the healthcare system in Korea.
Destrade, M.
2010-12-08
We study the propagation of two-dimensional finite-amplitude shear waves in a nonlinear pre-strained incompressible solid, and derive several asymptotic amplitude equations in a simple, consistent and rigorous manner. The scalar Zabolotskaya (Z) equation is shown to be the asymptotic limit of the equations of motion for all elastic generalized neo-Hookean solids (with strain energy depending only on the first principal invariant of Cauchy-Green strain). However, we show that the Z equation cannot be a scalar equation for the propagation of two-dimensional shear waves in general elastic materials (with strain energy depending on the first and second principal invariants of strain). Then, we introduce dispersive and dissipative terms to deduce the scalar Kadomtsev-Petviashvili (KP), Zabolotskaya-Khokhlov (ZK) and Khokhlov- Zabolotskaya-Kuznetsov (KZK) equations of incompressible solid mechanics. © 2010 The Royal Society.
Destrade, M.; Goriely, A.; Saccomandi, G.
2010-01-01
We study the propagation of two-dimensional finite-amplitude shear waves in a nonlinear pre-strained incompressible solid, and derive several asymptotic amplitude equations in a simple, consistent and rigorous manner. The scalar Zabolotskaya (Z) equation is shown to be the asymptotic limit of the equations of motion for all elastic generalized neo-Hookean solids (with strain energy depending only on the first principal invariant of Cauchy-Green strain). However, we show that the Z equation cannot be a scalar equation for the propagation of two-dimensional shear waves in general elastic materials (with strain energy depending on the first and second principal invariants of strain). Then, we introduce dispersive and dissipative terms to deduce the scalar Kadomtsev-Petviashvili (KP), Zabolotskaya-Khokhlov (ZK) and Khokhlov- Zabolotskaya-Kuznetsov (KZK) equations of incompressible solid mechanics. © 2010 The Royal Society.
The Cauchy problem for the Pavlov equation
International Nuclear Information System (INIS)
Grinevich, P G; Santini, P M; Wu, D
2015-01-01
Commutation of multidimensional vector fields leads to integrable nonlinear dispersionless PDEs that arise in various problems of mathematical physics and have been intensively studied in recent literature. This report aims to solve the scattering and inverse scattering problem for integrable dispersionless PDEs, recently introduced just at a formal level, concentrating on the prototypical example of the Pavlov equation, and to justify an existence theorem for global bounded solutions of the associated Cauchy problem with small data. (paper)
Nurhuda, Maryam; Aziz Majidi, Muhammad
2018-04-01
The role of excitons in semiconducting materials carries potential applications. Experimental results show that excitonic signals also appear in optical absorption spectra of semiconductor system with narrow gap, such as Gallium Arsenide (GaAs). While on the theoretical side, calculation of optical spectra based purely on Density Functional Theory (DFT) without taking electron-hole (e-h) interactions into account does not lead to the appearance of any excitonic signal. Meanwhile, existing DFT-based algorithms that include a full vertex correction through Bethe-Salpeter equation may reveal an excitonic signal, but the algorithm has not provided a way to analyze the excitonic signal further. Motivated to provide a way to isolate the excitonic effect in the optical response theoretically, we develop a method of calculation for the optical conductivity of a narrow band-gap semiconductor GaAs within the 8-band k.p model that includes electron-hole interactions through first-order electron-hole vertex correction. Our calculation confirms that the first-order e-h vertex correction reveals excitonic signal around 1.5 eV (the band gap edge), consistent with the experimental data.
Energy Technology Data Exchange (ETDEWEB)
Sivakumar, B.; Mohan, R. [Preidency College, Bangalore (India); Raj, S. Gokul [RR and Dr. SR Technical Univ., Avadi (India); Kumar, G. Ramesh [Anna Univ., Arni (India)
2012-11-15
Single crystals of lithium potassium phthalate (LiKP) were successfully grown from aqueous solution by solvent evaporation technique. The grown crystals were characterized by single crystal X-ray diffraction. The lithium potassium phthalate C{sub 16} H{sub 12} K Li{sub 3} O{sub 11} belongs to triclinic system with the following unit-cell dimensions at 298(2) K; a = 7.405(5) A; b = 9.878(5) A; c = 13.396(5) A; α = 71.778(5) .deg.; β = 87.300(5) .deg.; γ = 85.405(5) .deg.; having a space group P1. Mass spectrometric analysis provides the molecular weight of the compound and possible ways of fragmentations occurs in the compound. Thermal stability of the crystal was also studied by both simultaneous TGA/DTA analyses. The UV-Vis-NIR spectrum shows a good transparency in the whole of Visible and as well as in the near IR range. Third order nonlinear optical studies have also been studied by Z-scan technique. Nonlinear absorption and nonlinear refractive index were found out and the third order bulk susceptibility of compound was also estimated.
On Tuning PI Controllers for Integrating Plus Time Delay Systems
Directory of Open Access Journals (Sweden)
David Di Ruscio
2010-10-01
Full Text Available Some analytical results concerning PI controller tuning based on integrator plus time delay models are worked out and presented. A method for obtaining PI controller parameters, Kp=alpha/(k*tau, and, Ti=beta*tau, which ensures a given prescribed maximum time delay error, dtau_max, to time delay, tau, ratio parameter delta=dau_max/tau, is presented. The corner stone in this method, is a method product parameter, c=alpha*beta. Analytical relations between the PI controller parameters, Ti, and, Kp, and the time delay error parameter, delta, is presented, and we propose the setting, beta=c/a*(delta+1, and, alpha=a/(delta+1, which gives, Ti=c/a*(delta+1*tau, and Kp=a/((delta+1*k*tau, where the parameter, a, is constant in the method product parameter, c=alpha*beta. It also turns out that the integral time, Ti, is linear in, delta, and the proportional gain, Kp, inversely proportional to, delta+1. For the original Ziegler Nichols (ZN method this parameter is approximately, c=2.38, and the presented method may e.g., be used to obtain new modified ZN parameters with increased robustness margins, also documented in the paper.
Directory of Open Access Journals (Sweden)
Herbert Ugrinowitsch
2011-03-01
Full Text Available Este estudo teve como objetivo investigar os efeitos de duas faixas de amplitude de Conhecimento de Performance (CP na aprendizagem do saque tipo tênis do voleibol. Essa questão foi testada com uma faixa de amplitude estreita e uma ampla e mais um grupo controle. O estudo foi composto por um pré-teste, fase de aquisição e teste de retenção. Foram analisadas medidas de desempenho e dos componentes do padrão da habilidade. Apesar dos grupos mostrarem desempenho semelhante no teste de retenção, a faixa ampla foi a única que levou a melhora do desempenho. Além disso, a faixa ampla conduziu a mais mudanças no padrão da habilidade do que a faixa estreita ou o grupo controle.This study aimed to investigate two bandwidth Knowledge of Performance (KP effects on the learning of the volleyball tennis serve. This question was tested with a thin and wide bandwidth KP plus a control group. The study was composed by a pre test, acquisition phase and retention test. It was analyzed performance and components of the motor pattern measures. Although the groups showed similar performance on retention test, only wide bandwidth conducted to a better performance. Although all groups showed similar performance during retention test only the wide bandwidth conducted to performance improvement. Moreover, the wide bandwidth conducted to more changes in movement pattern than thin bandwidth or control group.
International Nuclear Information System (INIS)
Tutiya, Y.; Satsuma, J.
2003-01-01
In this Letter, we present a new hierarchy which includes the intermediate long wave (ILW) equation at the lowest order. This hierarchy is thought to be a novel reduction of the 1st modified KP type hierarchy. The framework of our investigation is Sato theory
Xiao, Zi-Jian; Tian, Bo; Sun, Yan
2018-01-01
In this paper, we investigate a (2+1)-dimensional variable-coefficient modified Kadomtsev-Petviashvili (mKP) equation in fluid dynamics. With the binary Bell-polynomial and an auxiliary function, bilinear forms for the equation are constructed. Based on the bilinear forms, multi-soliton solutions and Bell-polynomial-type Bäcklund transformation for such an equation are obtained through the symbolic computation. Soliton interactions are presented. Based on the graphic analysis, Parametric conditions for the existence of the shock waves, elevation solitons and depression solitons are given, and it is shown that under the condition of keeping the wave vectors invariable, the change of α(t) and β(t) can lead to the change of the solitonic velocities, but the shape of each soliton remains unchanged, where α(t) and β(t) are the variable coefficients in the equation. Oblique elastic interactions can exist between the (i) two shock waves, (ii) two elevation solitons, and (iii) elevation and depression solitons. However, oblique interactions between (i) shock waves and elevation solitons, (ii) shock waves and depression solitons are inelastic.
Sferruzzi-Perri, Amanda N.; López-Tello, Jorge; Fowden, Abigail L.; Constancia, Miguel
2016-01-01
Pregnancy success and life-long health depend on a cooperative interaction between the mother and the fetus in the allocation of resources. As the site of materno-fetal nutrient transfer, the placenta is central to this interplay; however, the relative importance of the maternal versus fetal genotypes in modifying the allocation of resources to the fetus is unknown. Using genetic inactivation of the growth and metabolism regulator, Pik3ca (encoding PIK3CA also known as p110α, α/+), we examined the interplay between the maternal genome and the fetal genome on placental phenotype in litters of mixed genotype generated through reciprocal crosses of WT and α/+ mice. We demonstrate that placental growth and structure were impaired and associated with reduced growth of α/+ fetuses. Despite its defective development, the α/+ placenta adapted functionally to increase the supply of maternal glucose and amino acid to the fetus. The specific nature of these changes, however, depended on whether the mother was α/+ or WT and related to alterations in endocrine and metabolic profile induced by maternal p110α deficiency. Our findings thus show that the maternal genotype and environment programs placental growth and function and identify the placenta as critical in integrating both intrinsic and extrinsic signals governing materno-fetal resource allocation. PMID:27621448
International Nuclear Information System (INIS)
Kokkoris, M.; Tsaris, A.; Misaelides, P.; Sokaras, D.; Lagoyannis, A.; Harissopulos, S.; Vlastou, R.; Papadopoulos, C.T.
2010-01-01
In the present work, new, differential cross-section values are presented for the nat K(p, p 0 ) reaction in the energy range E lab = 3000-5000 keV (with an energy step of 25 keV) and for detector angles between 140 o and 170 o (with an angular step of 10 o ). A qualitative discussion of the observed cross-section variations through the influence of strong, closely spaced resonances in the p + 39 K system is also presented. Information has also been extracted concerning the 39 K(p,α 0 ) reaction for E lab = 4000-5000 keV in the same angular range. As a result, more than ∼500 data points will soon be available to the scientific community through IBANDL (Ion Beam Analysis Nuclear Data Library - (http://www-nds.iaea.org/ibandl/)) and could thus be incorporated in widely used IBA algorithms (e.g. SIMNRA, WINDF, etc.) for potassium depth profiling at relatively high proton beam energies.
The Cauchy problem for the Pavlov equation
Grinevich, P. G.; Santini, P. M.; Wu, D.
2015-10-01
Commutation of multidimensional vector fields leads to integrable nonlinear dispersionless PDEs that arise in various problems of mathematical physics and have been intensively studied in recent literature. This report aims to solve the scattering and inverse scattering problem for integrable dispersionless PDEs, recently introduced just at a formal level, concentrating on the prototypical example of the Pavlov equation, and to justify an existence theorem for global bounded solutions of the associated Cauchy problem with small data. An essential part of this work was made during the visit of the three authors to the Centro Internacional de Ciencias in Cuernavaca, Mexico in November-December 2012.
Modernizing the 5G 100/8 piston compressor by means of directly streaming valves
Energy Technology Data Exchange (ETDEWEB)
Tsvetanov, Ts.; Stoyanov, I.
1988-02-01
Deals with 5G 100/8 air compressors which, despite long service and lack of spare parts, are still widely used in Bulgarian underground coal mines. K-4-10 ring-type valves are in particularly short supply; maintenance engineers have been forced to modify the compresors. Initially, Bulgarian KP-3.1 valves with direct air streaming replaced the K-4-10; these were later replaced by PIK-220 and PIK-220A valves. Tests on overhauled compressors have shown that replacing the KP-3.1 with the PIK-220 or PIK-220A can result in a saving of up to 100,000 kWh of electricity per compressor. Details of reconstruction and testing of piston compressors are included. 10 refs.
Guzzo, T; Mandaliti, W; Nepravishta, R; Aramini, A; Bodo, E; Daidone, I; Allegretti, M; Topai, A; Paci, M
2016-10-11
Inclusion of drugs in cyclodextrins (CDs) is a recognized tool for modifying several properties such as solubility, stability, bioavailability, and so on. The photoreactive behavior of the β-CD/ketoprofen (KP) complex upon UV exposure showed a significant increase in photodecarboxylation, whereas the secondary degradation products by hydroxylation of the benzophenone moiety were inhibited. The results may account for an improvement of KP photophysical properties upon inclusion, thus better fostering its topical use. To correlate the structural details of the inclusion with these results, an NMR spectroscopic study of KP upon inclusion in β-CD was performed. Effects of the magnetically anisotropic centers of KP, changing their orientations upon inclusion and giving chemical shift variations, were specifically correlated with the results of the molecular dynamic simulations and ab initio calculations. In the large variety of papers focusing on the structural analysis of β-CD complexes, this work represents one of the few examples in which a detailed analysis of these simultaneous upfield-downfield NMR shifts of the same aromatic molecule upon inclusion is reported. Interestingly, the results demonstrate that the observed upfield and downfield shifts upon inclusion are not related to any direct magnetic role of β-CD. The conformational change of KP upon the inclusion process consists of a slight reduction in the angle between the two phenyl rings and in a remarkable reduction in the mobility of the carboxyl group, the latter being one of the main contributions to the NMR resonance shifts. These structural details help in understanding the features of the inclusion complex and, eventually, the driving force for its formation.
Dispersionless wave packets in Dirac materials
Czech Academy of Sciences Publication Activity Database
Jakubský, Vít; Tušek, M.
2017-01-01
Roč. 378, MAR (2017), s. 171-182 ISSN 0003-4916 R&D Projects: GA ČR(CZ) GJ15-07674Y; GA ČR GA17-01706S Institutional support: RVO:61389005 Keywords : quantum systems * wave packets * dispersion * dirac materials Subject RIV: BE - Theoretical Physics OBOR OECD: Atomic, molecular and chemical physics ( physics of atoms and molecules including collision, interaction with radiation, magnetic resonances, Mössbauer effect) Impact factor: 2.465, year: 2016
Symmetries and casimir of an extended classical long wave system
Indian Academy of Sciences (India)
Keywords. Dispersionless equations; symmetries; casimir; conserved quantities. ... Application of Lie symmetry analysis to integro-differential equations or infinite systems ..... The financial support in the form of Senior Research Fellowship.
Tuning of graphene nanoribbon Landau levels by a nanotube
International Nuclear Information System (INIS)
Li, T S; Chang, S C; Lin, M F
2009-01-01
We investigate theoretically the effects of a nanotube on the graphene nanoribbon Landau level spectrum utilizing the tight-binding model. The addition of a nanotube changes the original dispersionless Landau subbands into distorted parabolic ones, creates additional band-edge states, and modifies the subband spacings. Moreover, the dispersion relations rely sensitively on the nanotube location. The nanotube-ribbon couplings disrupt the Landau wavefunctions and lift their spatial symmetry, which will change the selection rule of optical transitions. The numbers, frequencies and heights of the density of states (DOS) peaks are found to be strongly dependent on the magnetic flux density and the nanotube location. The evolution of the DOS peak with the magnetic flux density is explored. The graphene nanoribbon Landau levels are shown to be modified in an unexpected fashion by the nanotube-ribbon interactions. These predictions can be validated by measuring the spectra of scanning tunneling experiments or magneto-optical experiments, and they are most observable by placing the nanotube at the electron wavefunction localization sites.
2013-07-03
... forwarded to the Office of Management and Budget (OMB) for review and approval. The nature of the... the U.S. Merchant Marine Academy. Form Numbers: KP2-66-DK1, KP2-67-DK2, KP3-68-DK3, KP2-69-ENG1, KP2- 70-ENG2, KP2-71-ENG3. Abstract: 46 U.S.C. 51309 authorizes the Academy to confer academic degrees. To...
Urrea, D A; Carranza, J C; Cuba, C A Cuba; Gurgel-Gonçalves, R; Guhl, F; Schofield, C J; Triana, O; Vallejo, G A
2005-03-01
We present data on the molecular characterisation of strains of Trypanosoma rangeli isolated from naturally infected Rhodnius ecuadoriensis in Peru, from Rhodnius colombiensis, Rhodnius pallescens and Rhodnius prolixus in Colombia, and from Rhodnius pallescens in Panama. Strain characterisation involved a duplex PCR with S35/S36/KP1L primers. Mini-exon gene analysis was also carried out using TrINT-1/TrINT-2 oligonucleotides. kDNA and mini-exon amplification indicated dimorphism within both DNA sequences: (i) KP1, KP2 and KP3 or (ii) KP2 and KP3 products for kDNA, and 380 bp or 340 bp products for the mini-exon. All T. rangeli strains isolated from R. prolixus presented KP1, KP2 and KP3 products with the 340 bp mini-exon product. By contrast, all T. rangeli strains isolated from R. ecuadoriensis, R. pallescens and R. colombiensis, presented profiles with KP2 and KP3 kDNA products and the 380 bp mini-exon product. Combined with other studies, these results provide evidence of co-evolution of T. rangeli strains associated with different Rhodnius species groups east and west of the Andean mountains.
Marquez, D S; Ramírez, L E; Moreno, J; Pedrosa, A L; Lages-Silva, E
2007-09-01
This study presents the first genetic characterization of five Trypanosoma rangeli isolates from Minas Gerais, in the southeast of Brazil and their comparison with Colombian populations by minicircle classification, RAPD-PCR and LSSP-PCR analyses. Our results demonstrated a homogenous T. rangeli population circulating among Didelphis albiventris as reservoir host in Brazil while heterogeneous populations were found in different regions of Colombia. KP1(+) minicircles were found in 100% isolates from Brazil and in 36.4% of the Colombian samples, whereas the KP2 and KP3 minicircles were detected in both groups. RAPD-PCR and LSSP-PCR profiles revealed a polymorphism within KP1(+) and KP1(-) T. rangeli populations and allowed the division of T. rangeli in two branches. The Brazilian KP1(+) isolates were more homogenous than the KP1(+) isolates from Colombia. The RAPD-PCR were entirely consistent with the distribution of KP1 minicircles while those obtained by LSSP-PCR were associated in 88.9% and 71.4% with KP1(+) and KP1(-) populations, respectively.
Conway, Devon S; Thompson, Nicolas R; Cohen, Jeffrey A
2016-09-01
The appropriate treatment target in multiple sclerosis (MS) is unclear. Lack of magnetic resonance imaging (MRI) lesion activity, a component of the no evidence of disease activity concept, has been proposed as a treatment target in MS. We used our MS database to investigate whether aggressively pursuing MRI stability by changing disease modifying therapy (DMT) when MRI activity is observed leads to better clinical and imaging outcomes. The Knowledge Program (KP) is a database linked to our electronic medical record allowing capture of patient and clinician reported outcomes. Through KP query and chart review, we identified all relapsing-remitting MS patients visiting between 1 January 2008 and 31 December 2014 with active MRIs despite DMT. Propensity modeling based on demographic and disease characteristics was used to match DMT switchers to non-switchers. KP and MRI outcomes were compared 18 months after the active MRI using mixed-effects linear regression models. We identified 417 patients who met criteria for our analysis. After propensity matching, 78 switchers and 91 non-switchers were analyzed. There was no difference in clinical or radiologic outcomes between these groups at 18 months. We did not find a short-term benefit of changing DMT to pursue MRI stability. Copyright © 2016 Elsevier B.V. All rights reserved.
Kaempferia parviflora Extract Exhibits Anti-cancer Activity against HeLa Cervical Cancer Cells.
Potikanond, Saranyapin; Sookkhee, Siriwoot; Na Takuathung, Mingkwan; Mungkornasawakul, Pitchaya; Wikan, Nitwara; Smith, Duncan R; Nimlamool, Wutigri
2017-01-01
Kaempferia parviflora (KP) has been traditionally used as a folk remedy to treat several diseases including cancer, and several studies have reported cytotoxic activities of extracts of KP against a number of different cancer cell lines. However, many aspects of the molecular mechanism of action of KP remain unclear. In particular, the ability of KP to regulate cancer cell growth and survival signaling is still largely unexplored. The current study aimed to investigate the effects of KP on cell viability, cell migration, cell invasion, cell apoptosis, and on signaling pathways related to growth and survival of cervical cancer cells, HeLa. We discovered that KP reduced HeLa cell viability in a concentration-dependent manner. The potent cytotoxicity of KP against HeLa cells was associated with a dose-dependent induction of apoptotic cell death as determined by flow cytometry and observation of nuclear fragmentation. Moreover, KP-induced cell apoptosis was likely to be mediated through the intrinsic apoptosis pathway since caspase 9 and caspase 7, but not BID, were shown to be activated after KP exposure. Based on the observation that KP induced apoptosis in HeLa cell, we further investigated the effects of KP at non-cytotoxic concentrations on suppressing signal transduction pathways relevant to cell growth and survival. We found that KP suppressed the MAPK and PI3K/AKT signaling pathways in cells activated with EGF, as observed by a significant decrease in phosphorylation of ERK1/2, Elk1, PI3K, and AKT. The data suggest that KP interferes with the growth and survival of HeLa cells. Consistent with the inhibitory effect on EGF-stimulated signaling, KP potently suppressed the migration of HeLa cells. Concomitantly, KP was demonstrated to markedly inhibit HeLa cell invasion. The ability of KP in suppressing the migration and invasion of HeLa cells was associated with the suppression of matrix metalloproteinase-2 production. These data strongly suggest that KP may slow
International Nuclear Information System (INIS)
Camargo, Iara Maria Carneiro de.
2005-01-01
Studies of partition coefficient show that Kp values of metals can vary orders of magnitude according to the soil physical-chemistry characteristics. Therefore, the Kp is a sensible parameter in human health risk assessment model. In general, a default value is adopted by environmental agencies and often it is not represent suitably the soil studied and can cause errors in the risk calculation. The objectives of this work are: evaluate the heavy metals soil contamination around the Figueira coal-fired power plant; determine the metal Kp of As, Cd, Co, Cr, Cu, Mo, Ni, Pb and Zn in soil by the ratio between the metal concentration obtained by concentrate HNO 3 digestion and the metal concentration obtained by extraction with EDTA 0,05 mol L -1 (Kp EDTA ) or Ca(NO 3 ) 2 0,1 mol L -1 (Kp Ca(NO3)2 ); and evaluate the influence of the application of different Kp values in human health risk assessment C-Soil model in risk calculation. The main conclusions of the present study were: As, Cd, Mo, Pb e Zn were the Figueira soil metal contaminants, being As the pollutant of major human health concern; either Kp Ca(NO3)2 or Kp EDTA values could be used for human health risk calculation, in Figueira case, except for Pb, and the Kp EDTA values were preferably recommended due to the less dispersion of their values; the KpC Soil metals default values could be applied for the human health risk calculation in Figueira case, in other words, it would not have necessity to determine Kp values of region (Kp EDTA and Kp Ca(NO3)2 ), except to Pb. (author)
Aquino, Nayara S S; Araujo-Lopes, Roberta; Henriques, Patricia C; Lopes, Felipe E F; Gusmao, Daniela O; Coimbra, Candido C; Franci, Celso R; Reis, Adelina M; Szawka, Raphael E
2017-06-01
Kisspeptin (Kp) regulates prolactin (PRL) in an estradiol-dependent manner. We investigated the interaction between ovarian steroid receptors and Kp in the control of PRL secretion. Intracerebroventricular injections of Kp-10 or Kp-234 were performed in ovariectomized (OVX) rats under different hormonal treatments. Kp-10 increased PRL release and decreased 3,4-dihydroxyphenylacetic acid levels in the median eminence (ME) of OVX rats treated with estradiol (OVX+E), which was prevented by tamoxifen. Whereas these effects of Kp-10 were absent in OVX rats, they were replicated in OVX rats treated with selective agonist of estrogen receptor (ER)α, propylpyrazole triol, but not of ERβ, diarylpropionitrile. Furthermore, the Kp-10-induced increase in PRL was two times higher in OVX+E rats also treated with progesterone (OVX+EP), which was associated with a reduced expression of both tyrosine hydroxylase (TH) and Ser40-phosphorylated TH in the ME. Kp-10 also reduced dopamine levels in the ME of OVX+EP rats, an effect blocked by the progesterone receptor (PR) antagonist RU486. We also determined the effect of Kp antagonism with Kp-234 on the estradiol-induced surges of PRL and luteinizing hormone (LH), using tail-tip blood sampling combined with ultrasensitive enzyme-linked immunosorbent assay. Kp-234 impaired the early phase of the PRL surge and prevented the LH surge in OVX+E rats. Thus, we provide evidence that Kp stimulation of PRL release requires ERα and is potentiated by progesterone via PR activation. Moreover, alongside its essential role in the LH surge, Kp seems to play a role in the peak phase of the estradiol-induced PRL surge. Copyright © 2017 Endocrine Society.
Neuropeptide co-expression in hypothalamic kisspeptin neurons of laboratory animals and the human
Directory of Open Access Journals (Sweden)
Katalin eSkrapits
2015-02-01
Full Text Available Hypothalamic peptidergic neurons using kisspeptin (KP and its co-transmitters for communication are critically involved in the regulation of mammalian reproduction and puberty. This article provides an overview of neuropeptides present in KP neurons, with a focus on the human species. Immunohistochemical studies reveal that large subsets of human KP neurons synthesize neurokinin B, as also shown in laboratory species. In contrast, dynorphin described in KP neurons of rodents and sheep is found rarely in KP cells of human males and postmenopausal females. Similarly, galanin is detectable in mouse, but not human, KP cells, whereas substance P, cocaine- and amphetamine-regulated transcript and proenkephalin-derived opioids are expressed in varying subsets of KP neurons in humans, but not reported in ARC of other species. Human KP neurons do not contain neurotensin, cholecystokinin, proopiomelanocortin-derivatives, agouti-related protein, neuropeptide Y, somatostatin or tyrosine hydroxylase (dopamine. These data identify the possible co-transmitters of human KP cells. Neurochemical properties distinct from those of laboratory species indicate that humans use considerably different neurotransmitter mechanisms to regulate fertility.
Bihamiltonian Cohomology of KdV Brackets
Carlet, G.; Posthuma, H.; Shadrin, S.
2016-01-01
Using spectral sequences techniques we compute the bihamiltonian cohomology groups of the pencil of Poisson brackets of dispersionless KdV hierarchy. In particular, this proves a conjecture of Liu and Zhang about the vanishing of such cohomology groups.
Vermaas, Willem F J.
2014-06-17
Disclosed is a modified photoautotrophic bacterium comprising genes of interest that are modified in terms of their expression and/or coding region sequence, wherein modification of the genes of interest increases production of a desired product in the bacterium relative to the amount of the desired product production in a photoautotrophic bacterium that is not modified with respect to the genes of interest.
Solovieva, Ekaterina V; Myakinina, Vera P; Kislichkina, Angelina A; Krasilnikova, Valentina M; Verevkin, Vladimir V; Mochalov, Vladimir V; Lev, Anastasia I; Fursova, Nadezhda K; Volozhantsev, Nikolay V
2018-01-02
Hypermucoviscous (HV) strains of capsular types K1, K2 and K57 are the most virulent representatives of the Klebsiella pneumoniae species. Eight novel bacteriophages lytic for HV K. pneumoniae were isolated and characterized. Three bacteriophages, KpV41, KpV475, and KpV71 were found to have a lytic activity against mainly K. pneumoniae of capsular type K1. Two phages, KpV74, and KpV763 were lytic for K2 capsular type K. pneumoniae, and the phage KpV767 was specific to K57-type K. pneumoniae only. Two more phages, KpV766, and KpV48 had no capsular specificity. The phage genomes consist of a linear double-stranded DNA of 40,395-44,623bp including direct terminal repeats of 180-246 bp. The G + C contents are 52.3-54.2 % that is slightly lower than that of genomes of K. pneumoniae strains being used for phage propagation. According to the genome structures, sequence similarity and phylogenetic data, the phages are classified within the genus Kp32virus and Kp34virus of subfamily Autographivirinae, family Podoviridae. In the phage genomes, genes encoding proteins with putative motifs of polysaccharide depolymerase were identified. Depolymerase genes of phages KpV71 and KpV74 lytic for hypermucoviscous K. pneumoniae of K1 and K2 capsular type, respectively, were cloned and expressed in Escherichia coli, and the recombinant gene products were purified. The specificity and polysaccharide-degrading activity of the recombinant depolymerases were demonstrated. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Coen, S.
1981-01-01
The theory given by Moses and deRidder is modified so that the derivative of the solution of the Gelfand-Levitan integral equation is not required. Based on this modification, a numerical procedure is developed which approximately constructs the dielectric profile of the layered half-space from the impulse response. Moreover, an inverse scattering theory is developed for a Goupillaud-type dielectric medium, and a fast numerical procedure based on the Berryman and Greene algorithm is presented. The performance of the numerical algorithms is examined by applying them to pecise and imprecise artificial impulse response data. 11 refs
Institute of Scientific and Technical Information of China (English)
ZHUQuan-gang; HUJin-hong
2003-01-01
Aim:To study percutaneous absorption and metabolism of ketoprofen isopropyl ester (KPE)via excised nude mouse's and monkey's skin.Methods:Excised skin was prepared by surgical excision and enzyme digestion.Sideby-side diffusion cells were used for in vitro permeation studies.The concentrations of KPE and its metabolite in samples were assayed by HPLC.Results:All KPE penetration through whole thickness skin and stripped skin was metabolized to ketoprofen(KP).the concentration of which in the reciiver solution increased linearly with time.As to the nude mouse skin.the steady-state flux of KP through whole thickness skin was 2.5 times that of KPE through the whloe thickness skin,but the KP and KPE remaining in the whole thickness skin after the finishing of KPE penetration was 22.2 times in compered with the KP remaining in the whole thickness skin after the finshing of KP penetration.The rate of formation of the steady state KP from KPE throught dermis was significantly lower than that of KPE through the whole thickness skin.In he monkey skin,the rate of formation of the steady-state KP from KPE through the whole thickness skin was 0.7 times that from KPE through stripped skin.The KP and KPE remaining in the whole thickness skin after the finishing of KPE penetration was 2.0 time that in the stripped skin after the finishing of KPE penetration.The rate of fornation of the steady-state KP from KPE through dermis was lower than that from KPE through the whole thickness skin and the stripped skin.the KP remaining in dermis after the finsihing of KPE penetration was also significantly lower than the KP remaining in the whole thickness skin and the stripped skin after the finishing of KPE penetration.Conclusion:KP esters are of benefit to imporove the local action of KP.and skin esterase metabolism mainly develops in the epidermis.
Directory of Open Access Journals (Sweden)
Daniella Barreto-Santana
2015-03-01
Materiales y métodos. Se seleccionaron treinta ninfas de cada especie después de xenodiagnóstico artificial en sangre infectada con T. rangeli. Se examinaron periódicamente muestras de heces y hemolinfa. Los insectos con hemolinfas infectadas fueron alimentados en ratones a fin de comprobar la transmisión por picadura y posteriormente disecados para confirmar la infección de las glándulas salivales. Resultados. En Rhodnius pictipes se encontró un mayor porcentaje de infección intestinal que en las otras especies. Se detectaron epimastigotes y tripomastigotes en la hemolinfa de las cuatro especies, y se encontró que el parasitismo fue menor en las especies del linaje R. robustus. Rhodnius robustus y R. neglectus no transmitían T. rangeli a ratones por picadura: después de la disección, sus glándulas no estaban infectadas. Solo un espécimen de R. nasutus y dos de R. pictipes transmitieron el parásito por la picadura. La tasa de infección glandular fue de 16 % para R. pictipes y de 4 % para R. nasutus. Conclusiones. La capacidad infecciosa (hemolinfática, intestinal y glandular y la transmisión de T. rangeli (SC-58/KP1- fueron mayores y más eficientes en R. pictipes. Estos resultados refuerzan la hipótesis de que estos triatominos actúan como filtros biológicos en la transmisión de T. rangeli.
Gruber, Robert; Sugarman, Jeffrey L.; Crumrine, Debra; Hupe, Melanie; Mauro, Theodora M.; Mauldin, Elizabeth A.; Thyssen, Jacob P.; Brandner, Johanna M.; Hennies, Hans-Christian; Schmuth, Matthias; Elias, Peter M.
2016-01-01
Although keratosis pilaris (KP) is common, its etiopathogenesis remains unknown. KP is associated clinically with ichthyosis vulgaris and atopic dermatitis and molecular genetically with filaggrin-null mutations. In 20 KP patients and 20 matched controls, we assessed the filaggrin and claudin 1 genotypes, the phenotypes by dermatoscopy, and the morphology by light and transmission electron microscopy. Thirty-five percent of KP patients displayed filaggrin mutations, demonstrating that filaggrin mutations only partially account for the KP phenotype. Major histologic and dermatoscopic findings of KP were hyperkeratosis, hypergranulosis, mild T helper cell type 1-dominant lymphocytic inflammation, plugging of follicular orifices, striking absence of sebaceous glands, and hair shaft abnormalities in KP lesions but not in unaffected skin sites. Changes in barrier function and abnormal paracellular permeability were found in both interfollicular and follicular stratum corneum of lesional KP, which correlated ultrastructurally with impaired extracellular lamellar bilayer maturation and organization. All these features were independent of filaggrin genotype. Moreover, ultrastructure of corneodesmosomes and tight junctions appeared normal, immunohistochemistry for claudin 1 showed no reduction in protein amounts, and molecular analysis of claudin 1 was unremarkable. Our findings suggest that absence of sebaceous glands is an early step in KP pathogenesis, resulting in downstream hair shaft and epithelial barrier abnormalities. PMID:25660180
Jayasena, C N; Nijher, G M K; Abbara, A; Murphy, K G; Lim, A; Patel, D; Mehta, A; Todd, C; Donaldson, M; Trew, G H; Ghatei, M A; Bloom, S R; Dhillo, W S
2010-12-01
Kisspeptin is a novel therapeutic target for infertility. A single kisspeptin-54 (KP-54) injection acutely stimulates the release of reproductive hormones in women with hypothalamic amenorrhea (HA), a commonly occurring condition characterized by absence of menstruation; however, twice-daily administration of KP-54 results in tachyphylaxis. We determined the time course of desensitization to twice-daily KP-54 injections, compared the effects of twice-daily and twice-weekly administration regimens of KP-54, and studied the effects of long-term twice-weekly administration of KP-54 on the release of reproductive hormones in women with HA. When KP-54 was administered twice daily, responsiveness to luteinizing hormone (LH) diminished gradually, whereas responsiveness to follicle-stimulating hormone (FSH) was nearly abolished by day 2. Twice-weekly KP-54 administration resulted in only partial desensitization, in contrast to the complete tolerance achieved with twice-daily administration. Women with HA who were treated with twice-weekly KP-54 injections had significantly elevated levels of reproductive hormones after 8 weeks as compared with treatment with saline. No adverse effects were observed. This study provides novel pharmacological data on the effects of KP-54 on the release of reproductive hormones in women with HA.
Gout: a review of non-modifiable and modifiable risk factors
MacFarlane, Lindsey A.; Kim, Seoyoung C.
2014-01-01
Gout is a common inflammatory arthritis triggered by the crystallization of uric acid within the joints. Gout affects millions worldwide and has an increasing prevalence. Recent research has been carried out to better qualify and quantify the risk factors predisposing individuals to gout. These can largely be broken into non-modifiable risk factors such as sex, age, race, and genetics, and modifiable risk factors such as diet and lifestyle. Increasing knowledge of factors predisposing certain individuals to gout could potentially lead to improved preventive practices. This review summarizes the non-modifiable and modifiable risk factors associated with development of gout. PMID:25437279
Detection of Genetically Modified Food: Has Your Food Been Genetically Modified?
Brandner, Diana L.
2002-01-01
Explains the benefits and risks of genetically-modified foods and describes methods for genetically modifying food. Presents a laboratory experiment using a polymerase chain reaction (PCR) test to detect foreign DNA in genetically-modified food. (Contains 18 references.) (YDS)
Nauclér, P.; Kalin, M.; Giske, C. G.
2018-01-01
Klebsiella pneumoniae (KP) is after Escherichia coli (EC) the most common gram-negative species causing invasive infections. Herein, we analyzed risk factors and prognosis in invasive infections caused by KP versus EC, in an area with low antimicrobial resistance. Moreover, we compared antimicrobial resistance and relative prevalence of KP and EC (KP/EC-ratio) in different European countries, using EARS-Net data. Adult patients admitted to Karolinska University Hospital 2006–2012 with invasive infection caused by KP (n = 599) were matched regarding sex and age with patients infected by EC. The medical records were retrospectively reviewed. Comorbidity was adjusted for with multivariable analysis. European data were retrieved from the EARS-Net database. No differences were observed in 7- and 30-day mortality between the groups. The 90-day mortality was significantly higher in the KP cohort (26% versus 17%, pKarolinska University Hospital compared to aggregate data from 20 EARS-Net countries could be related to absence of clonal spread of multidrug-resistant KP. PMID:29624618
Functionality of kumquat (Fortunella margarita) in the production of fruity ice cream.
Çakmakçı, Songül; Topdaş, Elif Feyza; Çakır, Yusuf; Kalın, Pınar
2016-03-30
The aim of this study was to investigate the effect of kumquat (Fortunella margarita) on the quality characteristics of ice cream. Kumquat paste (KP) was added to an ice cream mix at four concentrations, 0 (control), 5, 10 and 15% (w/w), for ice cream production. The increment of KP level caused an increase in acidity, vitamin C content, b* value and overrun value compared with the control ice cream. The apparent viscosity of samples decreased with the addition of KP at concentrations of 5 and 10% compared with the control. Results indicated that lyophilized water extract of KP (LKE) contained remarkable phenolic compounds. It was observed that LKE exhibited moderate in vitro antioxidant capacity. KP enhanced the color, flavor, vitamin C content and Mg and K contents of the ice cream. The addition of KP positively affected the sensory properties. KP may be used as a suitable source of natural color and flavor agent in ice cream production. KP enhanced the vitamin C content and Mg and K contents of ice cream and improved its sensory properties. © 2015 Society of Chemical Industry.
Monroe, C Douglas; Chin, Karen Y
2013-05-01
The specialty pharmaceuticals market is expanding more rapidly than the traditional pharmaceuticals market. Specialty pharmacy operations have evolved to deliver selected medications and associated clinical services. The growing role of specialty drugs requires new approaches to managing the use of these drugs. The focus, expectations, and emphasis in specialty drug management in an integrated health care delivery system such as Kaiser Permanente (KP) can vary as compared with more conventional health care systems. The KP Specialty Pharmacy (KP-SP) serves KP members across the United States. This descriptive account addresses the impetus for specialty drug management within KP, the use of tools such as an electronic health record (EHR) system and process management software, the KP-SP approach for specialty pharmacy services, and the emphasis on quality measurement of services provided. Kaiser Permanente's integrated system enables KP-SP pharmacists to coordinate the provision of specialty drugs while monitoring laboratory values, physician visits, and most other relevant elements of the patient's therapy. Process management software facilitates the counseling of patients, promotion of adherence, and interventions to resolve clinical, logistic, or pharmacy benefit issues. The integrated EHR affords KP-SP pharmacists advantages for care management that should become available to more health care systems with broadened adoption of EHRs. The KP-SP experience may help to establish models for clinical pharmacy services as health care systems and information systems become more integrated.
Papular, profuse, and precocious keratosis pilaris.
Castela, Emeline; Chiaverini, Christine; Boralevi, Franck; Hugues, Rosalind; Lacour, Jean Philippe
2012-01-01
Keratosis pilaris (KP) is a frequent and benign condition in children characterized by the presence of rough, follicular papules and varying degrees of erythema. Different variants have been described, including simple KP and red KP. Between September 2007 and October 2010, 11 children with profuse and precocious KP seen at the department of pediatric dermatology were included. They defined an underemphasized clinical variant of childhood KP: the papular, profuse, and precocious KP characterized by early age of onset (<18 mos), extensive involvement of the limbs and cheeks, and papular nature of lesions. No clinical association has been found. The main complication was episodes of folliculitis. Diagnosis was delayed for all patients. Treatment is difficult, but association between emollient and keratolytic agents can provide some help. © 2011 Wiley Periodicals, Inc.
Sonwalkar, V. S.; Reddy, A.
2017-12-01
Variation in field-aligned electron and ion densities as a function of geomagnetic activity are important parameters in the physics of the thermosphere-ionosphere-magnetosphere coupling. Using whistler mode sounding from IMAGE, we report variations in field-aligned electron density and O+/H+ transition height (HT) during two periods (16-23 Aug 2005; 24 Sep-06 Oct 2005) when geomagnetic conditions were quiet (maximum Kp in the past 24 hours, Kpmax,24 ≤ 2) to moderately active (2 quiet time, during moderate geomagnetic activity: (1) O+/H+ transition height was roughly same; (2) electron density variations below HT showed no trend; (3) electron density above HT increased ( 10-40 %). The measured electron density is in agreement with in situ measurements from CHAMP (350 km) and DMSP (850 km) and past space borne (e. g., ISIS) measurements but the F2 peak density is a factor of 2 lower relative to that measured by ground ionosondes and that predicted by IRI-2012 empirical model. The measured transition height is consistent with OGO 4, Explorer 31, and C/NOFS measurements but is lower than that from IRI-2012. The observed variations in electron density at F2 peak are consistent with past work and are attributed to solar, geomagnetic, and meteorological causes [e. g. Risibeth and Mendillo, 2001; Forbes et al., 2000]. To the best of our knowledge, variations in field-aligned electron density above transition height at mid-latitudes during quiet to moderately active periods have not been reported in the past. Further investigation using physics based models (e. g., SAMI3) is required to explain the observed variations.
Salsano, Antonio; Giacobbe, Daniele Roberto; Sportelli, Elena; Olivieri, Guido Maria; Brega, Carlotta; Di Biase, Carlo; Coppo, Erika; Marchese, Anna; Del Bono, Valerio; Viscoli, Claudio; Santini, Francesco
2016-11-01
Patients undergoing major surgery are at increased risk of developing infections due to resistant organisms, including carbapenem-resistant Klebsiella pneumoniae (CR-Kp). In this study, we assessed risk factors for CR-Kp infections after open heart surgery in a teaching hospital in northern Italy. A retrospective study was conducted from January to December 2014. The primary outcome measure was postoperative CR-Kp infection, defined as a time-to-event end-point. The effect of potentially related variables was assessed by univariable and multivariable analyses. Secondary end-points were in-hospital mortality and 180-day postoperative mortality. Among 553 patients undergoing open heart surgery, 32 developed CR-Kp infections (6%). In the final multivariable model, CR-Kp colonization [hazard ratio (HR) 227.45, 95% confidence intervals (CI) 67.13-1225.20, P open heart surgery. CR-Kp infection after surgery significantly affected survival. Preventing colonization is conceivably the most effective current strategy to reduce the impact of CR-Kp. © The Author 2016. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.
Cruz, E A; Da-Silva, S A G; Muzitano, M F; Silva, P M R; Costa, S S; Rossi-Bergmann, B
2008-12-10
Previously, we reported the immunosuppressive action of the aqueous extract of Kalanchoe pinnata (Kp) in mice. In the present study, we report on the protective effect of Kp in fatal anaphylactic shock, likewise a Th2-driven immunopathology, and the identification of its active component. Mice daily treated with oral Kp during hypersensitization with ovalbumin were all protected against death when challenged with the allergen, as compared with the 100% mortality in the untreated group. A single intraperitoneal dose 3 h prior to challenge was partially effective. Oral protection was accompanied by a reduced production of OVA-specific IgE antibodies, reduced eosinophilia, and impaired production of the IL-5, IL-10 and TNF-alpha cytokines. In vitro, Kp prevented antigen-induced mast cell degranulation and histamine release. Oral treatment with the quercitrin flavonoid isolated from Kp prevented fatal anaphylaxis in 75% of the animals. These findings indicate that oral treatment with Kp effectively downmodulates pro-anaphylactic inducing immune responses. Protection achieved with quercitrin, although not maximal, suggests that this flavonoid is a critical component of Kp extract against this extreme allergic reaction.
PREFACE Integrability and nonlinear phenomena Integrability and nonlinear phenomena
Gómez-Ullate, David; Lombardo, Sara; Mañas, Manuel; Mazzocco, Marta; Nijhoff, Frank; Sommacal, Matteo
2010-10-01
one can generalize or adapt this construction to different settings like the integro-differential, discrete or super-symmetric ones. The emphasis is usually to find auxiliary linear systems defining an infinite set of linear commuting flows whose solutions, if some asymptotic conditions are imposed, are named wave or Baker-Akhiezer functions. These linear flows determine the so called Lax equations, another infinite set of commuting equations whose compatibility leads to the so called Zakharov-Shabat system. An alternative description of the hierarchies is achieved with the use of the bilinear equations directly linked with the tau-function description of the hierarchy. There are two paradigmatic integrable hierarchies, namely the KP and 2-dimensional Toda lattice (2DTL). These hierarchies are treated within this volume in three contributions. In particular, Takasaki [5] reconsiders the extended Toda hierarchy of Carlet, Dubrovin and Zhang in the light of Ogawa's 2 + 1D extension of the 1D Toda hierarchy. It turns out that the former may be thought of as some sort of dimensional reduction of the latter. This explains the structure of the bilinear formalism proposed by Milanov. Carlet and Manas [6] study the 2-component KP and 2D Toda hierarchies and solve explicitly several implicit constraints present in the usual Lax formulation of the hierarchy, thus identifying a set of free dependent variables for such hierarchies. Finally, the KP hierarchy is considered in the paper by Lin et al [7], which explores the extended flows of a q-deformed modified KP hierarchy leading to the introduction of self-consistent sources. By a combination of the dressing method and the method of variation of constants, the authors are able through a dressing approach to find a scheme for the construction of solutions of the corresponding integrable equations with self-consistent sources. The study of dispersionless integrable hierarchies is an active field of research, and this special issue
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
We obtain ratchet effect in inertial structureless systems in symmetric periodic potentials where the asymmetry comes from the non-uniform friction offered by the medium and driven by symmetric ... In the transient time scales the system shows dispersionless behaviour as reported earlier when a constant force is applied.
Time-resolved terahertz spectroscopy in a parallel-plate waveguide
DEFF Research Database (Denmark)
Cooke, David; Jepsen, Peter Uhd
2009-01-01
The parallel plate waveguide (PPWG), formed by two conducting parallel plates separated by a distance on the order of the wavelength of the propagating light, has shown itself to be a near ideal terahertz interconnect exhibiting low loss and dispersionless propagation.[1] It is also a useful tool...
Energy Technology Data Exchange (ETDEWEB)
Weller, R.E.
1991-10-01
Much of what used to be called immunotherapy is now included in the term biological response modifiers. Biological response modifiers (BRMs) are defined as those agents or approaches that modify the relationship between the tumor and host by modifying the host's biological response to tumor cells with resultant therapeutic effects.'' Most of the early work with BRMs centered around observations of spontaneous tumor regression and the association of tumor regression with concurrent bacterial infections. The BRM can modify the host response in the following ways: Increase the host's antitumor responses through augmentation and/or restoration of effector mechanisms or mediators of the host's defense or decrease the deleterious component by the host's reaction; Increase the host's defenses by the administration of natural biologics (or the synthetic derivatives thereof) as effectors or mediators of an antitumor response; Augment the host's response to modified tumor cells or vaccines, which might stimulate a greater response by the host or increase tumor-cell sensitivity to an existing response; Decrease the transformation and/or increase differentiation (maturation) of tumor cells; or Increase the ability of the host to tolerate damage by cytotoxic modalities of cancer treatment.
Modified Allergens for Immunotherapy.
Satitsuksanoa, Pattraporn; Głobińska, Anna; Jansen, Kirstin; van de Veen, Willem; Akdis, Mübeccel
2018-02-16
During the past few decades, modified allergens have been developed for use in allergen-specific immunotherapy (AIT) with the aim to improve efficacy and reduce adverse effects. This review aims to provide an overview of the different types of modified allergens, their mechanism of action and their potential for improving AIT. In-depth research in the field of allergen modifications as well as the advance of recombinant DNA technology have paved the way for improved diagnosis and research on human allergic diseases. A wide range of structurally modified allergens has been generated including allergen peptides, chemically altered allergoids, adjuvant-coupled allergens, and nanoparticle-based allergy vaccines. These modified allergens show promise for the development of AIT regimens with improved safety and long-term efficacy. Certain modifications ensure reduced IgE reactivity and retained T cell reactivity, which facilities induction of immune tolerance to the allergen. To date, multiple clinical trials have been performed using modified allergens. Promising results were obtained for the modified cat, grass and birch pollen, and house dust mite allergens. The use of modified allergens holds promise for improving AIT efficacy and safety. There is however a need for larger clinical studies to reliably assess the added benefit for the patient of using modified allergens for AIT.
Chandramouli, Bharadwaj; Jang, Myoseon; Kamens, Richard M
2003-09-15
The partitioning behavior of a set of diverse SOCs on two and three component mixtures of aerosols from different sources was studied using smog chamber experimental data. A set of SOCs of different compound types was introduced into a system containing a mixture of aerosols from two or more sources. Gas and particle samples were taken using a filter-filter-denuder sampling system, and a partitioning coefficient Kp was estimated using Kp = Cp/(CgTSP). Particle size distributions were measured using a differential mobility analyzer and a light scattering detector. Gas and particle samples were analyzed using GCMS. The aerosol composition in the chamber was tracked chemically using a combination of signature compounds and the organic matter mass fraction (f(om)) of the individual aerosol sources. The physical nature of the aerosol mixture in the chamber was determined using particle size distributions, and an aggregate Kp was estimated from theoretically calculated Kp on the individual sources. Model fits for Kp showed that when the mixture involved primary sources of aerosol, the aggregate Kp of the mixture could be successfully modeled as an external mixture of the Kp on the individual aerosols. There were significant differences observed for some SOCs between modeling the system as an external and as an internal mixture. However, when one of the aerosol sources was secondary, the aggregate model Kp required incorporation of the secondary aerosol products on the preexisting aerosol for adequate model fits. Modeling such a system as an external mixture grossly overpredicted the Kp of alkanes in the mixture. Indirect evidence of heterogeneous, acid-catalyzed reactions in the particle phase was also seen, leading to a significant increase in the polarity of the resulting aerosol mix and a resulting decrease in the observed Kp of alkanes in the chamber. The model was partly consistent with this decrease but could not completely explain the reduction in Kp because of
Functional representations of integrable hierarchies
International Nuclear Information System (INIS)
Dimakis, Aristophanes; Mueller-Hoissen, Folkert
2006-01-01
We consider a general framework for integrable hierarchies in Lax form and derive certain universal equations from which 'functional representations' of particular hierarchies (such as KP, discrete KP, mKP, AKNS), i.e. formulations in terms of functional equations, are systematically and quite easily obtained. The formalism genuinely applies to hierarchies where the dependent variables live in a noncommutative (typically matrix) algebra. The obtained functional representations can be understood as 'noncommutative' analogues of 'Fay identities' for the KP hierarchy
Dufourny, Laurence; Lomet, Didier
2017-12-01
Seasonal reproduction is under the control of gonadal steroid feedback, itself synchronized by day-length or photoperiod. As steroid action on GnRH neurons is mostly indirect and therefore exerted through interneurons, we looked for neuroanatomical interactions between kisspeptin (KP) neurons and somatostatin (SOM) neurons, two populations targeted by sex steroids, in three diencephalic areas involved in the central control of ovulation and/or sexual behavior: the arcuate nucleus (ARC), the preoptic area (POA) and the ventrolateral part of the ventromedial hypothalamus (VMHvl). KP is the most potent secretagogue of GnRH secretion while SOM has been shown to centrally inhibit LH pulsatile release. Notably, hypothalamic contents of these two neuropeptides vary with photoperiod in specific seasonal species. Our hypothesis is that SOM inhibits KP neuron activity and therefore indirectly modulate GnRH release and that this effect may be seasonally regulated. We used sections from ovariectomized estradiol-replaced ewes killed after photoperiodic treatment mimicking breeding or anestrus season. We performed triple immunofluorescent labeling to simultaneously detect KP, SOM and synapsin, a marker for synaptic vesicles. Sections from the POA and from the mediobasal hypothalamus were examined using a confocal microscope. Randomly selected KP or SOM neurons were observed in the POA and ARC. SOM neurons were also observed in the VMHvl. In both the ARC and POA, nearly all KP neurons presented numerous SOM contacts. SOM neurons presented KP terminals more frequently in the ARC than in the POA and VMHvl. Quantitative analysis failed to demonstrate major seasonal variations of KP and SOM interactions. Our data suggest a possible inhibitory action of SOM on all KP neurons in both photoperiodic statuses. On the other hand, the physiological significance of KP modulation of SOM neuron activity and vice versa remain to be determined. Copyright © 2017 Elsevier Inc. All rights reserved.
Slow Diffusive Motions in a Monolayer of Tetracosane Molecules Adsorbed on Graphite
DEFF Research Database (Denmark)
Taub, H.; Hansen, Flemming Yssing; Criswell, L.
2004-01-01
to a temperature of similar to230 K, we observe the QNS energy width to be dispersionless, consistent with molecular dynamics simulations showing rotational motion of the molecules about their long axis. At 260 K, the QNS energy width begins to increase with wave vector transfer, suggesting onset of nonuniaxial...
DEFF Research Database (Denmark)
Oliva, Paulo Borges
2002-01-01
Modified bar recursion is a variant of Spector's bar recursion which can be used to give a realizability interpretation of the classical axiom of dependent choice. This realizability allows for the extraction of witnesses from proofs of forall-exists-formulas in classical analysis. In this talk I...... shall report on results regarding the relationship between modified and Spector's bar recursion. I shall also show that a seemingly weak form of modified bar recursion is as strong as "full" modified bar recursion in higher types....
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...
Simple equation method for nonlinear partial differential equations and its applications
Directory of Open Access Journals (Sweden)
Taher A. Nofal
2016-04-01
Full Text Available In this article, we focus on the exact solution of the some nonlinear partial differential equations (NLPDEs such as, Kodomtsev–Petviashvili (KP equation, the (2 + 1-dimensional breaking soliton equation and the modified generalized Vakhnenko equation by using the simple equation method. In the simple equation method the trial condition is the Bernoulli equation or the Riccati equation. It has been shown that the method provides a powerful mathematical tool for solving nonlinear wave equations in mathematical physics and engineering problems.
DEFF Research Database (Denmark)
Janati, A; Talbi, R; Klosen, P
2013-01-01
, kisspeptin (Kp) and RF-amide-related peptide (RFRP)-3, displays seasonal variation in jerboa. Kp and/or RFRP-3 immunoreactivity was investigated in the hypothalamus of jerboas captured in the field of the Middle Atlas mountain (Morocco), either in the spring or autumn. As in other rodents, the Kp...
Chen, Nan; Wang, Lin-Lin; Xue, Juan; Ma, Xiang-Bo; Zhao, Sheng; Rong, Rui-Xue; Li, Hong-Quan; Ding, Liang; Zheng, Ming-Zhi; Chen, Ying-Ying; Duan, Fei; Shen, Yue-Liang
2014-10-01
K1 or K2 serotype Klebsiella pneumoniae isolate caused clinical pyogenic liver abscess (KLA) infection is prevalent in many areas. It has been identified that K1 or K2 serotype K. pneumoniae isolates caused KLA infection in mice by oral inoculation. In our study, K1 serotype K. pneumoniae isolate Kp1002 with hypermucoviscosity (HV)-positive phenotype caused KLA infection in C57BL/6 mice by oral inoculation. Simultaneously, non-serotype K1 and K2 isolate Kp1014 with HV-negative phenotype failed to cause KLA infection in the same manner. It seems that gastrointestinal tract translocation is the pathway by which K1 or K2 serotype K. pneumoniae caused KLA infection. Liquid chromatography-tandem mass spectrometry was used to further analyze metabolic profile changes in mice with KLA infection. Data showed that after Kp1002 or Kp1014 oral inoculation, serum Phosphatidylcholine (PC) and Lysophosphatidylcholine (LPC) levels significantly changed in mice. Some PC and LPC molecules showed changes both in the Kp1002 KLA group and the Kp1014 no-KLA group compared with the control group. The level of 18:1/18:2-PC significantly changed in the Kp1002 KLA group compared with the control group, but showed no change between the Kp1014 no-KLA group and the control group. The level of 18:1/18:2-PC might have been particularly affected by KLA infection caused by K1 serotype K. pneumoniae Kp1002. It may be a potential biomarker for KLA infection. Copyright © 2014 Elsevier Ltd. All rights reserved.
65 A Contrastive Study of the Phonology of Igbo and Yoruba Cecilia ...
African Journals Online (AJOL)
Tracie1
done for pedagogical purposes, with the aim to provide better descriptions and better .... kp 'mould', àkpà 'bag' gb. /gb/ voiced labial-velar plosive. Plosive p b t d k g kp gb kw gw. Nasal. M n w .... wá 'search', owo 'money', wàhála. 'trouble'.
Properties and nutritional value of wheat bread enriched by hemp products
Directory of Open Access Journals (Sweden)
Ivan Švec
2015-08-01
Full Text Available Hemp (Cannabis sativa is annual plant that is native to China and remained as important material for food, industrial and medical purposes. As source of cannabinoids belongs to controversial, but due to its excellent nutritional profile, non-gluten protein, fat and fibre it has potential in bakery products. Addition of 5% - 20% of hemp press cake fine flour and fine wholemeal significantly increased dietary fibre content, but their influence on volume of laboratory baked bread was different. Reflecting actual dosage, both types of hemp press cake flour diminished bun sizes about 6% - 33%; volumes of bread containing hulled wholemeal were comparable to standard (mean 310 mL/100 g vs. 333 ml/100 g, respectively. Only dehulled wholemeal hemp form increased the bread specific volume (6% - 30%, especially as 10% fortification (434 mL/100 g. Six Canadian hemp products were added as 10% and 20% on wheat flour base, comprising fine hemp flour and coarse hemp powder, dehulled whole seeds, hulled hemp seeds with sea salt as well as 50% and 43% hemp protein concentrates (KP1-KP6, respectively. The higher level of KP1, KP2, KP5 and KP6, the lower bread specific volumes were determined (decrease about 9% - 48%. Soft increase in buns size caused by 10% and 20% KP3 (323 and 319 ml/100 g vs. 296 mL/100 g was insignificant. The effect of KP4 was reversely verifiable, magnifying the parameter about 25% and 17%, respectively. In terms of protein content in bread, a level 11.75% in wheat bread has risen to approx. 14.5% and 18.0% when 10% and 20% of KP3 and KP5, respectively, was included into bread recipe. All six Canadian hemp products increased dietary fibre content in bread, mainly owing to KP4 and both protein concentrates (up to 4 and 3 times, respectively. Incorporation of hemp flour up to the level of 10% positively affected bread sensorial properties.
Characterization of modified clinoptilolite
International Nuclear Information System (INIS)
Novosad, J.; Jandl, J.; Woollins, J.D.
1992-01-01
Samples of clinoptilolite were modified using insoluble hexacyanoferrate from aqueous solution. The modified samples were characterized by elemental analysis, powder X-ray diffraction, solid state NMR and vibrational spectroscopy. The sorption properties of modified clinoptilolite were studied, too. Higher affinity for 137 Cs sorption in comparison with the natural clinoptilolite has been proved. (author) 5 refs.; 3 figs.; 2 tabs
Benincasa, Monica; Lagatolla, Cristina; Dolzani, Lucilla; Milan, Annalisa; Pacor, Sabrina; Liut, Gianfranco; Tossi, Alessandro; Cescutti, Paola; Rizzo, Roberto
2016-08-10
Biofilm matrices of two Klebsiella pneumoniae clinical isolates, KpTs101 and KpTs113, were investigated for their polysaccharide composition and protective effects against antimicrobial peptides. Both strains were good biofilm producers, with KpTs113 forming flocs with very low adhesive properties to supports. Matrix exopolysaccharides were isolated and their monosaccharide composition and glycosidic linkage types were defined. KpTs101 polysaccharide is neutral and composed only of galactose, in both pyranose and furanose ring configurations. Conversely, KpTs113 polysaccharide is anionic due to glucuronic acid units, and also contains glucose and mannose residues. The susceptibility of the two strains to two bovine cathelicidin antimicrobial peptides, BMAP-27 and Bac7(1-35), was assessed using both planktonic cultures and biofilms. Biofilm matrices exerted a relevant protection against both antimicrobials, which act with quite different mechanisms. Similar protection was also detected when antimicrobial peptides were tested against planktonic bacteria in the presence of the polysaccharides extracted from KpTs101 and KpTs113 biofilms, suggesting sequestering adduct formation with antimicrobials. Circular dichroism experiments on BMAP-27 in the presence of increasing amounts of either polysaccharide confirmed their ability to interact with the peptide and induce an α-helical conformation.
de Melo, Maíra Espíndola Silva; Cabral, Adriane Borges; Maciel, Maria Amélia Vieira; da Silveira, Vera Magalhães; de Souza Lopes, Ana Catarina
2011-05-01
The objectives of this study were to determine the distribution of phylogenetic groups among Klebsiella pneumoniae isolates from Recife, Brazil and to assess the relationship between the groups and the isolation sites and resistance profile. Ninety four isolates of K. pneumoniae from hospital or community infections and from normal microbiota were analyzed by gyrA PCR-RFLP, antibiotic susceptibility, and adonitol fermentation. The results revealed the distinction of three phylogenetic groups, as it has also been reported in Europe, showing that these clusters are highly conserved within K. pneumoniae. Group KpI was dominantly represented by hospital and community isolates while groups KpII and KpIII displayed mainly normal microbiota isolates. The resistance to third generation cephalosporins, aztreonam, imipenem, amoxicillin/clavulanic acid, and streptomycin was only observed in KpI. The percentage of resistance was higher in KpI, followed by KpII and KpIII. The differences in the distribution of K. pneumoniae phylogenetic groups observed in this study suggest distinctive clinical and epidemiological characteristics among the three groups, which is important to understand the epidemiology of infections caused by this organism. This is the first study in Brazil on K. pneumoniae isolates from normal microbiota and community infections regarding the distribution of phylogenetic groups based on the gyrA gene.
Lifescience Database Archive (English)
Full Text Available KEEIEKMVADAEKFKQQDE HKKIVLNQRINWKIMHSLLKIQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmp...IQLKMKKLQPKFQIQINQLLNLKLKVYSNG*nqikpqkrm nmkir*kp*kqlsiqimsxlxqeggmpqgggtarwyvk F
Outcomes following the Kawashima procedure for single-ventricle palliation in left atrial isomerism.
Vollebregt, Anne; Pushparajah, Kuberan; Rizvi, Maleeha; Hoschtitzky, Andreas; Anderson, David; Austin, Conal; Tibby, Shane M; Simpson, John
2012-03-01
Patients with left atrial isomerism and interrupted inferior vena cava palliated with a superior cavopulmonary connection or Kawashima procedure (KP) have a high incidence of developing pulmonary arteriovenous malformations. The necessity for hepatic vein redirection (HVR) and its timing remains a controversy. We aimed to assess the clinical outcome of patients with left atrial isomerism following a KP. The main end points were death, requirement for HVR and the impact of HVR on oxygen saturation. Retrospective review of 21 patients with a diagnosis of left atrial isomerism, interruption of the inferior vena cava and single-ventricle physiology managed with a KP at a single centre between January 1990 and March 2010. Twenty-one patients had a KP, with 12 subsequently undergoing HVR. There was relatively a constant monthly decrement in the proportion of patients who were free from death or HVR up until 60 months following the KP, with a dramatic increase in the hazard after this time. The Cox proportional hazards regression model demonstrated a reduced early risk for HVR or death in patients who underwent pulmonary artery banding versus arterial shunt as the primary procedure (hazard ratio: 0.10; P = 0.01), and an increased risk with bilateral superior vena cavas (SVCs) (hazard ratio: 3.4; P = 0.04) and age at KP (hazard ratio: 1.02 per month increase in age at KP; P = 0.02). HVR mortality was relatively high with 3 of 12 patients dying in the early postoperative period with profound cyanosis. The timing of HVR after the KP did not influence the postoperative rate of increase in oxygen saturation. These findings confirm that the majority of patients who undergo a KP will require HVR. Patients who are older at the time of the KP or having an initial arterial shunt or bilateral SVCs are at higher risk of HVR or death. The relatively high mortality at HVR was characterized by severe postoperative cyanosis.
The Cauchy problem for the Pavlov equation with large data
Wu, Derchyi
2017-08-01
We prove a local solvability of the Cauchy problem for the Pavlov equation with large initial data by the inverse scattering method. The Pavlov equation arises in studies Einstein-Weyl geometries and dispersionless integrable models. Our theory yields a local solvability of Cauchy problems for a quasi-linear wave equation with a characteristic initial hypersurface.
Amount of kinematic feedback affects learning of speech motor skills.
Ballard, Kirrie J; Smith, Heather D; Paramatmuni, Divija; McCabe, Patricia; Theodoros, Deborah G; Murdoch, Bruce E
2012-01-01
Knowledge of Performance (KP) feedback, such as biofeedback or kinematic feedback, is used to provide information on the nature and quality of movement responses for the purpose of guiding active learning or rehabilitation of motor skills. It has been proposed that KP feedback may interfere with long-term learning when provided throughout training. Here, twelve healthy English-speaking adults were trained to produce a trilled Russian [r] in words with KP kinematic feedback using electropalatography (EPG) and without KP (noKP). Five one-hour training sessions were provided over one week with testing pretraining and one day and one week posttraining. No group differences were found at pretraining or one day post training for production accuracy. A group by time interaction supported the hypothesis that providing kinematic feedback continually during skill acquisition interferes with retention.
Mapping of kisspeptin fibres in the brain of the pro-oestrus rat
DEFF Research Database (Denmark)
Desroziers, E; Mikkelsen, J; Simonneaux, V
2010-01-01
rat brain by comparing precisely the immunoreactive pattern obtained with two antibodies: one specifically directed against kisspeptin-52 (Kp-52), the longest isoform, and the other directed against kisspeptin-10 (Kp-10) whose sequence is common to all putative mature isoforms. With both antibodies......, immunoreactive cell bodies were exclusively observed in the arcuate nucleus, and immunoreactive fibres were confined to the septo-preoptico-hypothalamic continuum of the brain. Fibres were observed in the preoptic area, the diagonal band of Broca, the septohypothalamic area, the anteroventral periventricular...... terminalis were only recognised by antibody anti-Kp-10, suggesting that anti-Kp-10 may recognise a wider range of kisspeptin isoforms than anti-Kp-52 or cross-react with molecules other than kisspeptin in rat tissue. Overall, these results illustrate the variety of projection sites of kisspeptin neurones...
Energy Technology Data Exchange (ETDEWEB)
Tang, Zheng-hua [Xiangnan University-Gospell Joint Laboratory of Microwave Communication Technology, Xiangnan University, Chenzhou 423000 (China); Jiang, Zheng-Sheng [National Laboratory of Solid State Microstructures and Department of Physics, Nanjing University, Nanjing 210093 (China); Chen, Tao [Laboratory of Quantum Information and Quantum Materials, School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Lei, Da-Jun [Xiangnan University-Gospell Joint Laboratory of Microwave Communication Technology, Xiangnan University, Chenzhou 423000 (China); Yan, Wen-Yan, E-mail: yanwenyan88@126.com [School of Software and Communication Engineering, Xiangnan University, Chenzhou 423000 (China); Qiu, Feng; Huang, Jian-Quan; Deng, Hai-Ming; Yao, Min [Xiangnan University-Gospell Joint Laboratory of Microwave Communication Technology, Xiangnan University, Chenzhou 423000 (China)
2016-04-29
A novel phoxonic crystal using the piezoelectric (PMN-PT) and piezomagnetic (CoFe{sub 2}O{sub 4}) superlattices with three types of domains in a unit cell (PPSUC) is present, in which dual microwave photonic and phononic band gaps can be obtained simultaneously. Two categories of phononic band gaps, originating from both the Bragg scattering of acoustic waves in periodic structures at the Brillouin zone boundary and the electromagnetic wave-lattice vibration couplings near the Brillouin zone center, can be observed in the phononic band structures. The general characteristics of the microwave photonic band structures are similar to those of pure piezoelectric or piezomagnetic superlattices, with the major discrepancy being the appearance of nearly dispersionless branches within the microwave photonic band gaps, which show an extremely large group velocity delay. Thus, the properties may also be applied to compact acoustic-microwave devices. - Highlights: • Dual microwave photonic and phononic band gaps can coexist in the PPSUC. • Two categories of phononic band gaps with different mechanism can be obtained. • Nearly dispersionless branches appear in the microwave photonic band gaps.
Effects of Kisspeptin-10 on Lipid Metabolism in Cultured Chicken Hepatocytes
Directory of Open Access Journals (Sweden)
J. Wu
2012-09-01
Full Text Available Our previous studies showed that kisspeptin-10 (Kp-10 injected in vivo can markedly increase lipid anabolism in liver of quails. In order to investigate the direct effect of Kp-10 on lipid metabolism of hepatocytes in birds, cells were separated from embryos livers and cultured in vitro with 0, 100 and 1,000 nM Kp-10, respectively. The results showed that after 24 h treatment, cells viability was not affected by 100 nM Kp-10, but showed a mild decrease with 1,000 nM Kp-10 compared to the control cells. Based on the results of the cell viability, 100 nM dosage of Kp-10 was selected for the further study and analysis. Compared with control cells, total cholesterol (Tch contents in 100 nM treated cells were increased by 51.23%, but did not reach statistical significance, while the level of triglyceride (TG, high density of lipoprotein-cholesterol (HDL-C and low density of lipoprotein-cholesterol (LDL-C were significantly increased. Real-time PCR results showed that ApoVLDL-II mRNA expression had a tendency to increase, genes including sterol regulatory element-binding protein-1 (SREBP-1, acetyl coenzyme A carboxylase α (ACCα, carnitine palmitoyltransferase 1 (CPT1, 3-hydroxyl-3-methylglutaryl-coenzyme A reductases (HMGCR and stearyl coenzyme A dehydrogenase-1 (SCD1 mRNA in hepatocytes were significantly down-regulated by 100 nM Kp-10. However, contrary to its gene expression, SREBP-1 protein expression was significantly up-regulated by 100 nM Kp-10. Some of the significant correlations in mRNA expression were found between genes encoding hepatic factors or enzymes involved in lipid metabolism in liver of birds. These results indicate that Kp-10 stimulates lipid synthesis directly in primary cultured hepatocytes of chickens.
Directory of Open Access Journals (Sweden)
Nicolau Silveira-Neto
Full Text Available OBJECTIVES: This research evaluated detail registration in peri-implant bone using two different cone beam computer tomography systems and a digital periapical radiograph. METHODS: Three different image acquisition protocols were established for each cone beam computer tomography apparatus, and three clinical situations were simulated in an ex vivo fresh pig mandible: buccal bone defect, peri-implant bone defect, and bone contact. Data were subjected to two analyses: quantitative and qualitative. The quantitative analyses involved a comparison of real specimen measures using a digital caliper in three regions of the preserved buccal bone – A, B and E (control group – to cone beam computer tomography images obtained with different protocols (kp1, kp2, kp3, ip1, ip2, and ip3. In the qualitative analyses, the ability to register peri-implant details via tomography and digital periapical radiography was verified, as indicated by twelve evaluators. Data were analyzed with ANOVA and Tukey’s test (α=0.05. RESULTS: The quantitative assessment showed means statistically equal to those of the control group under the following conditions: buccal bone defect B and E with kp1 and ip1, peri-implant bone defect E with kp2 and kp3, and bone contact A with kp1, kp2, kp3, and ip2. Qualitatively, only bone contacts were significantly different among the assessments, and the p3 results differed from the p1 and p2 results. The other results were statistically equivalent. CONCLUSIONS: The registration of peri-implant details was influenced by the image acquisition protocol, although metal artifacts were produced in all situations. The evaluators preferred the Kodak 9000 3D cone beam computer tomography in most cases. The evaluators identified buccal bone defects better with cone beam computer tomography and identified peri-implant bone defects better with digital periapical radiography.
Involvement of the kynurenine pathway in human glioma pathophysiology.
Directory of Open Access Journals (Sweden)
Seray Adams
Full Text Available The kynurenine pathway (KP is the principal route of L-tryptophan (TRP catabolism leading to the production of kynurenine (KYN, the neuroprotectants, kynurenic acid (KYNA and picolinic acid (PIC, the excitotoxin, quinolinic acid (QUIN and the essential pyridine nucleotide, nicotinamide adenine dinucleotide (NAD(+. The enzymes indoleamine 2,3-dioxygenase-1 (IDO-1, indoleamine 2,3-dioxygenase-2 (IDO-2 and tryptophan 2,3-dioxygenase (TDO-2 initiate the first step of the KP. IDO-1 and TDO-2 induction in tumors are crucial mechanisms implicated to play pivotal roles in suppressing anti-tumor immunity. Here, we report the first comprehensive characterisation of the KP in 1 cultured human glioma cells and 2 plasma from patients with glioblastoma (GBM. Our data revealed that interferon-gamma (IFN-γ stimulation significantly potentiated the expression of the KP enzymes, IDO-1 IDO-2, kynureninase (KYNU, kynurenine hydroxylase (KMO and significantly down-regulated 2-amino-3-carboxymuconate semialdehyde decarboxylase (ACMSD and kynurenine aminotransferase-I (KAT-I expression in cultured human glioma cells. This significantly increased KP activity but significantly lowered the KYNA/KYN neuroprotective ratio in human cultured glioma cells. KP activation (KYN/TRP was significantly higher, whereas the concentrations of the neuroreactive KP metabolites TRP, KYNA, QUIN and PIC and the KYNA/KYN ratio were significantly lower in GBM patient plasma (n = 18 compared to controls. These results provide further evidence for the involvement of the KP in glioma pathophysiology and highlight a potential role of KP products as novel and highly attractive therapeutic targets to evaluate for the treatment of brain tumors, aimed at restoring anti-tumor immunity and reducing the capacity for malignant cells to produce NAD(+, which is necessary for energy production and DNA repair.
Magnetization reversal in ferromagnetic film through solitons by electromagnetic field
International Nuclear Information System (INIS)
Veerakumar, V.; Daniel, M.
2001-07-01
We study the reversal of magnetization in an isotopic ferromagnetic film free from charges by exposing it to a circularly polarized electromagnetic (EM) field. The magnetization excitations are obtained in the form of line and lump solitons of the completely integrable modified KP-II equation which is derived using a reductive perturbation method from the set of coupled Landau-Lifschitz and Maxwell equations. It is observed that when the polarization of the EM-field is reversed followed by a rotation, for every (π)/2-degrees, the magnetization is reversed. (author)
Yang, Xiao; Du, Dianlou
2010-08-01
The Poisson structure on CN×RN is introduced to give the Hamiltonian system associated with a spectral problem which yields the nonlinear Schrödinger (NLS) hierarchy. The Hamiltonian system is proven to be Liouville integrable. Some (2+1)-dimensional equations including NLS equation, Kadomtesev-Petviashvili I (KPI) equation, coupled KPI equation, and modified Kadomtesev-Petviashvili (mKP) equation, are decomposed into Hamilton flows via the NLS hierarchy. The algebraic curve, Abel-Jacobi coordinates, and Riemann-Jacobi inversion are used to obtain the algebrogeometric solutions of these equations.
International Nuclear Information System (INIS)
Yang Xiao; Du Dianlou
2010-01-01
The Poisson structure on C N xR N is introduced to give the Hamiltonian system associated with a spectral problem which yields the nonlinear Schroedinger (NLS) hierarchy. The Hamiltonian system is proven to be Liouville integrable. Some (2+1)-dimensional equations including NLS equation, Kadomtesev-Petviashvili I (KPI) equation, coupled KPI equation, and modified Kadomtesev-Petviashvili (mKP) equation, are decomposed into Hamilton flows via the NLS hierarchy. The algebraic curve, Abel-Jacobi coordinates, and Riemann-Jacobi inversion are used to obtain the algebrogeometric solutions of these equations.
Li, Deyu; Fedeles, Bogdan I; Singh, Vipender; Peng, Chunte Sam; Silvestre, Katherine J; Simi, Allison K; Simpson, Jeffrey H; Tokmakoff, Andrei; Essigmann, John M
2014-08-12
Viral lethal mutagenesis is a strategy whereby the innate immune system or mutagenic pool nucleotides increase the error rate of viral replication above the error catastrophe limit. Lethal mutagenesis has been proposed as a mechanism for several antiviral compounds, including the drug candidate 5-aza-5,6-dihydro-2'-deoxycytidine (KP1212), which causes A-to-G and G-to-A mutations in the HIV genome, both in tissue culture and in HIV positive patients undergoing KP1212 monotherapy. This work explored the molecular mechanism(s) underlying the mutagenicity of KP1212, and specifically whether tautomerism, a previously proposed hypothesis, could explain the biological consequences of this nucleoside analog. Establishing tautomerism of nucleic acid bases under physiological conditions has been challenging because of the lack of sensitive methods. This study investigated tautomerism using an array of spectroscopic, theoretical, and chemical biology approaches. Variable temperature NMR and 2D infrared spectroscopic methods demonstrated that KP1212 existed as a broad ensemble of interconverting tautomers, among which enolic forms dominated. The mutagenic properties of KP1212 were determined empirically by in vitro and in vivo replication of a single-stranded vector containing a single KP1212. It was found that KP1212 paired with both A (10%) and G (90%), which is in accord with clinical observations. Moreover, this mutation frequency is sufficient for pushing a viral population over its error catastrophe limit, as observed before in cell culture studies. Finally, a model is proposed that correlates the mutagenicity of KP1212 with its tautomeric distribution in solution.
Li, Deyu; Fedeles, Bogdan I.; Singh, Vipender; Peng, Chunte Sam; Silvestre, Katherine J.; Simi, Allison K.; Simpson, Jeffrey H.; Tokmakoff, Andrei; Essigmann, John M.
2014-01-01
Viral lethal mutagenesis is a strategy whereby the innate immune system or mutagenic pool nucleotides increase the error rate of viral replication above the error catastrophe limit. Lethal mutagenesis has been proposed as a mechanism for several antiviral compounds, including the drug candidate 5-aza-5,6-dihydro-2′-deoxycytidine (KP1212), which causes A-to-G and G-to-A mutations in the HIV genome, both in tissue culture and in HIV positive patients undergoing KP1212 monotherapy. This work explored the molecular mechanism(s) underlying the mutagenicity of KP1212, and specifically whether tautomerism, a previously proposed hypothesis, could explain the biological consequences of this nucleoside analog. Establishing tautomerism of nucleic acid bases under physiological conditions has been challenging because of the lack of sensitive methods. This study investigated tautomerism using an array of spectroscopic, theoretical, and chemical biology approaches. Variable temperature NMR and 2D infrared spectroscopic methods demonstrated that KP1212 existed as a broad ensemble of interconverting tautomers, among which enolic forms dominated. The mutagenic properties of KP1212 were determined empirically by in vitro and in vivo replication of a single-stranded vector containing a single KP1212. It was found that KP1212 paired with both A (10%) and G (90%), which is in accord with clinical observations. Moreover, this mutation frequency is sufficient for pushing a viral population over its error catastrophe limit, as observed before in cell culture studies. Finally, a model is proposed that correlates the mutagenicity of KP1212 with its tautomeric distribution in solution. PMID:25071207
Shifted-modified Chebyshev filters
ŞENGÜL, Metin
2013-01-01
This paper introduces a new type of filter approximation method that utilizes shifted-modified Chebyshev filters. Construction of the new filters involves the use of shifted-modified Chebyshev polynomials that are formed using the roots of conventional Chebyshev polynomials. The study also includes 2 tables containing the shifted-modified Chebyshev polynomials and the normalized element values for the low-pass prototype filters up to degree 6. The transducer power gain, group dela...
Salas, M. D.; Kuehn, M. S.
1994-01-01
Original version of program incorporated into program SRGULL (LEW-15093) for use on National Aero-Space Plane project, its duty being to model forebody, inlet, and nozzle portions of vehicle. However, real-gas chemistry effects in hypersonic flow fields limited accuracy of that version, because it assumed perfect-gas properties. As a result, SEAGULL modified according to real-gas equilibrium-chemistry methodology. This program analyzes two-dimensional, hypersonic flows of real gases. Modified version of SEAGULL maintains as much of original program as possible, and retains ability to execute original perfect-gas version.
Genetically modified foods and allergy.
Lee, T H; Ho, H K; Leung, T F
2017-06-01
2015 marked the 25th anniversary of the commercial use and availability of genetically modified crops. The area of planted biotech crops cultivated globally occupies a cumulative two billion hectares, equivalent to twice the land size of China or the United States. Foods derived from genetically modified plants are widely consumed in many countries and genetically modified soybean protein is extensively used in processed foods throughout the industrialised countries. Genetically modified food technology offers a possible solution to meet current and future challenges in food and medicine. Yet there is a strong undercurrent of anxiety that genetically modified foods are unsafe for human consumption, sometimes fuelled by criticisms based on little or no firm evidence. This has resulted in some countries turning away food destined for famine relief because of the perceived health risks of genetically modified foods. The major concerns include their possible allergenicity and toxicity despite the vigorous testing of genetically modified foods prior to marketing approval. It is imperative that scientists engage the public in a constructive evidence-based dialogue to address these concerns. At the same time, improved validated ways to test the safety of new foods should be developed. A post-launch strategy should be established routinely to allay concerns. Mandatory labelling of genetically modified ingredients should be adopted for the sake of transparency. Such ingredient listing and information facilitate tracing and recall if required.
Forcina, A; Baldan, R; Marasco, V; Cichero, P; Bondanza, A; Noviello, M; Piemontese, S; Soliman, C; Greco, R; Lorentino, F; Giglio, F; Messina, C; Carrabba, M; Bernardi, M; Peccatori, J; Moro, M; Biancardi, A; Nizzero, P; Scarpellini, P; Cirillo, D M; Mancini, N; Corti, C; Clementi, M; Ciceri, F
2017-01-01
Carbapenemase-producing Klebsiella pneumoniae (KPC-Kp) infections are an emerging cause of death after hematopoietic stem cell transplantation (HSCT). In allogeneic transplants, mortality rate may rise up to 60%. We retrospectively evaluated 540 patients receiving a transplant from an auto- or an allogeneic source between January 2011 and October 2015. After an Institutional increase in the prevalence of KPC-Kp bloodstream infections (BSI) in June 2012, from July 2012, 366 consecutive patients received the following preventive measures: (i) weekly rectal swabs for surveillance; (ii) contact precautions in carriers (iii) early-targeted therapy in neutropenic febrile carriers. Molecular typing identified KPC-Kp clone ST512 as the main clone responsible for colonization, BSI and outbreaks. After the introduction of these preventive measures, the cumulative incidence of KPC-Kp BSI (P=0.01) and septic shocks (P=0.01) at 1 year after HSCT was significantly reduced. KPC-Kp infection-mortality dropped from 62.5% (pre-intervention) to 16.6% (post-intervention). Day 100 transplant-related mortality and KPC-Kp infection-related mortality after allogeneic HSCT were reduced from 22% to 10% (P=0.001) and from 4% to 1% (P=0.04), respectively. None of the pre-HSCT carriers was excluded from transplant. These results suggest that active surveillance, contact precautions and early-targeted therapies, may efficiently control KPC-Kp spread and related mortality even after allogeneic HSCT.
Directory of Open Access Journals (Sweden)
Islam M. Saadeldin
2018-01-01
Full Text Available Recent studies showed the modulatory effect of kisspeptin (KP on calcium waves through the cell membrane and inside the cell. Spermatozoon can induce similar ooplasmic calcium oscillations at fertilization to trigger meiosis II. Here, we evaluated the effect of KP supplementation with 6-dimethylaminopurine (6-DMAP for 4 h on embryonic development after oocyte activation with single electric pulse, 5 µM ionomycin, or 8% ethanol. Compared to control nonsupplemented groups, KP significantly improved embryo developmental competence electric- and ethanol-activated oocytes in terms of cleavage (75.3% and 58.6% versus 64% and 48%, respectively, p<0.05 and blastocyst development (31.3% and 10% versus 19.3% and 4%, respectively, p<0.05. MOS expression was increased in electrically activated oocytes in presence of KP while it significantly reduced CCNB1 expression. In ionomycin treated group, both MOS and CCNB1 showed significant increase with no difference between KP and control groups. In ethanol-treated group, KP significantly reduced CCNB1 but no effect was observed on MOS expression. The early alterations in MOS and CCNB1 mRNA transcripts caused by KP may explain the significant differences in the developmental competence between the experimental groups. Kisspeptin supplementation may be adopted in protocols for porcine oocyte activation through electric current and ethanol to improve embryonic developmental competence.
Lee, Chen-Hsiang; Su, Lin-Hui; Tang, Ya-Fen; Liu, Jien-Wei
2006-11-01
To better understand the clinical outcomes of patients with extended-spectrum beta-lactamase-producing Klebsiella pneumoniae (ESBL-KP) bacteraemia treated with either flomoxef or a carbapenem, and to evaluate the in vitro activities of these antibiotics against ESBL-KP. Retrospective analyses to identify risk factors for mortality in patients with flomoxef-susceptible ESBL-KP, especially addressing the therapeutic roles of flomoxef and carbapenem. In vitro activities of flomoxef and carbapenem against flomoxef-susceptible ESBL-KP isolates were evaluated by susceptibility testing and time-kill study. Twenty-seven patients (flomoxef group, n=7; carbapenem group, n=20) were included. Clinical severity reflected by high Pitt bacteraemia score (>or=6) was an independent risk factor for mortality (OR 13.43; 95% CI, 1.08-166.73; P=0.043), while use of flomoxef or a carbapenem was not. The MICs of flomoxef and carbapenem indicated that the tested ESBL-KP were susceptible to these antibiotics regardless of the inoculum size of 10(5) or 10(7) cfu/mL. Time-kill study showed that these antibiotics (flomoxef 8 mg/L and meropenem 4 mg/L) each acted actively against and inhibited the regrowth of the tested ESBL-KP for at least 24 h. Flomoxef might be as clinically effective as a carbapenem in treating flomoxef-susceptible ESBL-KP bacteraemia.
Keragaman Genetik Plasma Nutfah Rambutan Di Indonesia Berdasarkan Karakter Morfologi
Kuswandi, Kuswandi; Sobir, Sobir; Suwarno, Willy Bayuardi
2014-01-01
Rambutan merupakan tanaman menyerbuk silang sehingga secara alami memiliki keragaman tinggi. Penelitian bertujuan mempelajari kemiripan genetik dan pengelompokan aksesi plasma nutfah rambutan (Nephelium lappaceum) dan kapulasan (Nephelium ramboutan-ake) di Indonesia berdasarkan karakteristik morfologi. Penelitian dilakukan di (1) Kebun Percobaan (KP) Aripan Balai Penelitian Tanaman Buah Tropika, (2) KP Subang Balai Penelitian Tanaman Buah Tropika, (3) KP Cipaku Balai Pengkajian Teknologi Pert...
Metabolic Impact on the Hypothalamic Kisspeptin-Kiss1r Signaling Pathway
Directory of Open Access Journals (Sweden)
Fazal Wahab
2018-03-01
Full Text Available A large body of data has established the hypothalamic kisspeptin (KP and its receptor, KISS1R, as major players in the activation of the neuroendocrine reproductive axis at the time of puberty and maintenance of reproductive capacity in the adult. Due to its strategic location, this ligand-receptor pair acts as an integrator of cues from gonadal steroids as well as of circadian and seasonal variation-related information on the reproductive axis. Besides these cues, the activity of the hypothalamic KP signaling is very sensitive to the current metabolic status of the body. In conditions of energy imbalance, either positive or negative, a number of alterations in the hypothalamic KP signaling pathway have been documented in different mammalian models including nonhuman primates and human. Deficiency of metabolic fuels during fasting causes a marked reduction of Kiss1 gene transcript levels in the hypothalamus and, hence, decreases the output of KP-containing neurons. Food intake or exogenous supply of metabolic cues, such as leptin, reverses metabolic insufficiency-related changes in the hypothalamic KP signaling. Likewise, alterations in Kiss1 expression have also been reported in other situations of energy imbalance like diabetes and obesity. Information related to the body’s current metabolic status reaches to KP neurons both directly as well as indirectly via a complex network of other neurons. In this review article, we have provided an updated summary of the available literature on the regulation of the hypothalamic KP-Kiss1r signaling by metabolic cues. In particular, the potential mechanisms of metabolic impact on the hypothalamic KP-Kiss1r signaling, in light of available evidence, are discussed.
Lu, Hongsheng; Sato, Yoshinori; Fujimura, Reiko; Nishizawa, Tomoyasu; Kamijo, Takashi; Ohta, Hiroyuki
2011-02-01
A Gram-negative, aerobic, heterotrophic bacterium, designated KP1-19(T), was isolated from a 22-year-old volcanic deposit at a site lacking vegetation on the island of Miyake, Japan. Strain KP1-19(T) was able to use thiosulfate (optimum concentration 10 mM) as an additional energy source. 16S rRNA gene sequence analysis indicated that strain KP1-19(T) was closely related to Limnobacter thiooxidans CS-K2(T) within the class Betaproteobacteria (97.7 % 16S rRNA gene sequence similarity). The cellular fatty acid profile was characteristic of the genus Limnobacter: the major fatty acids (>5 %) were C(16 : 0), C(16 : 1)ω7c and C(18 : 1)ω7c and minor amounts of C(10 : 0) 3-OH were also found. DNA-DNA relatedness between strain KP1-19(T) and L. thiooxidans LMG 19593(T) was 18 %. Therefore, strain KP1-19(T) represents a novel species, for which the name Limnobacter litoralis sp. nov. is proposed. The type strain is KP1-19(T) (=LMG 24869(T) =NBRC 105857(T) =CIP 109929(T)).
Chen, Chen-Peng; Chen, Chan-Cheng; Huang, Chia-Wen; Chang, Yen-Ching
2018-04-15
The skin permeability ( Kp ) defines the rate of a chemical penetrating across the stratum corneum. This value is widely used to quantitatively describe the transport of molecules in the outermost layer of epidermal skin and indicate the significance of skin absorption. This study defined a Kp quantitative structure-activity relationship (QSAR) based on 106 chemical substances of Kp measured using human skin and interpreted the molecular interactions underlying transport behavior of small molecules in the stratum corneum. The Kp QSAR developed in this study identified four molecular descriptors that described the molecular cyclicity in the molecule reflecting local geometrical environments, topological distances between pairs of oxygen and chlorine atoms, lipophilicity, and similarity to antineoplastics in molecular properties. This Kp QSAR considered the octanol-water partition coefficient to be a direct influence on transdermal movement of molecules. Moreover, the Kp QSAR identified a sub-domain of molecular properties initially defined to describe the antineoplastic resemblance of a compound as a significant factor in affecting transdermal permeation of solutes. This finding suggests that the influence of molecular size on the chemical's skin-permeating capability should be interpreted with other relevant physicochemical properties rather than being represented by molecular weight alone.
Phosphonium modified clay/polyimide nanocomposites
International Nuclear Information System (INIS)
Ceylan, Hatice; Çakmakçi, Emrah; Beyler-Çiǧil, Asli; Kahraman, Memet Vezir
2014-01-01
In this study, octyltriphenylphosphonium bromide [OTPP-Br] was prepared from the reaction of triphenylphosphine and 1 -bromooctane. The modification of clay was done by ion exchange reaction using OTPP-Br in water medium. Poly(amic acid) was prepared from the reaction of 3,3',4,4'-Benzophenonetetracarboxylic dianhydride (BTDA) and 4,4'-Oxydianiline (ODA). Polyimide(PI)/clay hybrids were prepared by blending of poly(amic acid) and organically modified clay as a type of layered clays. The morphology of the Polyimide/ phosphonium modified clay hybrids was characterized by scanning electron microscopy (SEM). Chemical structures of polyimide and Polyimide/ phosphonium modified clay hybrids were characterized by FTIR. SEM and FTIR results showed that the Polyimide/ phosphonium modified clay hybrids were successfully prepared. Thermal properties of the Polyimide/ phosphonium modified clay hybrids were characterized by thermogravimetric analysis (TGA)
Directory of Open Access Journals (Sweden)
E. I. Unuabonah
2017-01-01
Full Text Available The adsorption efficiency of a new hybrid clay adsorbent for polynuclear aromatic hydrocarbons (PAHs is compared with known modified clay adsorbents. The new hybrid clay adsorbent (HYCA showed far higher adsorption capacities for the adsorption of various PAH molecules compared with sodium dodecyl sulfate modified and humic acid modified Bentonite clay adsorbents. With the new hybrid clay adsorbent (HYCA, the adsorption of some of the larger PAH molecules was complete in the first 1 h as compared with ≈ 62% and ≈ 76% observed for both humic acid modified and sodium dodecyl sulfate modified Bentonite clay adsorbents respectively. In 24 h adsorption of the PAHs was complete for all adsorbents with HYCA adsorbent showing better efficiency in the removal of the PAH molecules from aqueous solutions. No significant change was observed with increase in time up to 48 h. The adsorption was observed to be more spontaneous with HYCA adsorbent than with either modified Bentonite adsorbents. The enthalpy of adsorption did not follow any specific order and were not consistent for all PAH molecules considered.
Wu, Ping-Feng; Chuang, Chien; Su, Chin-Fang; Lin, Yi-Tsung; Chan, Yu-Jiun; Wang, Fu-Der; Chuang, Yin-Ching; Siu, L Kristopher; Fung, Chang-Phone
2016-09-02
Carbapenem resistance in Klebsiella pneumoniae is important because of its increasing prevalence and limited therapeutic options. To investigate the clinical and microbiological characteristics of patients infected or colonized with carbapenem non-susceptible K. pneumoniae (CnsKP) in Taiwan, we conducted a retrospective study at Taipei Veterans General Hospital from January 2012 to November 2013. Carbapenem non-susceptibility was defined as a minimum inhibitory concentration (MIC) of ≥2 mg/L for imipenem or meropenem. A total of 105 cases with CnsKP were identified: 49 patients with infection and 56 patients with colonization. Thirty-one isolates had genes that encoded carbapenemases (29.5%), including K. pneumoniae carbapenemase (KPC)-2 (n = 27), KPC-3 (n = 1), VIM-1 (n = 1) and IMP-8 (n = 2). The in-hospital mortality among patients with CnsKP was 43.8%. A MIC for imipenem ≥16 μg/mL, nasogastric intubation and Acute Physiology and Chronic Health Evaluation II score were independent risk factors for in-hospital mortality for all patients with CnsKP. A MIC for imipenem ≥16 μg/mL was also an independent risk factor for 14-day mortality in patients with CnsKP. In conclusion, a positive culture for CnsKP was associated with high in-hospital mortality. A high imipenem MIC of CnsKP can predispose a patient to a poor prognosis.
Directory of Open Access Journals (Sweden)
C H J Albers-Wolthers
Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.
Modeling and Predicting the Daily Equatorial Plasma Bubble Activity Using the Tiegcm
Carter, B. A.; Retterer, J. M.; Yizengaw, E.; Wiens, K. C.; Wing, S.; Groves, K. M.; Caton, R. G.; Bridgwood, C.; Francis, M. J.; Terkildsen, M. B.; Norman, R.; Zhang, K.
2014-12-01
Describing and understanding the daily variability of Equatorial Plasma Bubble (EPB) occurrence has remained a significant challenge over recent decades. In this study we use the Thermosphere Ionosphere Electrodynamics General Circulation Model (TIEGCM), which is driven by solar (F10.7) and geomagnetic (Kp) activity indices, to study daily variations of the linear Rayleigh-Taylor (R-T) instability growth rate in relation to the measured scintillation strength at five longitudinally distributed stations. For locations characterized by generally favorable conditions for EPB growth (i.e., within the scintillation season for that location) we find that the TIEGCM is capable of identifying days when EPB development, determined from the calculated R-T growth rate, is suppressed as a result of geomagnetic activity. Both observed and modeled upward plasma drift indicate that the pre-reversal enhancement scales linearly with Kp from several hours prior, from which it is concluded that even small Kp changes cause significant variations in daily EPB growth. This control of Kp variations on EPB growth prompted an investigation into the use of predicted Kp values from the Wing Kp model over a 2-month equinoctial campaign in 2014. It is found that both the 1-hr and 4-hr predicted Kp values can be reliably used as inputs into the TIEGCM to forecast the EPB growth conditions during scintillation season, when daily EPB variability is governed by the suppression of EPBs on days with increased, but not necessarily high, geomagnetic activity.
Magnetic excitations in (VO)HPO4· 1/2 H2O
International Nuclear Information System (INIS)
Garrett, A.W.; Nagler, S.E.; Tennant, D.A.
1997-01-01
The magnetic excitations of an antiferromagnetic spin dimer system, (VO)HPO 4 · 1/2 H 2 O, are examined using inelastic neutron scattering. A dispersionless mode is found, consistent with expectations for a dimer excitation. The intensity variation of the mode reveals a V 4+ - V 4+ dimer separation of 4.43 angstrom, almost 50% larger than the originally expected length
Surface-modified electrodes (SME)
Schreurs, J.P.G.M.; Barendrecht, E.
1984-01-01
This review deals with the literature (covered up to August 1983), the characterization and the applications of Surface-Modified Electrodes (SME). As a special class of SME's, the Enzyme-Modified Electrode (EME) is introduced. Three types of modification procedures are distinguished; i.e. covalent
Modified blank ammunition injuries.
Ogunc, Gokhan I; Ozer, M Tahir; Coskun, Kagan; Uzar, Ali Ihsan
2009-12-15
Blank firing weapons are designed only for discharging blank ammunition cartridges. Because they are cost-effective, are easily accessible and can be modified to live firearms plus their unclear legal situation in Turkish Law makes them very popular in Turkey. 2004 through 2008, a total of 1115 modified blank weapons were seized in Turkey. Blank firing weapons are easily modified by owners, making them suitable for discharging live firearm ammunition or modified blank ammunitions. Two common methods are used for modification of blank weapons. After the modification, these weapons can discharge the live ammunition. However, due to compositional durability problems with these types of weapons; the main trend is to use the modified blank ammunitions rather than live firearm ammunition fired from modified blank firing weapons. In this study, two types of modified blank weapons and two types of modified blank cartridges were tested on three different target models. Each of the models' shooting side was coated with 1.3+/-2 mm thickness chrome tanned cowhide as a skin simulant. The first model was only coated with skin simulant. The second model was coated with skin simulant and 100% cotton police shirt. The third model was coated with skin simulant and jean denim. After the literature evaluation four high risky anatomic locations (the neck area; the eyes; the thorax area and inguinal area) were pointed out for the steel and lead projectiles are discharged from the modified blank weapons especially in close range (0-50 cm). The target models were designed for these anatomic locations. For the target models six Transparent Ballistic Candle blocks (TCB) were prepared and divided into two test groups. The first group tests were performed with lead projectiles and second group with steel projectile. The shortest penetration depth (lead projectile: 4.358 cm; steel projectile 8.032 cm) was recorded in the skin simulant and jean denim coated block for both groups. In both groups
Discrete integrable systems and deformations of associative algebras
International Nuclear Information System (INIS)
Konopelchenko, B G
2009-01-01
Interrelations between discrete deformations of the structure constants for associative algebras and discrete integrable systems are reviewed. Theory of deformations for associative algebras is presented. Closed left ideal generated by the elements representing the multiplication table plays a central role in this theory. Deformations of the structure constants are generated by the deformation driving algebra and governed by the central system of equations. It is demonstrated that many discrete equations such as discrete Boussinesq equation, discrete WDVV equation, discrete Schwarzian KP and BKP equations, discrete Hirota-Miwa equations for KP and BKP hierarchies are particular realizations of the central system. An interaction between the theories of discrete integrable systems and discrete deformations of associative algebras is reciprocal and fruitful. An interpretation of the Menelaus relation (discrete Schwarzian KP equation), discrete Hirota-Miwa equation for KP hierarchy, consistency around the cube as the associativity conditions and the concept of gauge equivalence, for instance, between the Menelaus and KP configurations are particular examples.
Kaur, G; Chandra, M; Dwivedi, P N
2016-03-01
Canine parvovirus (CPV) causes hemorrhagic enteritis, especially in young dogs, leading to high morbidity and mortality. It has four main antigenic types CPV-2, CPV-2a, CPV-2b and CPV-2c. Virus protein 2 (VP2) is the main capsid protein and mutations affecting VP2 gene are responsible for the evolution of various antigenic types of CPV. Full length VP2 gene from field isolates was amplified and cloned for sequence analysis. The sequences were submitted to the GenBank and were assigned Acc. Nos., viz. KP406928.1 for P12, KP406927.1 for P15, KP406930.1 for P32, KP406926.1 for Megavac-6 and KP406929.1 for NobivacDHPPi. Phylogenetic analysis indicated that the samples were forming a separate clad with vaccine strains. When the samples were compared with the world and Indian isolates, it was observed that samples formed a separate node indicating regional genetic variation in CPV.
The causative role and therapeutic potential of the kynurenine pathway in neurodegenerative disease.
Amaral, Marta; Outeiro, Tiago F; Scrutton, Nigel S; Giorgini, Flaviano
2013-06-01
Metabolites of the kynurenine pathway (KP), which arise from the degradation of tryptophan, have been studied in detail for over a century and garnered the interest of the neuroscience community in the late 1970s and early 1980s with work uncovering the neuromodulatory potential of this pathway. Much research in the following decades has found that perturbations in the levels of KP metabolites likely contribute to the pathogenesis of several neurodegenerative diseases. More recently, it has become apparent that targeting KP enzymes, in particular kynurenine 3-monooxygenase (KMO), may hold substantial therapeutic potential for these disorders. Here we provide an overview of the KP, the neuroactive properties of KP metabolites and their role in neurodegeneration. We also discuss KMO as a therapeutic target for these disorders, and our recent resolution of the crystallographic structure of KMO, which will permit the development of new and improved KMO inhibitors which may ultimately expedite clinical application of these compounds.
Torres-Santos, E C; Da Silva, S A G; Costa, S S; Santos, A P P T; Almeida, A P; Rossi-Bergmann, B
2003-08-01
Leishmaniasis is an extremely difficult disease to treat. Previously, it was shown that oral Kalanchoe pinnata (Kp) leaf extract is strongly effective against murine leishmaniasis. Here, it is shown that the serum levels of alanine-aminotransferase (ALT), aspartate-aminotransferase (AST), urea and alkaline phosphatase were unchanged in mice orally treated with supraoptimal Kp doses for 30 days, indicating the absence of chronic toxicity to the liver, heart or kidney. Additionally, evidence is presented that human leishmaniasis may also be controlled with oral Kp. A 36-year-old man with an active cutaneous leishmaniasis was orally treated with 30 g wet weight of Kp leaves/day for 14 days. During the Kp treatment, the lesion stopped growing and slightly decreased. No adverse reactions or toxicity was observed. This study reports for the first time that Kalanchoe pinnata contains substances potentially active and safe for the oral treatment of human cutaneous leishmaniasis. Copyright 2003 John Wiley & Sons, Ltd.
Kalanchoe pinnata inhibits mast cell activation and prevents allergic airway disease.
Cruz, E A; Reuter, S; Martin, H; Dehzad, N; Muzitano, M F; Costa, S S; Rossi-Bergmann, B; Buhl, R; Stassen, M; Taube, C
2012-01-15
Aqueous extract of Kalanchoe pinnata (Kp) have been found effective in models to reduce acute anaphylactic reactions. In the present study, we investigate the effect of Kp and the flavonoid quercetin (QE) and quercitrin (QI) on mast cell activation in vitro and in a model of allergic airway disease in vivo. Treatment with Kp and QE in vitro inhibited degranulation and cytokine production of bone marrow-derived mast cells following IgE/FcɛRI crosslinking, whereas treatment with QI had no effect. Similarly, in vivo treatment with Kp and QE decreased development of airway hyperresponsiveness, airway inflammation, goblet cell metaplasia and production of IL-5, IL-13 and TNF. In contrast, treatment with QI had no effect on these parameters. These findings demonstrate that treatment with Kp or QE is effective in treatment of allergic airway disease, providing new insights to the immunomodulatory functions of this plant. Copyright © 2011 Elsevier GmbH. All rights reserved.
Gomes, D C O; Muzitano, M F; Costa, S S; Rossi-Bergmann, B
2010-04-01
Previously, we described the protective action of the immunomodulatory extract of Kalanchoe pinnata (Kp) in murine and human cutaneous leishmaniasis. In the present study, we investigated the effectiveness of Kp against visceral leishmaniasis, using the BALB/c mouse model of infection with Leishmania chagasi. Mice receiving oral daily doses of Kp (400 mg/kg) for 30 days displayed significantly reduced hepatic and splenic parasite burden, when compared with untreated animals. Protectiveness was accompanied by a reduction in parasite-specific IgG serum levels, and impaired capacity of spleen cells to produce IL-4, but not IFN-gamma and nitric oxide upon antigen recall in vitro. The reference drug Pentostam (72 mg/kg) given by the intra-peritoneal route on alternate days produced an anti-leishmanial effect similar to oral Kp. Our findings show that the oral efficacy of Kp, seen previously in murine cutaneous leishmaniasis, extends also to visceral leishmaniasis caused by L. chagasi, a difficult to treat and lethal disease of man.
Tom, Jeffrey O; Chen, Chuhe; Zhou, Yi Yvonne
2014-01-01
To determine the association of parental use of integrated personal health records (PHRs) with children's adherence to immunization and well-child care (WCC) visit recommendations. For the immunization and WCC visit measures, we retrospectively analyzed, respectively, 766 and 639 matched pairs at Kaiser Permanente (KP) Hawaii and 2795 and 2448 pairs at KP Northwest who were ≤ 31 days old at enrollment and continuously enrolled for 2 years between January 2007 and July 2011. The independent variable (≥ 1 PHR feature used vs none) was matched using propensity scores on parental and children characteristics. The dependent variables were 2 measures from the 2010 Healthcare Effectiveness Data and Information Set: combination 2 immunization (all immunizations vs immunizations only at KP Northwest (KP Hawaii: OR 1.1, 95% CI 0.8-1.4, P > .05; KP Northwest OR 1.2, 95% CI 1.0-1.3, P immunizations in only 1 region. Copyright © 2014 Mosby, Inc. All rights reserved.
Zhang, Huaidong; Li, Qin; Wang, Lina; Chen, Yan
2018-05-01
Alcohol dehydrogenases (ADHs) catalyze the reversible oxidation of alcohol using NAD + or NADP + as cofactor. Three ADH homologues have been identified in Komagataella phaffii GS115 (also named Pichia pastoris GS115), ADH1, ADH2 and ADH3, among which adh3 is the only gene responsible for consumption of ethanol in Komagataella phaffii GS115. However, the relationship between structure and function of mitochondrial alcohol dehydrogenase isozyme III from Komagataella phaffii GS115 (KpADH3) is still not clear yet. KpADH3 was purified, identified and characterized by multiple biophysical techniques (Nano LC-MS/MS, Enzymatic activity assay, X-ray crystallography). The crystal structure of KpADH3, which was the first ADH structure from Komagataella phaffii GS115, was solved at 1.745 Å resolution. Structural analysis indicated that KpADH3 was the sole dimeric ADH structure with face-to-face orientation quaternary structure from yeast. The major structural different conformations located on residues 100-114 (the structural zinc binding loop) and residues 337-344 (the loop between α12 and β15 which covered the catalytic domain). In addition, three channels were observed in KpADH3 crystal structure, channel 2 and channel 3 may be essential for substrate specific recognition, ingress and egress, channel 1 may be the pass-through for cofactor. KpADH3 plays an important role in the metabolism of alcohols in Komagataella phaffii GS115, and its crystal structure is the only dimeric medium-chain ADH from yeast described so far. Knowledge of the relationship between structure and function of KpADH3 is crucial for understanding the role of KpADH3 in Komagataella phaffii GS115 mitochondrial metabolism. Copyright © 2018 Elsevier B.V. All rights reserved.
Hiney, Jill K; Srivastava, Vinod K; Vaden Anderson, Danielle N; Hartzoge, Nicole L; Dees, William L
2018-01-01
Alcohol (ALC) causes suppressed secretion of prepubertal luteinizing hormone-releasing hormone (LHRH). Insulin-like growth factor-1 (IGF-1) and kisspeptin (Kp) are major regulators of LHRH and are critical for puberty. IGF-1 may be an upstream mediator of Kp in the preoptic area and rostral hypothalamic area (POA/RHA) of the rat brain, a region containing both Kp and LHRH neurons. We investigated the ability of IGF-1 to stimulate prepubertal Kp synthesis and release in POA/RHA, and the potential inhibitory effects of ALC. Immature female rats were administered either ALC (3 g/kg) or water via gastric gavage at 0730 hours. At 0900 hours, both groups were subdivided where half received either saline or IGF-1 into the brain third ventricle. A second dose of ALC (2 g/kg) or water was administered at 1130 hours. Rats were killed 6 hours after injection and POA/RHA region collected. IGF-1 stimulated Kp, an action blocked by ALC. Upstream to Kp, IGF-1 receptor (IGF-1R) activation, as demonstrated by the increase in insulin receptor substrate 1, resulted in activation of Akt, tuberous sclerosis 2, ras homologue enriched in brain, and mammalian target of rapamycin (mTOR). ALC blocked the central action of IGF-1 to induce their respective phosphorylation. IGF-1 specificity and ALC specificity for the Akt-activated mTOR pathway were demonstrated by the absence of effects on PRAS40. Furthermore, IGF-1 stimulated Kp release from POA/RHA incubated in vitro. IGF-1 stimulates prepubertal Kp synthesis and release following activation of a mTOR signaling pathway, and ALC blocks this pathway at the level of IGF-1R. Copyright © 2017 by the Research Society on Alcoholism.
Directory of Open Access Journals (Sweden)
J. Wu
2013-08-01
Full Text Available Our previous results showed that kisspeptin-10 (Kp-10 injections via intraperitoneal (i.p. once daily for three weeks notably promoted the egg laying rate in quails. In order to investigate the mechanism behind the effects of Kp-10 on enhancing the egg laying rate in birds, this study focused on the alternations of lipids synthesis in liver after Kp-10 injections. 75 female quails (22 d of age were allocated to three groups randomly, and subjected to 0 (control, Con, 10 nmol (low dosage, L and 100 nmol (high dosage, H Kp-10 injections via i.p. once daily for three weeks, respectively. At d 52, quails were sacrificed and sampled for further analyses. Serum E2 concentration was increased by Kp-10 injections, and reached statistical significance in H group. Serum triglyceride (TG concentrations were increased by 46.7% in L group and 36.8% in H group, respectively, but did not reach statistical significance, and TG contents in liver were significantly elevated by Kp-10 injections in a dose-dependent manner. Serum total cholesterol (Tch concentrations significantly decreased in H group, while in H group the hepatic Tch content was markedly increased. The level of non-esterified fatty acid (NEFA, apolipoprotein A1 and B (apoA1 and apoB were not altered by Kp-10 injections. The genes expression of sterol regulatory element binding protein-1 (SREBP-1, fatty acid synthetase (FAS, apolipoprotein VLDL-II (apoVLDL-II, cholesterol 7α-hydroxylase (CYP7A1 and vitellogenin II (VTG-II were significantly up-regulated by high but not low dosage of Kp-10 injection compared to the control group. However, the expression of SREBP-2, acetyl-CoA carboxylase (ACCα, malic enzyme (ME, stearoyl-CoA (Δ9 desaturase 1 (SCD1, apolipoprotein A1 (apoA1, fatty acid binding protein 2 (FABP2, 3-hydroxyl-3-methyl glutaryl-coenzyme A reductases (HMGCR, estrogen receptor α, β (ERα and β mRNA were not affected by Kp-10 treatment. In line with hepatic mRNA abundance, hepatic SREBP
Empirical model of TEC response to geomagnetic and solar forcing over Balkan Peninsula
Mukhtarov, P.; Andonov, B.; Pancheva, D.
2018-01-01
An empirical total electron content (TEC) model response to external forcing over Balkan Peninsula (35°N-50°N; 15°E-30°E) is built by using the Center for Orbit Determination of Europe (CODE) TEC data for full 17 years, January 1999 - December 2015. The external forcing includes geomagnetic activity described by the Kp-index and solar activity described by the solar radio flux F10.7. The model describes the most probable spatial distribution and temporal variability of the externally forced TEC anomalies assuming that they depend mainly on latitude, Kp-index, F10.7 and LT. The anomalies are expressed by the relative deviation of the TEC from its 15-day mean, rTEC, as the mean value is calculated from the 15 preceding days. The approach for building this regional model is similar to that of the global TEC model reported by Mukhtarov et al. (2013a) however it includes two important improvements related to short-term variability of the solar activity and amended geomagnetic forcing by using a "modified" Kp index. The quality assessment of the new constructing model procedure in terms of modeling error calculated for the period of 1999-2015 indicates significant improvement in accordance with the global TEC model (Mukhtarov et al., 2013a). The short-term prediction capabilities of the model based on the error calculations for 2016 are improved as well. In order to demonstrate how the model is able to reproduce the rTEC response to external forcing three geomagnetic storms, accompanied also with short-term solar activity variations, which occur at different seasons and solar activity conditions are presented.
Whitham modulation theory for the Kadomtsev- Petviashvili equation
Ablowitz, Mark J.; Biondini, Gino; Wang, Qiao
2017-08-01
The genus-1 Kadomtsev-Petviashvili (KP)-Whitham system is derived for both variants of the KP equation; namely the KPI and KPII equations. The basic properties of the KP-Whitham system, including symmetries, exact reductions and its possible complete integrability, together with the appropriate generalization of the one-dimensional Riemann problem for the Korteweg-de Vries equation are discussed. Finally, the KP-Whitham system is used to study the linear stability properties of the genus-1 solutions of the KPI and KPII equations; it is shown that all genus-1 solutions of KPI are linearly unstable, while all genus-1 solutions of KPII are linearly stable within the context of Whitham theory.
Directory of Open Access Journals (Sweden)
Assaeedi Abdulrahman
2014-10-01
Full Text Available Isolation and identification of new alkalophilic Bacillus strains have been increasing interest due to their possessing valuable and commercially interesting enzymes. In the present study, a total six obligate and facultative alkalophilic isolates were isolated from desert soil around the Al-qunfotha city, Saudi Arabia. All isolates were phenotypically and genotypically characterized. Among these isolates; AS3, AS4, AS5 and AS6 could grow at pH 9, 10, 11 and 12, but could not grow at pH 7, indicates that these isolates are obligate alkalophiles. While, isolates AS1 and AS2 grew at pH ranged from 7 to 10, but could not grow at pH 11 and 12, suggesting that they could be facultative alkalophiles. All isolates could hydrolyze casein and starch, indicating that they possess interesting amylase and protease enzymes. Based on 16S rDNA data, the phylogenetic analysis of these strains showed that all six alkalophilic Bacillus belonged to Bacillus cohnii with 99% similarity. The nucleotide sequences of 16S rRNA gene for the six isolates were deposited in a Gene-bank under accession numbers; KP053301, KP053302, KP053303, KP053304, KP053305 and KP053306, respectively.
Lee, Sang Ju; Choi, Min Ju; Zheng, Zhenlong; Chung, Won Soon; Kim, Young Koo; Cho, Sung Bin
2013-06-01
Keratosis pilaris (KP) has beenpresented as small keratotic follicular papules with or without surrounding erythema. Various treatments with laser or light therapy have been used for the management of KP with various clinical outcomes. In the present study, we investigated the efficacy and safety of a combination therapy for KP. A total of 29 anatomical sites with KP in 26 patients were treated using a 595-nm pulsed dye laser (PDL) with nonpurpuragenic fluences, a long-pulsed 755-nm alexandrite laser, and microdermabrasion. Clinical improvement was assessed by comparing preand posttreatment clinical photographs and patient satisfaction rates. Evaluation of the clinical results three months after the treatments showed that 12 of the 29 anatomical sites (41.4%) demonstrated Grade 3 clinical improvement, ten (34.5%) had Grade 2 clinical improvement, four (13.8%) showed Grade 1 improvement, and three (10.3%) showed Grade 4 improvement. We observed that KP lesions improved not only in erythema and skin texture, but also in brownish dyschromias. Potential adverse events were not observed, except prolonged posttherapy scaling. Our observations demonstrate that combination therapy using a 595-nm PDL, a long-pulsed 755-nm alexandrite laser, and microdermabrasion can have a positive therapeutic effect on KP.
Directory of Open Access Journals (Sweden)
Chen-Peng Chen
2018-04-01
Full Text Available The skin permeability (Kp defines the rate of a chemical penetrating across the stratum corneum. This value is widely used to quantitatively describe the transport of molecules in the outermost layer of epidermal skin and indicate the significance of skin absorption. This study defined a Kp quantitative structure-activity relationship (QSAR based on 106 chemical substances of Kp measured using human skin and interpreted the molecular interactions underlying transport behavior of small molecules in the stratum corneum. The Kp QSAR developed in this study identified four molecular descriptors that described the molecular cyclicity in the molecule reflecting local geometrical environments, topological distances between pairs of oxygen and chlorine atoms, lipophilicity, and similarity to antineoplastics in molecular properties. This Kp QSAR considered the octanol-water partition coefficient to be a direct influence on transdermal movement of molecules. Moreover, the Kp QSAR identified a sub-domain of molecular properties initially defined to describe the antineoplastic resemblance of a compound as a significant factor in affecting transdermal permeation of solutes. This finding suggests that the influence of molecular size on the chemical’s skin-permeating capability should be interpreted with other relevant physicochemical properties rather than being represented by molecular weight alone.
International Nuclear Information System (INIS)
Hassan, Mohammad L.; Moorefield, Charles M.; Elbatal, Hany S.; Newkome, George R.; Modarelli, David A.; Romano, Natalie C.
2012-01-01
Highlights: ► Surfaces of cellulose nanocrystals were modified with terpyridine ligands. ► Fluorescent nanocrystals could be obtained via self-assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals. ► Further self-assembly of azide-functionalized terpyridine onto the fluorescent cellulose nanocrystals was possible to obtain nanocellulosic material with expected use in bioimaging. - Abstract: Due to their natural origin, biocompatibility, and non-toxicity, cellulose nanocrystals are promising candidates for applications in nanomedicine. Highly fluorescent nanocellulosic material was prepared via surface modification of cellulose nanocrystals with 2,2′:6′,2″-terpyridine side chains followed by supramolecular assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals (CTP) via Ru III /Ru II reduction. The prepared terpyridine-modified cellulose-Ru II -terpyridine-modified perylene (CTP-Ru II -PeryTP) fluorescent nanocrystals were characterized using cross-polarized/magic angle spin 13 C nuclear magnetic resonance (CP/MAS 13 C NMR), Fourier transform infrared (FTIR), UV–visible, and fluorescence spectroscopy. In addition, further self-assembly of terpyridine units with azide functional groups onto CTP-Ru II -PeryTP was possible via repeating the Ru III /Ru II reduction protocol to prepare supramolecular fluorescent nanocrystals with azide functionality (CTP-Ru II -PeryTP-Ru II -AZTP). The prepared derivative may have potential application in bio-imaging since the terminal azide groups can be easily reacted with antigens via “Click” chemistry reaction.
In vitro-in vivo evaluation of in situ gelling and thermosensitive ketoprofen liquid suppositories.
Ozgüney, Işık; Kardhiqi, Anita; Yıldız, Gülbeyaz; Ertan, Gökhan
2014-12-01
The main objective of this study was to investigate the release and pharmacokinetic profiles of ketoprofen (KP) from developed thermosensitive and mucoadhesive liquid suppositories. Thermosensitive liquid suppositories were prepared using KP, poloxamer 407 (P 407), poloxamer 188 (P 188) and various amounts of different mucoadhesive polymers. In vitro release studies was monitored by the USP XXVI paddle method. The results thus obtained were evaluated kinetically and mechanism of release was analyzed. Identification of poloxamer gel localization in vivo was conducted using white male rabbits by adding 1 % methylene blue. For in vivo studies, twenty-four white male rabbits were randomly divided into three groups. The rabbits in each group were administered with liquid suppository F1 [P407/P188/KP (4/20/2.5 %)], F5 [P407/P188/KP/C (4/20/2.5/0.8 %)] or conventional suppository (F-C) into the rectum. The plasma concentration of KP was analyzed by high performance liquid chromatography (HPLC). C max, AUC, MRT and T max were evaluated. The release of KP was variously affected by the mucoadhesive polymers. In vitro release studies showed that Carbopol 934 P(C) has significant effect on release rate among the mucoadhesive polymers. When the formulations were evaluated kinetically, different kinetic models were obtained. Formulation F6 [P407/P188/KP/C (4/20/2.5/1.6 %)] which contains the highest C concentration and very high viscosity, shows a significantly better fit with Higuchi kinetic model. n value of this formulation was also found approximately 0.5. n exponent results of the other formulations showed that KP might be released from the suppositories by non-Fickian diffusion. Identification of poloxamer gel localization in vivo showed that the suppositories remain in the rectum without leakage after administration. With regard to the results of in vivo studies, the AUC6→14 values of KP in liquid suppository containing C are significantly higher than those in
Directory of Open Access Journals (Sweden)
Surafel Luleseged Tilahun
2012-01-01
Full Text Available Firefly algorithm is one of the new metaheuristic algorithms for optimization problems. The algorithm is inspired by the flashing behavior of fireflies. In the algorithm, randomly generated solutions will be considered as fireflies, and brightness is assigned depending on their performance on the objective function. One of the rules used to construct the algorithm is, a firefly will be attracted to a brighter firefly, and if there is no brighter firefly, it will move randomly. In this paper we modify this random movement of the brighter firefly by generating random directions in order to determine the best direction in which the brightness increases. If such a direction is not generated, it will remain in its current position. Furthermore the assignment of attractiveness is modified in such a way that the effect of the objective function is magnified. From the simulation result it is shown that the modified firefly algorithm performs better than the standard one in finding the best solution with smaller CPU time.
Kisspeptin and Metabolism: The Brain and Beyond
Directory of Open Access Journals (Sweden)
Monika Dudek
2018-04-01
Full Text Available Apart from the well-established role of kisspeptin (Kp in the regulation of reproductive functions, recent data described its action in the control of metabolism. Of particular interest for the review is the population of Kp neurons localized in the arcuate nucleus (ARC of the hypothalamus, the site of the brain where reproductive and metabolic cross talk occurs. However, within the hypothalamus Kp does not work alone, but rather interacts with other neuropeptides, e.g., neurokinin B, dynorphin A, proopiomelanocortin, the cocaine- and amphetamine-regulated transcript, agouti-related peptide, and neuropeptide Y. Beyond the brain, Kp is expressed in peripheral tissues involved in metabolic functions. In this review, we will mainly focus on the local action of this peptide in peripheral organs such as the pancreas, liver, and the adipose tissue. We will concentrate on dysregulation of the Kp system in cases of metabolic imbalance, e.g., obesity and diabetes. Importantly, these patients besides metabolic health problems often suffer from disruptions of the reproductive system, manifested by abnormalities in menstrual cycles, premature child birth, miscarriages in women, decreased testosterone levels and spermatogenesis in men, hypogonadism, and infertility. We will review the evidence from animal models and clinical data indicating that Kp could serve as a promising agent with clinical applications in regulation of reproductive problems in individuals with obesity and diabetes. Finally, emerging data indicate a role of Kp in regulation of insulin secretion, potentially leading to development of further therapeutic uses of this peptide to treat metabolic problems in patients with these lifestyle diseases.
Kisspeptin and Metabolism: The Brain and Beyond.
Dudek, Monika; Ziarniak, Kamil; Sliwowska, Joanna H
2018-01-01
Apart from the well-established role of kisspeptin (Kp) in the regulation of reproductive functions, recent data described its action in the control of metabolism. Of particular interest for the review is the population of Kp neurons localized in the arcuate nucleus (ARC) of the hypothalamus, the site of the brain where reproductive and metabolic cross talk occurs. However, within the hypothalamus Kp does not work alone, but rather interacts with other neuropeptides, e.g., neurokinin B, dynorphin A, proopiomelanocortin, the cocaine- and amphetamine-regulated transcript, agouti-related peptide, and neuropeptide Y. Beyond the brain, Kp is expressed in peripheral tissues involved in metabolic functions. In this review, we will mainly focus on the local action of this peptide in peripheral organs such as the pancreas, liver, and the adipose tissue. We will concentrate on dysregulation of the Kp system in cases of metabolic imbalance, e.g., obesity and diabetes. Importantly, these patients besides metabolic health problems often suffer from disruptions of the reproductive system, manifested by abnormalities in menstrual cycles, premature child birth, miscarriages in women, decreased testosterone levels and spermatogenesis in men, hypogonadism, and infertility. We will review the evidence from animal models and clinical data indicating that Kp could serve as a promising agent with clinical applications in regulation of reproductive problems in individuals with obesity and diabetes. Finally, emerging data indicate a role of Kp in regulation of insulin secretion, potentially leading to development of further therapeutic uses of this peptide to treat metabolic problems in patients with these lifestyle diseases.
Horigome, Satoru; Yoshida, Izumi; Ito, Shihomi; Inohana, Shuichi; Fushimi, Kei; Nagai, Takeshi; Yamaguchi, Akihiro; Fujita, Kazuhiro; Satoyama, Toshiya; Katsuda, Shin-Ichi; Suzuki, Shinobu; Watai, Masatoshi; Hirose, Naoto; Mitsue, Takahiro; Shirakawa, Hitoshi; Komai, Michio
2017-04-01
The rhizome of Kaempferia parviflora (KP) is used in traditional Thai medicine. In this study, we investigated the effects of an ethanol KP extract and two of its components [5,7-dimethoxyflavone (DMF) and 5-hydroxy-3,7,3',4'-tetramethoxyflavone (TMF)] on monocyte adhesion and cellular reactive oxygen species (ROS) production in human umbilical vein endothelial cells (HUVECs), which provide an in vitro model of events relevant to the development and progression of atherosclerosis. RAW264.7 mouse macrophage-like cells were incubated with various concentrations of KP extract or polymethoxyflavonoids and stimulated with lipopolysaccharide prior to measuring nitrite levels in the culture media. Monocyte adhesion was evaluated by measuring the fluorescently labeled human monocytic leukemia THP-1 cells that is attached to tumor necrosis factor-α (TNF-α)-stimulated HUVECs. Cellular ROS production was assessed by measuring cellular antioxidant activity using pyocyanin-stimulated HUVECs. KP extract and DMF reduced nitrite levels (as indicator of nitric oxide production) in LPS-stimulated RAW264.7 cells and also inhibited THP-1 cell adhesion to HUVECs. These treatments induced mRNA expression of endothelial nitric oxide synthase in TNF-α-stimulated HUVECs and downregulated that of various cell adhesion molecules, inflammatory mediators, and endothelial function-related genes. Angiotensin-converting enzyme activity was inhibited by KP extract in vitro. Furthermore, KP extract, DMF, and TMF inhibited the production of cellular ROS in pyocyanin-stimulated HUVECs. KP extract, DMF, and TMF showed potential anti-inflammatory and antioxidant effects in these in vitro models, properties that would inhibit the development and progression of atherosclerosis.
Directory of Open Access Journals (Sweden)
Chunhui Ma
Full Text Available An ultrasound-assisted extraction (UAE method using ethanol was applied for extracting arabinogalactan (AG and dihydroquercetin (DHQ simultaneously from larch wood, as a pretreatment for pulping and papermaking. The extraction parameters were optimized by a Box-Behnken experimental design with the yields of AG and DHQ as the response values. Under optimum conditions (three extractions, each using 40% ethanol, for 50 min, 200 W ultrasound power and 1∶18 solid-liquid ratio, the yields of AG and DHQ were 183.4 and 36.76 mg/g, respectively. After UAE pretreated, the wood chips were used for Kraft pulping (KP and high boiling solvent pulping (HBSP. The pulping yield after pretreatment was higher than that of untreated (the pulping yields of untreated HBSP and KP were 42.37% and 39.60%, and the pulping yields of HBSP and KP after UAE-pretreated were 44.23% and 41.50% respectively, as indicated by a lower kappa number (77.91 and 27.30 for untreated HBSP and KP; 77.01 and 26.83 for UAE-pretreated HBSP and KP. Furthermore, the characteristics of paper produced from pretreated wood chips were superior to those from the untreated chips: the basis weight was lower (85.67 and 82.48 g·cm(-2 for paper from untreated KP and HBSP; 79.94 and 80.25 g·cm(-2 for paper from UAE-pretreated KP and HBSP, and the tensile strengths, tearing strengths, bursting strengths, and folding strengths were higher than these of paper after UAE-pretreated, respectively.
Foster, Christopher W; Pillay, Jeseelan; Metters, Jonathan P; Banks, Craig E
2014-11-19
Cobalt phthalocyanine (CoPC) compounds have been reported to provide electrocatalytic performances towards a substantial number of analytes. In these configurations, electrodes are typically constructed via drop casting the CoPC onto a supporting electrode substrate, while in other cases the CoPC complex is incorporated within the ink of a screen-printed sensor, providing a one-shot economical and disposable electrode configuration. In this paper we critically compare CoPC modified electrodes prepared by drop casting CoPC nanoparticles (nano-CoPC) onto a range of carbon based electrode substrates with that of CoPC bulk modified screen-printed electrodes in the sensing of the model analytes L-ascorbic acid, oxygen and hydrazine. It is found that no "electrocatalysis" is observed towards L-ascorbic acid using either of these CoPC modified electrode configurations and that the bare underlying carbon electrode is the origin of the obtained voltammetric signal, which gives rise to useful electroanalytical signatures, providing new insights into literature reports where "electrocatalysis" has been reported with no clear control experiments undertaken. On the other hand true electrocatalysis is observed towards hydrazine, where no such voltammetric features are witnessed on the bare underlying electrode substrate.
Minimal models from W-constrained hierarchies via the Kontsevich-Miwa transform
Gato-Rivera, Beatriz
1992-01-01
A direct relation between the conformal formalism for 2d-quantum gravity and the W-constrained KP hierarchy is found, without the need to invoke intermediate matrix model technology. The Kontsevich-Miwa transform of the KP hierarchy is used to establish an identification between W constraints on the KP tau function and decoupling equations corresponding to Virasoro null vectors. The Kontsevich-Miwa transform maps the $W^{(l)}$-constrained KP hierarchy to the $(p^\\prime,p)$ minimal model, with the tau function being given by the correlator of a product of (dressed) $(l,1)$ (or $(1,l)$) operators, provided the Miwa parameter $n_i$ and the free parameter (an abstract $bc$ spin) present in the constraints are expressed through the ratio $p^\\prime/p$ and the level $l$.
Ota, Hiroyuki; Lim, Tae-Kyu; Tanaka, Tsuyoshi; Yoshino, Tomoko; Harada, Manabu; Matsunaga, Tadashi
2006-09-18
A novel, automated system, PNE-1080, equipped with eight automated pestle units and a spectrophotometer was developed for genomic DNA extraction from maize using aminosilane-modified bacterial magnetic particles (BMPs). The use of aminosilane-modified BMPs allowed highly accurate DNA recovery. The (A(260)-A(320)):(A(280)-A(320)) ratio of the extracted DNA was 1.9+/-0.1. The DNA quality was sufficiently pure for PCR analysis. The PNE-1080 offered rapid assay completion (30 min) with high accuracy. Furthermore, the results of real-time PCR confirmed that our proposed method permitted the accurate determination of genetically modified DNA composition and correlated well with results obtained by conventional cetyltrimethylammonium bromide (CTAB)-based methods.
Rawson, Jonathan M.; Heineman, Richard H.; Beach, Lauren B.; Martin, Jessica L.; Schnettler, Erica K.; Dapp, Michael J.; Patterson, Steven E.; Mansky, Louis M.
2013-01-01
The nucleoside analog 5,6-dihydro-5-aza-2’-deoxycytidine (KP-1212) has been investigated as a first-in-class lethal mutagen of human immunodeficiency virus type-1 (HIV-1). Since a prodrug monotherapy did not reduce viral loads in Phase II clinical trials, we tested if ribonucleotide reductase inhibitors (RNRIs) combined with KP-1212 would improve antiviral activity. KP-1212 potentiated the activity of gemcitabine and resveratrol and simultaneously increased the viral mutant frequency. G-to-C ...
dimensional generalized KP equation
Indian Academy of Sciences (India)
Wei Tan
2017-10-31
Oct 31, 2017 ... ysed the rational localization of the lump solutions of eq. ... vide more information and more physical insight into ... a limit behaviour. More importantly, we have also dis- cussed that the space–time structure changes of lump.
14C ages for the ejecta from Kutcharo and Mashu calderas, eastern Hokkaido, Japan
International Nuclear Information System (INIS)
Yamamoto, Takahiro; Ito, Jun-ichi; Nakagawa, Mitsuhiro; Hasegawa, Takeshi; Kishimoto, Hiroshi
2010-01-01
Eruption ages of the ejecta from Kutcharo and Mashu calderas were systematically determined by 14 C dating. 16 charred samples were newly obtained from the Mashu and Nakashumbetsu Tephra Formations around the calderas and dated by AMS and β-counting methods. Examined units are Ma-d, Ma-e, Ma-f, Ma-j, Ma-k, Ma-l and Ml-a in the Mashu ejecta and 6 Nakashumbetsu tephra layers including Kutcharo Pumice Flow Deposit I (KpI), which is the youngest caldera-forming product from Kutcharo caldera. Results of the 14 C dating range from 3,660 ±40 yBP to 36,080±1,300 yBP, and are consistent with the tephrostratigraphy. Calendar age for KpI was newly calculated at almost 40 ka and this age shows there was about 70,000 years recurrence interval between KpI and KpIV caldera-forming eruptions. Mashu caldera has appeared on the eastern part of Kutcharo caldera immediately after the KpI eruption, and calendar age for its main caldera-forming eruption were determined at ca. BC 5,600. (author)
International Nuclear Information System (INIS)
Chandra, P.; Sawitsky, A.; Chanana, A.D.; Chikkappa, G.; Cohn, S.H.; Rai, K.R.; Cronkity, E.P.
1979-01-01
Total body leukemic mass in patients with chronic lymphocytic leukemia (CLL) was measured by quantitation of total body potassium (TBK) with a whole-body counter. In addition, the predicted normal total body potassium (Kp) for each patient was calculated from an empirically derived relationship involving height, weight age, and sex. Both the absolute TBK and the relative excess of total body potassium (TBK/Kp) were related to the stage of disease. Patients in the early stages of CLL were found to have lower TBK and TBK/Kp than patients in the late stages of disease. Both of these parameters increased with the successively advanced stages of the disease. The clinically monitored reduction of leukemic cell mass following therapy was accompanied by reductions in TBK and TBK/Kp. Data presented support the notion that TBK/Kp is a useful indicator of the total body leukemic mass. Futhermore, the results of these studies quantitatively validate the proposed clinical staging system for CLL. Quantitation of TBK by a whole-body counter is an accurate and noninvasive procedure and does not require administration of isotopes
Controversial Issues in Kyphoplasty and Vertebroplasty in Osteoporotic Vertebral Fractures
Directory of Open Access Journals (Sweden)
Ioannis D. Papanastassiou
2014-01-01
Full Text Available Kyphoplasty (KP and vertebroplasty (VP have been successfully employed for many years for the treatment of osteoporotic vertebral fractures. The purpose of this review is to resolve the controversial issues raised by the two randomized trials that claimed no difference between VP and SHAM procedure. In particular we compare nonsurgical management (NSM and KP and VP, in terms of clinical parameters (pain, disability, quality of life, and new fractures, cost-effectiveness, radiological variables (kyphosis correction and vertebral height restoration, and VP versus KP for cement extravasation and complications profile. Cement types and optimal filling are analyzed and technological innovations are presented. Finally unipedicular/bipedicular techniques are compared. Conclusion. VP and KP are superior to NSM in clinical and radiological parameters and probably more cost-effective. KP is superior to VP in sagittal balance improvement and cement leaking. Complications are rare but serious adverse events have been described, so caution should be exerted. Unilateral procedures should be pursued whenever feasible. Upcoming randomized trials (CEEP, OSTEO-6, STIC-2, and VERTOS IV will provide the missing link.
Blood and muscle metabolic responses to draught work of varying intensity and duration in horses.
Gottlieb, M; Essén-Gustavsson, B; Skoglund-Wallberg, H
1989-07-01
Three standardbred trotters performed treadmill exercise at a velocity of 2 m s-1 with a draught load of both 34 kiloponds (kp) (test 1) and 80 kp (test 2), and also at 7 m s-1 with 34 kp (test 3). The heart rate increased to average values of 111 (+/- 5), 157 (+/- 10) and 197 (+/- 7) beats min-1 in tests 1, 2, and 3, respectively. Plasma free fatty acids increased only during tests 1 and 2. Blood lactate and muscle glucose-6-phosphate and lactate concentrations were low after tests 1 and 2, but high after test 3, where also muscle glycogen utilisation was greatest. Muscle creatine phosphate and adenosine triphosphate concentrations decreased after test 3 only. The study indicates that oxidative metabolism is most important for energy supply in muscles when exercise is performed with draught loads of both 34 and 80 kp at a low velocity. Glycogenolysis with lactate accumulation and phosphagen breakdown becomes much more important when, with a draught load of 34 kp, the velocity of exercise increases.
International Nuclear Information System (INIS)
Galli, C; Parisi, L; Smerieri, A; Lumetti, S; Manfredi, E; Macaluso, G M; Elviri, L; Bianchera, A; Bettini, R; Lagonegro, P
2016-01-01
The aim of the present study was to investigate whether chitosan-based scaffolds modified with D-(+) raffinose and enriched with thiol-modified gelatin could selectively improve osteoblast adhesion and proliferation. 2, 3 and 4.5% chitosan films were prepared. Chitosan suitability for tissue engineering was confirmed by protein adsorption assay. Scaffolds were incubated with a 2.5 mg ml −1 BSA solution and the decrease of protein content in the supernatants was measured by spectrophotometry. Chitosan films were then enriched with thiol-modified gelatin and their ability to bind BSA was also measured. Then, 2% chitosan discs with or without thiol-modified gelatin were used as culture substrates for MC3T3-E1 cells. After 72 h cells were stained with trypan blue or with calcein AM and propidium iodide for morphology, viability and proliferation assays. Moreover, cell viability was measured at 48, 72, 96 and 168 h to obtain a growth curve. Chitosan films efficiently bound and retained BSA proportionally to the concentration of chitosan discs. The amount of protein retained was higher on chitosan enriched with thiol-modified gelatin. Moreover, chitosan discs allowed the adhesion and the viability of cells, but inhibited their proliferation. The functionalization of chitosan with thiol-modified gelatin enhanced cell spreading and proliferation. Our data confirm that chitosan is a suitable material for tissue engineering. Moreover, our data show that the enrichment of chitosan with thiol-modified gelatin enhances its biological properties. (paper)
Absence of kynurenine 3-monooxygenase reduces mortality of acute viral myocarditis in mice.
Kubo, Hisako; Hoshi, Masato; Mouri, Akihiro; Tashita, Chieko; Yamamoto, Yasuko; Nabeshima, Toshitaka; Saito, Kuniaki
2017-01-01
Infection of the encephalomyocarditis virus (EMCV) in mice is an established model for viral myocarditis. Previously, we have demonstrated that indoleamine 2,3-dioxygenase (IDO), an L-tryptophan - kynurenine pathway (KP) enzyme, affects acute viral myocarditis. However, the roles of KP metabolites in EMCV infection remain unclear. Kynurenine 3-monooxygenase (KMO) is one of the key regulatory enzymes, which metabolizes kynurenine to 3-hydroxykynurenine in the KP. Therefore, we examined the role of KMO in acute viral infection by comparing between KMO -/- mice and KMO +/+ mice. KMO deficiency resulted in suppressed mortality after EMCV infection. The number of infiltrating cells and F4/80 + cells in KMO -/- mice was suppressed compared with those in KMO +/+ mice. KMO -/- mice showed significantly increased levels of serum KP metabolites, and induction of KMO expression upon EMCV infection was involved in its effect on mortality through EMCV suppression. Furthermore, KMO -/- mice showed significantly suppression of CCL2, CCL3 and CCL4 on day 2 and CXCL1 on day 4 after infection. These results suggest that increased KP metabolites reduced chemokine production, resulting in suppressed mortality upon KMO knockdown in EMCV infection. KP metabolites may thus provide an effective strategy for treating acute viral myocarditis. Copyright © 2016 European Federation of Immunological Societies. Published by Elsevier B.V. All rights reserved.
Implant materials modified by colloids
Directory of Open Access Journals (Sweden)
Zboromirska-Wnukiewicz Beata
2016-03-01
Full Text Available Recent advances in general medicine led to the development of biomaterials. Implant material should be characterized by a high biocompatibility to the tissue and appropriate functionality, i.e. to have high mechanical and electrical strength and be stable in an electrolyte environment – these are the most important properties of bioceramic materials. Considerations of biomaterials design embrace also electrical properties occurring on the implant-body fluid interface and consequently the electrokinetic potential, which can be altered by modifying the surface of the implant. In this work, the surface of the implants was modified to decrease the risk of infection by using metal colloids. Nanocolloids were obtained using different chemical and electrical methods. It was found that the colloids obtained by physical and electrical methods are more stable than colloids obtained by chemical route. In this work the surface of modified corundum implants was investigated. The implant modified by nanosilver, obtained by electrical method was selected. The in vivo research on animals was carried out. Clinical observations showed that the implants with modified surface could be applied to wounds caused by atherosclerotic skeleton, for curing the chronic and bacterial inflammations as well as for skeletal reconstruction surgery.
Wang, Xiaoli; Xie, Yingzhou; Li, Gang; Liu, Jialin; Li, Xiaobin; Tian, Lijun; Sun, Jingyong; Ou, Hong-Yu; Qu, Hongping
2018-01-01
Hypervirulent K. pneumoniae variants (hvKP) have been increasingly reported worldwide, causing metastasis of severe infections such as liver abscesses and bacteremia. The capsular serotype K2 hvKP strains show diverse multi-locus sequence types (MLSTs), but with limited genetics and virulence information. In this study, we report a hypermucoviscous K. pneumoniae strain, RJF293, isolated from a human bloodstream sample in a Chinese hospital. It caused a metastatic infection and fatal septic shock in a critical patient. The microbiological features and genetic background were investigated with multiple approaches. The Strain RJF293 was determined to be multilocis sequence type (ST) 374 and serotype K2, displayed a median lethal dose (LD50) of 1.5 × 10 2 CFU in BALB/c mice and was as virulent as the ST23 K1 serotype hvKP strain NTUH-K2044 in a mouse lethality assay. Whole genome sequencing revealed that the RJF293 genome codes for 32 putative virulence factors and exhibits a unique presence/absence pattern in comparison to the other 105 completely sequenced K. pneumoniae genomes. Whole genome SNP-based phylogenetic analysis revealed that strain RJF293 formed a single clade, distant from those containing either ST66 or ST86 hvKP. Compared to the other sequenced hvKP chromosomes, RJF293 contains several strain-variable regions, including one prophage, one ICEKp1 family integrative and conjugative element and six large genomic islands. The sequencing of the first complete genome of an ST374 K2 hvKP clinical strain should reinforce our understanding of the epidemiology and virulence mechanisms of this bloodstream infection-causing hvKP with clinical significance.
Microstructure and phase transformations in the ODS alloys irradiated by swift heavy ions
International Nuclear Information System (INIS)
Zlotski, S.V.; Anishchik, V.M; Skuratov, V.A.; O’Connell, J.; Neethling, J.H.
2015-01-01
Microstructure of KP4 ODS alloy irradiated with 700 MeV bismuth ions at 300 K has been studied using high resolution transmission electron microscopy. No latent tracks have been observed in Y 4 Al 2 O 9 particles in KP4 irradiated with Bi ions. Small oxides (~ 5 nm) in KP4 alloy remain crystalline at Bi ion fluence 1.5*10 13 cm -2 , while subsurface regions in large (~ 20 nm) particles faced to the beam entrance became amorphous. (authors)
Molinaro Coelho, Cássia M; Duque Moreno, Juan C; Goulart, Daniel da S; Caetano, Leandro B; Soares, Lorena K; Coutinho, Gustavo H; Alves, Geraldo Es; da Silva, Luiz Antonio F
2014-11-01
To evaluate the cardiorespiratory and biochemical effects of ketamine-propofol (KP) or guaifenesin-ketamine-xylazine (GKX) anesthesia in donkeys. Prospective crossover trial. Eight healthy, standard donkeys, aged 10 ± 5 years and weighing 153 ± 23 kg. Donkeys were premedicated with 1.0 mg kg(-1) of xylazine (IV) in both treatments. Eight donkeys were administered ketamine (1.5 mg kg(-1)) and propofol (0.5 mg kg(-1) for induction, and anesthesia was maintained by constant rate infusion (CRI) of ketamine (0.05 mg kg(-1) minute(-1)) and propofol (0.15 mg kg(-1) minute(-1)) in the KP treatment. After 10 days, diazepam (0.05 mg kg(-1)) and ketamine (2.2 mg kg(-1)) were administered for induction, and anesthesia was maintained by a CRI (2.0 mL kg(-1) hour(-1)) of ketamine (2.0 mg mL(-1), xylazine (0.5 mg mL(-1)) and guaifenesin (50 mg mL(-1)) solution. Quality of anesthesia was assessed along with cardiorespiratory and biochemical measurements. Anesthetic induction took longer in GKX than in KP. The induction was considered good in 7/8 with KP and in 6/8 in GKX. Anesthetic recovery was classified as good in 7/8 animals in both treatments. Xylazine administration decreased heart rate (HR) in both treatments, but in KP the HR increased and was higher than GKX throughout the anesthetic period. Respiratory rate was higher in GKX than in KP. PaO(2) decreased significantly in both groups during the anesthetic period. Glucose concentrations [GLU] increased and rectal temperature and PCV decreased in both treatments. Arterial lactate [LAC] increased at recovery compared with all time points in KP. [GLU] and calcium were higher in GKX than in KP at recovery. These protocols induced significant hypoxemia but no other cardiorespiratory or metabolic changes. These protocols could be used to maintain anesthesia in donkeys, however, they were not tested in animals undergoing surgery. © 2014 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia
Blanca Pedregosa, A M; Sánchez-González, Á; Carrasco Valiente, J; Ruiz García, J M; Gómez Gómez, E; López Beltrán, A; Requena Tapia, M J
2017-04-01
To determine the differential protein expression of biomarkers FGFR3, PI3K (subunits PI3Kp110α, PI3KClassIII, PI3Kp85), AKT, p21Waf1/Cip1 and cyclins D1 and D3 in T1 bladder cancer versus healthy tissue and to study their potential role as early recurrence markers. This is a prospective study that employed a total of 67 tissue samples (55 cases of T1 bladder tumours that underwent transurethral resection and 12 cases of adjacent healthy mucosa). The protein expression levels were assessed using Western blot, and the means and percentages were compared using Student's t-test and the chi-squared test. The survival analysis was conducted using the Kaplan-Meier method and the log-rank test. Greater protein expression was detected for FGFR3, PI3Kp110α, PI3KClassIII, cyclins D1 and D3 and p21Waf1/Cip1 in the tumour tissue than in the healthy mucosa. However, these differences were not significant for PI3Kp85 and AKT. We observed statistically significant correlations between early recurrence and PI3Kp110α, PI3KClassIII, PI3Kp85 and AKT (P=.003, P=.045, P=.050 and P=.028, respectively), between the tumour type (primary vs. recurrence) and cyclin D3 (P=.001), between the tumour size and FGFR3 (P=.035) and between multifocality and cyclin D1 (P=.039). The survival analysis selected FGFR3 (P=.024), PI3Kp110α (P=.014), PI3KClassIII (P=.042) and AKT (P=.008) as markers of early-recurrence-free survival. There is an increase in protein expression levels in bladder tumour tissue. The overexpression of FGFR3, PI3Kp110α, PI3KClassIII and AKT is associated with increased early-recurrence-free survival for patients with T1 bladder tumours. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Christopher W. Foster
2014-11-01
Full Text Available Cobalt phthalocyanine (CoPC compounds have been reported to provide electrocatalytic performances towards a substantial number of analytes. In these configurations, electrodes are typically constructed via drop casting the CoPC onto a supporting electrode substrate, while in other cases the CoPC complex is incorporated within the ink of a screen-printed sensor, providing a one-shot economical and disposable electrode configuration. In this paper we critically compare CoPC modified electrodes prepared by drop casting CoPC nanoparticles (nano-CoPC onto a range of carbon based electrode substrates with that of CoPC bulk modified screen-printed electrodes in the sensing of the model analytes L-ascorbic acid, oxygen and hydrazine. It is found that no “electrocatalysis” is observed towards L-ascorbic acid using either of these CoPC modified electrode configurations and that the bare underlying carbon electrode is the origin of the obtained voltammetric signal, which gives rise to useful electroanalytical signatures, providing new insights into literature reports where “electrocatalysis” has been reported with no clear control experiments undertaken. On the other hand true electrocatalysis is observed towards hydrazine, where no such voltammetric features are witnessed on the bare underlying electrode substrate.
Nanoparticles modified with multiple organic acids
Cook, Ronald Lee (Inventor); Luebben, Silvia DeVito (Inventor); Myers, Andrew William (Inventor); Smith, Bryan Matthew (Inventor); Elliott, Brian John (Inventor); Kreutzer, Cory (Inventor); Wilson, Carolina (Inventor); Meiser, Manfred (Inventor)
2007-01-01
Surface-modified nanoparticles of boehmite, and methods for preparing the same. Aluminum oxyhydroxide nanoparticles are surface modified by reaction with selected amounts of organic acids. In particular, the nanoparticle surface is modified by reactions with two or more different carboxylic acids, at least one of which is an organic carboxylic acid. The product is a surface modified boehmite nanoparticle that has an inorganic aluminum oxyhydroxide core, or part aluminum oxyhydroxide core and a surface-bonded organic shell. Organic carboxylic acids of this invention contain at least one carboxylic acid group and one carbon-hydrogen bond. One embodiment of this invention provides boehmite nanoparticles that have been surface modified with two or more acids one of which additional carries at least one reactive functional group. Another embodiment of this invention provides boehmite nanoparticles that have been surface modified with multiple acids one of which has molecular weight or average molecular weight greater than or equal to 500 Daltons. Yet, another embodiment of this invention provides boehmite nanoparticles that are surface modified with two or more acids one of which is hydrophobic in nature and has solubility in water of less than 15 by weight. The products of the methods of this invention have specific useful properties when used in mixture with liquids, as filler in solids, or as stand-alone entities.
Nanoparticles modified with multiple organic acids
Cook, Ronald Lee; Luebben, Silvia DeVito; Myers, Andrew William; Smith, Bryan Matthew; Elliott, Brian John; Kreutzer, Cory; Wilson, Carolina; Meiser, Manfred
2007-07-17
Surface-modified nanoparticles of boehmite, and methods for preparing the same. Aluminum oxyhydroxide nanoparticles are surface modified by reaction with selected amounts of organic acids. In particular, the nanoparticle surface is modified by reactions with two or more different carboxylic acids, at least one of which is an organic carboxylic acid. The product is a surface modified boehmite nanoparticle that has an inorganic aluminum oxyhydroxide core, or part aluminum oxyhydroxide core and a surface-bonded organic shell. Organic carboxylic acids of this invention contain at least one carboxylic acid group and one carbon-hydrogen bond. One embodiment of this invention provides boehmite nanoparticles that have been surface modified with two or more acids one of which additional carries at least one reactive functional group. Another embodiment of this invention provides boehmite nanoparticles that have been surface modified with multiple acids one of which has molecular weight or average molecular weight greater than or equal to 500 Daltons. Yet, another embodiment of this invention provides boehmite nanoparticles that are surface modified with two or more acids one of which is hydrophobic in nature and has solubility in water of less than 15 by weight. The products of the methods of this invention have specific useful properties when used in mixture with liquids, as filler in solids, or as stand-alone entities.
Janssen, Renske H; Vincken, Jean-Paul; van den Broek, Lambertus A M; Fogliano, Vincenzo; Lakemond, Catriona M M
2017-03-22
Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor overestimates the protein content, due to the presence of nonprotein nitrogen in insects. In this paper, a specific Kp of 4.76 ± 0.09 was calculated for larvae from Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens, using amino acid analysis. After protein extraction and purification, a Kp factor of 5.60 ± 0.39 was found for the larvae of three insect species studied. We propose to adopt these Kp values for determining protein content of insects to avoid overestimation of the protein content.
International Nuclear Information System (INIS)
Heath, G.R.
1977-07-01
Studies of Eu sorption from 0.68M NaCl solution at 15 0 C by typical deep-sea sediments show less than an order-of-magnitude variation between partition coefficients (Kp) for calcareous oozes, red clays and siliceous oozes. Similarly, the concentration (C) dependence of Kp is comparable for all sediments (d log Kp/d C lies between -0.8 and -1.0 ml g -1 M -1 ). Sorption and desorption reactions are rapid and yield similar Kp's, suggesting that the process is primarily ion exchange. Magnetic studies of North Pacific core LL44-GPC3 (30 0 20'N, 157 0 49'W) support the ichthyolith time-scale of P. Doyle, and imply continuous deposition at 0.2 to 2.5 m/million years for the past 70 million years
Tests on model of a prestressed concrete nuclear pressure vessel with multiple cavities
International Nuclear Information System (INIS)
Favre, R.; Koprna, M.; Jaccoud, J.P.
1977-01-01
The prestressed concrete pressure vessel (prototype) is a cylinder having a diameter of 48 m and a height of 39 m. It has 25 vertical cavities (reactor, heat exchangers, heat recuperators) and 3 horizontal cavities (gas turbines of 500 kw). The cavities are closed by plugs, and their tightness is ensured by a steel lining. A model, on a scale of 1/20, made of microconcrete, was loaded in several cycles, by a uniform inner pressure in the cavities, increasing to the point of failure. The three successive stages were examined: stage of globally elastic behavior, cracking stage, ultimate stage. The behavior of the model is globally elastic up to an inner pressure of 120 to 130 kp/cm 2 , corresponding to about twice the maximum pressure of service, equal to 65 kp/cm 2 . The prestressed tendons at this stage show practically no stress increase. The first detectable cracks appear on the lateral side half-way up the model, as soon as the pressure exceeded 120 kp/cm 2 . From 150-165 kp/cm 2 , the cracking stage can be considered as achieved and the main crack pattern entirely formed. A horizontal crack continues in the middle of the barrel, as well as vertical cracks at each outer cavity. Beyond a pressure of 150-165 kp/cm 2 the ultimate stage begins. The strains of the stresses in the tendons grow more rapidly. The steel lining is highly solicited. Above about 210 kp/cm 2 the model behaves like a structure composed of a group of concrete blocks bound by the tendons and the lining. The failure (240 kp/cm 2 ) occurred through a mechanism of ejection and bending of the concrete ring at the periphery of the barrel of the vessel, which was solicited mainly in tension
Weisz, Keith; Bajaj, Lalit; Deakyne, Sara J; Brou, Lina; Brent, Alison; Wathen, Joseph; Roosevelt, Genie E
2017-07-01
The co-administration of ketamine and propofol (CoKP) is thought to maximize the beneficial profile of each medication, while minimizing the respective adverse effects of each medication. Our objective was to compare adverse events between ketamine monotherapy (KM) and CoKP for procedural sedation and analgesia (PSA) in a pediatric emergency department (ED). This was a prospective, randomized, single-blinded, controlled trial of KM vs. CoKP in patients between 3 and 21 years of age. The attending physician administered either ketamine 1 mg/kg i.v. or ketamine 0.5 mg/kg and propofol 0.5 mg/kg i.v. The physician could administer up to three additional doses of ketamine (0.5 mg/kg/dose) or ketamine/propofol (0.25 mg/kg/dose of each). Adverse events (e.g., respiratory events, cardiovascular events, unpleasant emergence reactions) were recorded. Secondary outcomes included efficacy, recovery time, and satisfaction scores. Ninety-six patients were randomized to KM and 87 patients were randomized to CoKP. There was no difference in adverse events or type of adverse event, except nausea was more common in the KM group. Efficacy of PSA was higher in the KM group (99%) compared to the CoKP group (90%). Median recovery time was the same. Satisfaction scores by providers, including nurses, were higher for KM, although parents were equally satisfied with both sedation regimens. We found no significant differences in adverse events between the KM and CoKP groups. While CoKP is a reasonable choice for pediatric PSA, our study did not demonstrate an advantage of this combination over KM. Copyright © 2017 Elsevier Inc. All rights reserved.
Kisspeptins and RFRP-3 act in concert to synchronize rodent reproduction with seasons
Directory of Open Access Journals (Sweden)
Valerie eSimonneaux
2013-02-01
Full Text Available Seasonal mammals use the photoperiodic variation in the nocturnal production of the pineal hormone melatonin to synchronize their reproductive activity with seasons. In rodents, the short day profile of melatonin secretion has long been proven to inhibit reproductive activity. Lately, we demonstrated that melatonin regulates the expression of the hypothalamic peptides kisspeptins (Kp and RFamide-related peptide-3 (RFRP-3, recently discovered as potent regulators of GnRH neuron activity. In the male Syrian hamster, Kp expression in the arcuate nucleus is down-regulated by melatonin independently of the inhibitory feedback of testosterone. A central or peripheral administration of Kp induces an increase in pituitary gonadotropins and gonadal hormone secretion, but most importantly a chronic infusion of the peptide reactivates the photoinhibited reproductive axis of Syrian hamsters kept in short day conditions. RFRP-3 expression in the dorsomedial hypothalamus is also strongly inhibited by melatonin in a short day photoperiod. Although RFRP-3 is usually considered as an inhibitory component of the gonadotropic axis, a central acute administration of RFRP-3 in the male Syrian hamster induces a marked increase in gonadotropin secretion and testosterone production. Furthermore, a chronic central infusion of RFRP-3 in short day-adapted hamsters reactivates the reproductive axis, in the same manner as Kp. Both Kp and RFRP-3 neurons project onto GnRH neurons and both neuropeptides regulate GnRH neuron activity. In addition, central RFRP-3 infusion was associated with a significant increase in arcuate Kp expression. However, the actual sites of action of both peptides in the Syrian hamster brain are still unknown. Altogether our findings indicate that Kp and RFRP neurons are pivotal relays for the seasonal regulation of reproduction, and also suggest that RFRP neurons might be the primary target of the melatoninergic message.
Asian sand dust enhances murine lung inflammation caused by Klebsiella pneumoniae
International Nuclear Information System (INIS)
He, Miao; Ichinose, Takamichi; Yoshida, Seiichi; Yamamoto, Shoji; Inoue, Ken-ichiro; Takano, Hirohisa; Yanagisawa, Rie; Nishikawa, Masataka; Mori, Ikuko; Sun, Guifan; Shibamoto, Takayuki
2012-01-01
Inhaling concomitants from Asian sand dust (ASD) may result in exacerbation of pneumonia by the pathogen. The exacerbating effect of ASD on pneumonia induced by Klebsiella pneumoniae (KP) was investigated in ICR mice. The organic substances adsorbed onto ASD collected from the atmosphere of Iki-island in Japan were excluded by heat treatment at 360 °C for 30 min. ICR mice were instilled intratracheally with ASD at doses of 0.05 mg or 0.2 mg/mouse four times at 2-week intervals (total dose of 0.2 mg or 0.8 mg/mouse) and were administrated with ASD in the presence or absence of KP at the last intratracheal instillation. Pathologically, ASD caused exacerbation of pneumonia by KP as shown by increased inflammatory cells within the bronchiolar and the alveolar compartments. ASD enhanced the neutrophil number dose dependently as well as the expression of cytokines (IL-1β, IL-6, IL-12, IFN-γ, TNF-α) and chemokines (KC, MCP-1, MIP-1α) related to KP in BALF. In an in vitro study using RAW264.7 cells, combined treatment of ASD and KP increased gene expression of IL-1β, IL-6, IFN-β, KC, MCP-1, and MIP-1α. The same treatment tended to increase the protein level of IL-1β, TNF-α and MCP-1 in a culture medium compared to each treatment alone. The combined treatment tended to increase the gene expression of Toll-like receptor 2 (TLR2), and NALP3, ASC and caspase-1 compared with KP alone. These results suggest that the exacerbation of pneumonia by ASD + KP was due to the enhanced production of pro-inflammatory mediators via activation of TLR2 and NALP3 inflammasome pathways in alveolar macrophages.
Asian sand dust enhances murine lung inflammation caused by Klebsiella pneumoniae
Energy Technology Data Exchange (ETDEWEB)
He, Miao [Department of Environmental and Occupational Health, College of Public Health, China Medical University, 11001, Shenyang (China); Ichinose, Takamichi; Yoshida, Seiichi [Department of Health Sciences, Oita University of Nursing and Health Sciences, 870-1201, Oita (Japan); Yamamoto, Shoji; Inoue, Ken-ichiro; Takano, Hirohisa; Yanagisawa, Rie [Pathophysiology Research Team, National Institute for Environmental Studies, 305-8506, Tsukuba, Ibaraki (Japan); Nishikawa, Masataka; Mori, Ikuko [Environmental Chemistry Division, National Institute for Environmental Studies, 305-8506, Tsukuba, Ibaraki (Japan); Sun, Guifan [Department of Environmental and Occupational Health, College of Public Health, China Medical University, 11001, Shenyang (China); Shibamoto, Takayuki, E-mail: tshibamoto@ucdavis.edu [Department of Environmental Toxicology, University of California, Davis, CA 95616 (United States)
2012-01-15
Inhaling concomitants from Asian sand dust (ASD) may result in exacerbation of pneumonia by the pathogen. The exacerbating effect of ASD on pneumonia induced by Klebsiella pneumoniae (KP) was investigated in ICR mice. The organic substances adsorbed onto ASD collected from the atmosphere of Iki-island in Japan were excluded by heat treatment at 360 °C for 30 min. ICR mice were instilled intratracheally with ASD at doses of 0.05 mg or 0.2 mg/mouse four times at 2-week intervals (total dose of 0.2 mg or 0.8 mg/mouse) and were administrated with ASD in the presence or absence of KP at the last intratracheal instillation. Pathologically, ASD caused exacerbation of pneumonia by KP as shown by increased inflammatory cells within the bronchiolar and the alveolar compartments. ASD enhanced the neutrophil number dose dependently as well as the expression of cytokines (IL-1β, IL-6, IL-12, IFN-γ, TNF-α) and chemokines (KC, MCP-1, MIP-1α) related to KP in BALF. In an in vitro study using RAW264.7 cells, combined treatment of ASD and KP increased gene expression of IL-1β, IL-6, IFN-β, KC, MCP-1, and MIP-1α. The same treatment tended to increase the protein level of IL-1β, TNF-α and MCP-1 in a culture medium compared to each treatment alone. The combined treatment tended to increase the gene expression of Toll-like receptor 2 (TLR2), and NALP3, ASC and caspase-1 compared with KP alone. These results suggest that the exacerbation of pneumonia by ASD + KP was due to the enhanced production of pro-inflammatory mediators via activation of TLR2 and NALP3 inflammasome pathways in alveolar macrophages.
Effects of UVA (320-400 nm) on the barrier characteristics of the skin
International Nuclear Information System (INIS)
McAuliffe, D.J.; Blank, I.H.
1991-01-01
The stratum corneum serves as the major barrier to the entrance of most molecules into the skin. In the studies presented here, the effects of UVA radiation (320-400 nm) on the barrier capacity of human stratum corneum were examined. Penetration of a homologous series of primary alcohols through unirradiated (control) and UVA-irradiated (test) human epidermis was determined in vitro. Permeability constants, kp, were calculated. Mean ratios of permeability constants for UVA-irradiated and unirradiated epidermis (mean kp test)/(mean kp control) ranged from 2.3 to 3.0 for methanol and from 2.2 to 2.5 for ethanol. These mean ratios were determined using different pieces of epidermis from the same piece of skin for test and control samples. When kp control and kp test were determined on the same piece of epidermis on successive days, the ratios (kp test/kp control) were similar to the mean ratios determined on different pieces of epidermis. For other primary alcohols, propanol, butanol, hexanol, and heptanol, UVA radiation did not alter their permeability constants significantly. Partition coefficients, Km, were determined for ethanol and heptanol using UVA-irradiated and unirradiated stratum corneum. For ethanol, irradiation resulted in a 1.5 to 2.6 times increase in Km. For heptanol, irradiation caused no change in Km. These results demonstrate that the barrier capacity of stratum corneum for small, polar, primary alcohols is diminished (permeability increases) and for higher molecular weight less polar alcohols, is unaffected by small doses of UVA radiation. This increased permeability of small polar alcohols through human skin may be due to enhanced partitioning into UVA-irradiated stratum corneum, which was not apparent for a higher molecular weight less polar alcohol
Targeting kynurenine 3-monooxygenase (KMO): implications for therapy in Huntington's disease.
Thevandavakkam, Mathuravani A; Schwarcz, Robert; Muchowski, Paul J; Giorgini, Flaviano
2010-12-01
Huntington's disease (HD) is an adult onset neurodegenerative disease caused by a polyglutamine expansion in the huntingtin protein. Recent work has shown that perturbation of kynurenine pathway (KP) metabolism is a hallmark of HD pathology, and that changes in brain levels of KP metabolites may play a causative role in this disease. The KP contains three neuroactive metabolites, the neurotoxins 3-hydroxykynurenine (3-HK) and quinolinic acid (QUIN), and the neuroprotectant kynurenic acid (KYNA). In model systems in vitro and in vivo, 3-HK and QUIN have been shown to cause neurodegeneration via a combination of excitotoxic mechanisms and oxidative stress. Recent studies with HD patient samples and in HD model systems have supported the idea that a shift away from the synthesis of KYNA and towards the formation of 3-HK and QUIN may trigger the neuropathological features observed in HD. The enzyme kynurenine 3-monooxygenase (KMO) is located at a critical branching point in the KP such that inhibition of this enzyme by either pharmacological or genetic means shifts the flux in the pathway towards the formation of KYNA. This intervention ameliorates disease-relevant phenotypes in HD models. Here we review the work implicating the KP in HD pathology and discuss the potential of KMO as a therapeutic target for this disorder. As several neurodegenerative diseases exhibit alterations in KP metabolism, this concept has broader implications for the treatment of brain diseases.
Modern Sedimentation off the Kaoping River, SW Taiwan: A Comparison with Eel River's S2S System
Huh, C.; Lin, H.; Lin, S.
2006-12-01
The Kaoping (KP) River in SW Taiwan has a watershed area of 3257 km2 and an annual sediment discharge of 49 MT. Although the sediment yield of the KP River basin (1.5×104 ton km-2 yr^{- 1}) is the 4th highest among Taiwan's catchment basins, it is nearly one order of magnitude higher than that of the Eel River's basin (~1.8×103 ton km-2 yr-1; the highest in the U.S.). The KP canyon extends almost immediately seaward from the river's mouth and terminates in the northwestern corner of the South China Sea. The head of the canyon is characterized by high and steep walls exceeding 600 m. The KP river's source-to-sink system offers a dramatic case of mountainous rivers at active margins for S2S study. Here we report some results about modern sedimentation in KP river's dispersal system. Seventy-six sediment cores collected from an area of ~3000 km2 were analyzed for fallout nuclides 7Be, 137Cs and 210Pb by gamma spectrometry. From profiles of excess 210Pb and 137Cs sediment accumulation rates in the coring sites were estimated, which vary from 0.06 to 1.6 cm/yr, with the highest rates (>1 cm/yr) distributed in the upper slope (exported out of the study area via the KP canyon to the deep sea by gravity-driven turbidity or hyperpycnal flows.
Reliability of Volumetry and Perimetry to Assess Knee Volume.
Nunes, Guilherme S; Yamashitafuji, Igor; Wageck, Bruna; Teixeira, Guilherme Garcia; Karloh, Manuela; de Noronha, Marcos
2016-08-24
The treatment of edema after a knee injury is usually 1 of the main objectives during rehabilitation. To assess the success of treatment, 2 methods are commonly used in clinical practice: volumetry and perimetry. To investigate the intra- and interassessor reliability of volumetry and perimetry to assess knee volume. Cross-sectional. Laboratory. 45 healthy participants (26 women) with mean age of 22.4 ± 2.8 y. Knee volume was assessed by 3 assessors (A, B, and C) with 3 methods (lower-limb volumetry [LLV], knee volumetry [KV], and knee perimetry [KP]). Assessor A was the most-experienced assessor, and assessor C, the least experienced. LLV and KV were performed with participants in the orthostatic position, while KP was performed with participants in supine. For the interassessor analysis, the ICC2,1 was high (.82) for KV and very high for LLV (.99) and KP (.99). For the intra-assessor analysis, ICC2,1 ranged from moderate to high for KV (.69-.83) and was very high for LLV (.99) and KP (.97-.99). KV, LLV, and KP are reliable methods, both intra- and interassessor, to measure knee volume.
Horseshoes in modified Chen's attractors
International Nuclear Information System (INIS)
Huang Yan; Yang Xiaosong
2005-01-01
In this paper we study dynamics of a class of modified Chen's attractors, we show that these attractors are chaotic by giving a rigorous verification for existence of horseshoes in these systems. We prove that the Poincare maps derived from these modified Chen's attractors are semi-conjugate to the 2-shift map
Karakteristik Kimiawi dan Mikrobiologi Kefir Susu Sapi dengan Penambahan Susu Kedelai
Julianto, Budi; Rossi, Evy; ', Yusmarini
2016-01-01
The purpose of this research was to observe chemical and microbiology characteristic of three kind of kefir, made from cow milk with addition of soymilk. Observed kefirs were kefir whey (KW), kefir optima (KO), and kefir prima (KP). A Completely Randomized Design (CRD) was used in this research with six treatments and three replications treatment consists of KW1 (100% cow milk), KW2 (50% cow milk: soymilk 50%), KO1 (100% cow milk), KO2 (50% cow milk: 50% soymilk), KP1 (100% cow milk), and KP2...
On self-dual Yang-Mills hierarchy
International Nuclear Information System (INIS)
Nakamura, Yoshimasa
1989-01-01
In this note, motivated by the Kadomtsev-Petviashvili (KP) hierarchy of integrable nonlinear evolution equations, a GL(n,C) self-dual Yang-Mills (SDYM) hierarchy is presented; it is an infinite system of SDYM equations having an infinite number of independent variables and being outside of the KP hierarchy. A relationship between the KP hierarchy and the SDYM hierarchy is discussed. It is also shown that GL(∞) SDYM equations introduced in this note are reduced to the GL(n,C) SDYM hierarchy by imposing an algebraic constraint. (orig.)
Ammonia synthesis on Au modified Fe(111) and Ag and Cu modified Fe(100) surfaces
DEFF Research Database (Denmark)
Lytken, Ole; Waltenburg, Hanne Neergaard; Chorkendorff, Ib
2003-01-01
In order to investigate any influence of steps and possible positive effects of making surface alloys the ammonia synthesis has been investigated over Au modified Fe(111) and Ag and Cu modified Fe(100) single crystals in the temperature range 603-773 K, using a system combining ultra-high vacuum...... and a high-pressure cell. Ammonia was synthesized from a stoichiometric (N-2:3H(2)) gas mixture at a pressure of 2 bar. By deposition of small amounts of An, the ammonia production activity of the Fe(1 1 1) surface can be enhanced. More important, for the gold modified surface, the reaction order in ammonia...
Energy Technology Data Exchange (ETDEWEB)
Martin, Ina; French, Roger H.
2018-03-19
Our project objective in the first and only Budget Period was to demonstrate the potential of nm-scale organofunctional silane coatings as a method of extending the lifetime of PV materials and devices. Specifically, the target was to double the lifetime performance of a laminated Cu(In,Ga)Se2 (CIGS) cell under real-world and accelerated aging exposure conditions. Key findings are that modification of aluminum-doped zinc oxide (AZO) films (materials used as transparent conductive oxide (TCO) top contacts) resulted in decreased degradation of optical and electrical properties under damp heat (DH) exposure compared to un-modified AZO. The most significant finding is that modification of the AZO top contact of full CIGS devices resulted in significantly improved properties under DH exposure compared to un-modified devices, by a factor of 4 after 1000 h. Results of this one-year project have demonstrated that surface functionalization is a viable pathway for extending the lifetime of state-of-the-art CIGS devices.
The nonlinear evolution of ring dark solitons in Bose-Einstein condensates
International Nuclear Information System (INIS)
Xue Jukui
2004-01-01
The dynamics of the ring dark soliton in a Bose-Einstein condensate (BEC) with thin disc-shaped potential is investigated analytically and numerically. Analytical investigation shows that the ring dark soliton in the radial non-symmetric cylindrical BEC is governed by a cylindrical Kadomtsev-Petviashvili equation, while the ring dark soliton in the radial symmetric cylindrical BEC is governed by a cylindrical Korteweg-de Vries equation. The reduction to the cylindrical KP or KdV equation may be useful to understand the dynamics of a ring dark soliton. The numerical results show that the evolution properties and the snaking of a ring dark soliton are modified significantly by the trapping
[Genetically modified food--unnecessary controversy?].
Tchórz, Michał; Radoniewicz-Chagowska, Anna; Lewandowska-Stanek, Hanna; Szponar, Elzbieta; Szponar, Jarosław
2012-01-01
Fast development of genetic engineering and biotechnology allows use of genetically modified organisms (GMO) more and more in different branches of science and economy. Every year we can see an increase of food amount produced with the use of modification of genetic material. In our supermarkets we can find brand new types of plants, products including genetically modified ingredients or meat from animals fed with food containing GMO. This article presents general information about genetically modified organisms, it also explains the range of genetic manipulation, use of newly developed products and current field area for GMO in the world. Based on scientific data the article presents benefits from development of biotechnology in reference to modified food. It also presents the voice of skeptics who are extremely concerned about the impact of those organisms on human health and natural environment. Problems that appear or can appear as a result of an increase of GMO are very important not only from a toxicologist's or a doctor's point of view but first of all from the point of view of ordinary consumers--all of us.
Modified nasolacrimal duct stenting
International Nuclear Information System (INIS)
Tian Min; Jin Mei; Chen Huanjun; Li Yi
2008-01-01
Objective: Traditional nasolacrimal duct stenting possesses some shortcoming including difficulty of pulling ball head guide wire from the nasal cavity with turbinate hypertrophy and nasal septal deviation. The new method of nose-oral tube track establishment can overcome the forementioned and increase the successful rate. Methods: 5 F catheter and arterial sheath were modified to be nasolacrimal duct stent delivery device respectively. Antegrade dacryocystography was taken firstly to display the obstructed site and followed by the modified protocol of inserting the guide wire through nasolacrimal duct and nasal cavity, and establishing the stent delivery track for retrograde stent placement. Results: 5 epiphora patients with failure implantation by traditional method were all succeeded through the modified stenting (100%). During 6-mouth follow-up, no serious complications and reocclusion occurred. Conclusion: The establishment of eye-nose-mouth-nose of external nasal guide wire track can improve the successful rate of nasolacrimal duct stenting. (authors)
de Lara-Castells, María Pilar; Stoll, Hermann; Civalleri, Bartolomeo; Causà, Mauro; Voloshina, Elena; Mitrushchenkov, Alexander O; Pi, Martí
2014-10-21
In this work we propose a general strategy to calculate accurate He-surface interaction potentials. It extends the dispersionless density functional approach recently developed by Pernal et al. [Phys. Rev. Lett. 103, 263201 (2009)] to adsorbate-surface interactions by including periodic boundary conditions. We also introduce a scheme to parametrize the dispersion interaction by calculating two- and three-body dispersion terms at coupled cluster singles and doubles and perturbative triples (CCSD(T)) level via the method of increments [H. Stoll, J. Chem. Phys. 97, 8449 (1992)]. The performance of the composite approach is tested on (4)He/graphene by determining the energies of the low-lying selective adsorption states, finding an excellent agreement with the best available theoretical data. Second, the capability of the approach to describe dispersionless correlation effects realistically is used to extract dispersion effects in time-dependent density functional simulations on the collision of (4)He droplets with a single graphene sheet. It is found that dispersion effects play a key role in the fast spreading of the (4)He nanodroplet, the evaporation-like process of helium atoms, and the formation of solid-like helium structures. These characteristics are expected to be quite general and highly relevant to explain experimental measurements with the newly developed helium droplet mediated deposition technique.
Normal modified stable processes
DEFF Research Database (Denmark)
Barndorff-Nielsen, Ole Eiler; Shephard, N.
2002-01-01
Gaussian (NGIG) laws. The wider framework thus established provides, in particular, for added flexibility in the modelling of the dynamics of financial time series, of importance especially as regards OU based stochastic volatility models for equities. In the special case of the tempered stable OU process......This paper discusses two classes of distributions, and stochastic processes derived from them: modified stable (MS) laws and normal modified stable (NMS) laws. This extends corresponding results for the generalised inverse Gaussian (GIG) and generalised hyperbolic (GH) or normal generalised inverse...
International Nuclear Information System (INIS)
Cui Weiguang; Zhang Pengjie; Yang Xiaohu
2010-01-01
A large fraction of cosmological information on dark energy and gravity is encoded in the nonlinear regime. Precision cosmology thus requires precision modeling of nonlinearities in general dark energy and modified gravity models. We modify the Gadget-2 code and run a series of N-body simulations on modified gravity cosmology to study the nonlinearities. The modified gravity model that we investigate in the present paper is characterized by a single parameter ζ, which determines the enhancement of particle acceleration with respect to general relativity (GR), given the identical mass distribution (ζ=1 in GR). The first nonlinear statistics we investigate is the nonlinear matter power spectrum at k < or approx. 3h/Mpc, which is the relevant range for robust weak lensing power spectrum modeling at l < or approx. 2000. In this study, we focus on the relative difference in the nonlinear power spectra at corresponding redshifts where different gravity models have the same linear power spectra. This particular statistics highlights the imprint of modified gravity in the nonlinear regime and the importance of including the nonlinear regime in testing GR. By design, it is less susceptible to the sample variance and numerical artifacts. We adopt a mass assignment method based on wavelet to improve the power spectrum measurement. We run a series of tests to determine the suitable simulation specifications (particle number, box size, and initial redshift). We find that, the nonlinear power spectra can differ by ∼30% for 10% deviation from GR (|ζ-1|=0.1) where the rms density fluctuations reach 10. This large difference, on one hand, shows the richness of information on gravity in the corresponding scales, and on the other hand, invalidates simple extrapolations of some existing fitting formulae to modified gravity cosmology.
Acid-degradable and bioerodible modified polyhydroxylated materials
Energy Technology Data Exchange (ETDEWEB)
Frechet, Jean M. J.; Bachelder, Eric M.; Beaudette, Tristan T.; Broaders, Kyle E.
2017-05-09
Compositions and methods of making a modified polyhydroxylated polymer comprising a polyhydroxylated polymer having reversibly modified hydroxyl groups, whereby the hydroxyl groups are modified by an acid-catalyzed reaction between a polydroxylated polymer and a reagent such as acetals, aldehydes, vinyl ethers and ketones such that the modified polyhydroxylated polymers become insoluble in water but freely soluble in common organic solvents allowing for the facile preparation of acid-sensitive materials. Materials made from these polymers can be made to degrade in a pH-dependent manner. Both hydrophobic and hydrophilic cargoes were successfully loaded into particles made from the present polymers using single and double emulsion techniques, respectively. Due to its ease of preparation, processability, pH-sensitivity, and biocompatibility, of the present modified polyhydroxylated polymers should find use in numerous drug delivery applications.
A call for differentiated approaches to delivering HIV services to key populations.
Macdonald, Virginia; Verster, Annette; Baggaley, Rachel
2017-07-21
Key populations (KPs) are disproportionally affected by HIV and have low rates of access to HIV testing and treatment services compared to the broader population. WHO promotes the use of differentiated approaches for reaching and recruiting KP into the HIV services continuum. These approaches may help increase access to KPs who are often criminalized or stigmatized. By catering to the specific needs of each KP individual, differentiated approaches may increase service acceptability, quality and coverage, reduce costs and support KP members in leading the HIV response among their communities. WHO recommends the implementation of community-based and lay provider administered HIV testing services. Together, these approaches reduce barriers and costs associated with other testing strategies, allow greater ownership in HIV programmes for KP members and reach more people than do facility-based services. Despite this evidence availability and support for them is limited. Peer-driven interventions have been shown to be effective in engaging, recruiting and supporting clients. Some programmes employ HIV-positive or non-PLHIV "peer navigators" and other staff to provide case management, enrolment and/or re-enrolment in care and treatment services. However, a better understanding of the impact, cost effectiveness and potential burden on peer volunteers is required. Task shifting and non-facility-based service locations for antiretroviral therapy (ART) initiation and maintenance and antiretroviral (ARV) distribution are recommended in both the consolidated HIV treatment and KP guidelines of WHO. These approaches are accepted in generalized epidemics and for the general population where successful models exist; however, few organizations provide or initiate ART at KP community-based services. The application of a differentiated service approach for KP could increase the number of people who know their status and receive effective and sustained prevention and treatment for HIV
Modified General Relativity and Cosmology
Abdel-Rahman, A.-M. M.
1997-10-01
Aspects of the modified general relativity theory of Rastall, Al-Rawaf and Taha are discussed in both the radiation- and matter-dominated flat cosmological models. A nucleosynthesis constraint on the theory's free parameter is obtained and the implication for the age of the Universe is discussed. The consistency of the modified matter- dominated model with the neoclassical cosmological tests is demonstrated.
Chromatin-modifying proteins in cancer
DEFF Research Database (Denmark)
Fog, Cathrine K; Jensen, Klaus T; Lund, Anders Henrik
2007-01-01
-despite the fact that all cells in the organism contain the same genetic information. A large amount of data gathered over the last decades has demonstrated that deregulation of chromatin-modifying proteins is etiologically involved in the development and progression of cancer. Here we discuss how epigenetic...... alterations influence cancer development and review known cancer-associated alterations in chromatin-modifying proteins....
21 CFR 184.1063 - Enzyme-modified lecithin.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Enzyme-modified lecithin. 184.1063 Section 184.1063... Listing of Specific Substances Affirmed as GRAS § 184.1063 Enzyme-modified lecithin. (a) Enzyme-modified lecithin is prepared by treating lecithin with either phospholipase A2 (EC 3.1.1.4) or pancreatin. (b) The...
Penumbra modifier for optimal electron fields combination
International Nuclear Information System (INIS)
ElSherbini, N.; Hejazy, M.A.; Khalil, W.
2003-01-01
Abutment of two or more electron fields to irradiate extended areas may lead to significant dose inhomogeneities in the junction region. This study describes the geometric and dosimetric characteristics of a device developed to modify the penumbra of an electron beam and therapy improve of dose uniformity in the over lap region when fields are abutted. The device is lipowitz metal block placed on top of the insertion plate of the electron applicator and positioned to stop part of he electron beam on side of field abutment. The air-scattered electrons beyond the block increase the penumbra width from about 1,4 to 2-7-43.4 cm at SSD 100 cm, the modified penumbra is broad and almost linear at all depths for the 6.8, and 15 MeV electron beams used. Film dosimetry was used to obtain profiles, iso-dose distributions, single modified beams and matched fields of 6, 10, and 15 MeV. Wellhofer dosimetry system was used to obtain beam profiles and iso-dose distributions of single modified beams needed for CADPLAN treatment planning system, which used to optimize and compare the skin gap to be used and to quantify the dose uniformity in a junction of the field separation for both modified and non-modified beams. Results are presented for various field configurations without the penumbra modifier; lateral setup error of 2-3 mm may introduce dose variations of 20% or more in the junction region. Similar setup error cause less than 5% dose variations when the penumbra modifier is used to match the field
A Chemical Probe that Labels Human Pluripotent Stem Cells
Directory of Open Access Journals (Sweden)
Nao Hirata
2014-03-01
Full Text Available A small-molecule fluorescent probe specific for human pluripotent stem cells would serve as a useful tool for basic cell biology research and stem cell therapy. Screening of fluorescent chemical libraries with human induced pluripotent stem cells (iPSCs and subsequent evaluation of hit molecules identified a fluorescent compound (Kyoto probe 1 [KP-1] that selectively labels human pluripotent stem cells. Our analyses indicated that the selectivity results primarily from a distinct expression pattern of ABC transporters in human pluripotent stem cells and from the transporter selectivity of KP-1. Expression of ABCB1 (MDR1 and ABCG2 (BCRP, both of which cause the efflux of KP-1, is repressed in human pluripotent stem cells. Although KP-1, like other pluripotent markers, is not absolutely specific for pluripotent stem cells, the identified chemical probe may be used in conjunction with other reagents.
Asymptotics for Large Time of Global Solutions to the Generalized Kadomtsev-Petviashvili Equation
Hayashi, Nakao; Naumkin, Pavel I.; Saut, Jean-Claude
We study the large time asymptotic behavior of solutions to the generalized Kadomtsev-Petviashvili (KP) equations where σ= 1 or σ=- 1. When ρ= 2 and σ=- 1, (KP) is known as the KPI equation, while ρ= 2, σ=+ 1 corresponds to the KPII equation. The KP equation models the propagation along the x-axis of nonlinear dispersive long waves on the surface of a fluid, when the variation along the y-axis proceeds slowly [10]. The case ρ= 3, σ=- 1 has been found in the modeling of sound waves in antiferromagnetics [15]. We prove that if ρ>= 3 is an integer and the initial data are sufficiently small, then the solution u of (KP) satisfies the following estimates: for all t∈R, where κ= 1 if ρ= 3 and κ= 0 if ρ>= 4. We also find the large time asymptotics for the solution.
Weak lensing probes of modified gravity
International Nuclear Information System (INIS)
Schmidt, Fabian
2008-01-01
We study the effect of modifications to general relativity on large-scale weak lensing observables. In particular, we consider three modified gravity scenarios: f(R) gravity, the Dvali-Gabadadze-Porrati model, and tensor-vector-scalar theory. Weak lensing is sensitive to the growth of structure and the relation between matter and gravitational potentials, both of which will in general be affected by modified gravity. Restricting ourselves to linear scales, we compare the predictions for galaxy-shear and shear-shear correlations of each modified gravity cosmology to those of an effective dark energy cosmology with the same expansion history. In this way, the effects of modified gravity on the growth of perturbations are separated from the expansion history. We also propose a test which isolates the matter-potential relation from the growth factor and matter power spectrum. For all three modified gravity models, the predictions for galaxy and shear correlations will be discernible from those of dark energy with very high significance in future weak lensing surveys. Furthermore, each model predicts a measurably distinct scale dependence and redshift evolution of galaxy and shear correlations, which can be traced back to the physical foundations of each model. We show that the signal-to-noise for detecting signatures of modified gravity is much higher for weak lensing observables as compared to the integrated Sachs-Wolfe effect, measured via the galaxy-cosmic microwave background cross-correlation.
Electronic structure of single crystalline Bi2(Sr,Ca,La)3Cu2O8
International Nuclear Information System (INIS)
Lindberg, P.A.P.; Shen, Z.X.; Dessau, D.S.; Wells, B.O.; Borg, A.; Mitzi, D.B.; Lindau, I.; Spicer, W.E.; Kapitulnik, A.
1989-01-01
Angle-resolved photoemission experiments on single crystals of Bi 2 (Sr,Ca,La) 3 Cu 2 O 8 are reported. The data show a dispersionless behavior of the valence band states as a function of the perpendicular component of the wave vector (along the c-axis), while as a function of the parallel component (in the a-b plane) clear dispersion occurs. Furthermore, polarization-dependent excitations reveal information on the symmetry of the unoccupied states
Genotoxicity of unmodified and organo-modified montmorillonite
DEFF Research Database (Denmark)
Sharma, Anoop Kumar; Schmidt, Bjørn; Frandsen, Henrik Lauritz
2010-01-01
absent in the filtered samples, which was independently confirmed by dynamic light-scattering measurements. Detection and identification of free quaternary ammonium modifier in the filtered sample was carried out by HPLC-Q-TOF/MS and revealed a total concentration of a mixture of quaternary ammonium...... assay, none of the clays produced ROS in a cell-free test system (the DCFH-DA assay). Inductively coupled plasma mass-spectrometry (ICP-MS) was used to detect clay particles in the filtered samples using aluminium as a tracer element characteristic to clay. The results indicated that clay particles were...... analogues of 1.57 mu g/ml. These findings suggest that the genotoxicity of organo-modified montmorillonite was caused by the organo-modifier. The detected organo-modifier mixture was synthesized and comet-assay results showed that the genotoxic potency of this synthesized organo-modifier was in the same...
Tree Diversity and Structure of Andaman Giant Evergreen Forests, India
Directory of Open Access Journals (Sweden)
M. Rajkumar
2008-12-01
Full Text Available We investigated tree diversity in ‘giant evergreen forest’ of Andaman and Nicobar Islands, which falls within the Indo-Burma hot spot of biodiversity in the world. A one hectare square plot was established in sites Kalapahad (KP and Macarthy Valley (MV of Middle Andamans, in which all trees ≥ 30 cm girth at breast height (gbh were enumerated. Tree diversity totaled 105 species that belonged to 63 genera and 49 families. Site MV harboured ~10% greater species richness than KP. Species diversity indices did not vary much between the two sites. In the two sites, there were 1311 individuals of trees (579 ha-1 in KP and 732 in MV. The stand basal area was nearly equal in both the sites (KP- 45.59 m2 ha-1; MV- 47.93 m2 ha-1. Thirteen tree species (12.38% were strict endemics to Andamans. Ten species recorded are rare to the flora of these islands. The two sites are distinctly dominated by two different plant families; Dipterocarpaceae in KP and Myristicaceae in MV. Most of the species were common to central and lower region of Myanmar and Indian mainland. The forest stand structure exhibited a typical reverse-J shape, but site MV had double the density of stems in the lower tree size class than that of KP. The voluminous dipterocarps contributed more to the total above-ground live biomass. The need to preserve these species- and endemics- rich, fragile island forests, prioritized for biodiversity conservation, is emphasized.
Giorgini, Flaviano; Huang, Shao-Yi; Sathyasaikumar, Korrapati V; Notarangelo, Francesca M; Thomas, Marian A R; Tararina, Margarita; Wu, Hui-Qiu; Schwarcz, Robert; Muchowski, Paul J
2013-12-20
Kynurenine 3-monooxygenase (KMO), a pivotal enzyme in the kynurenine pathway (KP) of tryptophan degradation, has been suggested to play a major role in physiological and pathological events involving bioactive KP metabolites. To explore this role in greater detail, we generated mice with a targeted genetic disruption of Kmo and present here the first biochemical and neurochemical characterization of these mutant animals. Kmo(-/-) mice lacked KMO activity but showed no obvious abnormalities in the activity of four additional KP enzymes tested. As expected, Kmo(-/-) mice showed substantial reductions in the levels of its enzymatic product, 3-hydroxykynurenine, in liver, brain, and plasma. Compared with wild-type animals, the levels of the downstream metabolite quinolinic acid were also greatly decreased in liver and plasma of the mutant mice but surprisingly were only slightly reduced (by ∼20%) in the brain. The levels of three other KP metabolites: kynurenine, kynurenic acid, and anthranilic acid, were substantially, but differentially, elevated in the liver, brain, and plasma of Kmo(-/-) mice, whereas the liver and brain content of the major end product of the enzymatic cascade, NAD(+), did not differ between Kmo(-/-) and wild-type animals. When assessed by in vivo microdialysis, extracellular kynurenic acid levels were found to be significantly elevated in the brains of Kmo(-/-) mice. Taken together, these results provide further evidence that KMO plays a key regulatory role in the KP and indicate that Kmo(-/-) mice will be useful for studying tissue-specific functions of individual KP metabolites in health and disease.
Drosophila eye color mutants as therapeutic tools for Huntington disease.
Green, Edward W; Campesan, Susanna; Breda, Carlo; Sathyasaikumar, Korrapati V; Muchowski, Paul J; Schwarcz, Robert; Kyriacou, Charalambos P; Giorgini, Flaviano
2012-01-01
Huntington disease (HD) is a fatal inherited neurodegenerative disorder caused by a polyglutamine expansion in the huntingtin protein (htt). A pathological hallmark of the disease is the loss of a specific population of striatal neurons, and considerable attention has been paid to the role of the kynurenine pathway (KP) of tryptophan (TRP) degradation in this process. The KP contains three neuroactive metabolites: 3-hydroxykynurenine (3-HK), quinolinic acid (QUIN), and kynurenic acid (KYNA). 3-HK and QUIN are neurotoxic, and are increased in the brains of early stage HD patients, as well as in yeast and mouse models of HD. Conversely, KYNA is neuroprotective and has been shown to be decreased in HD patient brains. We recently used a Drosophila model of HD to measure the neuroprotective effect of genetic and pharmacological inhibition of kynurenine monoxygenase (KMO)-the enzyme catalyzing the formation of 3-HK at a pivotal branch point in the KP. We found that KMO inhibition in Drosophila robustly attenuated neurodegeneration, and that this neuroprotection was correlated with reduced levels of 3-HK relative to KYNA. Importantly, we showed that KP metabolites are causative in this process, as 3-HK and KYNA feeding experiments modulated neurodegeneration. We also found that genetic inhibition of the upstream KP enzyme tryptophan-2,3-dioxygenase (TDO) was neuroprotective in flies. Here, we extend these results by reporting that genetic impairment of KMO or TDO is protective against the eclosion defect in HD model fruit flies. Our results provide further support for the possibility of therapeutic KP interventions in HD.
Targeted Deletion of Kynurenine 3-Monooxygenase in Mice
Giorgini, Flaviano; Huang, Shao-Yi; Sathyasaikumar, Korrapati V.; Notarangelo, Francesca M.; Thomas, Marian A. R.; Tararina, Margarita; Wu, Hui-Qiu; Schwarcz, Robert; Muchowski, Paul J.
2013-01-01
Kynurenine 3-monooxygenase (KMO), a pivotal enzyme in the kynurenine pathway (KP) of tryptophan degradation, has been suggested to play a major role in physiological and pathological events involving bioactive KP metabolites. To explore this role in greater detail, we generated mice with a targeted genetic disruption of Kmo and present here the first biochemical and neurochemical characterization of these mutant animals. Kmo−/− mice lacked KMO activity but showed no obvious abnormalities in the activity of four additional KP enzymes tested. As expected, Kmo−/− mice showed substantial reductions in the levels of its enzymatic product, 3-hydroxykynurenine, in liver, brain, and plasma. Compared with wild-type animals, the levels of the downstream metabolite quinolinic acid were also greatly decreased in liver and plasma of the mutant mice but surprisingly were only slightly reduced (by ∼20%) in the brain. The levels of three other KP metabolites: kynurenine, kynurenic acid, and anthranilic acid, were substantially, but differentially, elevated in the liver, brain, and plasma of Kmo−/− mice, whereas the liver and brain content of the major end product of the enzymatic cascade, NAD+, did not differ between Kmo−/− and wild-type animals. When assessed by in vivo microdialysis, extracellular kynurenic acid levels were found to be significantly elevated in the brains of Kmo−/− mice. Taken together, these results provide further evidence that KMO plays a key regulatory role in the KP and indicate that Kmo−/− mice will be useful for studying tissue-specific functions of individual KP metabolites in health and disease. PMID:24189070
Management of KPC-producing Klebsiella pneumoniae infections.
Bassetti, M; Giacobbe, D R; Giamarellou, H; Viscoli, C; Daikos, G L; Dimopoulos, G; De Rosa, F G; Giamarellos-Bourboulis, E J; Rossolini, G M; Righi, E; Karaiskos, I; Tumbarello, M; Nicolau, D P; Viale, P L; Poulakou, G
2018-02-01
Klebsiella pneumoniae carbapenemase (KPC)-producing K. pneumoniae (KPC-KP) has become one of the most important contemporary pathogens, especially in endemic areas. To provide practical suggestion for physicians dealing with the management of KPC-KP infections in critically ill patients, based on expert opinions. PubMed search for relevant publications related to the management of KPC-KP infections. A panel of experts developed a list of 12 questions to be addressed. In view of the current lack of high-level evidence, they were asked to provide answers on the bases of their knowledge and experience in the field. The panel identified several key aspects to be addressed when dealing with KPC-KP in critically ill patients (preventing colonization in the patient, preventing infection in the colonized patient and colonization of his or her contacts, reducing mortality in the infected patient by rapidly diagnosing the causative agent and promptly adopting the best therapeutic strategy) and provided related suggestions that were based on the available observational literature and the experience of panel members. Diagnostic technologies could speed up the diagnosis of KPC-KP infections. Combination treatment should be preferred to monotherapy in cases of severe infections. For non-critically ill patients without severe infections, results from randomized clinical trials are needed for ultimately weighing benefits and costs of using combinations rather than monotherapy. Multifaceted infection control interventions are needed to decrease the rates of colonization and cross-transmission of KPC-KP. Copyright © 2017 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
Modifying Knowledge, Emotions, and Attitudes Regarding Genetically Modified Foods
Heddy, Benjamin C.; Danielson, Robert W.; Sinatra, Gale M.; Graham, Jesse
2017-01-01
The purpose of this study was to explore whether conceptual change predicted emotional and attitudinal change while learning about genetically modified foods (GMFs). Participants were 322 college students; half read a refutation text designed to shift conceptual knowledge, emotions, and attitudes, while the other half served as a control group.…
MODIFIED TECHNIQUE OF TOTAL LARYNGECTOMY
Directory of Open Access Journals (Sweden)
Predrag Spirić
2010-12-01
Full Text Available Surgical technique of total laryngectomy is well presented in many surgical textbooks. Essentially, it has remained the same since Gluck an Soerensen in 1922 described all its details. Generally, it stresses the U shape skin incision with releasing laryngeal structures and removing larynx from up to down. Further, pharyngeal reconstruction is performed with different kinds of sutures in two or more layers and is finished with skin suture and suction drainage. One of worst complications following this surgery is pharyngocutaneous fistula (PF. Modifications proposed in this this article suggests vertical skin incision with larynx removal from below upwards. In pharyngeal reconstruction we used the running locked suture in submucosal plan with „tobacco sac“ at the end on the tongue base instead of traditional T shaped suture. Suction drains were not used.The aim of study was to present the modified surgical technique of total laryingectomy and its impact on hospital stay duration and pharyngocutanous fistula formation. In this randomized study we analyzed 49 patients operated with modified surgical technique compared to 49 patient operated with traditional surgical technique of total laryngectomy. The modified technique of total laryngectomy was presented. Using modified technique we managed to decrease the PF percentage from previous 20,41% to acceptable 8,16% (p=0,0334. Also, the average hospital stay was shortened from 14,96 to 10,63 days (t =-2.9850; p=0.0358.The modified technique of total laryngectomy is safe, short and efficient surgical intervention which decreases the number of pharyngocutaneos fistulas and shortens the hospital stay.
International Nuclear Information System (INIS)
Szczerba, A.
1974-01-01
Results of correlation-regression analysis of the relationship of the prosity Kp to the relative intensity of neutron-induced gamma radiation dIng are reviewed. The geophysical results and laboratory tests of Malmian carbonate rocks from 10 boreholes from the central part of the Nida trough have been utilized to study this relationship. The regression equation dIng=∫(Kp) and the nomogram to determine the porosity Kp on the basis of neutron-gamma log or neutron-gamma and gamma logs, when the correction for the content is to be considered, have been also presented. (author)
Properties of Direct Coal Liquefaction Residue Modified Asphalt Mixture
Directory of Open Access Journals (Sweden)
Jie Ji
2017-01-01
Full Text Available The objectives of this paper are to use Direct Coal Liquefaction Residue (DLCR to modify the asphalt binders and mixtures and to evaluate the performance of modified asphalt mixtures. The dynamic modulus and phase angle of DCLR and DCLR-composite modified asphalt mixture were analyzed, and the viscoelastic properties of these modified asphalt mixtures were compared to the base asphalt binder SK-90 and Styrene-Butadiene-Styrene (SBS modified asphalt mixtures. The master curves of the asphalt mixtures were shown, and dynamic and viscoelastic behaviors of asphalt mixtures were described using the Christensen-Anderson-Marasteanu (CAM model. The test results show that the dynamic moduli of DCLR and DCLR-composite asphalt mixtures are higher than those of the SK-90 and SBS modified asphalt mixtures. Based on the viscoelastic parameters of CAM models of the asphalt mixtures, the high- and low-temperature performance of DLCR and DCLR-composite modified asphalt mixtures are obviously better than the SK-90 and SBS modified asphalt mixtures. In addition, the DCLR and DCLR-composite modified asphalt mixtures are more insensitive to the frequency compared to SK-90 and SBS modified asphalt mixtures.
Partitioning of monomethylmercury between freshwater algae and water.
Miles, C J; Moye, H A; Phlips, E J; Sargent, B
2001-11-01
Phytoplankton-water monomethylmercury (MeHg) partition constants (KpI) have been determined in the laboratory for two green algae Selenastrum capricornutum and Cosmarium botrytis, the blue-green algae Schizothrix calcicola, and the diatom Thallasiosira spp., algal species that are commonly found in natural surface waters. Two methods were used to determine KpI, the Freundlich isotherm method and the flow-through/dialysis bag method. Both methods yielded KpI values of about 10(6.6) for S. capricornutum and were not significantly different. The KpI for the four algae studied were similar except for Schizothrix, which was significantly lower than S. capricornutum. The KpI for MeHg and S. capricornutum (exponential growth) was not significantly different in systems with predominantly MeHgOH or MeHgCl species. This is consistent with other studies that show metal speciation controls uptake kinetics, but the reactivity with intracellular components controls steady-state concentrations. Partitioning constants determined with exponential and stationary phase S. capricornutum cells at the same conditions were not significantly different, while the partitioning constant for exponential phase, phosphorus-limited cells was significantly lower, suggesting that P-limitation alters the ecophysiology of S. capricornutum sufficiently to impact partitioning, which may then ultimately affect mercury levels in higher trophic species.
Directory of Open Access Journals (Sweden)
Abdulla A.-B. Badawy
2016-01-01
Full Text Available Tryptophan (Trp metabolism via the kynurenine pathway (KP was assessed in normal healthy US volunteers at baseline and after acute Trp depletion (ATD and acute Trp loading (ATL using amino acid formulations. The hepatic KP accounts for ~90% of overall Trp degradation. Liver Trp 2,3-dioxygenase (TDO contributes ~70% toward Trp oxidation, with the remainder achieved by subsequent rate-limiting enzymes in the KP. TDO is not influenced by a 1.15 g Trp load, but is maximally activated by a 5.15 g dose. We recommend a 30 mg/kg dose for future ATL studies. ATD activates TDO and enhances the Trp flux down the KP via its leucine component. Higher plasma free [Trp] and lower total [Trp] are observed in women, with no gender differences in kynurenines. Kynurenic acid is lower in female Caucasians, which may explain their lower incidence of schizophrenia. African-American and Hispanic women have a lower TDO and Trp oxidation relative to free Trp than the corresponding men. African-American women have a potentially higher 3-hydroxyanthranilic acid/anthranilic acid ratio, which may protect them against osteoporosis. Future studies of the KP in relation to health and disease should focus on gender and ethnic differences.
Fractional Carbon Dioxide Laser for Keratosis Pilaris: A Single-Blind, Randomized, Comparative Study
Directory of Open Access Journals (Sweden)
Vasanop Vachiramon
2016-01-01
Full Text Available Objective. Keratosis pilaris (KP is a common condition which can frequently be cosmetically disturbing. Topical treatments can be used with limited efficacy. The objective of this study is to evaluate the effectiveness and safety of fractional carbon dioxide (CO2 laser for the treatment of KP. Patients and Methods. A prospective, randomized, single-blinded, intraindividual comparative study was conducted on adult patients with KP. A single session of fractional CO2 laser was performed to one side of arm whereas the contralateral side served as control. Patients were scheduled for follow-up at 4 and 12 weeks after treatment. Clinical improvement was graded subjectively by blinded dermatologists. Patients rated treatment satisfaction at the end of the study. Results. Twenty patients completed the study. All patients stated that the laser treatment improved KP lesions. At 12-week follow-up, 30% of lesions on the laser-treated side had moderate to good improvement according to physicians’ global assessment (p=0.02. Keratotic papules and hyperpigmentation appeared to respond better than the erythematous component. Four patients with Fitzpatrick skin type V developed transient pigmentary alteration. Conclusions. Fractional CO2 laser treatment may be offered to patients with KP. Dark-skinned patients should be treated with special caution.
Keratosis Pilaris Revisited: Is It More Than Just a Follicular Keratosis?
Thomas, Mary; Khopkar, Uday Sharadchandra
2012-01-01
Background: Keratosis pilaris (KP) is characterized by keratinous plugs in the follicular orifices and varying degrees of perifollicular erythema. The most accepted theory of its pathogenesis proposes defective keratinization of the follicular epithelium resulting in a keratotic infundibular plug. We decided to test this hypothesis by doing dermoscopy of patients diagnosed clinically as keratosis pilaris. Materials and Methods: Patients with a clinical diagnosis of KP seen between September 2011 and December 2011 were included in the study. A clinical history was obtained and examination and dermoscopic evaluation were performed on the lesions of KP. Results: The age of the patients ranged from 6-38 years. Sixteen patients had history of atopy. Nine had concomitant ichthyosis vulgaris. All the 25 patients were found to have coiled hair shafts within the affected follicular infundibula. The hair shafts were extracted with the help of a sterile needle and were found to retain their coiled nature. Perifollicular erythema was seen in 11 patients; perifollicular scaling in 9. Conclusion: Based on our observations and previously documented histological data of KP, we infer that KP may not be a disorder of keratinization, but caused by the circular hair shaft which ruptures the follicular epithelium leading to inflammation and abnormal follicular keratinization. PMID:23766609
The influence of alkali metal impurities on the uranium dioxide hydrofluorination reaction
International Nuclear Information System (INIS)
Ponelis, A.A.
1989-01-01
The effect alkali metal impurities (sodium and potassium) in the uranium dioxide (UO 2 ) feed material have on the conversion to uraniumtetrafluoride (UF 4 ) was examined. A direct correlation exists between impurity level and sintering with concomitant reduced conversion. The sintering mechanism is attributable to decreased specific surface area. The typical 'die-off' of reaction or conversion can be explained in terms of increased particle growth rather than an arbitray zero porosity function. Hydrofluorination temperatures varied from 250 to 650 degrees C using pellets varying in size from 0.42 mm to 10 mm. Scanning electron microscope photographs show clearly the particle or grain growth in the pellet as well as the increased size with impurity level. A new dimensionless constant, N KP , is defined to facilitate explanation of the reaction as a function of pellet radius. N KP is defined as the ratio of pellet diffusion resistance to particle diffusion resistance of the reacting HF gas. At high values of this number (N KP >40) the conversion is limited to the outer periphery of the pellet while at low values (N KP KP at higher reaction temperatures which means that the particle diffusion resistance increases with increasing impurity level and results in easier sintering of these materials. 53 refs., 206 figs., 94 tabs
Directory of Open Access Journals (Sweden)
Linjing Mu
2014-03-01
Full Text Available Cannabinoid receptor subtype 2 (CB2 has been shown to be up-regulated in activated microglia and therefore plays an important role in neuroinflammatory and neurodegenerative diseases such as multiple sclerosis, amyotrophic lateral sclerosis and Alzheimer’s disease. The CB2 receptor is therefore considered as a very promising target for therapeutic approaches as well as for imaging. A promising 2-oxoquinoline derivative designated KP23 was synthesized and radiolabeled and its potential as a ligand for PET imaging the CB2 receptor was evaluated. [11C]KP23 was obtained in 10%–25% radiochemical yield (decay corrected and 99% radiochemical purity. It showed high stability in phosphate buffer, rat and mouse plasma. In vitro autoradiography of rat and mouse spleen slices, as spleen expresses a high physiological expression of CB2 receptors, demonstrated that [11C]KP23 exhibits specific binding towards CB2. High spleen uptake of [11C]KP23 was observed in dynamic in vivo PET studies with Wistar rats. In conclusion, [11C]KP23 showed promising in vitro and in vivo characteristics. Further evaluation with diseased animal model which has higher CB2 expression levels in the brain is warranted.
Public attitudes towards genetically-modified food
Miles, S.; Ueland, O.; Frewer, L.J.
2005-01-01
Abstract: Purpose - This study aimed to investigate the impact of information about traceability and new detection methods for identifying genetically-modified organisms in food, on consumer attitudes towards genetically-modified food and consumer trust in regulators in Italy, Norway and England. It
Thermal oxidative degradation of wood modified with aminophenylborates
Directory of Open Access Journals (Sweden)
Klyachenkova Olga
2016-01-01
Full Text Available Comparative thermal analysis in the presence of oxygen was carried out for samples of native pine wood and wood samples modified with aminophenylborates. Significant decrease in the amount of heat released during thermal decomposition of the modified samples was established, which is due to the increase of carbonaceous residues on the surface. Reduction of heat release during decomposition of the modified samples may be explained by the lower yield of combustible volatile products as well as by thin film of boron oxide, formed on the surface of the modified wood, that partially reflects heat flow. Produced upon the modifier decomposition water vapor and inert nitrogen oxides dilute gaseous mixture near the wood surface and isolate it from oxygen. This enhances fire-resistance of wood modified with mono- and diethanolamine(N→Bphenylborates. Hydroxyl group at the sixth carbon atom of the glucopyranose ring of cellulose participates in reactions of cellulose modification, which prevents formation of flammable levoglucosan and, consequently, improves the fire-resistance of the modified wood.
Allosteric regulation of epigenetic modifying enzymes.
Zucconi, Beth E; Cole, Philip A
2017-08-01
Epigenetic enzymes including histone modifying enzymes are key regulators of gene expression in normal and disease processes. Many drug development strategies to target histone modifying enzymes have focused on ligands that bind to enzyme active sites, but allosteric pockets offer potentially attractive opportunities for therapeutic development. Recent biochemical studies have revealed roles for small molecule and peptide ligands binding outside of the active sites in modulating the catalytic activities of histone modifying enzymes. Here we highlight several examples of allosteric regulation of epigenetic enzymes and discuss the biological significance of these findings. Copyright © 2017 Elsevier Ltd. All rights reserved.
Characterization of lime mortar additivated with crystallization modifiers
Granneman, S.J.C.; Lubelli, B.; van Hees, R.P.J.
2018-01-01
Additivating mortars with crystallization modifiers is a novel approach to mitigate salt crystallization damage in historic masonry. Once verified the effectiveness of crystallization modifiers in bulk solution, the next step consists in verifying whether: (i) modifiers are still effective when
Arabidopsis CDS blastp result: AK105724 [KOME
Lifescience Database Archive (English)
Full Text Available AK105724 001-201-G07 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bisph...osphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...
Arabidopsis CDS blastp result: AK072243 [KOME
Lifescience Database Archive (English)
Full Text Available AK072243 J023003N10 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bispho...sphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...
Arabidopsis CDS blastp result: AK065086 [KOME
Lifescience Database Archive (English)
Full Text Available AK065086 J013001L18 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bispho...sphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...
Arabidopsis CDS blastp result: AK069285 [KOME
Lifescience Database Archive (English)
Full Text Available AK069285 J023011N22 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bispho...sphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...
International Nuclear Information System (INIS)
Yap, A.U.J.
1997-01-01
This study examined the post-irradiation hardness of resin-modified glass ionomer cements and a polyacid-modified composite resin using a digital microhardness tester. Change in hardness of these materials over a period of 6 months was compared to that of conventional glass ionomer cements and a composite resin. With the exception of the composite resin, all materials showed a significant increase in hardness over 24 h after their initial set. Dual-cure resin-modified glass ionomer cements showed decreased hardness with increased storage time in saline at 37 o C. Results suggest that the addition of resins to glass ionomer cements does not improve initial hardness and does not negate the acid-base reaction of conventional cements. Resin addition may, however, lead to increased water sorption and decreased hardness. (author)
Biotechnology: Two Decades of Experimentation with Genetically Modified Foods
Directory of Open Access Journals (Sweden)
Marjan Ajami
2016-10-01
Full Text Available Background and Objective: Over the recent years, genetically modified food in varieties of corn, soybeans, canola and cotton have been introduced to the global market. This study reviews the health and nutritional value of genetically modified foods in the past two decades.Results and Conclusions: Contrary to the present biotechnological claims, transgenic products did not prove to be so flawless, and actually failed to maintain social satisfaction. Genetically modified foods could not gain an increase in the yield potential. Planting natural products and genetically modified products in parallel lines will absolutely result in genetic infection from the side of genetically modified foods. One of the major anxieties of the anti- genetically modified foods activism is the claim that genetically modified crops would alter the consumable parts of the plant quality and safety. Genetically modified foods have shown to have inadequate efficiency and potential adverse effects in both fields of health and biodiversity. This review has presented studies of genetically modified foods performances in the past two decades, and concludes that the wide application and the over generalization of genetically modified foods are not fundamentally recommended.Conflict of interest: Authors declare that there is no conflict of interest.
Glucose Oxidation on Gold-modified Copper Electrode
Energy Technology Data Exchange (ETDEWEB)
Lim, Jieun; Pyo, Sung Gyu; Son, Hyungbin; Kim, Sookil [Chung-Ang Univ., Seoul (Korea, Republic of); Ahn, Sang Hyun; Son, Hyungbin [Korea Institute of Science and Technology, Seoul (Korea, Republic of)
2013-09-15
The activities of Au-modified Cu electrodes toward glucose oxidation are evaluated according to their fabrication conditions and physico-chemical properties. The Au-modified Cu electrodes are fabricated by the galvanic displacement of Au on a Cu substrate and the characteristics of the Au particles are controlled by adjusting the displacement time. From the glucose oxidation tests, it is found that the Au modified Cu has superior activity to the pure Au or Cu film, which is evidenced by the negative shift in the oxidation potential and enhanced current density during the electrochemical oxidation. Though the activity of the Au nanoparticles is a contributing factor, the enhanced activity of the Au-modified Cu electrode is due to the increased oxidation number of Cu through the electron transfer from Cu to more electronegative Au. The depletion of electron in Cu facilitates the oxidation of glucose. The stability of the Au-modified Cu electrode was also studied by chronoamperometry.
On W1+∞ 3-algebra and integrable system
Directory of Open Access Journals (Sweden)
Min-Ru Chen
2015-02-01
Full Text Available We construct the W1+∞ 3-algebra and investigate its connection with the integrable systems. Since the W1+∞ 3-algebra with a fixed generator W00 in the operator Nambu 3-bracket recovers the W1+∞ algebra, it is intrinsically related to the KP hierarchy. For the general case of the W1+∞ 3-algebra, we directly derive the KP and KdV equations from the Nambu–Poisson evolution equation with the different Hamiltonian pairs of the KP hierarchy. Due to the Nambu–Poisson evolution equation involves two Hamiltonians, the deep relationship between the Hamiltonian pairs of KP hierarchy is revealed. Furthermore we give a realization of the W1+∞ 3-algebra in terms of a complex bosonic field. Based on the Nambu 3-brackets of the complex bosonic field, we derive the (generalized nonlinear Schrödinger equation and give an application in optical soliton.
Design of elliptic curve cryptoprocessors over GF(2^163 using the Gaussian normal basis
Directory of Open Access Journals (Sweden)
Paulo Cesar Realpe
2014-05-01
Full Text Available This paper presents the efficient hardware implementation of cryptoprocessors that carry out the scalar multiplication kP over finite field GF(2163 using two digit-level multipliers. The finite field arithmetic operations were implemented using Gaussian normal basis (GNB representation, and the scalar multiplication kP was implemented using Lopez-Dahab algorithm, 2-NAF halve-and-add algorithm and w-tNAF method for Koblitz curves. The processors were designed using VHDL description, synthesized on the Stratix-IV FPGA using Quartus II 12.0 and verified using SignalTAP II and Matlab. The simulation results show that the cryptoprocessors present a very good performance to carry out the scalar multiplication kP. In this case, the computation times of the multiplication kP using Lopez-Dahab, 2-NAF halve-and-add and 16-tNAF for Koblitz curves were 13.37 µs, 16.90 µs and 5.05 µs, respectively.
Saha, Asit; Pal, Nikhil; Chatterjee, Prasanta
2014-10-01
The dynamic behavior of ion acoustic waves in electron-positron-ion magnetoplasmas with superthermal electrons and positrons has been investigated in the framework of perturbed and non-perturbed Kadomtsev-Petviashili (KP) equations. Applying the reductive perturbation technique, we have derived the KP equation in electron-positron-ion magnetoplasma with kappa distributed electrons and positrons. Bifurcations of ion acoustic traveling waves of the KP equation are presented. Using the bifurcation theory of planar dynamical systems, the existence of the solitary wave solutions and the periodic traveling wave solutions has been established. Two exact solutions of these waves have been derived depending on the system parameters. Then, using the Hirota's direct method, we have obtained two-soliton and three-soliton solutions of the KP equation. The effect of the spectral index κ on propagations of the two-soliton and the three-soliton has been shown. Considering an external periodic perturbation, we have presented the quasi periodic behavior of ion acoustic waves in electron-positron-ion magnetoplasmas.
Energy Technology Data Exchange (ETDEWEB)
Saha, Asit, E-mail: asit-saha123@rediffmail.com, E-mail: prasantachatterjee1@rediffmail.com [Department of Mathematics, Sikkim Manipal Institute of Technology, Majitar, Rangpo, East-Sikkim 737136 (India); Department of Mathematics, Siksha Bhavana, Visva Bharati University, Santiniketan-731235 (India); Pal, Nikhil; Chatterjee, Prasanta, E-mail: asit-saha123@rediffmail.com, E-mail: prasantachatterjee1@rediffmail.com [Department of Mathematics, Siksha Bhavana, Visva Bharati University, Santiniketan-731235 (India)
2014-10-15
The dynamic behavior of ion acoustic waves in electron-positron-ion magnetoplasmas with superthermal electrons and positrons has been investigated in the framework of perturbed and non-perturbed Kadomtsev-Petviashili (KP) equations. Applying the reductive perturbation technique, we have derived the KP equation in electron-positron-ion magnetoplasma with kappa distributed electrons and positrons. Bifurcations of ion acoustic traveling waves of the KP equation are presented. Using the bifurcation theory of planar dynamical systems, the existence of the solitary wave solutions and the periodic traveling wave solutions has been established. Two exact solutions of these waves have been derived depending on the system parameters. Then, using the Hirota's direct method, we have obtained two-soliton and three-soliton solutions of the KP equation. The effect of the spectral index κ on propagations of the two-soliton and the three-soliton has been shown. Considering an external periodic perturbation, we have presented the quasi periodic behavior of ion acoustic waves in electron-positron-ion magnetoplasmas.
A Semi-Synthetic Glycoconjugate Vaccine Candidate for Carbapenem-Resistant Klebsiella pneumoniae.
Seeberger, Peter H; Pereira, Claney L; Khan, Naeem; Xiao, Guozhi; Diago-Navarro, Elizabeth; Reppe, Katrin; Opitz, Bastian; Fries, Bettina C; Witzenrath, Martin
2017-11-06
Hospital-acquired infections are an increasingly serious health concern. Infections caused by carpabenem-resistant Klebsiella pneumoniae (CR-Kp) are especially problematic, with a 50 % average survival rate. CR-Kp are isolated from patients with ever greater frequency, 7 % within the EU but 62 % in Greece. At a time when antibiotics are becoming less effective, no vaccines to protect from this severe bacterial infection exist. Herein, we describe the convergent [3+3] synthesis of the hexasaccharide repeating unit from its capsular polysaccharide and related sequences. Immunization with the synthetic hexasaccharide 1 glycoconjugate resulted in high titers of cross-reactive antibodies against CR-Kp CPS in mice and rabbits. Whole-cell ELISA was used to establish the surface staining of CR-Kp strains. The antibodies raised were found to promote phagocytosis. Thus, this semi-synthetic glycoconjugate is a lead for the development of a vaccine against a rapidly progressing, deadly bacterium. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Genetically Modified Products – Contradictions and Challenges
Rodica Pamfilie; Lavinia-Alexandra Cristescu
2011-01-01
This paper aims to identify the perception that consumers have about GM products, also taking into consideration the evolution of consumption and production of products based on genetically modified organisms. Therefore, the paper presents both aspects to clarify the concept of genetically modified organism (GMO issues such as typology, national or international regulations regarding this area) and global market development of genetically modified organisms, evolution which is presented by st...
Cadmium Adsorption on HDTMA Modified Montmorillionite
Directory of Open Access Journals (Sweden)
Mohd. Elmuntasir I. Ahmed
2009-06-01
Full Text Available In this paper the possibility of cadmium removal from aqueous solutions by adsorption onto modified montmorillonite clay is investigated. Batch adsorption experiments performed revealed an enhanced removal of cadmium using HDTMA modified montmorillonite to 100% of its exchange capacity. Modified montmorillonite adsorption capacity increases at higher pHs suggesting adsorption occurs as a result of surface precipitation and HDTMA complex formation due to the fact that the original negatively charged montmorillonite is now covered by a cationic layer of HDTMA. Adsorption isotherms generated followed a Langmuir isotherm equation possibly indicating a monolayer coverage. Adsorption capacities of up to 49 mg/g and removals greater than 90% were achieved. Anionic selectivity of the HDTMA modified monmorillonite is particularly advantageous in water treatment applications where high concentrations of less adsorbable species are present, and the lack of organoclay affinity for these species may allow the available capacity to be utilized selectively by the targeted species.
Institute of Scientific and Technical Information of China (English)
Xiaohua; PAN; Liang; YANG; Hairui; XIN; Benhai; XIONG
2016-01-01
Accurate assessment of feed’s Carbohydrate( CHO) and protein nutritional values and rumen metabolism are significant for dairy production. Cornell Net Carbohydrate and Protein System( CNCPS) as an important method to evaluate feedstuff nutritional values,hasn’t been widely used in China. In order to illustrate updates of CNCPS systems deeply,the following sections were reviewed:( i) CHO and protein fractions were updated,CA was subdivided into CA1,CA2,CA3 and CA4 in CNCPS v6. 1,protein was reclassified into PA1,PA2,PB1,PB2 and PC after CNCPS v6. 1. Content of CHO and protein fractions vary in different feedstuff and affected by feed processing;( ii) Degradation rates( Kd) values for the new CA expanded scheme were updated to 0,7,5,40- 60 % h-1respectively,Kd for PA and PB1 decreased to 200 % h-1and 10- 40 % h-1;( iii) Equations for passage rate( Kp) initially includes Kpf( Kp of forages) and Kpc( Kp of concentrates),and adjusted by effective NDF( e NDF),while in CNCPS v5. 0,Kpl( Kp of liquids) equation was added and e NDF was replaced by physically effective NDF( pe NDF). In CNCPS v6. 1,Fp BW and Cp BW were integrated into Kp equations and pe NDF was abandoned.( iv)The relationship and difference among Weende system of proximate analysis,Van Soest fiber analysis[35],NRC( 2001)[28]and CNCPS were analyzed. The first two systems laid the foundation for NRC( 2001) and CNCPS system. The latter two systems are different in CHO and protein division,also NRC( 2001) developed separate Kp equations for wet and dry forages but no equation for Kpl. CNCPS developed a Kp equation that work for wet and dry forages,and Kpl equation was established. In conclusion,the division and development of CHO and protein fractions,the update of Kd and Kp equation were reviewed systematically.
Abd-Rabbo, Diala; Michnick, Stephen W
2017-03-16
Kinases and phosphatases (KP) form complex self-regulating networks essential for cellular signal processing. In spite of having a wealth of data about interactions among KPs and their substrates, we have very limited models of the structures of the directed networks they form and consequently our ability to formulate hypotheses about how their structure determines the flow of information in these networks is restricted. We assembled and studied the largest bona fide kinase-phosphatase network (KP-Net) known to date for the yeast Saccharomyces cerevisiae. Application of the vertex sort (VS) algorithm on the KP-Net allowed us to elucidate its hierarchical structure in which nodes are sorted into top, core and bottom layers, forming a bow tie structure with a strongly connected core layer. Surprisingly, phosphatases tend to sort into the top layer, implying they are less regulated by phosphorylation than kinases. Superposition of the widest range of KP biological properties over the KP-Net hierarchy shows that core layer KPs: (i), receive the largest number of inputs; (ii), form bottlenecks implicated in multiple pathways and in decision-making; (iii), and are among the most regulated KPs both temporally and spatially. Moreover, top layer KPs are more abundant and less noisy than those in the bottom layer. Finally, we showed that the VS algorithm depends on node degrees without biasing the biological results of the sorted network. The VS algorithm is available as an R package ( https://cran.r-project.org/web/packages/VertexSort/index.html ). The KP-Net model we propose possesses a bow tie hierarchical structure in which the top layer appears to ensure highest fidelity and the core layer appears to mediate signal integration and cell state-dependent signal interpretation. Our model of the yeast KP-Net provides both functional insight into its organization as we understand today and a framework for future investigation of information processing in yeast and eukaryotes
Distinguishing Active Site Characteristics of Chlorite Dismutases with Their Cyanide Complexes.
Geeraerts, Zachary; Celis, Arianna I; Mayfield, Jeffery A; Lorenz, Megan; Rodgers, Kenton R; DuBois, Jennifer L; Lukat-Rodgers, Gudrun S
2018-03-06
O 2 -evolving chlorite dismutases (Clds) efficiently convert chlorite (ClO 2 - ) to O 2 and Cl - . Dechloromonas aromatica Cld ( DaCld) is a highly active chlorite-decomposing homopentameric enzyme, typical of Clds found in perchlorate- and chlorate-respiring bacteria. The Gram-negative, human pathogen Klebsiella pneumoniae contains a homodimeric Cld ( KpCld) that also decomposes ClO 2 - , albeit with an activity 10-fold lower and a turnover number lower than those of DaCld. The interactions between the distal pocket and heme ligand of the DaCld and KpCld active sites have been probed via kinetic, thermodynamic, and spectroscopic behaviors of their cyanide complexes for insight into active site characteristics that are deterministic for chlorite decomposition. At 4.7 × 10 -9 M, the K D for the KpCld-CN - complex is 2 orders of magnitude smaller than that of DaCld-CN - and indicates an affinity for CN - that is greater than that of most heme proteins. The difference in CN - affinity between Kp- and DaClds is predominantly due to differences in k off . The kinetics of binding of cyanide to DaCld, DaCld(R183Q), and KpCld between pH 4 and 8.5 corroborate the importance of distal Arg183 and a p K a of ∼7 in stabilizing complexes of anionic ligands, including the substrate. The Fe-C stretching and FeCN bending modes of the DaCld-CN - (ν Fe-C , 441 cm -1 ; δ FeCN , 396 cm -1 ) and KpCld-CN - (ν Fe-C , 441 cm -1 ; δ FeCN , 356 cm -1 ) complexes reveal differences in their FeCN angle, which suggest different distal pocket interactions with their bound cyanide. Conformational differences in their catalytic sites are also reported by the single ferrous KpCld carbonyl complex, which is in contrast to the two conformers observed for DaCld-CO.
Genetically Modified Organisms
Directory of Open Access Journals (Sweden)
Claro Llaguno
2001-06-01
Full Text Available Recent reports have brought to public attention concerns about Bt corn and genetically modified organisms (GMO in general. The timing, it seems, is most appropriate considering two related developments early this year: the final approval of the Cartagena Protocol on Biosafety in Montreal on January 29, 2001, and the OECD Edinburgh Conference on GM food safety last February 28- March 1, 2001. The protocol makes clear that GMOs include all living modified organisms (LMO defined as "any living organism that possesses a novel combination of genetic material obtained through the use of modern biotechnology". This includes seeds, live fish, and other organisms intentionally obtained for release to the environment. It would seem that the common understanding about GMOs as referring to farm-to-table products is perforce expanded to embrace genetically modified farm animals and aquatic resources. Being a trade agreement, the Montreal accord primarily deals with the safety issues related to the transboundary movement of LMOs around the globe. The OECD conference on the other hand, called for an international body "to address all sides of the GM debate" in response to the public outcry, particularly in Western Europe, regarding the risks the new products pose to human health and the environment. Some points of contention, which remain unresolved, include issues such as whether countries should be allowed to develop their own GM food based on their needs, and whether a global moratorium on GMOs and mandatory labeling should be enforced worldwide.
Modifiable risk factors of hypertension and socio demographic ...
African Journals Online (AJOL)
Background: Factors associated with the development of hypertension can be categorized into modifiable and non‑modifiable risk factors. The modifiable risk factors include obesity, physical inactivity, high salt diet, smoking alcohol consumption and others. Aim: This study was aimed to determine the prevalence of ...
Functional properties of unmodified and modified Jack bean ...
African Journals Online (AJOL)
The native Jack bean (Canavalia eniformis) starch was chemically modified through oxidation and acetylation. Proximate composition analysis revealed higher moisture, protein, fat and ash contents 'native unmodified than modified starches and higher yield in modified starches. Swelling capacity and solubility of all the ...
Elmer, John W.; Teruya, Alan T.; O'Brien, Dennis W.
1996-01-01
A tomographic technique for measuring the current density distribution in electron beams using electron beam profile data acquired from a modified Faraday cup to create an image of the current density in high and low power beams. The modified Faraday cup includes a narrow slit and is rotated by a stepper motor and can be moved in the x, y and z directions. The beam is swept across the slit perpendicular thereto and controlled by deflection coils, and the slit rotated such that waveforms are taken every few degrees form 0.degree. to 360.degree. and the waveforms are recorded by a digitizing storage oscilloscope. Two-din-tensional and three-dimensional images of the current density distribution in the beam can be reconstructed by computer tomography from this information, providing quantitative information about the beam focus and alignment.
Arabidopsis CDS blastp result: AK106106 [KOME
Lifescience Database Archive (English)
Full Text Available AK106106 001-207-C12 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bisph...osphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 9e-39 ...
Arabidopsis CDS blastp result: AK105066 [KOME
Lifescience Database Archive (English)
Full Text Available AK105066 001-044-F12 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bisph...osphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 1e-166 ...
Directory of Open Access Journals (Sweden)
Sumitha Upadhyay
2013-01-01
Full Text Available Objective: To investigate and compare the amount of fluoride release of conventional, resin modified and nanofilled resin modified glass ionomer cements.Materials and Methods: Tablets of glass-ionomer cements were immersed in deionized water and incubated at 37◦C. After 1, 2, 7, 15 and 30 days, fluoride ion was measured under normal atmospheric conditions by fluoride ion selective electrode. Buffer (TISAB II was used to decomplex the fluoride ion and to provide a constant background ionic strength and to maintain the pH of water between 5.0 and 5.5 as the fluoride electrode is sensitive to changes in pH. Statistical evaluation was carried out by one way ANOVA (Analysis of Variance using SPSS 11.0. The significance level was set at p< 0.05.Results: The release of fluoride was highest on day 1 and there was a sudden fall on day 2 in all three groups. Initially fluoride release from conven-tional glass-ionomer cement was highest compared to the other two glass-ionomer cements, but the amount drastically reduced over the period. Although the amount of fluoride release was less than both the resin modified and nanofilled resin modified glass-ionomer cement, the release was sustained consistently for 30 daysConclusion: The cumulative fluoride release of nanofilled resin modified glass ionomer cement was very less compared to the conventional and resin modified glass ionomer cements and Nanofilled resin modified glass ionomer cement released less but steady fluoride as compared to other resin modified glass ionomer cements.
Eigenvalue Decomposition-Based Modified Newton Algorithm
Directory of Open Access Journals (Sweden)
Wen-jun Wang
2013-01-01
Full Text Available When the Hessian matrix is not positive, the Newton direction may not be the descending direction. A new method named eigenvalue decomposition-based modified Newton algorithm is presented, which first takes the eigenvalue decomposition of the Hessian matrix, then replaces the negative eigenvalues with their absolute values, and finally reconstructs the Hessian matrix and modifies the searching direction. The new searching direction is always the descending direction. The convergence of the algorithm is proven and the conclusion on convergence rate is presented qualitatively. Finally, a numerical experiment is given for comparing the convergence domains of the modified algorithm and the classical algorithm.
The Modified Enskog Equation for Mixtures
Beijeren, H. van; Ernst, M.H.
1973-01-01
In a previous paper it was shown that a modified form of the Enskog equation, applied to mixtures of hard spheres, should be considered as the correct extension of the usual Enskog equation to the case of mixtures. The main argument was that the modified Enskog equation leads to linear transport
Directory of Open Access Journals (Sweden)
Miyer Patiño-Ruiz
Full Text Available Na+/H+ exchange is essential for survival of all organisms, having a role in the regulation of the intracellular Na+ concentration, pH and cell volume. Furthermore, Na+/H+ exchangers were shown to be involved in the virulence of the bacterium Yersinia pestis, indicating they might be potential targets for novel antibiotic treatments. The model system for Na+/H+ exchangers is the NhaA transporter from Escherichia coli, EcNhaA. Therefore, the general transport mechanism of NhaA exchangers is currently well characterized. However, much less is known about NhaB exchangers, with only a limited number of studies available. The pathogen Klebsiella pneumoniae, which is a major source of nosocomial infection, possesses three electrogenic Na+/H+ exchangers, KpNhaA1, KpNhaA2 and KpNhaB, none of which have been previously investigated. Our aim in this study was to functionally characterize KpNhaB using solid supported membrane-based electrophysiology as the main investigation technique, and thus provide the first electrophysiological investigation of an NhaB Na+/H+ exchanger. We found that NhaB can be described by the same competition-based mechanism that was shown to be valid for electrogenic NhaA and NapA, and for electroneutral NhaP Na+/H+ exchangers. For comparison we also characterized the activity of KpNhaA1 and KpNhaA2 and found that the three exchangers have complementary activity profiles, which is likely a survival advantage for K. pneumoniae when faced with environments of different salinity and pH. This underlines their importance as potential antibiotic drug targets.
Constraints on modified gravity models from white dwarfs
Energy Technology Data Exchange (ETDEWEB)
Banerjee, Srimanta; Singh, Tejinder P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai 400005, Maharashtra (India); Shankar, Swapnil, E-mail: srimanta.banerjee@tifr.res.in, E-mail: swapnil.shankar@cbs.ac.in, E-mail: tpsingh@tifr.res.in [Department of Physics, Centre for Excellence in Basic Sciences, Mumbai 400098, Maharashtra (India)
2017-10-01
Modified gravity theories can introduce modifications to the Poisson equation in the Newtonian limit. As a result, we expect to see interesting features of these modifications inside stellar objects. White dwarf stars are one of the most well studied stars in stellar astrophysics. We explore the effect of modified gravity theories inside white dwarfs. We derive the modified stellar structure equations and solve them to study the mass-radius relationships for various modified gravity theories. We also constrain the parameter space of these theories from observations.
Carbon Dioxide Adsorption Behavior of Modified HKUST-1
Ma, Lan; Tang, Huamin; Zhou, Chaohua; Zhang, Hongpeng; Yan, Chunxiao; Hu, Xiaochun; Yang, Yang; Yang, Weiwei; Li, Yuming; He, Dehua
2014-12-01
A kind of typical metal-organic frameworks (MOFs) material, HKUST-1 was prepared by hydrothermal method and characterized by XRD and SEM. The results of characterizations manifested that HKUST-1 showed a regular octahedral crystal structure. The as-prepared HKUST-1 was modified by several kinds of organic base materials and the CO2 adsorption behaviors of modified HKUST-1 materials were evaluated. The CO2 adsorption capacities of different base modified HKUST-1 varied with the base intensity of modified organic base materials.
International Nuclear Information System (INIS)
Judd, D.L.; Celata, C.; Close, E.; Faltens, A.; Hahn, K.; La Mon, K.; Lee, E.P.; Smith, L.; Thur, W.
1989-03-01
Sixteen intense parallel ion beams are to be transversely combined into four by dispersionless double bends. Emittance growth due to electrostatic energy redistribution and to the geometry is evaluated. Most bending elements are electric, and alternate with AG electrostatic quadrupoles similar to those upstream. The final elements are magnetic, combining focusing and ''unbending''. Electrode shapes and pulsed-current arrays (having very small clearances), and mechanical and electric features of the combiner, and described. 1 ref., 7 figs
Solar-terrestrial effect controls seismic activity to a large extent (Invited)
Duma, G.
2010-12-01
Several observational results and corresponding publications in the 20 century indicate that earthquakes in many regions happen systematically in dependence on the time of day and on the season as well. In the recent decade, studies on this topic have also been intensively performed at the Central Institute for Meteorology and Geodynamics (ZAMG), Vienna. Any natural effect on Earth which systematically appears at certain hours of the day or at a special season can solely be caused by a solar or lunar influence. And actually, statistic results on seismic activity reveal a correlation with the solar cycles. Examples of this seismic performance are shown. To gain more clarity about these effects, the three-hour magnetic index Kp, which characterizes the magnetic field disturbances, mainly caused by the solar particle radiation, the solar wind, was correlated with the seismic energy released by earthquakes over decades. Kp is determined from magnetic records of 13 observatories worldwide and continuously published by ISGI, France. It is demonstrated that a highly significant correlation between the geomagnetic index Kp and the annual seismic energy release in regions at latitudes between 35 and 60° N exists. Three regions of continental size were investigated, using the USGS (PDE) earthquake catalogue data. In the period 1974-2009 the Kp cycle periods range between 9 and 12 years, somewhat different to the sunspot number cycles of 11 years. Seismicity follows the Kp cycles with high coincidence. A detailed analysis of this correlation for N-America reveals, that the sum of released energy by earthquakes per year changes by a factor up to 100 with Kp. It is shown that during years of high Kp there happen e.g. 1 event M7, 4 events M6 and 30 events M5 per year, instead of only 10 events M5 in years with lowest Kp. Almost the same relation appears in other regions of continental size, with the same significance. The seismicity in S-America clearly follows the Kp cycles
Modified teleparallel gravity: Inflation without an inflaton
International Nuclear Information System (INIS)
Ferraro, Rafael; Fiorini, Franco
2007-01-01
The Born-Infeld strategy to smooth theories having divergent solutions is applied to the teleparallel equivalent of general relativity. Differing from other theories of modified gravity, modified teleparallelism leads to second order equations, since the teleparallel Lagrangian only contains first derivatives of the vierbein. We show that the Born-Infeld-modified teleparallelism solves the particle horizon problem in a spatially flat Friedmann-Robertson-Walker (FRW) universe by providing an initial exponential expansion without resorting to an inflaton field
Magnetically modified biocells in constant magnetic field
Energy Technology Data Exchange (ETDEWEB)
Abramov, E.G.; Panina, L.K. [Saint Petersburg State University, St. Petersburg (Russian Federation); Kolikov, V.A., E-mail: kolikov1@yandex.ru [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation); Bogomolova, E.V. [Botanical Institute of the RAS after V.L.Komarov, St. Petersburg (Russian Federation); Snetov, V.N. [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation); Cherepkova, I.A. [Saint Petersburg State Institute of Technology, St. Petersburg (Russian Federation); Kiselev, A.A. [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation)
2017-02-01
Paper addresses the inverse problem in determining the area, where the external constant magnetic field captures the biological cells modified by the magnetic nanoparticles. Zero velocity isolines, in area where the modified cells are captured by the magnetic field were determined by numerical method for two locations of the magnet. The problem was solved taking into account the gravitational field, magnetic induction, density of medium, concentration and size of cells, and size and magnetization of nanoparticles attached to the cell. Increase in the number of the nanoparticles attached to the cell and decrease in the cell’ size, enlarges the area, where the modified cells are captured and concentrated by the magnet. Solution is confirmed by the visible pattern formation of the modified cells Saccharomyces cerevisiae. - Highlights: • The inverse problem was solved for finding zero velocity isolines of magnetically modified biological cells. • Solution of the inverse problem depends on the size of cells and the number of nanoparticles attached to the single cell. • The experimental data are in agreement with theoretical solution.
Kynurenines in CNS disease: regulation by inflammatory cytokines
Campbell, Brian M.; Charych, Erik; Lee, Anna W.; Möller, Thomas
2014-01-01
The kynurenine pathway (KP) metabolizes the essential amino acid tryptophan and generates a number of neuroactive metabolites collectively called the kynurenines. Segregated into at least two distinct branches, often termed the “neurotoxic” and “neuroprotective” arms of the KP, they are regulated by the two enzymes kynurenine 3-monooxygenase and kynurenine aminotransferase, respectively. Interestingly, several enzymes in the pathway are under tight control of inflammatory mediators. Recent years have seen a tremendous increase in our understanding of neuroinflammation in CNS disease. This review will focus on the regulation of the KP by inflammatory mediators as it pertains to neurodegenerative and psychiatric disorders. PMID:24567701
Lorentz invariance violation in modified gravity
International Nuclear Information System (INIS)
Brax, Philippe
2012-01-01
We consider an environmentally dependent violation of Lorentz invariance in scalar-tensor models of modified gravity where General Relativity is retrieved locally thanks to a screening mechanism. We find that fermions have a modified dispersion relation and would go faster than light in an anisotropic and space-dependent way along the scalar field lines of force. Phenomenologically, these models are tightly restricted by the amount of Cerenkov radiation emitted by the superluminal particles, a constraint which is only satisfied by chameleons. Measuring the speed of neutrinos emitted radially from the surface of the earth and observed on the other side of the earth would probe the scalar field profile of modified gravity models in dense environments. We argue that the test of the equivalence principle provided by the Lunar ranging experiment implies that a deviation from the speed of light, for natural values of the coupling scale between the scalar field and fermions, would be below detectable levels, unless gravity is modified by camouflaged chameleons where the field normalisation is environmentally dependent.
Lorentz invariance violation in modified gravity
Energy Technology Data Exchange (ETDEWEB)
Brax, Philippe, E-mail: philippe.brax@cea.fr [Institut de Physique Theorique, CEA, IPhT, CNRS, URA 2306, F-91191Gif/Yvette Cedex (France)
2012-06-06
We consider an environmentally dependent violation of Lorentz invariance in scalar-tensor models of modified gravity where General Relativity is retrieved locally thanks to a screening mechanism. We find that fermions have a modified dispersion relation and would go faster than light in an anisotropic and space-dependent way along the scalar field lines of force. Phenomenologically, these models are tightly restricted by the amount of Cerenkov radiation emitted by the superluminal particles, a constraint which is only satisfied by chameleons. Measuring the speed of neutrinos emitted radially from the surface of the earth and observed on the other side of the earth would probe the scalar field profile of modified gravity models in dense environments. We argue that the test of the equivalence principle provided by the Lunar ranging experiment implies that a deviation from the speed of light, for natural values of the coupling scale between the scalar field and fermions, would be below detectable levels, unless gravity is modified by camouflaged chameleons where the field normalisation is environmentally dependent.
CONCRETE BASED ON MODIFIED DISPERSE CEMENT SYSTEM
Directory of Open Access Journals (Sweden)
D. V. Rudenko
2016-08-01
Full Text Available Purpose. The article considers definition of the bond types occurring in a modified cement concrete matrix, and the evaluation of the quality of these links in a non-uniform material to determine the geometrical and physical relationships between the structure and the cement matrix modifiers. Methodology. To achieve this purpose the studies covered the microstructure of dispersed modified concrete cement matrix, the structure formation mechanism of the modified cement concrete system of natural hardening; as well as identification of the methods of sound concrete strength assessment. Findings. The author proposed a model of the spatial structure of the concrete cement matrix, modified by particulate reinforcement crystal hydrates. The initial object of study is a set of volume elements (cells of the cement matrix and the system of the spatial distribution of reinforcing crystallohydrates in these volume elements. It is found that the most dangerous defects such as cracks in the concrete volume during hardening are formed as a result of internal stresses, mainly in the zone of cement matrix-filler contact or in the area bordering with the largest pores of the concrete. Originality. The result of the study is the defined mechanism of the process of formation of the initial strength and stiffness of the modified cement matrix due to the rapid growth of crystallohydrates in the space among the dispersed reinforcing modifier particles. Since the lack of space prevents from the free growth of crystals, the latter cross-penetrate, forming a dense structure, which contributes to the growth of strength. Practical value. Dispersed modifying cement matrix provides a durable concrete for special purposes with the design performance characteristics. The developed technology of dispersed cement system modification, the defined features of its structure formation mechanism and the use of congruence principle for the complex of technological impacts of physical
Directory of Open Access Journals (Sweden)
A. Pérez-Guerra
2017-12-01
Full Text Available Objective: Changes in pacing rhythm are translated into functional and metabolic changes that can be significantly reflected in the final results of an athlete. Method: Ten male subjects, with moderate performance level (age: 25.2 ± 2.2 years; VO2max: 56.9 ± 5.7 ml kgâ1 minâ1, performed four 5-min races with different pacing strategies: constant-pace (CP, record-pace (RP, kicker-pace (KP, incremental-pace (IP. Results: The cardio-respiratory response did not show statistically significant. There were statistically significant differences (p â¤Â 0.05 in the energetic efficiency among the protocols CP vs. RP, CP vs. KP and RP vs. IP. When results were analyzed by partials (1-min duration phases, significant differences were observed in the energetic efficiency during the 3rd-min among CP vs. KP, RP vs. KP and KP vs. IP. These significant differences were extended to the 4th-min when comparing CP vs. IP, CP vs. KP, KP vs. RP and KP vs. IP. In the last minute of the test, there were significant differences among CP vs. KP. No significant differences were found in any of the variables assessing anaerobic metabolism (accumulated oxygen deficit, oxygen debt, oxygen uptake kinetics and blood lactate between both protocols. Conclusions: Results suggest that the main functional systems response are significantly affected by the pacing strategy used by middle-level subjects during middle-distance running. Resumen: Objetivo: Los cambios en el ritmo de carrera se traducen en cambios funcionales y metabólicos que pueden reflejarse significativamente en los resultados finales de un atleta. Método: Diez sujetos varones, con un nivel medio (edad: 25.2 ± 2.2 años; VO2max: 56.9 ± 5.7 mlkgâ1minâ1, llevaron a cabo carreras de 5 minutos con diferentes estrategias: ritmo constante (RC, ritmo récord (RR, ritmo kicker (RK y ritmo incremental (RI. Resultados: La respuesta
Modified basin-type solar still
International Nuclear Information System (INIS)
El-Mously, M.K.; El-Ashry, M.Y.; El-Iraqi, M.H.
1981-07-01
A modified basin-type solar still (BTSS) has been developed. The new idea introduced is to re-use the latent heat due to condensation for increasing the temperature of saline water flowing into the device. A new term had been introduced in the balance of equation of conventional BTSS leading to the increase of the efficiency. According to the suggested model, a modified BTSS had been constructed and tested. It is found that the increase in the efficiency is about 14%. (author)
Directory of Open Access Journals (Sweden)
Gaurav Vats
2014-03-01
Full Text Available This paper has considered the selection of the optimal processing parameter (sintering temperature leading to best possible properties of K0.5Na0.5NbO3 (KNN for electromechanical applications. Vital piezoelectric properties for such applications include the piezoelectric coupling coefficient (kp, piezoelectric coefficient (d31, Curie temperature (Tc, remanent polarization (Pr, coercive field (Ec, density (ρ, elastic compliance (S11E and S12E and dielectric loss (tan δ. The weights and priority of these physical properties for KNN are calculated using the modified digital logic (MDL method. The priority order of these properties used for the selection of optimal processing parameters is as d31>tan δ>S11E=S12E>Tc=Pr>ρ>kp>Ec. The weights obtained using MDL are further incorporated with analytic hierarchy process (AHP and VlseKriterijumska Optimisacija I Kompromisno Resenje (VIKOR in order to determine the optimal sintering temperature for KNN. Both methods suggest that 1080 °C and 1120 °C are the most and least desirable sintering temperatures, respectively. Finally, sensitivity analysis is performed for the robustness of our results and prediction of most influential parameter in terms of sensitivity. tan δ is found to be the most sensitive property for alteration in the present ranking.
Kilopower Small Fission Technology (KP)
National Aeronautics and Space Administration — Previous space reactor development programs (e.g. SP-100, Prometheus) have failed to complete the all-important system- level demonstration. The Nuclear Systems...
Isotopically modified compounds
International Nuclear Information System (INIS)
Kuruc, J.
2009-01-01
In this chapter the nomenclature of isotopically modified compounds in Slovak language is described. This chapter consists of following parts: (1) Isotopically substituted compounds; (2) Specifically isotopically labelled compounds; (3) Selectively isotopically labelled compounds; (4) Non-selectively isotopically labelled compounds; (5) Isotopically deficient compounds.
Clark, Robert, L.; Clough, Michael P.; Berg, Craig A.
2000-01-01
Modifies an extended lab activity from a cookbook approach for determining the percent mass of water in copper sulfate pentahydrate crystals to one which incorporates students' prior knowledge, engenders active mental struggling with prior knowledge and new experiences, and encourages metacognition. (Contains 12 references.) (ASK)
Nindrea, Ricvan Dana; Aryandono, Teguh; Lazuardi, Lutfan
2017-12-28
Objective: The aim of this study was to determine breast cancer risk from modifiable and non-modifiable factors among women in Southeast Asia. Methods: This meta-analysis was performed on research articles on breast cancer risk factors in PubMed, ProQuest and EBSCO databases published between 1997 and October 2017. Pooled odds ratios (OR) are calculated using fixed and random-effect models. Data were processed using Review Manager 5.3 (RevMan 5.3). Results: From a total of 1,211 articles, 15 studies (1 cohort and 14 case control studies) met the criteria for systematic review. Meta-analysis results showed that of the known modifiable risk factors for breast cancer, parity (nulipara) had the highest odd ratio (OR = 1.85 [95% CI 1.47-2.32]) followed by body mass index (overweight) (OR = 1.61 [95% CI 1.43-1.80]) and use of oral contraceptives (OR = 1.27 [95% CI 1.07-1.51]). Of non-modifiable risk factors, family history of breast cancer had the highest odd ratio (OR = 2.53 [95% CI 1.25-5.09]), followed by age (≥ 40 years) (OR = 1.53 [95% CI 1.34-1.76]) and menopausal status (OR = 1.44 [95% CI 1.26-1.65]). Conclusion: This analysis confirmed associations between both modifiable risk factors (parity, body mass index and use of oral contraceptives) and non-modifiable risk factors (family history of breast cancer, age and menopausal status) with breast cancer. Creative Commons Attribution License
Chemical composition of silica-based biocidal modifier
Directory of Open Access Journals (Sweden)
Grishina Anna Nikolaevna
2016-11-01
Full Text Available Increase of the amount of fungi spores and micotixines causes the increase in the number of different diseases. Because of this, ensuring the biological safety in buildings is becoming more and more important today. The preferred way to guarantee the biological safety of a building is to employ modern building materials that prevent the settlement of the fungi colonies on the inner surfaces of walls. Such building materials can be produced using novel biocidal modifiers that allow controlling the number of microorganisms on the surface and in the bulk of a composite construction. The precipitation product of zinc hydrosilicates and sodium sulfate is one of the mentioned modifiers. Till now, the exact chemical composition of such precipitation product is controversial; it is obvious, though, that the efficacy of the biocidal modifier is mostly determined by the type of the copper compounds. In the present work an integrated approach is used for the investigation of the chemical composition of the biocidal modifier. Such an approach consists in the examination of the modifier’s composition by means of different, yet complementary, research methods: X-ray diffraction, infrared spectroscopy and DTA. It is shown that the chemical composition of the modifier mainly depends on the amount of precipitant. X-ray diffraction reveals that the major part of the modifier is represented by amorphous phase. Along with the increase of the precipitant’s amount the crystalline phase Zn4SO4(OH6•xH2O formation takes place. Such a crystalline phase is not appropriate as a component of the biocidal modifier. Another two methods - DTA and IR spectroscopy - reveal that the amorphous phase consists essentially of zinc hydrosilicates.
Electron Dropout Echoes Induced by Interplanetary Shock: A Statistical Study
Liu, Z.; Zong, Q.; Hao, Y.; Zhou, X.; Ma, X.; Liu, Y.
2017-12-01
"Electron dropout echo" as indicated by repeated moderate dropout and recovery signatures of the flux of energetic electron in the out radiation belt region has been investigated systematically. The electron dropout and its echoes are usually found for higher energy (> 300 keV) channels fluxes, whereas the flux enhancements are obvious for lower energy electrons simultaneously after the interplanetary shock arrives at the Earth's geosynchronous orbit. 104 dropout echo events have been found from 215 interplanetary shock events from 1998 to 2007 based on LANL satellite data. In analogy to substorm injections, these 104 events could be naturally divided into two categories: dispersionless (49 events) or dispersive (55 events) according to the energy dispersion of the initial dropout. It is found that locations of dispersionless events are distributed mainly in the duskside magnetosphere. Further, the obtained locations derived from dispersive events with the time-of-flight technique of the initial dropout regions are mainly located at the duskside as well. Statistical studies have shown that the effect of shock normal, interplanetary magnetic field Bz and solar wind dynamic pressure may be insignificant to these electron dropout events. We suggest that the electric field impulse induced by the IP shock produces a more pronounced inward migration of electrons at the dusk side, resulting in the observed dusk-side moderate dropout of electron flux and its consequent echoes.
Energy Technology Data Exchange (ETDEWEB)
Lara-Castells, María Pilar de, E-mail: Pilar.deLara.Castells@csic.es [Instituto de Física Fundamental (C.S.I.C.), Serrano 123, E-28006 Madrid (Spain); Stoll, Hermann [Institut für Theoretische Chemie, Universität Stuttgart, D-70550 Stuttgart (Germany); Civalleri, Bartolomeo [Dipartimento di Chimica e Centro Interdipartimentale NIS, Universitá di Torino, Via P. Giuria 7, 10125 Torino (Italy); Causà, Mauro [Dipartimento di Ingegneria Chimica, dei Materiali e delle Produzioni Industriali, Universiá di Napoli Federico II, Piazzale Tecchio, 80126 Napoli (Italy); Voloshina, Elena [Humboldt-Universität zu Berlin, Institut für Chemie, Brook-Taylor-Str. 2, 12489 Berlin (Germany); Mitrushchenkov, Alexander O. [Université Paris-Est, Laboratoire Modélisation et Simulation Multi Echelle, MSME UMR 8208 CNRS, 5 bd Descartes, 77454 Marne-la-Vallée (France); Pi, Martí [Department ECM, Facultat de Física, and IN" 2UB, Universitat de Barcelona, Diagonal 645, E-08028 Barcelona (Spain)
2014-10-21
In this work we propose a general strategy to calculate accurate He–surface interaction potentials. It extends the dispersionless density functional approach recently developed by Pernal et al. [Phys. Rev. Lett. 103, 263201 (2009)] to adsorbate-surface interactions by including periodic boundary conditions. We also introduce a scheme to parametrize the dispersion interaction by calculating two- and three-body dispersion terms at coupled cluster singles and doubles and perturbative triples (CCSD(T)) level via the method of increments [H. Stoll, J. Chem. Phys. 97, 8449 (1992)]. The performance of the composite approach is tested on {sup 4}He/graphene by determining the energies of the low-lying selective adsorption states, finding an excellent agreement with the best available theoretical data. Second, the capability of the approach to describe dispersionless correlation effects realistically is used to extract dispersion effects in time-dependent density functional simulations on the collision of {sup 4}He droplets with a single graphene sheet. It is found that dispersion effects play a key role in the fast spreading of the {sup 4}He nanodroplet, the evaporation-like process of helium atoms, and the formation of solid-like helium structures. These characteristics are expected to be quite general and highly relevant to explain experimental measurements with the newly developed helium droplet mediated deposition technique.
Genetically modified soybean plants and their ecosystem
Directory of Open Access Journals (Sweden)
Milošević Mirjana B.
2004-01-01
Full Text Available Transgenic plants are developed by introgressing new genes using methods of molecular genetics and genetic engineering. The presence of these genes in plant genome is identified on the basis of specific oligonucleotides primers, and the use of PCR (Polymerase Chain Reaction and DNA fragments multiplication. Genetically modified plants such as soybean constitute a newly created bioenergetic potential whose gene expression can cause disturbance of the biological balance ecosystem, soil structure and soil microbiological activity. Genetically modified plants may acquire monogenic or polygenic traits causing genetic and physiological changes in these plants, which may elicit a certain reaction of the environment including changes of microbiological composition of soil rhizosphere. The aim of introgressing genes for certain traits into a cultivated plant is to enhance its yield and intensify food production. There are more and more genetically modified plant species such as soybean, corn, potato, rice and others and there is a pressure to use them as human food and animal feed. Genetically modified soybean plants with introgressed gene for resistance to total herbicides, such as Round-up, are more productive than non-modified herbicide-sensitive soybeans.
The McDonald Modified Weibull Distribution: Properties and Applications
Merovci, Faton; Elbatal, Ibrahim
2013-01-01
A six parameter distribution so-called the McDonald modified Weibull distribution is defined and studied. The new distribution contains, as special submodels, several important distributions discussed in the literature, such as the beta modified Weibull, Kumaraswamy modified Weibull, McDonald Weibull and modified Weibull distribution,among others. The new distribution can be used effectively in the analysis of survival data since it accommodates monotone, unimodal and bathtub-shaped hazard fu...
Modified one-way coupled map lattices as communication cryptosystems
International Nuclear Information System (INIS)
Zhao Mingchao; Li Kezan; Fu Xinchu
2009-01-01
In this paper, we modify the original communication cryptosystem based on OCML (one-way coupled map lattices), and present a modified OCML communication cryptosystem. The modified OCML communication cryptosystem is shown to have some additional advantages compared to the original one, e.g., it has a larger parameter space, and is more capable of anti-error analysis. And, we apply this modified OCML communication cryptosystem for multiplex OCML communication.
Plants having modified response to ethylene
Meyerowitz, E.M.; Chang, C.; Bleecker, A.B.
1997-11-18
The invention includes transformed plants having at least one cell transformed with a modified ETR nucleic acid. Such plants have a phenotype characterized by a decrease in the response of at least one transformed plant cell to ethylene as compared to a plant not containing the transformed plant cell. Tissue and/or temporal specificity for expression of the modified ETR nucleic acid is controlled by selecting appropriate expression regulation sequences to target the location and/or time of expression of the transformed nucleic acid. The plants are made by transforming at least one plant cell with an appropriate modified ETR nucleic acid, regenerating plants from one or more of the transformed plant cells and selecting at least one plant having the desired phenotype. 31 figs.
Modified sol-gel coatings for biotechnological applications
Energy Technology Data Exchange (ETDEWEB)
Beganskiene, A [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania); Raudonis, R [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania); Jokhadar, S Zemljic [Faculty of Medicine, Institute of Biophysics, Lipiceva 2, Ljubljana SI-1000 (Slovenia); Batista, U [Faculty of Medicine, Institute of Biophysics, Lipiceva 2, Ljubljana SI-1000 (Slovenia); Kareiva, A [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania)
2007-12-15
The modified sol-gel derived silica coatings were prepared and characterized. The amino and methyl groups were introduced onto the colloidal silica. The silica coatings with different wettability properties: coloidal silica (water contact angle 17 deg.), polysiloxane (61 deg.), methyl-modified (158 deg. and 46 deg.) coatings samples were tested for CaCo-2 cells proliferation. Methyl-modified coating (46 deg.) proved to be the best substrate for cell proliferation. CaCo-2 cell proliferation two days post seeding was significantly faster on almost laminine, fibronectin and collagen-1 coated samples compared to corresponding controls.
Oil and gas processing products to obtain polymers modified bitumen
Directory of Open Access Journals (Sweden)
Serhiy Pyshyev
2017-07-01
Full Text Available To obtain modified bitumen with excellent adhesive properties, coumarone-indene resin (CIR was used. However, bitumens modified by CIR have somewhat worse plastic properties. For the improvement of the plastic properties of road bitumen modified by coumarone-indene resin, the paper proposes to use plasticizers. Characterized by a high content of rings (aromatic-naphthenic oils, a range of compounds was used as plasticizers. Of all different plasticizers tested, the tar produced from West-Ukrainian oils has been found to be the most effective one. The optimal ratio between modified bitumen components was determined enabling to obtain the commercial product of polymers modified bitumen of BMP 60/90-52 brand. The complex thermogravimetry and differential-thermal analysis has been used to analyze the initial and modified bitumen. Bitumens modified by CIR have shown by far the highest thermal stability under operation conditions. Keywords: Bitumen, Modifier, Coumarone-indene resin, Plasticizer
Functions of some capsular polysaccharide biosynthetic genes in Klebsiella pneumoniae NTUH K-2044.
Directory of Open Access Journals (Sweden)
Jin-Yuan Ho
Full Text Available The growing number of Klebsiella pneumoniae infections, commonly acquired in hospitals, has drawn great concern. It has been shown that the K1 and K2 capsular serotypes are the most detrimental strains, particularly to those with diabetes. The K1 cps (capsular polysaccharide locus in the NTUH-2044 strain of the pyogenic liver abscess (PLA K. pneumoniae has been identified recently, but little is known about the functions of the genes therein. Here we report characterization of a group of cps genes and their roles in the pathogenesis of K1 K. pneumoniae. By sequential gene deletion, the cps gene cluster was first re-delimited between genes galF and ugd, which serve as up- and down-stream ends, respectively. Eight gene products were characterized in vitro and in vivo to be involved in the syntheses of UDP-glucose, UDP-glucuronic acid and GDP-fucose building units. Twelve genes were identified as virulence factors based on the observation that their deletion mutants became avirulent or lost K1 antigenicity. Furthermore, deletion of kp3706, kp3709 or kp3712 (ΔwcaI, ΔwcaG or Δatf, respectively, which are all involved in fucose biosynthesis, led to a broad range of transcriptional suppression for 52 upstream genes. The genes suppressed include those coding for unknown regulatory membrane proteins and six multidrug efflux system proteins, as well as proteins required for the K1 CPS biosynthesis. In support of the suppression of multidrug efflux genes, we showed that these three mutants became more sensitive to antibiotics. Taken together, the results suggest that kp3706, kp3709 or kp3712 genes are strongly related to the pathogenesis of K. pneumoniae K1.
Babouee Flury, Baharak; Donà, Valentina; Buetti, Niccolò; Furrer, Hansjakob; Endimiani, Andrea
2017-09-01
We describe the first two multifocal invasive infections due to Klebsiella pneumoniae recently observed in Switzerland. Phenotypic (MIC assays and string test) and molecular analyses (PCR/Sequencing for bla, virulence factor genes and whole genome sequencing for one strain) were performed to characterize the causative K. pneumoniae isolates. Both K. pneumoniae isolates (Kp1 and Kp2) were pan-susceptible to antibiotics and produced narrow-spectrum SHV β-lactamases. However, only Kp1 was string test positive. Kp1 was of ST380 and caused liver abscess as well as pneumonia and orbital phlegmon in an Eritrean patient. It belonged to the hypervirulent capsular serotype K2 and harboured the classic virulence-associated rmpA and aerobactin genes, fulfilling both the clinical and microbiological definitions for an invasive K. pneumoniae syndrome. Kp2 was of ST1043 and caused both liver abscess and endocarditis in a Swiss patient. Moreover, it did not possess the classic virulence-associated genes. Whole genome sequencing identified less well-known virulence factors in Kp2 that might have contributed to its virulence. Among these there were genes important for intestinal colonization and/or invasion, such as genes involved in adhesion (e.g., fimABCD and mrkABCD), regulation of capsule polysaccharide biosynthesis (e.g., evgS-evgA), as well as iron uptake (iroN), energy conversion, and metabolism. This report confirms the continuous dissemination of hypervirulent K. pneumoniae strains among patients of non-Asian descent in Europe. Moreover, it highlights the genetic background of an atypical hypervirulent K. pneumoniae causing a severe invasive infection despite not possessing the classical virulence characteristics of hypermucoviscous strains. Copyright © 2017 International Society for Chemotherapy of Infection and Cancer. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Rajesh Prasad
Full Text Available Papain-like cysteine proteases of malaria parasites degrade haemoglobin in an acidic food vacuole to provide amino acids for intraerythrocytic parasites. These proteases are potential drug targets because their inhibitors block parasite development, and efforts are underway to develop chemotherapeutic inhibitors of these proteases as the treatments for malaria. Plasmodium knowlesi has recently been shown to be an important human pathogen in parts of Asia. We report expression and characterization of three P. knowlesi papain-like proteases, termed knowpains (KP2-4. Recombinant knowpains were produced using a bacterial expression system, and tested for various biochemical properties. Antibodies against recombinant knowpains were generated and used to determine their cellular localization in parasites. Inhibitory effects of the cysteine protease inhibitor E64 were assessed on P. knowlesi culture to validate drug target potential of knowpains. All three knowpains were present in the food vacuole, active in acidic pH, and capable of degrading haemoglobin at the food vacuolar pH (≈5.5, suggesting roles in haemoglobin degradation. The proteases showed absolute (KP2 and KP3 to moderate (KP4 preference for peptide substrates containing leucine at the P2 position; KP4 preferred arginine at the P2 position. While the three knowpains appear to have redundant roles in haemoglobin degradation, KP4 may also have a role in degradation of erythrocyte cytoskeleton during merozoite egress, as it displayed broad substrate specificity and was primarily localized at the parasite periphery. Importantly, E64 blocked erythrocytic development of P. knowlesi, with enlargement of food vacuoles, indicating inhibition of haemoglobin hydrolysis and supporting the potential for inhibition of knowpains as a strategy for the treatment of malaria. Functional expression and characterization of knowpains should enable simultaneous screening of available cysteine protease
Goenawan, Joshua; Trisanti, P. N.; Sumarno
2015-12-01
This work studies the relation between dissolved H2O content in supercritical carbon dioxide (SC-CO2) with the formation of ketoprofen (KP)/β-cyclodextrin(CD) inclusion complexes. The process involves a physical mixture of these two compounds into contact with the supercritical carbon dioxide which had been previously saturated with H2O over a certain duration. The pressure used for saturation process is 130 bar and saturation temperature was ranged between 30 °C to 50 °C. The inclusion process was achieved by keeping it for 2 hours at 160 bar and 200 bar with inclusion temperature of 50 °C. The results enable us to suggest explanations for the inclusion formation. The inclusion complexes can be formed by contacting the dissolved H2O in SC-CO2 to the physical mixture of KP and CD. An increase in the temperature of saturation process resulted in an increase of dissolved H2O content in the supercritical carbon dioxide. The increasing levels of this water soluble resulted an increase in the inclusion complexes that has been formed. The formation of inclusion complexes includes the water molecules enhancing the emptying of the CD cavities and being replaced by KP, towards a more stable energy state. The drug release used for analyzing the dissolution rate of the KP/CD complexes. The results vary from 79,85% to 99,98% after 45 minutes which is above the rate that has been assigned by Farmakope Indonesia at 70% dissolution rate for KP. The use of SC-CO2 offers a new methods for increasing the rate of dissolution of drugs that are hydrophobic such as KP. CO2 used as a supercritical fluid because of its relatively low cost, easily obtainable supercritical conditions, and lack of toxicity. The material samples were characterized by DSC and Spectrophotometer UV-vis technique.
Garrison, Allison M; Parrott, Jennifer M; Tuñon, Arnulfo; Delgado, Jennifer; Redus, Laney; O'Connor, Jason C
2018-08-01
Chronic stress or inflammation increases tryptophan metabolism along the kynurenine pathway (KP), and the generation of neuroactive kynurenine metabolites contributes to subsequent depressive-like behaviors. Microglia regulate KP balance by preferentially producing oxidative metabolites, including quinolinic acid. Research has focused on the interplay between cytokines and HPA axis-derived corticosteroids in regulating microglial activity and effects of KP metabolites directly on neurons; however, the potential role that KP metabolites have directly on microglial activity is unknown. Here, murine microglia were stimulated with lipopolysaccharide(LPS). After 6 h, mRNA expression of interleukin(IL)-1β, IL-6, tumor necrosis factor(TNF)-α and inducible nitric oxide synthase(iNOS) was dose-dependently increased along with the rate-limiting enzymes for oxidative KP metabolism, indoleamine-2,3-dioxygenase(IDO)-1 and kynurenine 3-monooxygenase(KMO). By 24 h post-LPS, kynurenine and quinolinic acid in the media was elevated. Inhibiting KMO with Ro 61-8048 during LPS challenge attenuated extracellular nitrite accumulation and expression of KMO and TNF-α in response to LPS. Similarly, primary microglia isolated from KMO -/- mice exhibited a significantly reduced pro-inflammatory response to LPS compared to WT controls. To determine whether the substrate (kynurenine) or end product (quinolinic acid) of KMO-dependent metabolism modulates the LPS response, microglia were treated with increasing concentrations of L-kynurenine or quinolinic acid in combination with LPS or saline. Interestingly, quinolinic acid did not impact the microglial LPS response. However, L-kynurenine had dose-dependent inhibitory effect on the LPS response. These data are the first to show an anti-inflammatory effect of KMO inhibition on microglia during immune challenge and suggest that KP metabolic balance may play a direct role in regulating microglia activity. Published by Elsevier Ltd.
Kisspeptin, unexplained infertility and embryo implantation
Directory of Open Access Journals (Sweden)
Aaida Mumtaz
2017-03-01
Full Text Available Background Kisspeptin (KP is a neuropeptide that causes the release of the gonadotropin releasing hormone, which controls hypothalamo pituitary ovarian axis and exerts a number of peripheral effects on reproductive organs. The primary objective of this study was to compare baseline KP levels in females with different types of infertility and identify possible correlations with risk of failure to conceive, preclinical abortion and pregnancy after intracytoplasmic sperm injection (ICSI. Materials and Methods A longitudinal cohort study was carried out from August 2014 until May 2015 by recruiting 124 female patients undergoing ICSI, after obtaining ethical approval from the Australian Concept Infertility Medical Center. Cause of infertility due to male, female and unexplained factors was at a frequency of 32 (24%, 33 (31% and 59 (45% among the individuals respectively. KP levels were measured by ELISA assay before the initiation of the ICSI treatment protocol. Outcome of ICSI was categorized into three groups of non-pregnant with beta-human chorionic gonadotropin (β-hCG25 mIU/ml and no cardiac activity, and clinical pregnancy declared upon confirmation of cardiac activity. Results based on cause of infertility and outcome groups were analyzed by one-way ANOVA. Results Females with unexplained infertility had significantly lower levels of KP when compared with those with male factor infertility (176.69 ± 5.03 vs. 397.6 ± 58.2, P=0.001. Clinical pregnancy was observed in 28 (23% females of which 17 (71% had a female cause of infertility. In the non-pregnant group of 66 (53% females, common cause of infertility was unexplained 56(85%. A weak positive correlation of KP levels with fertilized oocytes and endometrial thickness was observed (P=0.04 and 0.01 respectively. Conclusion Deficiency of KP in females with unexplained infertility was associated with reduced chances of implantation after ICSI.
A Liberal Assessment of Intercultural Relations in Khyber Pakhtunkhwa, Pakistan
Directory of Open Access Journals (Sweden)
Jamal Shah
2017-10-01
Full Text Available Various theories attempt to provide generalized solutions to the challenges arising out of plurality but no unanimous mechanism has been developed so far. Many questions related to cultural diversity can be addressed if theories are complemented by empirical research. This paper is an attempt in that direction. It evaluates the attitudes of cultural groups in Khyber Pakhtunkhwa (KP, Pakistan, towards culture and the strategies for the management of plurality by conducting a field survey for collecting data through 2977 questionnaires and 80 personal interviews from 9 religio-linguistic groups. The paper makes Douglas Hartmann and Joseph Gerteis’s model of difference (2005 a theoretical classification and investigates which vision is appreciated most by the people of KP. The paper shows that the majority of the people in KP has a negative attitude towards assimilationism, cosmopolitanism and fragmented pluralism but a positive attitude towards interactive pluralism. After this research it was found that KP society is more tolerant and liberal than it was thought to be.
Fairfield, D. H.; Acuna, M. H.; Zanetti, L. J.; Potemra, T. A.
1987-01-01
The MPTE/CCE magnetic field experiment has been used to obtain a quantitative evaluation of the frequency and extent of magnetic field distortion in the near-tail region at less than 8.8 earth radii. The variation of this distortion with Kp, radial distance, longitude, and near-equatorial latitude is reported. It has been found that taillike distortions from the dipole field direction may reach 80 deg near the MPTE/CE apogee of 8.8 earth radii. The Bz field component in dipole coordinates was always positive within 0.5 earth radii of the equatorial current sheet, indicating the neutral lines were never seen inside of 8.8 earth radii. Fields were most taillike near midnight and during times of high Kp. At 8.5 earth radii the equatorial field magnitude depressions were roughly half the dipole field strength of 51 nT. These depressions are larger at lesser distances, reaching -40 nT at 3.4 earth radii for Kp of 2- or less and -80 nT and Kp of 3+ and greater.
General Relativity solutions in modified gravity
Motohashi, Hayato; Minamitsuji, Masato
2018-06-01
Recent gravitational wave observations of binary black hole mergers and a binary neutron star merger by LIGO and Virgo Collaborations associated with its optical counterpart constrain deviation from General Relativity (GR) both on strong-field regime and cosmological scales with high accuracy, and further strong constraints are expected by near-future observations. Thus, it is important to identify theories of modified gravity that intrinsically possess the same solutions as in GR among a huge number of theories. We clarify the three conditions for theories of modified gravity to allow GR solutions, i.e., solutions with the metric satisfying the Einstein equations in GR and the constant profile of the scalar fields. Our analysis is quite general, as it applies a wide class of single-/multi-field scalar-tensor theories of modified gravity in the presence of matter component, and any spacetime geometry including cosmological background as well as spacetime around black hole and neutron star, for the latter of which these conditions provide a necessary condition for no-hair theorem. The three conditions will be useful for further constraints on modified gravity theories as they classify general theories of modified gravity into three classes, each of which possesses i) unique GR solutions (i.e., no-hair cases), ii) only hairy solutions (except the cases that GR solutions are realized by cancellation between singular coupling functions in the Euler-Lagrange equations), and iii) both GR and hairy solutions, for the last of which one of the two solutions may be selected dynamically.
Assessment of Nutrient Contents of Modified Finger Millet (Eleusine coracana Starch
Directory of Open Access Journals (Sweden)
Tukura Bitrus Wokhe
2017-02-01
Full Text Available Modification processes can change the physicochemical and structural properties of native starch, thereby increasing its industrial applications. Finger millet starch (FMS was modified with casava starch (CS, guar gum (GG and xanthan gum (XG modifiers at the ratios of 95:5%, 90:10%, 80:20% and 75: 25%, for each of the modifier. The proximate and mineral compositions of the modified starch were determined using standard methods. Atomic absorption spectrometry method was used to quantify the mineral contents of the modified starch. Proximate contents of the modified FMS starch varied according to the type of the modifier and FMS/modifier ratios. Concentrations of carbohydrate in CS (66.97±0.03%, GG (64.42±0.05% and XG (64.64 ± 0.01% FMS modified starches were highest at 10%, 25% and 5% of the modifier contents repectively. The highest levels of fat in GG (8.91±0.02%, XG (7.89±0.01 and ash (3.55±0.02% in CS modified starches were recorded when the quantity of the modifiers were increased to 25%. Fatty acid levels in the modified starches varied in the order of XG (7.74±0.03% at 20% > GG (7.13±0.02% at 25% > CS (5.14±0.20% at 10%. At 25% modifier contents, levels of mineral element were highest in the modified CS and GG starches. Modifications decreased Mg, Mn, Fe, Zn, and Cu contents, while the concentrations Na, K, Ca and P increased. The modified starches can be used for production of some foods for specific health purposes.
Electronic structure of single crystalline Bi sub 2 (Sr,Ca,La) sub 3 Cu sub 2 O sub 8
Energy Technology Data Exchange (ETDEWEB)
Lindberg, P A.P.; Shen, Z X; Dessau, D S; Wells, B O; Borg, A; Mitzi, D B; Lindau, I; Spicer, W E; Kapitulnik, A [Stanford Electronics Labs. and Dept. of Applied Physics, Stanford Univ., CA (USA)
1989-12-01
Angle-resolved photoemission experiments on single crystals of Bi{sub 2}(Sr,Ca,La){sub 3}Cu{sub 2}O{sub 8} are reported. The data show a dispersionless behaviour of the valence band states as a function of the perpendicular component of the wave vector (along the c-axis), while as a function of the parallel component (in the a-b plane) clear dispersion occurs. Furthermore, polarization-dependent excitations reveal information on the symmetry of the unoccupied states. (orig.).
WDVV equation and triple-product relation
International Nuclear Information System (INIS)
Shigechi, Keiichi; Wadati, Miki; Wang Ning
2005-01-01
We study the relation between the WDVV equations and the τ-function of the noncommutative KP (NCKP) hierarchy. WDVV-like equations (Hirota triple-product relation) in the noncommutative context appear as a consequence of the nontrivial equation for τ-function of the NC KP hierarchy, while the prepotential in the Seiberg-Witten (SW) theory has been identified to the τ-function of the Whitham hierarchy. We show that the spectral curve for the SW theory is the same as the Toda-chain hierarchy. We also show explicitly that Whitham hierarchy includes commutative Toda/KP hierarchy. Further, we comment on the origin of the Hirota triple-product relation in the context of the SW theory
Directory of Open Access Journals (Sweden)
Nitin Arora
2015-01-01
Full Text Available This paper describes modified Nance palatal button by which problems encountered in the palatal region around the acrylic button during space closure and molar distalization can be minimized.
Micro-Bulges Investigation on Laser Modified Tool Steel Surface
Directory of Open Access Journals (Sweden)
Fauzun Fazliana
2017-01-01
Full Text Available This paper presents micro-bulges investigation on laser modified tool steel. The aim of this study is to understand the effect of laser irradiance and interaction time on surface morphology configuration. An Nd:YAG laser system with TEM00 pulse processing mode was used to modify the samples. Metallographic study shows samples were analyzed for focal position effect on melted pool size, angle of peaks geometry and laser modified layer depth. Surface morphology were analyzed for surface roughness. Laser modified layer shows depth ranged between 42.22 and 420.12 μm. Angle of peak bulge was found to be increase with increasing peak power. The maximum roughness, Ra, achieved in modified H13 was 21.10 μm. These findings are significant to enhance surface properties of laser modified steel and cast iron for dies and high wear resistance applications.
Genetically Modified Foods and Consumer Perspective.
Boccia, Flavio; Sarnacchiaro, Pasquale
2015-01-01
Genetically modified food is able to oppose the world's hunger and preserve the environment, even if the patents in this matter are symptomatic of several doubts. And also, transgenic consumption causes problems and skepticism among consumers in several European countries, but above all in Italy, where there is a strong opposition over recent years. So, the present study conducted a research to study the consumption of genetically modified food products by Italian young generation. This research presented the following purposes: firstly, to analyze genetically modified products' consumption among a particular category of consumers; secondly, to implement a quantitative model to understand behaviour about this particular kind of consumption and identify the factors that determine their purchase. The proposed model shows that transgenic consumption is especially linked to knowledge and impact on environment and mankind's health.
Controlling harmful algae blooms using aluminum-modified clay.
Liu, Yang; Cao, Xihua; Yu, Zhiming; Song, Xiuxian; Qiu, Lixia
2016-02-15
The performances of aluminum chloride modified clay (AC-MC), aluminum sulfate modified clay (AS-MC) and polyaluminum chloride modified clay (PAC-MC) in the removal of Aureococcus anophagefferens were compared, and the potential mechanisms were analyzed according to the dispersion medium, suspension pH and clay surface charges. The results showed that AC-MC and AS-MC had better efficiencies in removing A.anophagefferens than PAC-MC. The removal mechanisms of the three modified clays varied. At optimal coagulation conditions, the hydrolysates of AC and AS were mainly monomers, and they transformed into Al(OH)3(am) upon their addition to algae culture, with the primary mechanism being sweep flocculation. The PAC mainly hydrolyzed to the polyaluminum compounds, which remained stable when added to the algae culture, and the flocculation mainly occurred through polyaluminum compounds. The suspension pH significantly influenced the aluminum hydrolysate and affected the flocculation between the modified clay and algae cells. Copyright © 2016 Elsevier Ltd. All rights reserved.
Modified Mason number for charged paramagnetic colloidal suspensions
Du, Di; Hilou, Elaa; Biswal, Sibani Lisa
2016-06-01
The dynamics of magnetorheological fluids have typically been described by the Mason number, a governing parameter defined as the ratio between viscous and magnetic forces in the fluid. For most experimental suspensions of magnetic particles, surface forces, such as steric and electrostatic interactions, can significantly influence the dynamics. Here we propose a theory of a modified Mason number that accounts for surface forces and show that this modified Mason number is a function of interparticle distance. We demonstrate that this modified Mason number is accurate in describing the dynamics of a rotating pair of paramagnetic colloids of identical or mismatched sizes in either high or low salt solutions. The modified Mason number is confirmed to be pseudoconstant for particle pairs and particle chains undergoing a stable-metastable transition during rotation. The interparticle distance term can be calculated using theory or can be measured experimentally. This modified Mason number is more applicable to magnetorheological systems where surface forces are not negligible.
Osteoblast cell response to surface-modified carbon nanotubes
International Nuclear Information System (INIS)
Zhang Faming; Weidmann, Arne; Nebe, J. Barbara; Burkel, Eberhard
2012-01-01
In order to investigate the interaction of cells with modified multi-walled carbon nanotubes (MWCNTs) for their potential biomedical applications, the MWCNTs were chemically modified with carboxylic acid groups (–COOH), polyvinyl alcohol (PVA) polymer and biomimetic apatite on their surfaces. Additionally, human osteoblast MG-63 cells were cultured in the presence of the surface-modified MWCNTs. The metabolic activities of osteoblastic cells, cell proliferation properties, as well as cell morphology were studied. The surface modification of MWCNTs with biomimetic apatite exhibited a significant increase in the cell viability of osteoblasts, up to 67.23%. In the proliferation phases, there were many more cells in the biomimetic apatite-modified MWCNT samples than in the MWCNTs–COOH. There were no obvious changes in cell morphology in osteoblastic MG-63 cells cultured in the presence of these chemically-modified MWCNTs. The surface modification of MWCNTs with apatite achieves an effective enhancement of their biocompatibility.
MS Disease-Modifying Medications
... disease-modifying therapies Approval: 2014 US; 2014 CAN Pregnancy Category C (see footnote, page 11) Rash, headache, fever, nasal congestion, nausea, urinary tract infection, fatigue, insomnia, upper respiratory tract infection, herpes viral ...
Study of Antiultraviolet Asphalt Modifiers and Their Antiageing Effects
Directory of Open Access Journals (Sweden)
Jinxuan Hu
2017-01-01
Full Text Available Ultraviolet (UV radiation causes serious ageing problems on pavement surface. In recent years, different UV blocking materials have been used as modifiers to prevent asphalt ageing during the service life of the pavement. In this study, three different materials have been used as modifiers in base asphalt to test their UV blocking effects: layered double hydroxides (LDHs, organomontmorillonite (OMMT, and carbon black (CB. UV ageing was applied to simulate the ageing process and softening point, penetration, ductility, DSR (Dynamic Shear Rheometer test, and Fourier Transform Infrared Spectroscopy (FTIR test were conducted to evaluate the anti-UV ageing effects of the three UV blocking modifiers. Physical property tests show that base asphalt was influenced more seriously by UV radiation compared to the modified asphalt. DSR test results indicate that the complex modulus of asphalt before UV ageing is increased because of modifiers, while the complex modulus of base asphalt after UV ageing is higher than that of the modified asphalt, which shows that the UV blocking modifiers promote the antiageing effects of asphalt. FTIR test reveals that the increment of carbonyl groups and sulfoxide groups of modified asphalt is less than that in base asphalt. Tests indicate the best UV blocking effect results for samples with LDHs and the worst UV blocking effect results for samples with CB.
The statistical studies of the inner boundary of plasma sheet
Directory of Open Access Journals (Sweden)
J. B. Cao
2011-02-01
Full Text Available The penetration of plasma sheet ions into the inner magnetosphere is very important to the inner magnetospheric dynamics since plasma sheet ions are one of the major particle sources of ring current during storm times. However, the direct observations of the inner boundary of the plasma sheet are fairly rare due to the limited number of satellites in near equatorial orbits outside 6.6 RE. In this paper, we used the ion data recorded by TC-1 from 2004 to 2006 to study the distribution of inner boundary of ion plasma sheet (IBIPS and for the first time show the observational distribution of IBIPS in the equatorial plane. The IBIPS has a dawn-dusk asymmetry, being farthest to the Earth in the 06:00 08:00 LT bin and closest to the Earth in the 18:00–20:00 LT bin. Besides, the IBIPS has also a day-night asymmetry, which may be due to the fact that the ions on the dayside are exposed more time to loss mechanisms on their drift paths. The radial distance of IBIPS decrease generally with the increase of Kp index. The mean radial distance of IBIPS is basically larger than 6.6 RE during quiet times and smaller than 6.6 RE during active times. When the strength of convection electric field increases, the inward shift of IBIPS is most significant on the night side (22:00–02:00 LT. For Kp ≤ 0+, only 16% of IBIPSs penetrate inside the geosynchronous orbit. For 2 ≤ Kp +, however, 70% of IBIPSs penetrate inside the geosynchronous orbit. The IBIPS has weak correlations with the AE and Dst indexes. The average correlation coefficient between Ri and Kp is −0.58 while the correlation coefficient between Ri and AE/Dst is only −0.29/0.17. The correlation coefficients are local time dependent. Particularly, Ri and Kp are highly correlated (r=−0.72 in the night sector, meaning that the radial distance of IBIPS Ri in the night sector has the good response to the Kp index These observations indicate that Kp plays a key role in determining the position of
Zhang, Xingyu; Chen, Di; Xu, Guifeng; Huang, Weichun; Wang, Xing
2018-01-01
Infection by carbapenem-resistant Klebsiella pneumoniae (CR-KP) is a public health challenge worldwide, in particular among children, which was associated with high morbidity and mortality rates. There was limited data in pediatric populations, thus this study aimed to investigate molecular epidemiology and drug resistant mechanism of CR-KP strains from pediatric patients in Shanghai, China. A total of 41 clinical CR-KP isolates from sputum, urine, blood or drainage fluid were collected between July 2014 and May 2015 in Shanghai Children's Medical Center. Multilocus sequence typing (MLST), antibiotic susceptibility testing, PCR amplification and sequencing of the drug resistance associated genes were applied to all these isolates. MLST analysis revealed 16 distinct STs identified within the 41 isolates, among which the most frequently represented were ST11(19.5%),ST25(14.6%),ST76(14.6%),ST37(9.8%).One new ST was first identified. All CR-KP isolates showed MDR phenotypes and were resistance to ceftazidime, imipenem, piperacillin / tazobactam, ceftriaxone, ampicillin /sulbactam, aztreonam. They were confirmed as carbapenemase producer, NDM-1 (56.1%, 23/41), IMP (26.8%, 11/41), KPC-2 (22.0%, 9/41) were detected. Of note, two isolates carried simultaneously both NDM-1 and IMP-4. All CR-KP strains contained at least one of extended spectrum β-lactamase genes tested(TEM, SHV, OXA-1, CTX-M group) and six isolates carried both ESBL and AmpC genes(DHA-1). Among the penicllinase and β-lactamase genes, the most frequently one is SHV(92.7%,38/41), followed by TEM-1(68.3%,28/41), CTX-M-14(43.9%,18/41), CTX-M-15(43.9%,14/41), OXA-1(14.6%,6/41). In the present study, NDM-1-producing isolates was the predominant CR-KP strains in children, follow by IMP and KPC-producing strains. NDM-1and IMP-4 were more frequent than KPC-2 and showed a multiclonal background. Those suggested carbapenem-resistant in children is diverse, and certain resistance mechanisms differ from prevalent
Plasma potassium concentration and content changes after banana ingestion in exercised men.
Miller, Kevin C
2012-01-01
Individuals prone to exercise-associated muscle cramps (EAMCs) are instructed to eat bananas because of their high potassium (K(+)) concentration and carbohydrate content and the perception that K(+) imbalances and fatigue contribute to the genesis of EAMCs. No data exist about the effect of bananas on plasma K(+) concentration ([K(+)](p)) or plasma glucose concentration ([glucose](p)) after exercise in the heat. To determine whether ingesting 0, 1, or 2 servings of bananas after 60 minutes of moderate to vigorous exercise in the heat alters [K(+)](p) or [glucose](p) and whether changes in [K(+)](p) result from hypotonic fluid effluxes or K(+) ion changes. Crossover study. Laboratory. Nine euhydrated men (age = 27 ± 4 years, height = 180.3 ± 8.4 cm, mass = 84.9 ± 26.1 kg, urine specific gravity ≤ 1.006) without EAMCs volunteered. On 3 separate days, participants completed 60 minutes of moderate to vigorous cycling (temperature = 36.4°C ± 1.1°C, relative humidity = 19.4% ± 2.5%) and then ate 0 g (0 servings), 150 g (1 serving), or 300 g (2 servings) of bananas. Blood samples were collected at 3, 5, 15, 30, and 60 minutes postingestion. The [K(+)](p), changes in plasma K(+) content, plasma volume changes, and [glucose](p). The [K(+)](p) differed between conditions at 60 minutes; 2 servings (4.6 ± 0.3 mmol/L [conventional unit = 4.6 ± 0.3 mEq/L]) was greater than 1 serving (4.5 ± 0.2 mmol/L [conventional unit = 4.5 ± 0.2 mEq/L]) and 0 servings (4.4 ± 0.3 mmol/L [conventional unit = 4.4 ± 0.3 mEq/L]) (P banana ingestion on EAMCs is unknown; however, these data suggested bananas are unlikely to relieve EAMCs by increasing extracellular [K(+)] or [glucose](p). The increases in [K(+)](p) were marginal and within normal clinical values. The changes in [K(+)](p), plasma K(+) content, and [glucose](p) do not occur quickly enough to treat acute EAMCs, especially if they develop near the end of competition.
Modified microdissection electrocautery needle
Singh, Virendra; Kumar, Pramod
2014-01-01
Electrocautery is routinely used in surgical procedures. The commercially available microdissection electrocautery needles are costly. To overcome this disadvantage, we have modified monopolar electrocautery tip to function as well as commercially available systems.
Removal of cadmium in urban wastewater with systems based on zeolite type clinoptilolite
International Nuclear Information System (INIS)
Barragan P, P.
2016-01-01
From an environmental issue detected in wastewater samples taken in a municipal wastewater collector in Nogales, Sonora, which is related to cadmium pollution, a research project came out where the principal aim was to implement a system to remove metallic ions of cadmium in wastewater, based on modified and unmodified natural zeolites. The zeolitic material used was natural clinoptilolite modified with NaCl and thiourea, sourced in El Cajon and Guaymas, Sonora. The materials were characterized with X-ray diffraction, Sem, Ft-IR spectra, and Bet analysis. The kinetics of four modified zeolites was investigated at ph=5 and initial concentration of 30 mgL"-"1 of Cd"2"+. The pseudo-first, the pseudo-second order, and Elovich models were applied to the experimental results. The results best fitted to pseudo-second order model. The maximum sorption capacity of modified zeolites was investigated through isotherms, The Langmuir model, Freundlich, and the combined Langmuir-Freundlich models were applied to the experimental results afterwards. ZGuayThio showed the highest sorption capacity, 11.60 mgg"-"1, with R"2=0.978 according to Langmuir-Freundlich model. Fixed-bed column adsorption experiments were carried out with ZGuayNa and ZGuayThio with three bed heights with 30 mgL"-"1 solution of Cd"2"+. influent at a flow rate of 1 mLmin"-"1, at ph=5. The Thomas, mass balance, and Bed Depth Service Time models were applied to the results. The dynamic adsorption capacity (No) and the constant of sorption velocity (K a) were determined, 28.67 gL"-"1 and 0.072 Lg"-"1min"-"1 respectively for ZGuayNa with R"2= 0.9954. Column experiments with municipal wastewater from Colinas del Yaqui sub-collector, previously characterized, were conducted using ZGuayNa and ZGuayThio. A mass transference model was applied to the results which accounted for K_p= 0.815 m"3Kg"-1 with R"2= 0.9789 for ZGuayNa, and K_p= 3.1 m"3Kg"-1 for ZGuayThio with R"2= 0.78. Finally, the capacity of the column system
40 CFR 721.3710 - Polyether modified fatty acids (generic).
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polyether modified fatty acids... Specific Chemical Substances § 721.3710 Polyether modified fatty acids (generic). (a) Chemical substance... Polyether modified fatty acids (PMN P-99-0435) is subject to reporting under this section for the...
40 CFR 721.9513 - Modified magnesium silicate polymer (generic).
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Modified magnesium silicate polymer... Specific Chemical Substances § 721.9513 Modified magnesium silicate polymer (generic). (a) Chemical... as modified magnesium silicate polymer (PMN P-98-604) is subject to reporting under this section for...
Disulfiram as a radiation modifier
International Nuclear Information System (INIS)
Taylor, R.D.; Maners, A.W.; Salari, H.; Baker, M.; Walker, E.M. Jr.
1986-01-01
The radiation modifying effect and toxicity of tetraethylthiuram disulfide (disulfiram) have been studied. Disulfiram (DSM) inhibits aldehyde dehydrogenase, dopamine-beta-oxygenase, microsomal mixed-function oxidases and cytochrome P-450 enzymes. It is widely used for aversion therapy in alcoholism. Disulfiram also inhibits tumor formation by several known carcinogens. A biphasic toxicity pattern of DSM is reported in the L-929 mouse fibroblast culture system. Disulfiram is 100 percent toxic at 2 X 10(-7) M (0.05 micrograms per ml), 23 percent toxic at 3 X 10(-7) M (0.1 microgram per ml), and 100 percent toxic again at 3.4 X 10(-6) M (1.0 microgram per ml). The pattern is similar to the biphasic toxicity pattern of DMS's major metabolite, sodium diethyldithiocarbamate (DTC). Reports of both radiation protection and radiation enhancement by DTC exist. Previously, a radioprotective effect by 2 X 10(-6) M DTC (dose modifying factor = 1.26) has been demonstrated in the L-929 cell system. To date, no radiation modifying properties of DSM have been reported. Our investigation of DSM as a radiation modifier at 3 X 10(-7) M (0.1 microgram per ml) did not show significant improvement in survival of irradiated cells treated with DSM relative to the irradiated control group, as determined by absence of a difference in the Do of the two groups. Considering DSM's close structural relationship to DTC, it is possible that DSM may exhibit a radioprotective effect when applied in a different concentration than what was used in our research
Getting super-excited with modified dispersion relations
Energy Technology Data Exchange (ETDEWEB)
Ashoorioon, Amjad; Casadio, Roberto [INFN—Sezione di Bologna, viale B. Pichat 6/2, I-40127 Bologna (Italy); Geshnizjani, Ghazal; Kim, Hyung J., E-mail: amjad.ashoorioon@bo.infn.it, E-mail: roberto.casadio@bo.infn.it, E-mail: ggeshniz@uwaterloo.ca, E-mail: h268kim@uwaterloo.ca [Department of Applied Mathematics, University of Waterloo Waterloo, Ontario, N2L 3G1 (Canada)
2017-09-01
We demonstrate that in some regions of parameter space, modified dispersion relations can lead to highly populated excited states, which we dub as 'super-excited' states. In order to prepare such super-excited states, we invoke dispersion relations that have negative slope in an interim sub-horizon phase at high momenta. This behaviour of quantum fluctuations can lead to large corrections relative to the Bunch-Davies power spectrum, which mimics highly excited initial conditions. We identify the Bogolyubov coefficients that can yield these power spectra. In the course of this computation, we also point out the shortcomings of the gluing method for evaluating the power spectrum and the Bogolyubov coefficients. As we discuss, there are other regions of parameter space, where the power spectrum does not get modified. Therefore, modified dispersion relations can also lead to so-called 'calm excited states'. We conclude by commenting on the possibility of obtaining these modified dispersion relations within the Effective Field Theory of Inflation.
Active containment systems incorporating modified pillared clays
International Nuclear Information System (INIS)
Lundie, P.; McLeod, N.
1997-01-01
The application of treatment technologies in active containment systems provides a more advanced and effective method for the remediation of contaminated sites. These treatment technologies can be applied in permeable reactive walls and/or funnel and gate systems. The application of modified pillared clays in active containment systems provides a mechanism for producing permeable reactive walls with versatile properties. These pillared clays are suitably modified to incorporate reactive intercalatants capable of reacting with both a broad range of organic pollutants of varying molecular size, polarity and reactivity. Heavy metals can be removed from contaminated water by conventional ion-exchange and other reactive processes within the clay structure. Complex contamination problems can be addressed by the application of more than one modified clay on a site specific basis. This paper briefly describes the active containment system and the structure/chemistry of the modified pillared clay technology, illustrating potential applications of the in-situ treatment process for contaminated site remediation
Modified asphalt for pavements; Hosoyo kaishitsu asufuaruto ni tsuite
Energy Technology Data Exchange (ETDEWEB)
Tsukagoshi, T. [Nippon Oil Co. Ltd., Yokohama (Japan)
1997-10-01
Modified asphalt has been used widely in such applications as countermeasure against rutting, countermeasure against wear caused by tire chains in snowy and cold areas, or bridge deck pavement. Features of various kinds of modified asphalt, standards, and standard properties are introduced. Modified asphalt containing natural asphalt is used for steel plate deck pavement. Semi-blown asphalt is used when emphasis must be given to the countermeasure for flowing resistance of asphalt pavement. Features and standards of asphalt containing rubber, thermoplastic elastomer, and thermoplastic resin are described. Asphalt containing heat-setting resin shows excellent characteristics, which other types of modified asphalt do not possess, in the laboratory resistance test for fatigue, flowing, and wear. Change in the history of modified asphalt in Japan from the initial stage to the present are explained and shown in a table together with time and phenomena, and the change in the production of modified asphalt is shown. 15 refs., 5 figs., 5 tabs.
Non-singular and cyclic universe from the modified GUP
International Nuclear Information System (INIS)
Salah, Maha; Hammad, Fayçal; Faizal, Mir; Ali, Ahmed Farag
2017-01-01
In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.
Non-singular and cyclic universe from the modified GUP
Salah, Maha; Hammad, Fayçal; Faizal, Mir; Farag Ali, Ahmed
2017-02-01
In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.
Non-singular and cyclic universe from the modified GUP
Energy Technology Data Exchange (ETDEWEB)
Salah, Maha [Department of Mathematics, Faculty of Science, Cairo University, Giza, 12613, Egypt. (Egypt); Hammad, Fayçal [Physics Department and STAR Research Cluster, Bishop' s University, 2600 College Street, Sherbrooke (QC), J1M 1Z7 (Canada); Faizal, Mir [Department of Physics and Astronomy, University of Lethbridge, Lethbridge, Alberta, T1K 3M4 (Canada); Ali, Ahmed Farag, E-mail: abdelmoneim.maha@gmail.com, E-mail: fhammad@ubishops.ca, E-mail: mirfaizalmir@gmail.com, E-mail: ahmed.ali@fsc.bu.edu.eg [Department of Physics, Faculty of Science, Benha University, Benha, 13518 (Egypt)
2017-02-01
In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.
A Modified Image Comparison Algorithm Using Histogram Features
Al-Oraiqat, Anas M.; Kostyukova, Natalya S.
2018-01-01
This article discuss the problem of color image content comparison. Particularly, methods of image content comparison are analyzed, restrictions of color histogram are described and a modified method of images content comparison is proposed. This method uses the color histograms and considers color locations. Testing and analyzing of based and modified algorithms are performed. The modified method shows 97% average precision for a collection containing about 700 images without loss of the adv...
Breda, Carlo; Sathyasaikumar, Korrapati V; Sograte Idrissi, Shama; Notarangelo, Francesca M; Estranero, Jasper G; Moore, Gareth G L; Green, Edward W; Kyriacou, Charalambos P; Schwarcz, Robert; Giorgini, Flaviano
2016-05-10
Metabolites of the kynurenine pathway (KP) of tryptophan (TRP) degradation have been closely linked to the pathogenesis of several neurodegenerative disorders. Recent work has highlighted the therapeutic potential of inhibiting two critical regulatory enzymes in this pathway-kynurenine-3-monooxygenase (KMO) and tryptophan-2,3-dioxygenase (TDO). Much evidence indicates that the efficacy of KMO inhibition arises from normalizing an imbalance between neurotoxic [3-hydroxykynurenine (3-HK); quinolinic acid (QUIN)] and neuroprotective [kynurenic acid (KYNA)] KP metabolites. However, it is not clear if TDO inhibition is protective via a similar mechanism or if this is instead due to increased levels of TRP-the substrate of TDO. Here, we find that increased levels of KYNA relative to 3-HK are likely central to the protection conferred by TDO inhibition in a fruit fly model of Huntington's disease and that TRP treatment strongly reduces neurodegeneration by shifting KP flux toward KYNA synthesis. In fly models of Alzheimer's and Parkinson's disease, we provide genetic evidence that inhibition of TDO or KMO improves locomotor performance and ameliorates shortened life span, as well as reducing neurodegeneration in Alzheimer's model flies. Critically, we find that treatment with a chemical TDO inhibitor is robustly protective in these models. Consequently, our work strongly supports targeting of the KP as a potential treatment strategy for several major neurodegenerative disorders and suggests that alterations in the levels of neuroactive KP metabolites could underlie several therapeutic benefits.
Surface-modified bacterial nanofibrillar PHB scaffolds for bladder tissue repair.
Karahaliloğlu, Zeynep; Demirbilek, Murat; Şam, Mesut; Sağlam, Necdet; Mızrak, Alpay Koray; Denkbaş, Emir Baki
2016-01-01
The aim of the study is in vitro investigation of the feasibility of surface-modified bacterial nanofibrous poly [(R)-3-hydroxybutyrate] (PHB) graft for bladder reconstruction. In this study, the surface of electrospun bacterial PHB was modified with PEG- or EDA via radio frequency glow discharge method. After plasma modification, contact angle of EDA-modified PHB scaffolds decreased from 110 ± 1.50 to 23 ± 0.5 degree. Interestingly, less calcium oxalate stone deposition was observed on modified PHB scaffolds compared to that of non-modified group. Results of this study show that surface-modified scaffolds not only inhibited calcium oxalate growth but also enhanced the uroepithelial cell viability and proliferation.
Mechanical Properties of Isotactic Polypropylene Modified with Thermoplastic Potato Starch
Knitter, M.; Dobrzyńska-Mizera, M.
2015-05-01
In this paper selected mechanical properties of isotactic polypropylene (iPP) modified with potato starch have been presented. Thermoplastic starch (TPS) used as a modifier in the study was produced from potato starch modified with glycerol. Isotactic polypropylene/thermoplastic potato starch composites (iPP/TPS) that contained 10, 30, 50 wt.% of modified starch were examined using dynamic mechanical-thermal analysis, static tensile, Brinell hardness, and Charpy impact test. The studies indicated a distinct influence of a filler content on the mechanical properties of composites in comparison with non-modified polypropylene.
Sensing based on the motion of enzyme-modified nanorods
DEFF Research Database (Denmark)
Bunea, Ada-Ioana; Pavel, Ileana-Alexandra; David, Sorin
2015-01-01
of nanorods modified with the appropriate enzyme. Nanorods, with a Pt and a polypyrrole (PPy) segment, were fabricated. The PPy segment of such nanorods was then modified with glucose oxidase (GOx), glutamate oxidase (GluOx), or xanthine oxidase (XOD). Calibration curves, linking the diffusion coefficient...... of the oxidase-modified nanorods to the concentration of the oxidase substrate, were subsequently built. The oxidase-modified nanorods and their calibration curves were finally used to determine substrate concentrations both in simple aqueous solutions and in complex samples such as horse serum and cell culture...
Photochemistry of modified proteins benzophenone-containing bovine serum albumin
International Nuclear Information System (INIS)
Mariano, P.S.; Glover, G.I.; Wilkinson, T.J.
1976-01-01
The results of exploratory and mechanistic studies of the photochemistry of poly-p-benzoyl-acetimido-bovine serum albumin, a modified protein containing photoreactive and photosensitizing groups, are reported. Specifically described are recent findings concerning (1) the synthesis and characterization of a modified bovine serum albumin that contains benzophenone-like moieties, (2) the photochemistry of this modified protein which appeared to involve photoreductive coupling of the benzophenone chromophores to the protein backbone, and (3) triplet energy transfer from modified bovine serum albumin to small molecule acceptors resulting in quenching of the photoreaction. (author)
Yan Li; Hua-Feng Pan; Gui-Lan Sun
2016-01-01
Objective: Through prospective randomized clinical study,to observe the preventive effect of improved surgical method to subcutaneous hydrops after modified radical mastec tomy. Method: A total of 80 cases of patients who have done modified radical mastectomy were selected, and randomly divided them into study group (40 cases) and control group (40 cases), then adopted different surgical methods as followed respectively, to observe the daily drainage volume at the first 3 d after ...
Doubly periodic solutions of the modified Kawahara equation
International Nuclear Information System (INIS)
Zhang Dan
2005-01-01
Some doubly periodic (Jacobi elliptic function) solutions of the modified Kawahara equation are presented in closed form. Our approach is to introduce a new auxiliary ordinary differential equation and use its Jacobi elliptic function solutions to construct doubly periodic solutions of the modified Kawahara equation. When the module m → 1, these solutions degenerate to the exact solitary wave solutions of the equation. Then we reveal the relation of some exact solutions for the modified Kawahara equation obtained by other authors
Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
Directory of Open Access Journals (Sweden)
Linda S Kaltenbach
2007-05-01
Full Text Available Huntington's disease (HD is a fatal neurodegenerative condition caused by expansion of the polyglutamine tract in the huntingtin (Htt protein. Neuronal toxicity in HD is thought to be, at least in part, a consequence of protein interactions involving mutant Htt. We therefore hypothesized that genetic modifiers of HD neurodegeneration should be enriched among Htt protein interactors. To test this idea, we identified a comprehensive set of Htt interactors using two complementary approaches: high-throughput yeast two-hybrid screening and affinity pull down followed by mass spectrometry. This effort led to the identification of 234 high-confidence Htt-associated proteins, 104 of which were found with the yeast method and 130 with the pull downs. We then tested an arbitrary set of 60 genes encoding interacting proteins for their ability to behave as genetic modifiers of neurodegeneration in a Drosophila model of HD. This high-content validation assay showed that 27 of 60 orthologs tested were high-confidence genetic modifiers, as modification was observed with more than one allele. The 45% hit rate for genetic modifiers seen among the interactors is an order of magnitude higher than the 1%-4% typically observed in unbiased genetic screens. Genetic modifiers were similarly represented among proteins discovered using yeast two-hybrid and pull-down/mass spectrometry methods, supporting the notion that these complementary technologies are equally useful in identifying biologically relevant proteins. Interacting proteins confirmed as modifiers of the neurodegeneration phenotype represent a diverse array of biological functions, including synaptic transmission, cytoskeletal organization, signal transduction, and transcription. Among the modifiers were 17 loss-of-function suppressors of neurodegeneration, which can be considered potential targets for therapeutic intervention. Finally, we show that seven interacting proteins from among 11 tested were able to
A remark on Dickey's stabilizing chain
International Nuclear Information System (INIS)
Svinin, Andrei K.
2011-01-01
We observe that Dickey's stabilizing chain can be naturally included into two-dimensional chain of infinitely many copies of equations of KP hierarchy. -- Highlights: → In this study we consider Dickey's stabilizing chain. → We construct two-dimensional chain of dressing truncated operators. → We show that Dickey's stabilizing chain can be included into two-dimensional chain of KP hierarchies.
Modified planar functions and their components
DEFF Research Database (Denmark)
Anbar Meidl, Nurdagül; Meidl, Wilfried Meidl
2017-01-01
functions in odd characteristic as a vectorial bent function. We finally point out that though these components behave somewhat different than the multivariate bent4 functions, they are bent or semibent functions shifted by a certain quadratic term, a property which they share with their multivariate......Zhou ([20]) introduced modified planar functions in order to describe (2n; 2n; 2n; 1) relative difference sets R as a graph of a function on the finite field F2n, and pointed out that projections of R are difference sets that can be described by negabent or bent4 functions, which are Boolean...... functions given in multivariate form. One of the objectives of this paper is to contribute to the understanding of these component functions of modified planar functions. Moreover, we obtain a description of modified planar functions by their components which is similar to that of the classical planar...
46 CFR 53.01-5 - Scope (modifies HG-100).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Scope (modifies HG-100). 53.01-5 Section 53.01-5... General Requirements § 53.01-5 Scope (modifies HG-100). (a) The regulations in this part apply to steam... governing various types of pressure vessels and boilers. (b) Modifies HG-100. The requirements of Part HG of...
International Nuclear Information System (INIS)
Meng Xianghua; Tian Bo; Yao Zhenzhi; Feng Qian; Gao Yitian
2009-01-01
In this paper, the investigation is focused on a (3+1)-dimensional variable-coefficient Kadomtsev-Petviashvili (vcKP) equation, which can describe the realistic nonlinear phenomena in the fluid dynamics and plasma in three spatial dimensions. In order to study the integrability property of such an equation, the Painleve analysis is performed on it. And then, based on the truncated Painleve expansion, the bilinear form of the (3+1)-dimensional vcKP equation is obtained under certain coefficients constraint, and its solution in the Wronskian determinant form is constructed and verified by virtue of the Wronskian technique. Besides the Wronskian determinant solution, it is shown that the (3+1)-dimensional vcKP equation also possesses a solution in the form of the Grammian determinant. (general)
Series expansion of the modified Einstein Procedure
Seema Chandrakant Shah-Fairbank
2009-01-01
This study examines calculating total sediment discharge based on the Modified Einstein Procedure (MEP). A new procedure based on the Series Expansion of the Modified Einstein Procedure (SEMEP) has been developed. This procedure contains four main modifications to MEP. First, SEMEP solves the Einstein integrals quickly and accurately based on a series expansion. Next,...
Modified bitumen for embedding of radioactive wastes
International Nuclear Information System (INIS)
Bozkurt, C.
1984-11-01
This work describes new possibilities of using polymer modified bitumen as matrix material for embedding of low- and medium level radioactive wastes. Epoxy resins, polyurethane resins and styrene-butadiene-copolymers with 20-40 weight per cent are used as modifying agents. Penetration and softening point (ring and ball) of modified samples have been measured. Further the resistance to toluene and leaching rate in n-heptane have been determined. Within these polymer bitumen combinations investigated, the epoxy resins having a high epoxid equivalent weight with dicarbooxylic acid anhydrid hardeners and tertiary amin accelerators give the most dense network, highest thermodimensional stability and lowest leaching rate in organic solvents. 71 refs., 9 figs., 6 tabs
Genetically Modified Products in Lithuania: Situational Analysis and Consumers’ Attitudes
Dainora Grundey; Indre Rimkiene
2012-01-01
The paper analyses the genetically modified organism products (GMP) in relation to genetically modified organisms (GMO) from two perspectives: 1) from the theoretical standpoint, discussing the GMO and GMP trade conditions and 2) from the practical perspective, namely analysing the availability of GMP in the Lithuanian market. With the growing of genetically modified products (GMP) levels, it becomes important to examine the situation of genetically modified products. According to various stu...
Automorphism group of the modified bubble-sort graph
Ganesan, Ashwin
2014-01-01
The modified bubble-sort graph of dimension $n$ is the Cayley graph of $S_n$ generated by $n$ cyclically adjacent transpositions. In the present paper, it is shown that the automorphism group of the modified bubble sort graph of dimension $n$ is $S_n \\times D_{2n}$, for all $n \\ge 5$. Thus, a complete structural description of the automorphism group of the modified bubble-sort graph is obtained. A similar direct product decomposition is seen to hold for arbitrary normal Cayley graphs generate...
Modified Chebyshev Collocation Method for Solving Differential Equations
Directory of Open Access Journals (Sweden)
M Ziaul Arif
2015-05-01
Full Text Available This paper presents derivation of alternative numerical scheme for solving differential equations, which is modified Chebyshev (Vieta-Lucas Polynomial collocation differentiation matrices. The Scheme of modified Chebyshev (Vieta-Lucas Polynomial collocation method is applied to both Ordinary Differential Equations (ODEs and Partial Differential Equations (PDEs cases. Finally, the performance of the proposed method is compared with finite difference method and the exact solution of the example. It is shown that modified Chebyshev collocation method more effective and accurate than FDM for some example given.
Sensitivity analysis of a modified energy model
International Nuclear Information System (INIS)
Suganthi, L.; Jagadeesan, T.R.
1997-01-01
Sensitivity analysis is carried out to validate model formulation. A modified model has been developed to predict the future energy requirement of coal, oil and electricity, considering price, income, technological and environmental factors. The impact and sensitivity of the independent variables on the dependent variable are analysed. The error distribution pattern in the modified model as compared to a conventional time series model indicated the absence of clusters. The residual plot of the modified model showed no distinct pattern of variation. The percentage variation of error in the conventional time series model for coal and oil ranges from -20% to +20%, while for electricity it ranges from -80% to +20%. However, in the case of the modified model the percentage variation in error is greatly reduced - for coal it ranges from -0.25% to +0.15%, for oil -0.6% to +0.6% and for electricity it ranges from -10% to +10%. The upper and lower limit consumption levels at 95% confidence is determined. The consumption at varying percentage changes in price and population are analysed. The gap between the modified model predictions at varying percentage changes in price and population over the years from 1990 to 2001 is found to be increasing. This is because of the increasing rate of energy consumption over the years and also the confidence level decreases as the projection is made far into the future. (author)
Modified Kidner procedure utilizing a Mitek bone anchor.
Dawson, D M; Julsrud, M E; Erdmann, B B; Jacobs, P M; Ringstrom, J B
1998-01-01
The recent development of small bone suture anchors has created several potential applications in reconstructive surgery of the foot. Mitek bone anchors are simple to insert, require less aggressive dissection and surgical time than reefing of the redundant posterior tibial tendon, and are a reliable method of tendon-to-bone fixation. Mitek bone anchors are an excellent technique for the treatment of redundant tibialis posterior tendon following a modified Kidner procedure. In modified Kidner procedures involving an excessively large os tibiale externum, Mitek anchoring of the redundant tibialis posterior tendon to the navicular bone is an excellent means for secure plication of the posterior tibial tendon in cases involving intraoperative tendon laxity. A description of the Mitek Anchor System and technique of application in a modified Kinder procedure is presented. The purpose of this study was to describe patient satisfaction and long-term clinical outcomes of the modified Kinder procedure with and without the Mitek bone anchoring system. A retrospective study of the modified Kinder procedure was performed with 13 patients being evaluated, seven with Mitek anchoring and six without. The University of Maryland 100-point Painful Foot Center Scoring System was modified to be more specific to the modified Kinder procedure for assessment of subjective long-term results. Patient overall satisfaction was rated good to excellent by 85.6% of patients in the Mitek group and by 100% of patients in the non-Mitek group. Use of the Mitek anchor allowed for quicker postoperative recovery to resumption of ambulation without assistive devices (average of 3 weeks vs. 4.42 weeks) and a quicker return to pain-free ambulation in normal shoegear (average of 4 weeks vs. 6 weeks). Mitek anchoring of the tibialis posterior tendon, theoretically, increases medial arch support as evidenced by 14% of the Mitek group and 67% of the non-Mitek group requiring postoperative orthotics.
Modified interstitial water squeezer for trace metal analysis
Digital Repository Service at National Institute of Oceanography (India)
Nath, B.N.; Rajaraman, V.S.; Mudholkar, A.V.
Hydraulic squeezer of Manheim, used in the extraction of pore water of sediments, has been modified by providing teflon inner lining and increasing the volume of squeezer. The modified version facilitates collection of pore water sample, for trace...
Surface treated fly ash filled modified epoxy composites
Directory of Open Access Journals (Sweden)
Uma Dharmalingam
2015-01-01
Full Text Available Abstract Fly ash, an inorganic alumino silicate has been used as filler in epoxy matrix, but it reduces the mechanical properties due to its poor dispersion and interfacial bonding with the epoxy matrix. To improve its interfacial bonding with epoxy matrix, surface treatment of fly ash was done using surfactant sodium lauryl sulfate and silane coupling agent glycidoxy propyl trimethoxy silane. An attempt is also made to reduce the particle size of fly ash using high pressure pulverizer. To improve fly ash dispersion in epoxy matrix, the epoxy was modified by mixing with amine containing liquid silicone rubber (ACS. The effect of surface treated fly ash with varying filler loadings from 10 to 40% weight on the mechanical, morphological and thermal properties of modified epoxy composites was investigated. The surface treated fly ash was characterized by particle size analyzer and FTIR spectra. Morphological studies of surface treated fly ash filled modified epoxy composites indicate good dispersion of fillers in the modified epoxy matrix and improves its mechanical properties. Impact strength of the surface treated fly ash filled modified epoxy composites show more improvement than unmodified composites.
Generated effect modifiers (GEM's) in randomized clinical trials.
Petkova, Eva; Tarpey, Thaddeus; Su, Zhe; Ogden, R Todd
2017-01-01
In a randomized clinical trial (RCT), it is often of interest not only to estimate the effect of various treatments on the outcome, but also to determine whether any patient characteristic has a different relationship with the outcome, depending on treatment. In regression models for the outcome, if there is a non-zero interaction between treatment and a predictor, that predictor is called an "effect modifier". Identification of such effect modifiers is crucial as we move towards precision medicine, that is, optimizing individual treatment assignment based on patient measurements assessed when presenting for treatment. In most settings, there will be several baseline predictor variables that could potentially modify the treatment effects. This article proposes optimal methods of constructing a composite variable (defined as a linear combination of pre-treatment patient characteristics) in order to generate an effect modifier in an RCT setting. Several criteria are considered for generating effect modifiers and their performance is studied via simulations. An example from a RCT is provided for illustration. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Ion upflow and downflow at the topside ionosphere observed by the EISCAT VHF radar
Directory of Open Access Journals (Sweden)
M. Endo
2000-02-01
Full Text Available We have determined the MLT distribution and KP dependence of the ion upflow and downflow of the thermal bulk oxygen ion population based on a data analysis using the EISCAT VHF radar CP-7 data obtained at Tromsø during the period between 1990 and 1996: (1 both ion upflow and downflow events can be observed at any local time (MLT, irrespective of dayside and nightside, and under any magnetic disturbance level, irrespective of quiet and disturbed levels; (2 these upflow and downflow events are more frequently observed in the nightside than in the dayside; (3 the upflow events are more frequently observed than the downflow events at any local time except midnight and at any KP level and the difference of the occurrence frequencies between the upflow and downflow events is smaller around midnight; and (4 the occurrence frequencies of both the ion upflow and downflow events appear to increase with increasing KP level, while the occurrence frequency of the downflow appears to stop increasing at some KP level.Key words: Ionosphere (particle acceleration; plasma waves and instabilities - Space plasma physics (transport processes
Structural insights into the elevator-like mechanism of the sodium/citrate symporter CitS.
Kim, Ji Won; Kim, Subin; Kim, Songwon; Lee, Haerim; Lee, Jie-Oh; Jin, Mi Sun
2017-05-31
The sodium-dependent citrate transporter of Klebsiella pneumoniae (KpCitS) belongs to the 2-hydroxycarboxylate transporter (2-HCT) family and allows the cell to use citrate as sole carbon and energy source in anaerobic conditions. Here we present crystal structures of KpCitS in citrate-bound outward-facing, citrate-bound asymmetric, and citrate-free inward-facing state. The structures reveal that the KpCitS dimerization domain remains stationary throughout the transport cycle due to a hydrogen bond network as well as extensive hydrophobic interactions. In contrast, its transport domain undergoes a ~35° rigid-body rotation and a ~17 Å translocation perpendicular to the membrane to expose the substrate-binding site alternately to either side of the membrane. Furthermore, homology models of two other 2-HCT proteins based on the KpCitS structure offer structural insights into their differences in substrate specificity at a molecular level. On the basis of our results and previous biochemical data, we propose that the activity of the 2-HCT CitS involves an elevator-like movement in which the transport domain itself traverses the lipid bilayer, carrying the substrate into the cell in a sodium-dependent manner.
Vision after 53 years of blindness.
Sikl, Radovan; Simecček, Michal; Porubanová-Norquist, Michaela; Bezdíček, Ondřej; Kremláček, Jan; Stodůlka, Pavel; Fine, Ione; Ostrovsky, Yuri
2013-01-01
Several studies have shown that visual recovery after blindness that occurs early in life is never complete. The current study investigated whether an extremely long period of blindness might also cause a permanent impairment of visual performance, even in a case of adult-onset blindness. We examined KP, a 71-year-old man who underwent a successful sight-restoring operation after 53 years of blindness. A set of psychophysical tests designed to assess KP's face perception, object recognition, and visual space perception abilities were conducted six months and eight months after the surgery. The results demonstrate that regardless of a lengthy period of normal vision and rich pre-accident perceptual experience, KP did not fully integrate this experience, and his visual performance remained greatly compromised. This was particularly evident when the tasks targeted finer levels of perceptual processing. In addition to the decreased robustness of his memory representations, which was hypothesized as the main factor determining visual impairment, other factors that may have affected KP's performance were considered, including compromised visual functions, problems with perceptual organization, deficits in the simultaneous processing of visual information, and reduced cognitive abilities.
Vision after 53 Years of Blindness
Directory of Open Access Journals (Sweden)
Radovan Šikl
2013-12-01
Full Text Available Several studies have shown that visual recovery after blindness that occurs early in life is never complete. The current study investigated whether an extremely long period of blindness might also cause a permanent impairment of visual performance, even in a case of adult-onset blindness. We examined KP, a 71-year-old man who underwent a successful sight-restoring operation after 53 years of blindness. A set of psychophysical tests designed to assess KP's face perception, object recognition, and visual space perception abilities were conducted six months and eight months after the surgery. The results demonstrate that regardless of a lengthy period of normal vision and rich pre-accident perceptual experience, KP did not fully integrate this experience, and his visual performance remained greatly compromised. This was particularly evident when the tasks targeted finer levels of perceptual processing. In addition to the decreased robustness of his memory representations, which was hypothesized as the main factor determining visual impairment, other factors that may have affected KP's performance were considered, including compromised visual functions, problems with perceptual organization, deficits in the simultaneous processing of visual information, and reduced cognitive abilities.
Muscle glycogen depletion patterns during draught work in Standardbred horses.
Gottlieb, M
1989-03-01
Muscle fibre recruitment was investigated during draught loaded exercise by studying glycogen depletion patterns from histochemical stains of muscle biopsies from the gluteus and semitendinosus muscles. Three Standardbred trotters performed several intervals of draught loaded exercise on a treadmill with 34 kp at a trot (7 m/sec) and with 34 and 80 kp, respectively at a walk (2m/sec). Exercise was continued until the horses were unwilling to continue. Glycogen depletion was seen in all three fibre types when trotting with 34 kp for 5 or 10 mins. When an equal weight resistance was pulled at a walk, glycogen depletion was first seen in type I fibres only, then followed by a small percentage of type IIA fibres after at least 1 h. When 80 kp was pulled at a walk both type I and IIA fibres showed glycogen depletion, and after at least 30 mins exercise a small percentage of type IIB fibres was also depleted. These results indicate that the muscle fibres are depleted, in order, from type I through IIA to IIB as the intensity or duration of draught work increases.
Societal aspects of genetically modified foods
DEFF Research Database (Denmark)
Frewer, L.J.; Lassen, J.; Kettlitz, B.
2004-01-01
This paper aims to examine some of the reasons behind public controversy associated with the introduction of genetically modified foods in Europe the 1990s. The historical background to the controversy is provided to give context. The issue of public acceptance of genetically modified foods......, and indeed the emerging biosciences more generally, is considered in the context of risk perceptions and attitudes, public trust in regulatory institutions, scientists and industry, and the need to develop communication strategies that explicitly include public concerns rather than exclude them. Increased...
Anuradha; Krishna, Amitabh
2017-11-01
Cynopterus sphinx, a fruit bat, undergoes delayed embryonic development during the winter months, a period that corresponds to low levels of progesterone and estradiol synthesis by the ovary. Kisspeptins (KPs) are a group of neuropeptide hormones that act via G-protein coupled receptor 54 (GPR54) to stimulate hypothalamic secretion of Gonadotropin-releasing hormone, thereby regulating ovarian steroidogenesis, folliculogenesis, and ovulation. GPR54 is also expressed in the ovary, suggesting a direct role for KPs in ovarian steroidogenesis. The aim of present study was to determine if a low serum level of KP is responsible for reduced progesterone and estradiol levels during the period of delayed embryonic development in C. sphinx. Indeed, low serum KP abundance corresponded to reduced expression of GPR54 in ovarian luteal cells during the period of delayed development compared to normal development. In vitro and in vivo treatment with KP increased GPR54 abundance, via Extracellular signal regulated kinase and its downstream mediators, leading to increased progesterone synthesis in the ovary during delayed embryonic development. KP treatment also increased cholesterol uptake and elevated expression of Luteinizing hormone receptor and Steroid acute regulatory protein in the ovary, suggesting that elevation in circulating KP during delayed embryonic development may reactivate luteal activity. KPs may also enhance cell survival (BCL-2, reduced Caspase 3 activity) and angiogenesis (Vascular endothelium growth factor) during this period. The findings of this study thus demonstrate a regulatory role for KPs in the maintenance of luteal steroidogenesis during pregnancy in C. sphinx. © 2017 Wiley Periodicals, Inc.
Gottlieb-Vedi, M; Essén-Gustavsson, B; Lindholm, A
1996-12-01
Five Standardbred trotters performed treadmill exercise with incrementally increasing trotting velocities for 2 min intervals in three different tests until fatigue. Each test was performed with draught loads of either 10, 20 or 30 kilopond (kp). Each trotting interval was followed by 2 min periods at a walk without draught load. Recordings were made of heart rate (HR), respiratory rate (RR), plasma lactate (PLA) and stride frequency (SF) at the end of each trotting interval. The HR increased to average values of 191 +/- 10,203 +/- 10 and 214 +/- 7 bpm and PLA increased to 3.8 +/- 0.7, 7.3 +/- 3.8 and 10.8 +/- 6.4 mmol/l at 9 m/s in the three tests, respectively. The HR response to exercise was significantly higher with increasing draught loads, and PLA was significantly higher with 30 kp compared to 10 kp draught resistance. The lowest respiratory rate was seen in the test with 30 kp loading. Peak oxygen uptake (VO2peak) was measured in a separate test on a sloped treadmill with increasing velocities without draught load and averaged 70.4 +/- 9.11/min. Muscle biopsies were taken from the gluteus muscle. Individual variations were seen in VO2peak, muscle fibre composition and HR and PLA responses to exercise. In conclusion, at a certain velocity a small increase in draught resistance from 10 to 30 kp significantly increases both the HR and PLA responses. At comparable work intensities the horses differed in circulatory and metabolic responses to exercise.
Modifiable Combining Functions
Cohen, Paul; Shafer, Glenn; Shenoy, Prakash P.
2013-01-01
Modifiable combining functions are a synthesis of two common approaches to combining evidence. They offer many of the advantages of these approaches and avoid some disadvantages. Because they facilitate the acquisition, representation, explanation, and modification of knowledge about combinations of evidence, they are proposed as a tool for knowledge engineers who build systems that reason under uncertainty, not as a normative theory of evidence.
DEFF Research Database (Denmark)
Andersen, Poul
1999-01-01
The paper deals with tip-modified propellers and the methods which, over a period of two decades, have been applied to develop such propellers. The development is driven by the urge to increase the efficiency of propellers and can be seen as analogous to fitting end plates and winglets to aircraft...... propeller, have efficiency increases of a reasonable magnitude in both open-water and behind-ship conditions....
Super boson-fermion correspondence
International Nuclear Information System (INIS)
Kac, V.G.; Leur van de, J.W.
1987-01-01
Since the pioneering work of Skyrme, the boson-fermion correspondence has been playing an increasingly important role in 2-dimensional quantum field theory. More recently, it has become an important ingredient in the work of the Kyoto school on the KP hierarchy of soliton equations. In the present paper we establish a super boson-fermion correspondence, having in mind its applications to super KP hierarchies
Köebner phenomenon induced by cupping therapy in a psoriasis patient.
Yu, Rui-Xing; Hui, Yun; Li, Cheng-Rang
2013-06-15
Psoriasis is a chronic, immune-mediated inflammatory and refractory disease. The koebner phenomenon, which can be induced by trauma, is common in psoriasis patients. Herein, we report a patient with psoriasis who was treated by cupping therapy and subsequently developed the koebner phenomenon (KP) at the cupped sites. To our knowledge, it is the first report about cupping therapy leading to KP in a psoriasis patient.
Specifications and Prototype of the Knowledge Repository (V.3.0) and the Knowledge Mediator (V.3.0)
Andreou, Dimitris; Christophides, Vassilis; Flouris, Giorgos; Kotzinos, Dimitris; Pediaditis, Panagiotis; Tsialiamanis, Petros
2009-01-01
This deliverable reports the technical and research development performed until M36 (January 2009) within tasks T5.2 and T5.4 of WP5 in the KP-Lab project, per the latest Description of Work (DoW) 3.2 [DoW3.2]. The described components are included in the KP-Lab Semantic Web Knowledge Middleware (SWKM) Prototype Release 3.0 software that takes…
Defluorination of drinking water using surfactant modified zeolites ...
African Journals Online (AJOL)
This study focused on the removal of fluoridefrom groundwater by employing surfactant modified zeolites (SMZ) synthesized using locallyavailable kaolin material as precursor. The zeolite synthesis involved calcination of kaolin, alkaline fusion and hydrothermal treatment. The final product was modified with 5g/L ...
Posa, Mihalj; Pilipović, Ana; Lalić, Mladena; Popović, Jovan
2011-02-15
Linear dependence between temperature (t) and retention coefficient (k, reversed phase HPLC) of bile acids is obtained. Parameters (a, intercept and b, slope) of the linear function k=f(t) highly correlate with bile acids' structures. Investigated bile acids form linear congeneric groups on a principal component (calculated from k=f(t)) score plot that are in accordance with conformations of the hydroxyl and oxo groups in a bile acid steroid skeleton. Partition coefficient (K(p)) of nitrazepam in bile acids' micelles is investigated. Nitrazepam molecules incorporated in micelles show modified bioavailability (depo effect, higher permeability, etc.). Using multiple linear regression method QSAR models of nitrazepams' partition coefficient, K(p) are derived on the temperatures of 25°C and 37°C. For deriving linear regression models on both temperatures experimentally obtained lipophilicity parameters are included (PC1 from data k=f(t)) and in silico descriptors of the shape of a molecule while on the higher temperature molecular polarisation is introduced. This indicates the fact that the incorporation mechanism of nitrazepam in BA micelles changes on the higher temperatures. QSAR models are derived using partial least squares method as well. Experimental parameters k=f(t) are shown to be significant predictive variables. Both QSAR models are validated using cross validation and internal validation method. PLS models have slightly higher predictive capability than MLR models. Copyright © 2010 Elsevier B.V. All rights reserved.
Beam aperture modifier design with acoustic metasurfaces
Tang, Weipeng; Ren, Chunyu
2017-10-01
In this paper, we present a design concept of acoustic beam aperture modifier using two metasurface-based planar lenses. By appropriately designing the phase gradient profile along the metasurface, we obtain a class of acoustic convex lenses and concave lenses, which can focus the incoming plane waves and collimate the converging waves, respectively. On the basis of the high converging and diverging capability of these lenses, two kinds of lens combination scheme, including the convex-concave type and convex-convex type, are proposed to tune up the incoming beam aperture as needed. To be specific, the aperture of the acoustic beam can be shrunk or expanded through adjusting the phase gradient of the pair of lenses and the spacing between them. These lenses and the corresponding aperture modifiers are constructed by the stacking ultrathin labyrinthine structures, which are obtained by the geometry optimization procedure and exhibit high transmission coefficient and a full range of phase shift. The simulation results demonstrate the effectiveness of our proposed beam aperture modifiers. Due to the flexibility in aperture controlling and the simplicity in fabrication, the proposed modifiers have promising potential in applications, such as acoustic imaging, nondestructive evaluation, and communication.
EDTA modified glassy carbon electrode: Preparation and characterization
International Nuclear Information System (INIS)
Ustuendag, Zafer; Solak, Ali Osman
2009-01-01
EDTA-phenoxyamide modified glassy carbon electrode (EDTA-GC) was prepared at a glassy carbon electrode by surface synthesis. In the first step, nitrophenyl was grafted to the glassy carbon (GC) surface via the electrochemical reduction of its tetraflouroborate diazonium salt. In the second step, nitrophenyl-modified electrode (NP-GC) was subjected to the cathodic potential scan to reduce the nitro to amine group. p-Aminophenyl modified glassy carbon electrode (AP-GC) was dipped into a EDTA solution containing 1-ethyl-3(3-(dimethlyamino)propyl)-carbodiimide (EDC) as an activating agent. Thus formed ((2-anilino-2-oxoethyl){2-[bis(carboxymethyl)amino]-ethyl}amino)acetic acid modified GC electrode was denoted as EDTA-GC and characterized by cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS), ellipsometry and X-ray photoelectron spectroscopy (XPS). Complexation of the EDTA-GC surface with Pb 2+ ions was investigated if this electrode could be used as a metal sensor.
Self-healing of polymer modified concrete
Directory of Open Access Journals (Sweden)
Abd_Elmoaty M. Abd_Elmoaty
2011-06-01
Full Text Available Self healing phenomenon of concrete has been observed in traditional, fibrous, self compacting concrete. This phenomenon occurred mainly due to the presence of unhydrated cement particles in the presence of water. Mechanism of polymer in concrete depends on creating a layer and net of polymer around cement particles which enhances the properties of polymer modified concrete. This mechanism may affect the self healing of this type of concrete. This work aims to study the presence of the self healing phenomenon in polymer modified concrete and the related parameters. An experimental investigation on self healing of polymer modified concrete was undertaken. In this research work, effect of polymer type, polymer dose, cement content, cement type, w/cm ratio and age of damage were studied. The healing process extended up to 60 days. Ultrasonic pulse velocity measurements were used to evaluate the healing process. Results indicated that, the self healing phenomenon existed in polymer modified concrete as in traditional concrete. The increase of polymer dose increases the healing degree at the same healing time. This increase depends on polymer type. Also, the decrease of w/cm ratio reduces the self healing degree while the use of Type V Portland cement improves the self healing process compared with Type I Portland cement. Cement content has an insignificant effect on healing process for both concrete with and without polymer. In addition, the increase of damage age decreases the efficiency of self healing process.
Modified silica sol coatings for surface enhancement of leather.
Mahltig, Boris; Vossebein, Lutz; Ehrmann, Andrea; Cheval, Nicolas; Fahmi, Amir
2012-06-01
The presented study reports on differently modified silica sols for coating applications on leather. Silica sols are prepared by acidic hydrolysis of tetraethoxysilane and modified by silane compounds with fluorinated and non-fluorinated alkylgroups. In contrast to many earlier investigations regarding sol-gel applications on leather, no acrylic resin is used together with the silica sols when applying on leather. The modified silica particles are supposed to aggregate after application, forming thus a modified silica coating on the leather substrate. Scanning electron microscopy investigation shows that the applied silica coatings do not fill up or close the pores of the leather substrate. However, even if the pores of the leather are not sealed by this sol-gel coating, an improvement of the water repellent and oil repellent properties of the leather substrates are observed. These improved properties of leather by application of modified silica sols can provide the opportunity to develop sol-gel products for leather materials present in daily life.