Directory of Open Access Journals (Sweden)
A. Sarmiento
2003-04-01
Full Text Available Objetivo: La desinfección del agua con cloro en las plantas de potabilización da lugar a la formación de trihalometanos (THM. Estos compuestos están asociados a efectos adversos para la salud. En este estudio se determinó la concentración de THM en el agua para consumo humano suministrada por las redes de distribución de los dos principales sistemas de potabilización de agua del Estado Carabobo, la planta Alejo Zuloaga y el embalse Pao-Cachinche que forman el Sistema Regional del Centro I (SRC-I y la planta Lucio Baldo Soules y el embalse Pao-La Balsa que forman el Sistema Regional del Centro II (SRC-II. Métodos: Se analizaron un total de 144 muestras recolectadas durante 6 muestreos que se realizaron durante los años 2000 y 2001. La concentración de THM se determinó por cromatografía de gases, mediante la técnica de headspace. Se determinaron las concentraciones para los siguientes THM: cloroformo (CHCl3, bromoformo (CHBr3, dibromoclorometano (CHBr2Cl y diclorobromometano (CHCl2Br. Resultados: La concentración de THM totales estuvo entre 47,84 y 93,23 μg/l. El CHCl3 fue el compuesto predominante, representando el 83% de total de THM para el SRC-I y el 82% en el SRC-II. Se encontró que las concentraciones de THM totales en el SRC-I (Red Baja y Red San Diego son significativamente superiores (p Objective: Disinfection of water with chlorine in water treatment plants leads to the formation of trihalomethanes (THMs. These compounds are associated with adverse health effects. The aim of this study was to analyze THM concentrations in the water provided for human consumption in the two main water treatment systems of Carabobo State: the Alejo Zuloaga plant and the Pao-Cachinche reservoir, which form the Central Regional System I (CRS I, and the Lucio Baldo Soules plant and the Pao-La Balsa reservoir, which form the Central Regional System II (CRS II. Methods: We analyzed 144 water samples collected in 6 samplings carried out in 2000
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Carlos F Linares1 Freddy Ocanto1 Pablo Bretto1 Maricela Monsalve1. Unidad de Síntesis de Materiales y Metales de Transición, Facultad de Ciencias y Tecnología, Departamento de Química, Universidad de Carabobo, Valencia, Edo. Carabobo, Apartado Postal 3336, Venezuela ...
African Journals Online (AJOL)
Edo Journal of Counselling, the official publication of Edo Chapter of Counselling ... The Mediating Impact of Personality and Socio-Economic Status in the ... Fostering Adolescents' Interpersonal Behaviour: An Empirical Assessment of ...
Investigación de trihalometanos en agua potable del Estado Carabobo, Venezuela
Directory of Open Access Journals (Sweden)
Sarmiento A.
2003-01-01
Full Text Available Objetivo: La desinfección del agua con cloro en las plantas de potabilización da lugar a la formación de trihalometanos (THM. Estos compuestos están asociados a efectos adversos para la salud. En este estudio se determinó la concentración de THM en el agua para consumo humano suministrada por las redes de distribución de los dos principales sistemas de potabilización de agua del Estado Carabobo, la planta Alejo Zuloaga y el embalse Pao-Cachinche que forman el Sistema Regional del Centro I (SRC-I y la planta Lucio Baldo Soules y el embalse Pao-La Balsa que forman el Sistema Regional del Centro II (SRC-II. Métodos: Se analizaron un total de 144 muestras recolectadas durante 6 muestreos que se realizaron durante los años 2000 y 2001. La concentración de THM se determinó por cromatografía de gases, mediante la técnica de headspace. Se determinaron las concentraciones para los siguientes THM: cloroformo (CHCl3, bromoformo (CHBr3, dibromoclorometano (CHBr2Cl y diclorobromometano (CHCl2Br. Resultados: La concentración de THM totales estuvo entre 47,84 y 93,23 μg/l. El CHCl3 fue el compuesto predominante, representando el 83% de total de THM para el SRC-I y el 82% en el SRC-II. Se encontró que las concentraciones de THM totales en el SRC-I (Red Baja y Red San Diego son significativamente superiores (p < 0,05 con respecto a la concentración máxima permisible establecida por la Agencia de Protección Ambiental de los EE.UU. (80 μg/l para el total de los cuatro THM. Conclusiones: Los resultados demuestran que en la zona de estudio existe un riesgo de efectos adversos para la salud por la presencia de THM en agua de consumo humano, especialmente en la Red Baja y Red San Diego del SRC-I.
Archives: Edo Journal of Counselling
African Journals Online (AJOL)
Items 1 - 6 of 6 ... Archives: Edo Journal of Counselling. Journal Home > Archives: Edo Journal of Counselling. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. 1 - 6 of 6 Items. 2011 ...
Prevalence of onchocerciasis in Edo State, Nigeria | Onowhakpor ...
African Journals Online (AJOL)
Objective: To determine the prevalence of onchocerciasis in endemic areas in Edo State,Nigeria. Methodology: A descriptive cross-sectional study was conducted among 658 respondents residing in onchocerciasis endemic areas of Edo State using a pre-tested interviewers' administered questionnaire and examination of ...
Paisaje del viñedo: patrimonio y recurso
Directory of Open Access Journals (Sweden)
Luis Vicente Elías
2008-01-01
Full Text Available La propuesta de que el paisaje del viñedo sea el complemento a la visita a la bodega, siendo esta el eje del turismo del vino, es el objetivo de este trabajo. Repasando los conceptos variables de patrimonio, llegamos al paisaje del viñedo como recurso, formando parte del patrimonio natural. Pero este no se puede desvincular de los otros aspectos patrimoniales, por lo que la cultura tradicional es el soporte de la tipología de paisaje que queremos proponer y que va contrastar con los nuevos paisajes del viñedo que surgen de las recientes técnicas en los cultivos y de la actual vitivicultura, emparejada con una moderna cultura del vino. El análisis de las diversas normativas, que salvaguardan el paisaje y la comprobación del escaso valor legal del paisaje del viñedo, es otro puntal de este trabajo que trata de unir paisaje con cultura tradicional como recursos del Turismo del Vino, integrados en las Rutas del Vino.
ECONOMIC DENIAL OF SUSTAINABILITY (EDOS ATTACK ON CLOUD – A SURVEY
Directory of Open Access Journals (Sweden)
A. Somasundaram
2016-12-01
Full Text Available Cloud computing is a promising technology aims to provide reliable, customized and quality of service computation environments for cloud users in terms of Software as a Service-SaaS , Plat- form as a Service-PaaS and Infrastructure as Service-IaaS, which is provided on the pay per use basis. Cloud computing enables services to be deployed and accessed globally on demand with little maintenance by providing QoS as per service level agreement (SLA of customer. However, due to elasticity of resources, cloud systems are facing severe security problems. One of the most serious threats to cloud computing is EDoS (economic Distributed Denial of Service aims to consume the cloud resource by attacker and impose financial burden to the legitimate user, where integrity, availability and confidentiality of the cloud services are never compromised but affects the accountability which leads to inaccurate billing. Since the billing models of cloud services may not be mature enough to properly account for an EDoS attack. These paper surveys, the different techniques that generate, detect and mitigate the EDoS Attack on Cloud.
Wagner, Tom
2010-01-01
The ceremonial copper and iron bells at the Smithsonian's National Museum of African Art were the author's inspiration for an interdisciplinary unit with a focus on the contributions various cultures make toward the richness of a community. The author of this article describes an Edo bell-inspired ceramic project incorporating slab-building…
High Lassa Fever activity in Northern part of Edo State, Nigeria ...
African Journals Online (AJOL)
The purpose was to establish simple statistics of the effects of lassa fever in northern part of Edo State, Nigeria. Lassa fever activity in the northern part of Edo state, Nigeria, was confirmed in 2004 by laboratory analysis of samples sent to Bernhard–Nocht Institute (BNI) for Tropical Medicine Hamburg, Germany.
Non-Formal education in astronomy: The experience of the University the Carabobo
Falcón, Nelson
2011-06-01
Since 1995, the University the Carabobo, in Venezuela, has come developing a program of astronomical popularization and learning Astronomy using the Non formal education methods. A synopsis of the activities is presented. We will also discuss some conceptual aspects about the extension of the knowledge like supplementary function of the investigation and the university teaching. We illustrate the characteristics of the communication with an example of lectures and printed material. The efficiency of the heuristic arguments could be evaluated through a ethnology study. In that order of ideas, we show some images of the activities of astronomical popularization. We can see the population and great concurrence with chronological (and cultural) heterogeneity. We conclude that the Non formal education, structured with characteristic different to the usual educational instruction, constitutes a successful strategy in the diffusion and the communicating astronomy.
75 FR 38412 - Safety Zone; San Diego POPS Fireworks, San Diego, CA
2010-07-02
...-AA00 Safety Zone; San Diego POPS Fireworks, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary... waters of San Diego Bay in support of the San Diego POPS Fireworks. This safety zone is necessary to... San Diego POPS Fireworks, which will include fireworks presentations conducted from a barge in San...
76 FR 45693 - Safety Zone; San Diego POPS Fireworks, San Diego, CA
2011-08-01
...-AA00 Safety Zone; San Diego POPS Fireworks, San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Temporary... San Diego Bay in support of the San Diego POPS Fireworks. This safety zone is necessary to provide for... of the waterway during scheduled fireworks events. Persons and vessels will be prohibited from...
An evaluation of electron diamond type EDO2E and EDO3 diamond radiation detectors
International Nuclear Information System (INIS)
Poole, D.A.; Wilson, R.
1977-12-01
Observations on the response of two d.c. mode (EDO2E) and three pulse mode (EDO3) diamond probes to beta and gamma radiation are reported. In the d.c. mode, response to gamma exposure rates from 1 R h -1 to >6x10 4 R h -1 were measured, currents of approximately 5x10 -13 A and approximately 3x10 -9 A respectively at 20 0 C being observed. The dark current was approximately 3x10 -13 A at 20 0 C and doubled for every 3 to 4 0 C temperature rise. In the pulse mode the count rate was approximately linear with gamma exposure rate from 10 mR h -1 to > 300 R h -1 . The detection of beta particles was limited to energies > or approximately equal 0.8 MeV. Over the temperature range -5 0 C to 50 0 C the count rate for one probe increased by a factor of 1.25 whereas a second probe showed a decrease of 1.4. There is scope for major improvement of diamond detectors as reported by Kozlov et al (1977a) who have eliminated certain undesirable effects by careful selection and the provision of special electrodes. (author)
Factors influencing breastfeeding practices in Edo state, Nigeria ...
African Journals Online (AJOL)
In Nigeria however, young infants may not benefit from such a practice as a ... The purpose of this study was to determine factors influencing breastfeeding practices in Edo State, Nigeria. ... Only 20 per cent practiced exclusive breastfeeding.
phytoplankton diversity indices of Osse River, Edo State, Nigeria
African Journals Online (AJOL)
USER
The phytoplankton diversity indices of Osse River, Edo State, Nigeria, were investigated monthly from January ... In terms of abundance, Bacillariophyceae had the highest distribution of phytoplankton (79.00%), ...... erosion beach in Lagos.
Simulación basada en SMA de sistemas originalmente representados con EDO
Directory of Open Access Journals (Sweden)
Ekaitz Zulueta Guerrero
2011-10-01
Full Text Available Resumen: En el presente trabajo se expone una metodología para modelar mediante un Sistema Multi-Agente (SMA sistemas biológicos y fisiológicos dinámicos con variables cuantificadas discretas, como el crecimiento y decrecimiento de poblaciones o el modelado epidemiológico de enfermedades. Se muestra un procedimiento para transformar un sistema de Ecuaciones Diferenciales Ordinarias (EDO (que modela un entorno de forma correcta en un SMA equivalente mediante un esquema basado en el método de Monte Carlo. Se utiliza un caso práctico fundamentado en un modelo matemático de Leucemia Mieloide Crónica (LMC para comparar la metodología basada en agentes con el modelado tradicional basado en un sistema de EDO. Se realiza una simulación con cada modelo (SMA y EDO y se compara los resultados obtenidos con ambas metodologías. Palabras clave: Ecuaciones diferenciales, modelo basado en agentes, Monte Carlo
Structure, conduct and performance of Plantain Marketing in Edo ...
African Journals Online (AJOL)
Structure, conduct and performance of Plantain Marketing in Edo State, Nigeria. ... marketing system, assess its performance and estimate the cost and returns in plantain marketing. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
The European Drought Observatory (EDO): Current State and Future Directions
Vogt, Jürgen; Sepulcre, Guadalupe; Magni, Diego; Valentini, Luana; Singleton, Andrew; Micale, Fabio; Barbosa, Paulo
2013-04-01
Europe has repeatedly been affected by droughts, resulting in considerable ecological and economic damage and climate change studies indicate a trend towards increasing climate variability most likely resulting in more frequent drought occurrences also in Europe. Against this background, the European Commission's Joint Research Centre (JRC) is developing methods and tools for assessing, monitoring and forecasting droughts in Europe and develops a European Drought Observatory (EDO) to complement and integrate national activities with a European view. At the core of the European Drought Observatory (EDO) is a portal, including a map server, a metadata catalogue, a media-monitor and analysis tools. The map server presents Europe-wide up-to-date information on the occurrence and severity of droughts, which is complemented by more detailed information provided by regional, national and local observatories through OGC compliant web mapping and web coverage services. In addition, time series of historical maps as well as graphs of the temporal evolution of drought indices for individual grid cells and administrative regions in Europe can be retrieved and analysed. Current work is focusing on validating the available products, developing combined indicators, improving the functionalities, extending the linkage to additional national and regional drought information systems and testing options for medium-range probabilistic drought forecasting across Europe. Longer-term goals include the development of long-range drought forecasting products, the analysis of drought hazard and risk, the monitoring of drought impact and the integration of EDO in a global drought information system. The talk will provide an overview on the development and state of EDO, the different products, and the ways to include a wide range of stakeholders (i.e. European, national river basin, and local authorities) in the development of the system as well as an outlook on the future developments.
Determinants of Revenue Derived from Pineapple Marketing in Edo ...
African Journals Online (AJOL)
Determinants of Revenue Derived from Pineapple Marketing in Edo State, Nigeria. ... The results showed that an average pineapple marketer has a mean volume of 98 dozens and incurred a variable ... EMAIL FULL TEXT EMAIL FULL TEXT
Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria
Rashidi Akanji Okunola; Adediran Daniel Ikuomola
2016-01-01
Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature...
76 FR 1386 - Safety Zone; Centennial of Naval Aviation Kickoff, San Diego Bay, San Diego, CA
2011-01-10
...-AA00 Safety Zone; Centennial of Naval Aviation Kickoff, San Diego Bay, San Diego, CA AGENCY: Coast... zone on the navigable waters of San Diego Bay in San Diego, CA in support of the Centennial of Naval... February 12, 2010, the Centennial of Naval Aviation Kickoff will take place in San Diego Bay. In support of...
Investigation of Ojirami reservoir, Akoko-Edo, Southsouth, Nigeria ...
African Journals Online (AJOL)
Ojirami Reservoir was constructed between 1971 and 1974 for the purpose of supplying potable water to Edo North senatorial zone, Nigeria. The reservoir is aging, with evidence of siltation but relatively free of any anthropogenic activities. A study was carried out between January 2009 and December 2010 to monitor the ...
Anion size and isotope effects in (EDO-TTF)2XF6
International Nuclear Information System (INIS)
Nakano, Yoshiaki; Yamochi, Hideki; Saito, Gunzi; Uruichi, Mikio; Yakushi, Kyuya
2009-01-01
(EDO-TTF) 2 PF 6 is a quasi one-dimensional molecular conductor and undergoes a peculiar metal-insulator (MI) transition. The phase transition mechanism is cooperative among Peierls, charge ordering, and anion ordering transitions, which is accompanied with a distinct molecular deformation. (EDO-TTF) 2 XF 6 (X = P (1h), As (2h), Sb (3h)) showed that the transition temperature (T MI ) and the width of thermal hysteresis (ΔT MI ) were systematically changed depending on the anion size, i.e., the T MI decreased in order of 279.0 K (1h), 270.8 K (2h), and 242 K (3h) and the ΔT MI increased in order of 1.0 K (1h), 5.5 K (2h), and 14 K (3h). The deuterated salts, (EDO-TTF-d 2 ) 2 XF 6 (X = P (1d) and As (2d)), showed higher T MI of 282.0 (1d) and 274.0 K (2d) and narrower ΔT MI of 0.0 (1d) and 5.0 K (2d) than the undeuterated 1h and 2h, respectively. X-ray analysis revealed the anisotropic thermal expansion of unit cell. The linear relationship between ΔT MI and volume change at T MI was found.
Challenges of Local Government Administration in Edo State of ...
African Journals Online (AJOL)
This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.
Socio-economic characteristics of registered cocoa farmers in Edo ...
African Journals Online (AJOL)
This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; Nigeria. Primary data was collected using a well structured questionnaire administered to 180 registered cocoa farmers selected using a multi-stage sampling technique. Data were analyzed using descriptive statistics and ...
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria.
African Journals Online (AJOL)
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. ... Agricultural marketing involves numerous lines of activities, which if well developed can sustain livelihood. It is in line with this ... EMAIL FULL TEXT EMAIL FULL TEXT
Gender issues in human trafficking in Edo State, Nigeria | Osezua ...
African Journals Online (AJOL)
Gender issues in human trafficking in Edo State, Nigeria. ... in order to capture family dynamics and power relations and women status in ... The paper concluded that efforts targeted towards eradicating existing gender inequality in the region ...
Human ecotoparasitoses among some rural dwellers in Edo State ...
African Journals Online (AJOL)
Studies on clinical and epidemiological aspects of human ectoparasites among some rural dwellers in Edo State Nigeria were carried out between September 2002 and August 2003. A total of 910 subjects who had complained of having been infested by arthropod parasites were enrolled for this study. The study ...
Chemical Compositions of Soils in Parts of Edo State, Southwest ...
African Journals Online (AJOL)
MICHAEL HORSFALL
www.bioline.org.br/ja. Chemical Compositions of Soils in Parts of Edo State, Southwest Nigeria and their ... the soil in agriculture and engineering (Imasuen et al. 1989b). Clay mineral ..... Unpublished Ph.D. Thesis, The. University of Western ...
Economic analysis of honey production in Edo State, Nigeria ...
African Journals Online (AJOL)
This research work was carried out to analyze the economics of honey production in Edo State. The objectives of the study were to examine the demographic characteristics of honey production, assess the profitability of honey bee and the problems facing honey production .The list of honey farmers in the state was ...
DROP OUT FROM SCHOOL AMONG GIRLS IN EDO STATE ...
African Journals Online (AJOL)
Elizabeth
this paper is to investigate why girls dropout from school in Edo State. The descriptive survey ... women. It allows them greater control of their lives and provides them with skills to ... in an attempt to protect their teenage daughters, give them out to wealthy old friends. .... Counselling intervention for gender equality. A paper.
Physio-Chemical Analysis of Industrial Effluents in parts of Edo ...
African Journals Online (AJOL)
Physio-Chemical Analysis of Industrial Effluents in parts of Edo States Nigeria. ... Journal of Applied Sciences and Environmental Management ... particularly, surface water results from all activities of man involving indiscriminate waste disposal from industry such as effluents into waterways, waste, agricultural waste, and all ...
Determinants of Rural Development in Edo State, Nigeria: An ...
African Journals Online (AJOL)
About 70% of the total population in Nigeria lives in the rural areas, while half of this population is without proper-formal education (World Bank 2005). Data for this study which is on the Determinants of rural Development in Edo State, Nigeria were collected through the primary and secondary sources. Primary data were ...
Economic Potential of Taungya Farming System in Edo State, Nigeria
African Journals Online (AJOL)
The study examined the economic potential of taungya system in Edo state, using of data obtained from both primary and secondary sources with the aid of well structured questionnaires administered to 230 respondents in eight the Local Government Areas practicing taungya farming in government reserved forests.
Vicissitudes of Edo State Council for Arts and Culture Performing ...
African Journals Online (AJOL)
Abstract. The ding-dong charade of Edo State Council for Arts and Culture Performing Troupe (ESCFAACPT) cannot be divorced from the vacillating condition the establishment had been experiencing since its establishment. This condition is fore-grounded, first, on the cacophony of nomenclature that the council had been ...
Assessment of groundwater quality of Benin City, Edo state, Nigeria ...
African Journals Online (AJOL)
The quality of groundwater of Benin City, Edo State, Nigeria was investigated between February and July 2008. Water samples were collected from functional bore holes from five locations (stations 1 – 5) and analyzed for physico-chemical parameters including heavy metals. Data obtained were compared with World ...
75 FR 15611 - Safety Zone; United Portuguese SES Centennial Festa, San Diego Bay, San Diego, CA
2010-03-30
...-AA00 Safety Zone; United Portuguese SES Centennial Festa, San Diego Bay, San Diego, CA AGENCY: Coast... navigable waters of the San Diego Bay in support of the United Portuguese SES Centennial Festa. This... Centennial Festa, which will include a fireworks presentation originating from a tug and barge combination in...
Evolución del e-gobierno en la Alcaldía del Municipio Naguanagua, estado Carabobo: período 2004-2014
Lubiza Osio; Pedro Luis Pineda
2015-01-01
El presente artículo, tiene como objetivo realizar una comparación evolutiva, sobre los avances del gobierno electrónico en el área específica de los servicios disponibles a través de la página Web de la Alcaldía de Naguanagua, estado Carabobo, durante el periodo comprendido entre el año 2004 y el año 2014. Su fundamentación se basó en el análisis de datos provenientes de dos investigaciones de las cuales, se precisó el avance sobre el e-gobierno en dos momentos: año 2004 y 2007, en el contex...
Loaisis in Edo State, Nigeria | Mordi | Journal of Medicine and ...
African Journals Online (AJOL)
The inaccessibility of the arthropod vector to humans could be advanced for the low prevalence of the disease in the state. The socio-cultural and economic factors, which predisposed to infection, were discussed as part of control measures. Keywords: Loaisis, Prevalence, Loa Loa, Edo State Nigeria Journal of Medicine ...
The Prevalence of Malaria in Edo State, Nigeria | Mordi | Nigerian ...
African Journals Online (AJOL)
This study determined the prevalence of malaria in Edo State, Nigeria. The study was cross-sectional, and lasted one year. Children of school ages participated in the study. Detection of malaria parasites was through thick blood film with Giemsa stain. There was a predilection for infection for children less than ten years.
Students Perception of Cyber Crime in Edo State: Implications for ...
African Journals Online (AJOL)
The study determined the perception of students toward committing cyber crime the study will determine the level of success and the gender mostly prone to commit this crime. The study employed the use of descriptive survey to find out students perception towards cyber crime in Edo State. A sample of 500 students ...
(Recognizing Mondoñedo: The Past Projects Itself as Future
Directory of Open Access Journals (Sweden)
Freire Paz, Elena
2009-12-01
Full Text Available The author approaches the current socio-cultural reality in the town of Mondoñedo (province of Lugo, Galicia, Spain by considering the rapid economic, social and cultural changes that have taken place there over the past few decades. Whereas from an outside perspective the global economic process has resulted in the transformation of certain cultural patterns everywhere, the changes occurred inside any cultural system have brought about the inception of an interesting strategy of a clearly cultural character. Local development in Mondoñedo nowadays rests on making the most of specific cultural resources so as to prompt and energize an area affected by a sharp population decline. The current context also includes the loss of the town’s provincial hegemony to Lugo, the capital, the demise of primary activities and the meagre implementation of secondary activities.
La autora se acerca a la realidad socio-cultural actual creada en Mondoñedo, ciudad del interior de la provincia de Lugo (Galicia, España, teniendo en cuenta las bruscas transformaciones económicas, sociales y culturales acontecidas en las últimas décadas. Si, desde una perspectiva externa, el movimiento económico global ha motivado la transformación de determinadas pautas culturales en todo el mundo, los cambios propiciados desde el interior de cualquier sistema cultural han repercutido en la génesis de una interesante planificación de marcado carácter cultural. El desarrollo local de la zona gira en torno al aprovechamiento de determinados recursos culturales como impulsores y dinamizadores de un territorio estrangulado por un fuerte descenso poblacional, la pérdida de consideración hegemónica de la villa frente a la capitalidad de la provincia, el abandono del sector primario y la escasez de actividades del sector secundario.
Human Trafficking in Edo State (Nigeria): A Socio- Economic Study ...
African Journals Online (AJOL)
The essay is derived from a field study executed in 2009. Its focus is on. Benin City inhabited mostly by the Bini group although other groups like the Ishan, Etsako, Akoko-Edo, and Owan are also well represented. It is generally believed that Bini girls/women dominate the sex export to. Europe through human trafficking.
77 FR 34988 - Notice of Inventory Completion: San Diego State University, San Diego, CA
2012-06-12
.... ACTION: Notice. SUMMARY: San Diego State University Archeology Collections Management Program has... that believes itself to be culturally affiliated with the human remains and associated funerary objects may contact San Diego State University Archeology Collections Management Program. Repatriation of the...
Aloanticorpo anti-Diego (a em gestante Anti-Diego (a alloantibody in pregnant
Directory of Open Access Journals (Sweden)
Célia R. G. Silva
2004-12-01
Full Text Available O sistema de grupo sangüíneo Diego é composto principalmente por dois antígenos Diegoª (Diª e Diego b (Di b. A prevalência de Diª na população caucasóide é rara com uma freqüência de aproximadamente de 0,02%, podendo gerar anticorpos que são clinicamente significantes em medicina transfusional e neonatal. O presente estudo relata anti-Diª em gestante caucasóide detectado nos exames realizados no pré-parto por meio do teste indireto de antigamaglobulina humana. Na amostra de sangue de cordão foi realizado o teste de antigamaglobulina direto e o resultado foi negativo, o fenótipo do recém-nascido revelou Di (a - b +; portanto, a criança não desenvolveu doença hemolítica perinatal. O estudo fenotípico realizado em toda a família revelou que a sensibilização materna provavelmente ocorreu na segunda gestação gemelar onde as duas crianças demonstraram a presença de antígeno Diª adquirido por herança paterna.The Diego blood group system is composed of two principal antigens Diegoª (Diª and Diego b (Di b. In the Caucasian population the prevalence of Diª is rare with a frequency of about 0.02% and can lead to the production of antibodies that are important in newborn babies and in transfusional medicine. The present study reports on anti-Diª antibodies in a Caucasian pregnant woman, detected by indirect anti-globulin testing shortly before delivery. The direct anti-globulin test of the newborn's blood cord was negative because its phenotype was Di (a- b+. So the newborn did not develop any hemolytic diseases. A phenotyping study of the whole family was performed which revealed that probably the mother became sensitive during her second pregnancy of twins where the two children presented with the Diª antigen phenotype inherited from the father.
Manifestation of the Kabuki actors’ gender in woodblock prints of the Edo Period
Directory of Open Access Journals (Sweden)
Beata ROMANOWICZ
2015-06-01
Full Text Available The connection between Kabuki theatre and Japanese woodblock prints of the Edo period (1603–1868, especially in their portraits of actors called yakusha‑e, offers an exceptional opportunity to analyse perceptions of the sex of the actor: as the hero of the drama, as well as the character performed on the stage. Both phenomena flourished in the Edo period and had a crucial impact on the visual art of the time, inspiring pictures of the Floating World (Jap. Ukiyo‑e. The images on Ukiyo‑e woodblock prints serve as a pretext for approaching the matter of whether to portray an actor as a performer (a man or as the character performed by him (which could also be a woman, as in the case of the onnagata actor. The author focuses on the actors’ identification with their own sex (only men appeared on the Kabuki stage and on cases of breaking the convention between the real actor and his stage emploi. In the first part, the paper discusses the historical background of Kabuki theatre, which was invented by a woman (Izumo‑no Okuni and then after a few government edicts, was allowed to be performed on the stage only by adult men. Since the Kabuki tradition has successfully continued until today, apart from surveys of theatrical archives, the author supports her arguments by also referring to contemporary phenomena, especially the Kabuki performances she has watched in Japan (in such theatres as: Kabuki‑za, Minami‑za, the National Theatre in Tokyo, and Zenshin‑za, and through interviews with actors and people of the theatre. In parallel, Ukiyo‑e images of the Edo period are studied, with core research from the National Museum in Kraków, Poland, and its collection of Japanese woodblock prints (including over 4600 original works from the Edo Period, and with special attention paid to the yakusha‑e portrait by Utagawa Kuniyoshi.
The pain of labour: Perspectives of traditional birth attendants in Edo ...
African Journals Online (AJOL)
Objective: To determine the concept of labour pain and its relief in a cultural setting using the perspectives of Traditional Birth Attendants (TBAs). Design: Cross Sectional Comparative Study. Setting: An urban area (Benin City) and a semi-urban town (Auchi) in Edo State, Nigeria. Subjects: Traditional Birth Attendants in an ...
Prevalence of diseases among sheep and goats in Edo State, Nigeria
African Journals Online (AJOL)
Clinical records of small ruminant (Sheep and Goat) diseases treated were collected from the veterinary clinics, Ministry of Agriculture and Natural Resources of three Local Government areas in Edo state, for a period of five years (1997-2002). To identify the disease occurrence and prevalence as it militates against the ...
EOS Operations Systems: EDOS Implemented Changes to Reduce Operations Costs
Cordier, Guy R.; Gomez-Rosa, Carlos; McLemore, Bruce D.
2007-01-01
The authors describe in this paper the progress achieved to-date with the reengineering of the Earth Observing System (EOS) Data and Operations System (EDOS), the experience gained in the process and the ensuing reduction of ground systems operations costs. The reengineering effort included a major methodology change, applying to an existing schedule driven system, a data-driven system approach.
Efficiency of resource-use in Cassava production in Edo state, Nigeria
African Journals Online (AJOL)
This study employed the use of the Maximum Likelihood Estimation Technique in estimating the efficiency of resource-use in cassava production in Edo State. Data used for the study were sourced through the cost-route method of data collection, based on a stratified random sampling technique. The average farm size of ...
Youth sexuality and youth age at first sexual intercourse in Edo ...
African Journals Online (AJOL)
... significant (p>0.05), using the chi-square statistic. Finally, it is advocated that such information is important to stakeholders for helping the youth who would certainly not be able to face the challenges of adulthood when they engage in early sexual activity. Keywords: Youth, Sexuality, Age, Sexual Intercourse, Edo Central ...
Poultry production constraints: the case of Esan West LGA of Edo ...
African Journals Online (AJOL)
Poultry production constraints: the case of Esan West LGA of Edo State, Nigeria. ... They also identified the lack of good quality water, and proper marketing outlets. High cost and at times ... By so doing, their resources `can be pooled together for meaningful development of their farms and the poultry industry in general.
78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA
2013-08-29
... this rule because the logistical details of the San Diego Bay triathlon swim were not finalized nor... September 22, 2013. (c) Definitions. The following definition applies to this section: Designated...
Quality of life among female workers in edo state: consideration of ...
African Journals Online (AJOL)
This study examined the role of age, marital status and job-type on quality of Life amonge female workers in Edo State (N =188). Results from t-test revealed that female teachers reported better quality of life than female police officer, married female workers reported better quality of life than single female workers, while ...
Costs and return analysis in rubber latex production in Edo State ...
African Journals Online (AJOL)
The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.
Sino-Japanese Interaction via Chinese Junks in the Edo Period
MATSUURA, Akira
2010-01-01
To maintain its policy of national isolation during the Edo period, Japan restricted contact with the outside world to Dutch merchant ships and Chinese junks at the Japanese port of Nagasaki. Sino-Japanese interaction consisted not only of trade in goods, but also of cultural and scholarly exchanges. This paper will examine how this unofficial trade affected both Japan and China from a cultural perspective.
77 FR 42649 - Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA
2012-07-20
... 1625-AA00 Safety Zone: Sea World San Diego Fireworks, Mission Bay; San Diego, CA AGENCY: Coast Guard... authorized by the Captain of the Port, or his designated representative. DATES: This rule is effective from 8... to ensure the public's safety. B. Basis and Purpose The Ports and Waterways Safety Act gives the...
Mathematics Teachers' Use of Ethnomathematics Approach in Mathematics Teaching in Edo State
Aikpitanyi, Lucky Aiwuyor; Eraikhuemen, Lucy
2017-01-01
The study investigated mathematics teachers' use of ethnomathematics approach to teaching. Descriptive survey research was used with a target population of all mathematics teacher in all public secondary schools in Oredo, Egor and Ikpoba-Okha local government areas of Edo State out of which 121 mathematics teachers in 42 randomly selected public…
Insectos de importancia forense en cadáveres de ratas, Carabobo - Venezuela
Directory of Open Access Journals (Sweden)
Jonathan Liria Salazar
2006-01-01
Full Text Available Objetivos: Determinar la composición de la entomofauna asociada con cadáveres de ratas, para identificar las especies de importancia forense en Carabobo, Venezuela. Materiales y métodos: Se estudiaron los insectos en nueve cadáveres de ratas de laboratorio. Diariamente cada rata (cadáver + bandeja con tierra de sustrato fue recogida para obtener la fauna asociada. Con los datos de abundancias se calcularon índices de diversidad y equidad, y se empleó el análisis de componentes principales. Resultados: Se colectaron 13 590 insectos, de los cuales 14,8% correspondieron a cadáveres y 85,2% a bandejas. El orden Diptera fue el más abundante (94,2% seguido por Coleóptera e Hymenóptera (0,2%. Las especies de Diptéra más importantes fueron: Calliphoridae: Lucilia cluvia (Walker, Chrysomya albiceps (Wiedemann y C. megacephala (Fabricius; y Muscidae: Musca domestica Linnaeus. También se encontraron algunos coleópteros como Dermestes ater DeGeer (Dermestidae y Staphylinidae. Conclusiones: La equidad y diversidad fue baja, debido a la dominancia de especies, y la poca sensibilidad de los índices de diversidad a la presencia de especies raras. Se observó la sucesión de especies en donde L. cluvia se relaciona con los primeros días, seguida por C. albiceps y C. megacephala. Se recomienda continuar con estudios relacionados, para su uso como herramienta de ayuda en la medicina legal en Venezuela.
Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics.
Hsieh, Sheng-Hsun; Li, Yung-Hui; Tien, Chung-Hao
2016-11-25
For many practical applications of image sensors, how to extend the depth-of-field (DoF) is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known "extended DoF" (EDoF) technique, or "wavefront coding," by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.
An exploration of life experiences of left behind wives in Edo State, Nigeria
Directory of Open Access Journals (Sweden)
Adediran Daniel Ikuomola
2015-06-01
Full Text Available Research emphasising effects of migration on left behind families often focus on implications of absent fathers, particularly in Africa and areas with historic male migration. Yet, information on the experiences of left behind wives in a patriarchal and familial setting is scanty. This Study explore the socio-cultural challenges facing wives of migrants (Bini women, in Edo State, Nigeria. Specifically it examines the stigmatised experiences and the effect of cultural constrains on women adjustment to life in the absence of their husbands. Drawing on qualitative data collected from in-depth interviews with twenty-one (21 left-behind wives in Benin, Edo State. The study shows how women are confronted with traditions and the need to readjust their lives amidst cultural and familial cooperations and constrains. Narratives buttressed on the excessive surveillance through significant others and the renegotiation of living arrangements based on patriarchal values and expectations. Life adjustment was described as stigmatic, hectic and demanding in maintaining the home front.
A study of blood and gastro-intestinal parasites in Edo state | Mordi ...
African Journals Online (AJOL)
A four-year study to determine the prevalence of both blood and gastro-intestinal parasites of man was done in all the eighteen local government areas of Edo State, Nigeria. The study, which commenced in January of 2000, ended in December of 2004. Of the 136,360 samples examined, 1000 that is 0.7% had parasites.
California Clean Air Act: A compliance strategy for the City of San Diego`s non-emergency fleet
Energy Technology Data Exchange (ETDEWEB)
1992-12-31
Historically, parts of California have had the worst air quality in the nation. The California Energy Commission began experimenting with alternate fuels in the 1970`s in an effort to reduce harmful automobile emissions and hence, improve air quality. It is recognized that the costs to California which result from our air quality problems are immense. Ten to twenty billion dollars each year is the estimated damage in terms of health impacts, materials damages, lost agricultural crop output and forest damages. As the California population increases and health care costs escalate, the total monetary damages from air pollution will increase. The California Energy Commission goal to improve air quality became a mandate in 1988 with the passage of the California Clean Air Act (CCAA). The CCAA requires a revised air quality strategy for the San Diego district since we do not meet State air quality standards for smog, carbon monoxide and nitrogen dioxide. Smog remains San Diego`s major air quality problem, even though the annual number of days each year over the Federal standard has been reduced by 55 percent in the past ten years. Ten years ago about two-thirds of San Diego`s smog was transported from Los Angeles. Today more than 60 per cent of the days San Diego exceeds the State standard are from locally generated smog. It is estimated that 57% of the reactive hydrocarbon emissions (which react with nitrogen dioxide in the presence of sunlight to form smog) is from cars, trucks and buses. The Air Pollution Control District (part of the County of San Diego) is the office that the Air Resources Board has put in charge of creating regulations and designing strategy to reduce polluting emissions. The purpose of this project is to determine the full cost of acquiring and operating a municipal fleet which meets the mandates of the California Clean Air Act. With that information, a plan to meet the Clear Air Act (CCAA) requirements can be formulated by local government.
Test of the Practicality and Feasibility of EDoF-Empowered Image Sensors for Long-Range Biometrics
Directory of Open Access Journals (Sweden)
Sheng-Hsun Hsieh
2016-11-01
Full Text Available For many practical applications of image sensors, how to extend the depth-of-field (DoF is an important research topic; if successfully implemented, it could be beneficial in various applications, from photography to biometrics. In this work, we want to examine the feasibility and practicability of a well-known “extended DoF” (EDoF technique, or “wavefront coding,” by building real-time long-range iris recognition and performing large-scale iris recognition. The key to the success of long-range iris recognition includes long DoF and image quality invariance toward various object distance, which is strict and harsh enough to test the practicality and feasibility of EDoF-empowered image sensors. Besides image sensor modification, we also explored the possibility of varying enrollment/testing pairs. With 512 iris images from 32 Asian people as the database, 400-mm focal length and F/6.3 optics over 3 m working distance, our results prove that a sophisticated coding design scheme plus homogeneous enrollment/testing setups can effectively overcome the blurring caused by phase modulation and omit Wiener-based restoration. In our experiments, which are based on 3328 iris images in total, the EDoF factor can achieve a result 3.71 times better than the original system without a loss of recognition accuracy.
Mammal Track Counts - San Diego County [ds442
California Natural Resource Agency — The San Diego Tracking Team (SDTT) is a non-profit organization dedicated to promoting the preservation of wildlife habitat in San Diego County through citizen-based...
77 FR 46115 - Notice of Inventory Completion: San Diego Museum of Man, San Diego, CA
2012-08-02
...The San Diego Museum of Man has completed an inventory of human remains in consultation with the appropriate Indian tribe, and has determined that there is a cultural affiliation between the human remains and a present-day Indian tribe. Representatives of any Indian tribe that believes itself to be culturally affiliated with the human remains may contact the San Diego Museum of Man. Repatriation of the human remains to the Indian tribe stated below may occur if no additional claimants come forward.
Attitude of Local Dwellers towards Ecotourism in the Okomu National Park, Edo State Nigeria
Directory of Open Access Journals (Sweden)
Digun-Aweto Oghenetejiri
2015-12-01
Full Text Available Ensuring local community support for national parks is viewed as a paramount ingredient for conservation and sustainability. This is advocated for the park to meet its conservation goals. The Okomu National Park (ONP, Edo State, Nigeria, is one of such protected areas of lush green rain forest requiring conservation.
2011-11-14
... River Estuary Restoration Project, South San Diego Bay Unit of the San Diego Bay National Wildlife...), intend to prepare an environmental impact statement (EIS) for the proposed Otay River Estuary Restoration... any one of the following methods. Email: [email protected] . Please include ``Otay Estuary NOI'' in the...
International Nuclear Information System (INIS)
Chuyanov, V.
1999-01-01
After 6 years of existence the ITER EDA project in San Diego, USA, was terminated by desition of the US Congress. This article describes how nice it was for everybody as long as it lasted and how sad it is now
Olomukoro, Caroline O.; Adelore, Omobola O.
2015-01-01
The study examined the political empowerment of women through literacy education programmes in Edo and Delta States in the South-South Geopolitical zone of Nigeria. A sample of 1022 women was randomly drawn from the different levels of literacy classes organised by the Agency of Adult and Nonformal Education and non-governmental and private…
Ultra-fast and sensitive photo-induced phase switching in (EDO-TTF)2PF6
International Nuclear Information System (INIS)
Chollet, Matthieu; Guerin, Laurent; Uchida, Naoki; Fukaya, Souichi; Ishikawa, Tadahiko; Koshihara, Shin-ya; Matsuda, Kazunari; Yamochi, Hideki; Ota, Akira; Saito, Gunzi
2005-01-01
Organic conductor (EDO-TTF) 2 PF 6 crystal having 14 filled band shows a metal (M)-insulator (I) transition accompanied with Peierls transition, charge ordering, and anion ordering at transition temperature, T C =280K. This crystal is an important and fascinating candidate for photo-induced M-I transition because the multi-instability will afford sensitivity to the tiny stimulation. We make the report of the reflectivity change in (EDO-TTF) 2 PF 6 crystal induced by the irradiation of femto-second (fs) pulsed laser (pulse width: 120fs, main wavelength: 800nm, repetition rate: 1kHz). The obtained results indicate that the highly efficient I-to-M transition occurs within 3ps in this material. Based on these results, the strong electron-lattice cooperative interaction is proved to play an essential role in the driving process of this M-I transition. Also, 14 filled materials, which show M-I transition, accompanied with the charge ordering, can be classified as fascinating candidates not only for superconductivity but also for photo-induced cooperative phenomena and application in phase switching devices
Coastal Cactus Wren, San Diego Co. - 2009 [ds702
California Natural Resource Agency — The San Diego Multiple Species Conservation program (MSCP) was developed for the conservation of plants and animals in the southeast portion of San Diego County....
Coastal Cactus Wren, San Diego Co. - 2011 [ds708
California Natural Resource Agency — The San Diego Multiple Species Conservation program (MSCP) was developed for the conservation of plants and animals in the southeast portion of San Diego County....
Trouble Brewing in San Diego. Policy Brief
Buck, Stuart
2010-01-01
The city of San Diego will face enormous budgetary pressures from the growing deficits in public pensions, both at a state and local level. In this policy brief, the author estimates that San Diego faces total of $45.4 billion, including $7.95 billion for the county pension system, $5.4 billion for the city pension system, and an estimated $30.7…
Mammal Track Counts - San Diego County, 2010 [ds709
California Natural Resource Agency — The San Diego Tracking Team (SDTT) is a non-profit organization dedicated to promoting the preservation of wildlife habitat in San Diego County through citizen-based...
Directory of Open Access Journals (Sweden)
Nicholls Clara I.
2000-12-01
Full Text Available En el manejo de plagas es factible incrementar poblaciones de enemigos naturales, diversificando el hábitat. En los agroecosistemas es reconocida la importancia de la vegetación marginal para la sobrevivencia de parasitoides y predatores. En cultivos comercialees de viñedos, manejados orgánicamente, se adelantó este trabajo, se establecieron corredores de 65 especies diferentes de plantas con flores. Los cultivos de cobertura se sembraron en hilera por medio cada año. Los viñedos recibieron en promedio 2 toneladas de compost por hectárea. Para el control de enfermedades se empleó preventivamente azufre. Se pretendió precisar si el corredor de 200 metros de largo, podría incrementar el control biológico de insectos plaga en el viñedo. Se evaluó la contribución del corredor como proveedor de recursos alimenticios alternativos, consistentes, abundantes y bien distribuidos de enemigos naturales. Se comprobó la utilidad del corredor para incrementar los niveles poblacionales de insectos benéficos.
77 FR 34984 - Notice of Intent To Repatriate a Cultural Item: San Diego Museum of Man, San Diego, CA
2012-06-12
...The San Diego Museum of Man, in consultation with the appropriate Indian tribes, has determined that a cultural item meets the definition of unassociated funerary object and repatriation to the Indian tribes stated below may occur if no additional claimants come forward. Representatives of any Indian tribe that believes itself to be culturally affiliated with the cultural item may contact the San Diego Museum of Man.
Festival of Curses: A Traditional Crime Control Method In Edo State –Nigeria
Directory of Open Access Journals (Sweden)
Rashidi Akanji Okunola
2016-02-01
Full Text Available Festivals and ceremonies are part and parcel of African culture, usually in all its pump, merriment and pageantry. However, with the increasing wave of criminal activities in Nigeria especially in Edo state, festivals and ceremonies are being redefined and conceptualized in practice. Only recently a new festival ‘Festival of Curses’ was brought to the fore in combating crime in Edo state. The study therefore seeks to explain the festival as a traditional mechanism in crime control, the nature of the festival, the factors that led to its emergence in the 21st century, the level of acceptance and its impact in reducing criminal activities in the State. The study employed principally secondary literature and in-depth interviews among a cross section of the Bini. Major findings revealed that immediately after the festival of curses, a lot of criminals in the state besieged the Bini Monarch’s Palace to confess their atrocities; and pleaded for forgiveness. There was an overwhelming acceptance of the festival irrespective of the people’s religious affiliations to Christianity and Islam as a result of the potency and sudden drop in crime during the period. The study concludes that the festival should be taken as a mechanism of crime control and policing in Nigeria.
Silk and Sakoku : a simulation analysis of industrial location in Edo period Japan
ATSUMI, Toshihiro
2012-01-01
Japan closed itself to international trade from the 17^ century to the mid-19^ century during the Edo period, known as the Sakoku. After the closure, industries dispersed from western coastal cities to inland areas in western and eastern Japan. This paper investigates how the Sakoku may have aff ected industrial locations within Japan by applying a footloose entrepreneur type geography model to an economy with agricultural raw materials in a continuous space setting. The simulations based on ...
78 FR 42027 - Safety Zone; San Diego Bayfair; Mission Bay, San Diego, CA
2013-07-15
... safety zones. Thunderboats Unlimited Inc. is sponsoring San Diego Bayfair, which is held on the navigable... distribution of power and responsibilities between the Federal Government and Indian tribes. 12. Energy Effects This proposed rule is not a ``significant energy action'' under Executive Order 13211, Actions...
Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria
Philipa O. Idogho; Olotu Yahaya
2013-01-01
Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS) Physical Water Loss (WLρ) Apparent Water Loss (WLE) Water Loss Reduction Index (WLRI) and Av...
Offor, Dianarose Iyeoma; Akinlosotu, Nathaniel Toyosi
2017-01-01
The study investigated attitude towards special need students (SNS) among teachers in public secondary schools in Edo Central Senatorial District. The study was undertaken to determine the teachers' attitude and the influence of gender, educational specialisation and experience on their attitude towards SNS. A total of 369 (50%) of the 739…
Energía renovable e hidrógeno generados in situ para riego y movilidad en viñedos
Directory of Open Access Journals (Sweden)
Carroquino Javier
2017-01-01
Full Text Available La energía utilizada en agricultura es fuente de emisiones de gases de efecto invernadero. Para reducir las producidas por el uso de gasóleo y electricidad, el proyecto europeo LIFE REWIND aborda el suministro desde fuentes renovables. Para ello, se ha caracterizado la demanda energética y recursos renovables en viñedo y bodega. Se ha buscado el diseño óptimo económico y medioambiental de la generación. Se ha instalado un prototipo en una explotación vitivinícola, con generación fotovoltaica, incluyendo un conjunto flotante sobre una balsa. Esto evita el uso de terreno, reduce la pérdida de agua de la balsa y mejora el rendimiento de los paneles fotovoltaicos. La electricidad producida alimenta la depuración de agua y el bombeo de riego por goteo del viñedo. Con la energía sobrante, un electrolizador produce hidrógeno mediante electrólisis del agua, que es utilizado por un vehículo todoterreno con pila de combustible. Los resultados muestran la viabilidad técnica y económica de los sistemas autónomos de energía renovable para alimentar el riego estacional en los viñedos. Así se evitan las extensiones indiscriminadas de la red y los grupos electrógenos diésel. Adicionalmente se muestra la posibilidad de reemplazar el gasóleo por electricidad o hidrógeno producido en la propia explotación.
Species - San Diego Co. [ds121
California Natural Resource Agency — This is the Biological Observation Database point layer representing baseline observations of sensitive species (as defined by the MSCP) throughout San Diego County....
The San Diego Panasonic Partnership: A Case Study in Restructuring.
Holzman, Michael; Tewel, Kenneth J.
1992-01-01
The Panasonic Foundation provides resources for restructuring school districts. The article examines its partnership with the San Diego City School District, highlighting four schools that demonstrate promising practices and guiding principles. It describes recent partnership work on systemic issues, noting the next steps to be taken in San Diego.…
AMS San Diego Testbed - Calibration Data
Department of Transportation — The data in this repository were collected from the San Diego, California testbed, namely, I-15 from the interchange with SR-78 in the north to the interchange with...
Alika, Ijeoma Henrietta; Egbochuku, Elizabeth Omotunde
2012-01-01
The study investigated the relationship between vocational interest socio-economic status and re-entry of girls into school in Edo State. The research design adopted was correlational because it sought to establish the relationship between the independent variable and the dependent variable. A sample size of 306 girls who re-enrolled in institutes…
Diego Guillén de Ávila, autor y traductor del siglo XV
Directory of Open Access Journals (Sweden)
María Elvira Roca Barea
2006-12-01
Full Text Available Diego Guillén de Ávila, son of Pero Guillén de Segovia or Sevilla, is an almost unknown author. There is not a single article devoted to him, although his work as translator and poet deserves some attention. This article focuses on Diego Guillén. Firstly I trace his social and literary connections, especially with Archbishop Alonso Carrillo and Gómez Manrique and put them in their historical context. The rest of the article is devoted to Diego Guillén’s translations and poems. Diego translated into Spanish the military text of Frontino, the Hermetic book Liber de sapientia et potentia Dei and Historia Romae by Herodianus. We only know of two long poems of Diego Guillén: both are Panegirics he dedicated to Queen Isabella and to don Alonso Carrillo. Egloga interlocutoria is a piece of theatre attributed to Diego Guillén. Since it has been impossible to prove whether this attribution is correct, I included some unknown data that re-enforce the possibility of this authorship. The facts studied in this article gave me occasion to make some reflections about Castilian aristocracy, culture and Humanism in 15th century Castile
78 FR 48046 - Safety Zone; Kuoni Destination Management Fireworks; San Diego, CA
2013-08-07
...-AA00 Safety Zone; Kuoni Destination Management Fireworks; San Diego, CA AGENCY: Coast Guard, DHS... waters of the San Diego Bay in support of the Kuoni Destination Management Fireworks Display on August 6... Guard's ability to protect the public from the potential hazards associated with fireworks displays...
"edo jal̀qkina üts̀varòkaetus ma vaelda ..." : [luuletused] / Andreas Kalkun
Kalkun, Andreas, 1977-
2002-01-01
Sisu: "edo jal̀qkina üts̀varòkaetus ma vaelda ..." ; "tsirguq ku kiviq no satassõ taivast aràlaq ..." ; "vahtsõq silmäq pitsitä pääluu sisse ..." ; "tõppõ tõmmat haigõst ma haarõt jal̀ki ..." ; "arsatas njago sisse aigopiteh ..." ; "rühkeq yks jumalat pallõlda jaloh ..." ; "mu süä om no süüdläne täǹtäseq kuvvõ ..." ; "halvaq haavaq häitsese veiga silmih. Eluloolisi andmeid autori kohta lk. 379
2012-08-14
... Management Program, in consultation with the appropriate Indian tribe, has determined that the cultural items... itself to be culturally affiliated with the cultural items may contact San Diego State University Archaeology Collections Management Program. DATES: Representatives of any Indian tribe that believes it has a...
33 CFR 165.1120 - Security Zone; Naval Amphibious Base, San Diego, CA.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Naval Amphibious Base, San Diego, CA. 165.1120 Section 165.1120 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.1120 Security Zone; Naval Amphibious Base, San Diego, CA. (a) Location. The following area is a...
Ogbe, Joseph O.
2015-01-01
The study was meant to analyze Parents and Teachers perception of the use of corporal punishment in primary schools in Edo/Delta state. The purpose was to find time out parents and teachers opinion on the need for continuity or to discontinue the use of corporal punishment among primary school pupils. The method was a descriptive study with the…
San Diego Littoral Cell CRSMP Receiver Sites 2009
California Natural Resource Agency — A total of 27 possible placement sites (some with multiple placement footprints) are incorporated into this San Diego Coastal Regional Sediment Management Plan to...
San Diego Littoral Cell CRSMP Receiver Sites 2009
California Department of Resources — A total of 27 possible placement sites (some with multiple placement footprints) are incorporated into this San Diego Coastal Regional Sediment Management Plan to...
2011-02-04
...] San Diego County Water Authority Subregional Natural Community Conservation Program/Habitat Conservation Plan, San Diego and Riverside Counties, CA; Final Environmental Impact Statement and Habitat... also announce the availability of the Water Authority's Subregional Natural Community Conservation...
76 FR 1521 - Security Zone: Fleet Industrial Supply Center Pier, San Diego, CA
2011-01-11
...-AA87 Security Zone: Fleet Industrial Supply Center Pier, San Diego, CA AGENCY: Coast Guard, DHS. ACTION... Diego, CA. The existing security zone is around the former Fleet Industrial Supply Center Pier. The security zone encompasses all navigable waters within 100 feet of the former Fleet Industrial Supply Center...
Edo Mihevc – urbanist, arhitekt in oblikovalec. Vrednotenje povojnega urbanizma slovenske obale
Directory of Open Access Journals (Sweden)
Jasna Kralj Pavlovec
1999-01-01
Full Text Available Edo Mihevc (1911–1985 je bil eden protagonistov slovenske moderne arhitekture po drugi svetovni vojni in eden Plečnikovih študentov, ki se je ločil od njegove manire ter zakorakal na pot samoizraznosti in iskanja skladja med modernizmom, regionalizmom in humanistično filozofijo. Pomen njegovega prispevka slovenski arhitekturi in kulturi je predstavljen skozi perspektivo večrazsežnostne dejavnosti, s poudarkom na vlogi urbanista slovenske obale. Posamezni deli iz njegovega opusa so predstavljeni z vidika časa nastanka, uporabe in arhitekturne vrednosti, pomen in vloga zamisli ter trendov pa skozi dela. V luči sodobnih doktrin varovanja kulturne dediščine, pravočasna ocena in minimalno varstvo njegove arhitekture mora biti doseženo, tudi za mojstrovine iz bližnje preteklosti.
2013-01-25
... DEPARTMENT OF STATE [Public Notice 8160] Culturally Significant Objects Imported for Exhibition Determinations: ``Frida & Diego: Passion, Politics and Painting'' SUMMARY: Notice is hereby given of the... exhibition ``Frida & Diego: Passion, Politics and Painting,'' imported from abroad for temporary exhibition...
2010-03-04
... Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation Plan, San... the NCCP/HCP's conservation strategy. Covered Activities would include developing new water... permit application, and notice of public meetings. SUMMARY: The San Diego County Water Authority (Water...
Species Observations (poly) - San Diego County [ds648
California Natural Resource Agency — Created in 2009, the SanBIOS database serves as a single repository of species observations collected by various departments within the County of San Diego's Land...
Species Observations (poly) - San Diego County [ds648
California Department of Resources — Created in 2009, the SanBIOS database serves as a single repository of species observations collected by various departments within the County of San Diego's Land...
Directory of Open Access Journals (Sweden)
Antariksa Antariksa
2003-01-01
Full Text Available In the early Edo period the number of memorial cloisters (tacchu increased, especially, at Daitoku-ji and Myôshin-ji temples. As a consequence, the hondô (kyakuden, hojo were further developed in all aspects of architectural style, interior design and plan. This study will attempt to clarify the types of plans at memorial cloisters of both temples, by analyzing the arrangement and composition of the sanctuary, during the Edo period. In that period, the requirement of the rooms was interlaced with the function, and even dependent upon everyday life and the activities of religious services.
2010-03-10
... Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation Plan, San... meetings for the San Diego County Water Authority's (Water Authority/Applicant) draft Natural Communities Conservation Plan (NCCP)/Habitat Conservation Plan (HCP) prepared in application to us for an incidental take...
San Diego's High School Dropout Crisis
Wilson, James C.
2012-01-01
This article highlights San Diego's dropout problem and how much it's costing the city and the state. Most San Diegans do not realize the enormous impact high school dropouts on their city. The California Dropout Research Project, located at the University of California at Santa Barbara, has estimated the lifetime cost of one class or cohort of…
Leah S. Bauer
1990-01-01
A standardized laboratory bioassay was used to quantify the lethal and sub-lethal responses of larval and adult cottonwood leaf beetles, Chrysomela scripta F., to Bacillus thuringiensis var. san diego, formulated as M-One standard powder (Mycogen Corporation, San Diego). The median lethal concentration (LC
Emiri; Ogochukwu T.
2015-01-01
Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descri...
San Diego, California 1/3 arc-second DEM
National Oceanic and Atmospheric Administration, Department of Commerce — The 1/3-second San Diego, California Elevation Grid provides bathymetric data in ASCII raster format of 1/3-second resolution in geographic coordinates. This grid is...
33 CFR 165.1121 - Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA.
2010-07-01
... Guard District § 165.1121 Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. (a... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. 165.1121 Section 165.1121 Navigation and Navigable Waters COAST...
Directory of Open Access Journals (Sweden)
L. E. Flint
2012-10-01
Full Text Available Many basins throughout the world have sparse hydrologic and geologic data, but have increasing demands for water and a commensurate need for integrated understanding of surface and groundwater resources. This paper demonstrates a methodology for using a distributed parameter water-balance model, gaged surface-water flow, and a reconnaissance-level groundwater flow model to develop a first-order water balance. Flow amounts are rounded to the nearest 5 million cubic meters per year.
The San Diego River basin is 1 of 5 major drainage basins that drain to the San Diego coastal plain, the source of public water supply for the San Diego area. The distributed parameter water-balance model (Basin Characterization Model was run at a monthly timestep for 1940–2009 to determine a median annual total water inflow of 120 million cubic meters per year for the San Diego region. The model was also run specifically for the San Diego River basin for 1982–2009 to provide constraints to model calibration and to evaluate the proportion of inflow that becomes groundwater discharge, resulting in a median annual total water inflow of 50 million cubic meters per year. On the basis of flow records for the San Diego River at Fashion Valley (US Geological Survey gaging station 11023000, when corrected for upper basin reservoir storage and imported water, the total is 30 million cubic meters per year. The difference between these two flow quantities defines the annual groundwater outflow from the San Diego River basin at 20 million cubic meters per year. These three flow components constitute a first-order water budget estimate for the San Diego River basin. The ratio of surface-water outflow and groundwater outflow to total water inflow are 0.6 and 0.4, respectively. Using total water inflow determined using the Basin Characterization Model for the entire San Diego region and the 0.4 partitioning factor, groundwater outflow from the San Diego region, through
Vegetation Mapping - Tecolote Canyon, San Diego Co. [ds656
California Natural Resource Agency — Vegetation mapping has been conducted at various City of San Diego Park and Recreation Open Space lands in support of natural resource management objectives and the...
Baseline Surveys - Tecolote Canyon, San Diego Co. [ds655
California Natural Resource Agency — Various resource projects have been conducted in the City of San Diego's Open Space Parks as part of the implementation of the City's Multiple Species Conservation...
2013-04-24
... DEPARTMENT OF STATE [Public Notice 8290] Culturally Significant Objects Imported for Exhibition Determinations: ``Frida Kahlo, Diego Rivera, and Masterpieces of Modern Mexico: The Jacques and Natasha Gelman..., 2003), I hereby determine that the objects to be included in the exhibition ``Frida Kahlo, Diego Rivera...
Enato, E. F. O.; Mens, P. F.; Okhamafe, A. O.; Okpere, E. E.; Pogoson, E.; Schallig, H. D. F. H.
2009-01-01
SUMMARY: This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and
The Environmental Health Coalition (EHC) is a recipient of a CARE Level II cooperative agreement grant. The Clean Ports, Healthy Communities in San Diego targets the Barrio Logan and Old Town National City areas located along San Diego Bay.
2010-07-01
... thuringiensis variety San Diego encapsulated into killed Pseudomonas fluorescens; exemption from the requirement... into killed Pseudomonas fluorescens; exemption from the requirement of a tolerance. The delta endotoxin of Bacillus thuringiensis variety San Diego encapsulated into killed Pseudomonas fluorescens is...
2011-10-13
... exhibition ``Diego Rivera: Murals for The Museum of Modern Art,'' imported from abroad for temporary... Determinations: ``Diego Rivera: Murals for the Museum of Modern Art'' SUMMARY: Notice is hereby given of the... exhibit objects at The Museum of Modern Art, New York, NY, from on or about November 13, 2011, until on or...
Hispanics of a San Diego Barrio.
1983-04-01
electronic music of Black American discoteques, played loudly on automobile stereo systems or on the oversized "sound boxes" which have more...rider" automobiles , and intense partying are parts of an essentially anti-social image held by the larger San Diego community. Parallels might be drawn...Research Naval Academy, U.S. Annapolis, MD 21402 - .I . . . . I I II I I l i List 7 HRM Officer in Charge Commanding Officer Human Resource Management
San Diego Littoral Cell CRSMP Potential Offshore Borrow Areas 2009
California Natural Resource Agency — Offshore sediment sources along the entire reach of the San Diego Coastal RSM Plan region were previously identified by SANDAG and used for Regional Beach Sand...
Directory of Open Access Journals (Sweden)
Rodríguez Mediano, Fernando
2004-06-01
Full Text Available This paper deals with the Italian sojourn of Diego de Urrea, who spent the last years of his life in Naples. His relationship with the Italian learned milieu, especially with Prince Federico Cesi and his Accademia dei Lincei, of which Galileo Galilei was a member, sheds some light on the traits of the Italian "orientalism" at that time, and its coincidences and differences with what happened in Spain at the beginning of the 17th Century, when the affaire of the "Lead Books of the Sacromonte" was an essential factor in the way in which Arabic and the Islamic past was to be incorporated in the history of Spain.
Este artículo trata de la estancia en Italia del traductor del árabe Diego de Urrea, que pasó los últimos años de su vida en Nápoles. Su relación con círculos eruditos italianos, como el del príncipe Federico Cesi y su Accademia dei Lincei, a la que perteneció Galileo, pone de relieve algunos de los rasgos característicos del «orientalismo» italiano de la época, y sus relaciones y diferencias con lo que ocurría en España a comienzos de s. XVII, cuando el asunto de los Plomos del Sacromonte ejerció un papel fundamental en la definición de la lengua y la historia árabes dentro de la historia de España.
Tracey, Jeff A.; Madden, Melanie C.; Bloom, Peter H.; Katzner, Todd E.; Fisher, Robert N.
2018-04-16
Beginning in 2014, the U.S. Geological Survey, in collaboration with Bloom Biological, Inc., began telemetry research on golden eagles (Aquila chrysaetos) captured in the San Diego, Orange, and western Riverside Counties of southern California. This work was supported by the San Diego Association of Governments, California Department of Fish and Wildlife, the U.S. Fish and Wildlife Service, the Bureau of Land Management, and the U.S. Geological Survey. Since 2014, we have tracked more than 40 eagles, although this report focuses only on San Diego County eagles.An important objective of this research is to develop habitat selection models for golden eagles. Here we provide predictions of population-level habitat selection for golden eagles in San Diego County based on environmental covariates related to land use and terrain.
Parasites of edible land snails in Edo State, Nigeria
Directory of Open Access Journals (Sweden)
Igbinosa I. B.
2016-12-01
Full Text Available Land snails are sources of protein to man and are hosts to a number of parasites. It is imperative that the roles of the snail hosts and parasites are clearly defined. Before then however, the parasites of the different land snails collected in any locality should be identified. Land snails were collected in the wild in both dry and wet seasons. The internal organs and the faeces were examined for the presence of parasite. In the rainy season of 2015, a total of 272 snails were collected across four major towns (Benin, Uromi, Ekpoma and Auchi in Edo State, Nigeria, while in the dry season, fewer snails (n=91 were handpicked. The snail species seen are: Achatina achatina (Linnaeus, 1758, Achatina fulica (Férussac, 1821, Acharchatina marginata (Swainson, 1982, Limicolaria aurora (Jay, 1839, L. flammea (Müller, 1774 and Limicolariopsis spp. The larvae of Strongyloides stercoralis were isolated from the various snail species with overall prevalence of 54.04 %. Snails positive with Alaria mesocercariae were L. aurora, L. flammea and Limicolariopsis spp. Additionally, few L. flammea were positive of the cercariae of Drocoelium dedriticum. Meanwhile, some samples of A. fulica harboured larvae of Angiostrongylus cantonesis, sporocysts of Fasciola gigantica and Schistosoma mansoni. Therefore, these edible snails could pose serious health hazard to man and animals by serving as a possible alternative parasite transmission route.
Irrigation Capability Evaluation of Illushi Floodplain, Edo State, Nigeria
Directory of Open Access Journals (Sweden)
A.S. Umweni
2014-06-01
Full Text Available Many irrigation projects, especially in the developing tropical regions, are embarked upon without any land capability assessment, resulting in avoidable and undesirable ecological consequences. The aim of this study is to assess the irrigation capability potentials of the soils of a rice growing Illushi/Ega community in Edo State of Nigeria. Soils of Illushi/Ega (200 ha were studied to establish their irrigation capabilities. Water samples were collected from the rivers within and near the sites at the proposed points of intake structures and analyzed for salinity (ECw, permeability (SAR and ion toxicity [Chlorine (Cl and Boron (B]. Gravity irrigation suitability assessment was carried out following the guidelines of the United States Bureau for Land Reclamation (USBR, 1953 and FAO (1979. Results showed that about 5.5 % of the land was non-irrigable, 11.5 % was marginally irrigable, 30.5% was moderately irrigable and 52.5 % highly irrigable.Thus about 83 % of the total land area was found to be irrigable. The results of analyses of irrigation water [ECw, SAR and Cl and B (ion toxicity problems in water sources were 0.1 – 0.7 dS m-1, 1.2 – 1.7, 0.6 – 1.8 cmol kg-1 and 0.5 – 0.7 mg kg-1] also show that there is no indication of salinity or ion toxicity problem.
Directory of Open Access Journals (Sweden)
Manuel Gárate
2007-06-01
Full Text Available Resulta difícil explicar nuestra pasión sudamericana por el fútbol, pero lo es aún más cuando se trata de aquella que siente pueblo argentino por Diego Armando Maradona. No se trata del cariño propio a una gran estrella del balompié, sino del amor incondicional al “10”: el ídolo popular; el mismo que en 1986 lavó en una cancha de fútbol la afrenta de los ingleses, vencedores de la Guerra de las Malvinas. Pero Maradona también representa el éxito del chico pobre, que viene de las villas miser...
Calibration of System Input Volume and Non-Revenue Water Index in Edo North, Nigeria
Directory of Open Access Journals (Sweden)
Philipa O. Idogho
2013-09-01
Full Text Available Water scarcity is a serious problem in developing world. It could be physical scarcity or economic water shortage. The output of physicsbased study conducted in Edo North, Nigeria revealed that physical water losses in the water distribution network have compounded the accessibility and affordability of safe drinking water. Water supply and loss variables such as Water Supply (WS Physical Water Loss (WLρ Apparent Water Loss (WLE Water Loss Reduction Index (WLRI and Available Water (AW were mathematically modeled to produce realistic and efficient water loss management and improve water revenue. The result of the modeling iterations show that the average physical and apparent losses of 4,000m 3 and 2,700m 3 of (WLρ and (WLE correspond to 13,200m 3 , 6,400m 3 and 0.5 of WS/SIV, AW and WLRI in 2007. Strong indication exists between the WLRI for both physical and apparent losses with the coefficient of determination R 2=0.83 and 0.99 respectively. This relationship shows that more water is being lost through real loss with average total of 59.2% and 40.8% of apparent losses. However, a reduction of Total Non-Revenue Water (TNRW from 50.7% to 10.6% was recorded between 2007 to 2011. This reduction led to a total increase of 4,400m 3 of Revenue Water, decrease in Non-Revenue Water reduction cost from 36% in 2007 to 7% in 2011 and saving of US$17,400 which could be used to provide health facility for malaria treatment for 14,500 people on daily basis. Water efficiency, and particularly drinking water loss, is a serious issue which has significant financial and economic depression; awareness in this respect is totally unrecognized by both individual and governmental sector. Generally, long-term strategies towards the reduction of water losses should continue to be sustained by Edo State government, donor agencies and some private sectors in the area of water supply in order to support the fulfillment of the Millennium Development Goals, control of
2012-06-04
... Inventory Completion: Marine Corps Base Camp Pendleton, U.S. Marine Corps, San Diego County, CA AGENCY..., institution, or Federal agency that has control of the Native American human remains. The National Park... and present archeological theory place the Luiseno tribes within this geographic area of San Diego...
Solar water-heating performance evaluation-San Diego, California
1981-01-01
Report describes energy saved by replacing domestic, conventional natural gas heater with solar-energy subsystem in single-family residence near San Diego, California. Energy savings for 6 month test period averaged 1.089 million Btu. Collector array covered 65 square feet and supplied hot water to both 66-gallon solar storage tank and 40-gallon tank for domestic use. Natural gas supplied house's auxiliary energy.
Puente Coronado - San Diego (EE. UU.
Directory of Open Access Journals (Sweden)
Editorial, Equipo
1971-12-01
Full Text Available This 3,5 km long bridge, joining the cities of San Diego and Coronado is one of the longest in the world of this type, and one of the three most important straight line bridges in the United States. Its supporting structure consists of reinforced concrete columns resting on footings or piles, according to whether they are under the sea water or on dry land. The superstructure is partly of metal plates and partly of box girders. The surfacing of the deck consists of asphalt epoxy concrete, of 5 cm depth. Special paint was applied to the bridge, including layers of vinyl, iron oxide and blue vinyl on a zinc base.Este puente, de unos 3 km y medio, que une las ciudades de San Diego y Coronado es uno de los de mayor longitud del mundo, de este tipo, y uno de los tres principales ortótropos de los Estados Unidos de América. Su infraestructura está constituida por pilas de hormigón armado apoyadas sobre pilotes o sobre zapatas, según estén en el mar o en tierra firme. La superestructura está formada, en parte, por chapas metálicas y, en parte, por vigas cajón. El acabado del tablero metálico se realizó a base de hormigón asfáltico de epoxi con un espesor de 5 cm. La pintura es especial y se compone de capas de vinilo, de óxido de hierro y de vinilo azul sobre una capa de cinc.
San Diego Met High School: Personalization as a Foundation
Principal Leadership, 2010
2010-01-01
The mission of San Diego Met High School is to prepare students for college and the workforce through active learning, academic rigor, and community involvement in a small school setting. Because personalization is a key component of the school culture, advisories of 20-25 students work with the same teachers for all four years. Advisers, parents,…
Gender issues in contraceptive use among educated women in Edo state, Nigeria.
Osemwenkha, Sylvia Osayi
2004-04-01
While traditional contraception is widely used, in southern Nigerian modern contraception is a relatively recent phenomenon. Modern contraception is more wide spread among the educated and sexually active youth in Nigeria. Few studies have been done on contraception among educated women in Nigeria. This study was carried out in December 2000 to determine factors that influence the choice of contraceptives among female undergraduates at the University of Benin and Edo State University Ekpoma. Data was collected from a sample of 800 female undergraduates matched ethnic group, socio economic status, religion and rural urban residence. Subjects were selected by proportional representation and the instrument used was closed ended questionnaire. The responses obtained were analysed using Spearman Rank Correlation co-efficient and regression analysis. Findings revealed the highest correlation for availability (r =.96) vis a vis the use of various types of artificial contraceptive and cost (r =.96), next was safety (r =.95) and effectiveness (r =.95). Others were peer group influence (r =.80) and convenience (r =.77). An important step in improving women's reproductive health is the involvement of men. Health programmes should conduct campaigns to educate men about reproductive health and the role they can assume in family planning.
A Tale of Two Cities: San Diego (USA) and Tijuana (Mexico) El Niño Readiness
Stewart, C.; Kinoshita, A. M.; Nishikawa, T.; Briones-Gamboa, F.
2016-12-01
This research seeks to define the characteristics of an El Niño Ready City (ENRC) by comparing two neighboring cities, San Diego, United States and Tijuana, Mexico, with diverse management and social conditions, yet similar climatology. Notable El Niño years, 1982-83 and 1997-98, brought heavy precipitation and consequently significant flooding in southern California and northwest Mexico. Using the 2015-16 El Niño, we were able to investigate both Cities' historical and current preparation for hazardous events and identify lessons learned from previous events. Preparation activities include steps taken to prepare storm-related infrastructure, develop emergency protocols, establish communication and coordination efforts, and encourage public outreach and awareness. Literature, media searches, and interviews with local and regional agencies such as the San Diego Department of Transportation and Storm Water, San Diego Lifeguard Services and River Rescue Team, Tijuana State Civil Protection, and Mexican Meteorological Service Departments provided insight into the current and ongoing management for these urban Cities during the 2015-2016 El Niño. Both San Diego and Tijuana were cognizant of the 2015-2016 El Niño and anticipated above-average precipitation and had public agencies that were concerned with potential El Niño related impacts. Common challenges of inter-agency communication and coordination were noted for both Cities. By tracking the electronic media in Tijuana, we observed that local institutions respond proactively, but in a specific period of time. While, in the case of San Diego, the media analysis indicated a focus on El Niño related weather and its implications for the City as evidenced by the total number of articles related to weather across four decades. A challenge for both Cities will be to develop readiness capacities for long-term periods even if El Niño signals are weak or not present.
Institute for Children and Poverty, New York, NY.
An analysis of data from a survey of more than 100 parents residing in emergency shelter in San Diego, California, reveals a portrait of poverty that is prevalent among women and children in the United States today. Homeless families in San Diego, as in the rest of the country, are most often headed by women in their early thirties whose prospects…
33 CFR 334.870 - San Diego Harbor, Calif.; restricted area.
2010-07-01
..., Calif.; restricted area. (a) Restricted area at Bravo Pier, Naval Air Station—(1) The area. The water of... delay or loitering. On occasion, access to the bait barges may be delayed for intermittent periods not... Supply Center Pier—(1) The area. The waters of San Diego Bay extending approximately 100 feet out from...
Do PEV Drivers Park Near Publicly Accessible EVSE in San Diego but Not Use Them?
Energy Technology Data Exchange (ETDEWEB)
Francfort, James Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-06-01
The PEV charging stations deployed as part of The EV Project included both residential and non-residential sites. Non-residential sites included EVSE installed in workplace environments, fleet applications and those that were publicly accessible near retail centers, parking lots, and similar locations. The EV Project utilized its Micro-Climate® planning process to determine potential sites for publicly accessible EVSE in San Diego. This process worked with local stakeholders to target EVSE deployment near areas where significant PEV traffic and parking was expected. This planning process is described in The Micro-Climate deployment Process in San Diego1. The EV Project issued its deployment plan for San Diego in November 2010, prior to the sale of PEVs by Nissan and Chevrolet. The Project deployed residential EVSE concurrent with vehicle delivery starting in December 2010. The installation of non-residential EVSE commenced in April 2011 consistent with the original Project schedule, closely following the adoption of PEVs. The residential participation portion of The EV Project was fully subscribed by January 2013 and the non-residential EVSE deployment was essentially completed by August 2013.
ITN utilization among pregnant women attending ANC in Etsako West Lga, Edo State, Nigeria.
Wagbatsoma, V A; Aigbe, E E
2010-06-01
To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo State. A descriptive cross-sectional study design was employed. Using a systematic sampling method, a total of 385 respondents were selected from all ANC facilities in the LGA following a verbally obtained consent. Tool for data collection was a semi-structured, researcher administered questionnaire. The respondents' knowledge of cause of malaria was good, as 269 (69%) had good knowledge but only 9 (2.3%) knew its effects on the foetus. Meanwhile, ownership of ITN and its use were very low, 36 (9.3%) and 31 (8.0) respectively. The main factor affecting the use of the commodity in the LGA was unavailability of ITNs. Other factors included belief of the women on the effectiveness of the commodity, level of education, marital status and family sizes ofrespondents. Use of Insecticide treated bed net has been hampered by unavailability of the commodity. It is therefore recommended that efforts should be made to make the commodity available to reduce morbidity and mortality among this vulnerable group.
Marine biodiversity at the end of the world: Cape Horn and Diego Ramírez islands
Ballesteros, Enric; Bell, Tom W.; Giddens, Jonatha; Henning, Brad; Hüne, Mathias; Muñoz, Alex; Salinas-de-León, Pelayo; Sala, Enric
2018-01-01
The vast and complex coast of the Magellan Region of extreme southern Chile possesses a diversity of habitats including fjords, deep channels, and extensive kelp forests, with a unique mix of temperate and sub-Antarctic species. The Cape Horn and Diego Ramírez archipelagos are the most southerly locations in the Americas, with the southernmost kelp forests, and some of the least explored places on earth. The giant kelp Macrocystis pyrifera plays a key role in structuring the ecological communities of the entire region, with the large brown seaweed Lessonia spp. forming dense understories. Kelp densities were highest around Cape Horn, followed by Diego Ramírez, and lowest within the fjord region of Francisco Coloane Marine Park (mean canopy densities of 2.51 kg m-2, 2.29 kg m-2, and 2.14 kg m-2, respectively). There were clear differences in marine communities among these sub-regions, with the lowest diversity in the fjords. We observed 18 species of nearshore fishes, with average species richness nearly 50% higher at Diego Ramírez compared with Cape Horn and Francisco Coloane. The number of individual fishes was nearly 10 times higher at Diego Ramírez and 4 times higher at Cape Horn compared with the fjords. Dropcam surveys of mesophotic depths (53–105 m) identified 30 taxa from 25 families, 15 classes, and 7 phyla. While much of these deeper habitats consisted of soft sediment and cobble, in rocky habitats, echinoderms, mollusks, bryozoans, and sponges were common. The southern hagfish (Myxine australis) was the most frequently encountered of the deep-sea fishes (50% of deployments), and while the Fueguian sprat (Sprattus fuegensis) was the most abundant fish species, its distribution was patchy. The Cape Horn and Diego Ramírez archipelagos represent some of the last intact sub-Antarctic ecosystems remaining and a recently declared large protected area will help ensure the health of this unique region. PMID:29364902
2012-08-01
This report presents the test plan for conducting the Air Quality Analysis for the United States Department of Transportation (U.S. DOT) evaluation of the San Diego Integrated Corridor Management (ICM) Initiative Demonstration. The ICM projects being...
Directory of Open Access Journals (Sweden)
Carolina Pineda Chávez
2016-01-01
Full Text Available tijuana y s an Diego forman una frontera de intensa dinámica demográf ica y socioeconó - mica, con población de origen mexicano creciente en s an Diego generada por oportunidades de empleo en esta ciudad. l as economías en interrelación modif ican la población y las ra - mas de trabajo. s e analiza el contexto económico de 1970 a 2010, incluyendo el Programa de industria lización Fronteriza, la ley s impson- rodino, el t ratado de l ibre c omercio de a mérica del n orte y la crisis de 2008. e n t ijuana predomina la industria de transformación, mientras que en s an Diego los servicios y el comercio requieren trabajadores de origen mexicano, que ahora incrementan su participación en servicios profesionales.
Meacham, Meredith C.; Strathdee, Steffanie A.; Rangel, Gudelia; Armenta, Richard F.; Gaines, Tommi L.; Garfein, Richard S.
2016-01-01
Objective: Although persons who inject drugs (PWID) in the western United States–Mexico border region are known to inject both heroin and methamphetamine, little is known about the prevalence and risks associated with co-injection of this depressant–stimulant combination (also known as “goofball” and “Mexican speedball”). Method: Baseline data from parallel cohort studies of PWID conducted concurrently in San Diego, CA, and Tijuana, Mexico, were used to estimate the prevalence and identify correlates of heroin–methamphetamine co-injection. PWID older than 18 years of age who reported injecting illicit drugs in the past month (N = 1,311; 32.7% female) were recruited in San Diego (n = 576) and Tijuana (n = 735) and completed interviewer-administered questionnaires. Bivariate and multivariable logistic regression analyses were used to identify correlates of heroin–methamphetamine co-injection. Results: The prevalence of co-injection in the past 6 months was 39.9% overall and was higher in Tijuana (55.8%) than in San Diego (19.8%). In multivariable analyses adjusting for study cohort, distributive syringe sharing, purchasing syringes prefilled with drugs, finding it hard to get new syringes, reporting great or urgent need for treatment, and younger age were independently associated with co-injection. Past-6-month overdose was significantly associated with higher odds of co-injection in San Diego than in Tijuana. Conclusions: These findings indicate that heroin–methamphetamine co-injection is more common in Tijuana than in San Diego, yet this practice was only associated with overdose in San Diego. Heroin–methamphetamine co-injection was also independently associated with HIV-associated injection risk behaviors. Overdose-prevention interventions should address co-injection of depressants and stimulants. PMID:27588536
Meacham, Meredith C; Strathdee, Steffanie A; Rangel, Gudelia; Armenta, Richard F; Gaines, Tommi L; Garfein, Richard S
2016-09-01
Although persons who inject drugs (PWID) in the western United States-Mexico border region are known to inject both heroin and methamphetamine, little is known about the prevalence and risks associated with co-injection of this depressant-stimulant combination (also known as "goofball" and "Mexican speedball"). Baseline data from parallel cohort studies of PWID conducted concurrently in San Diego, CA, and Tijuana, Mexico, were used to estimate the prevalence and identify correlates of heroin-methamphetamine co-injection. PWID older than 18 years of age who reported injecting illicit drugs in the past month (N = 1,311; 32.7% female) were recruited in San Diego (n = 576) and Tijuana (n = 735) and completed interviewer-administered questionnaires. Bivariate and multivariable logistic regression analyses were used to identify correlates of heroin-meth-amphetamine co-injection. The prevalence of co-injection in the past 6 months was 39.9% overall and was higher in Tijuana (55.8%) than in San Diego (19.8%). In multivariable analyses adjusting for study cohort, distributive syringe sharing, purchasing syringes prefilled with drugs, finding it hard to get new syringes, reporting great or urgent need for treatment, and younger age were independently associated with co-injection. Past-6-month overdose was significantly associated with higher odds of co-injection in San Diego than in Tijuana. These findings indicate that heroin-methamphetamine co-injection is more common in Tijuana than in San Diego, yet this practice was only associated with overdose in San Diego. Heroin-methamphetamine coinjection was also independently associated with HIV-associated injection risk behaviors. Overdose-prevention interventions should address co-injection of depressants and stimulants.
Pier Diego Siccardi (1880-1917) and the "Clinica del Lavoro" in the trench warfare.
Riva, Michele Augusto; Caramella, Michela; Turato, Massimo; Cesana, Giancarlo
2017-12-14
The year 2017 marks the centenary of the death of the Italian scientist Pier Diego Siccardi (1880-1917), one of Luigi Devoto's assistants at the "Clinica del Lavoro" in Milan. To commemorate Siccardi and to describe the activities of the physicians of the "Clinica del Lavoro" during World War I. A comprehensive analysis was conducted on scientific papers written by Pier Diego Siccardi and by other physicians belonging to the Clinica del Lavoro, in the period 1915-1918. During the Great War, the Clinica del Lavoro became a military hospital, even though it indirectly maintained a role in Occupational Health, assisting women who had started to work to replace the men sent to the front. Devoto and his assistants were drafted as Army doctors, but continued their research activities while at the front; focusing on the diseases that affected the soldiers, mainly infections. Bleeding fevers and jaundice were endemic among Italian troops, but their etiology was unknown. Pier Diego Siccardi identified this syndrome as an infection caused by a spirochete, and was the first one to isolate the infectious agent. Siccardi prematurely died of the same disease as a consequence of a laboratory accident, which provided further confirmation for his research. The heroic life of Siccardi and his tragic death testify the important activities of the scientists of the "Clinica del Lavoro" in the years of the Great War.
EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release
International Nuclear Information System (INIS)
Rodenas Diago, Jose; Serradell Garcia, Vicente
1983-01-01
1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied
EDO, Doses to Man and Organs from Reactor Operation Noble Gas and Liquid Waste Release
Energy Technology Data Exchange (ETDEWEB)
Rodenas Diago, Jose; Serradell Garcia, Vicente [Departamento de Ingenieria Nuclear, Escuela Tecnica Superior de Ingenieros Industriales, Universidad Politecnica, Camino de Vera 2/n Apartado 2012, Valencia (Spain)
1983-10-18
1 - Description of problem or function: EDO evaluates individual and collective doses to man from atmospheric releases of noble gases and other gaseous effluents. 2 - Method of solution: The dose calculations are carried out by following the guide- lines of USNRC Regulatory Guide 1.109. Radiation exposure for maximum individuals and population are estimated within 30 km from the nuclear plant. This area is divided into 160 circular trapezoids, to which computations are referred. Four age groups, seven organs for internal dose and two for external dose have been considered. Dose calculations are done through 14 pathways, 7 for liquid effluents, one for noble gases, and 6 for the rest of gaseous effluents. 3 - Restrictions on the complexity of the problem: The following are the maximum dimension sizes preset in the code: 73 radionuclides (other than noble gases); 15 noble gases; 160 circular trapezoids; 31 chemical elements; 4 types of aquatic foods; 15 points of exposure for shorelines; 15 trapezoids influenced by each point; 4 terrestrial food pathways; 100 centres of population. Some of these limits can be varied.
Diosas y madres, el arquetipo femenino en Diego Rivera
Dina Comisarenco Mirkin
2010-01-01
En el presente trabajo se estudia la representación del arquetipo femenino en la obra mural de Diego Rivera que el artista entretejió en sus amplios y complejos programas iconográficos con una extraordinaria imaginación poética. Se postula aquí que por una parte, dicha representación arquetípica partió de su erudita utilización de símbolos alegóricos y de alusiones a divinidades femeninas de distin...
76 FR 15216 - Security Zones; Cruise Ships, Port of San Diego, CA
2011-03-21
... Executive Order 13045, Protection of Children from Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health or risk to...-AA87 Security Zones; Cruise Ships, Port of San Diego, CA AGENCY: Coast Guard, DHS. ACTION: Final rule...
2012-08-01
This report presents the test plan for conducting the Technical Capability Analysis for the United States Department of Transportation (U.S. DOT) evaluation of the San Diego Integrated Corridor Management (ICM) Initiative Demonstration. The ICM proje...
In San Diego County, Court Schools Educate Teens When No One Else Can.
Rosander, Gerald A.
1987-01-01
Discussion of Juvenile Court Schools in San Diego County focuses on institutional schools that provide academic instruction in an incarceration setting and community schools that bridge institutional and public schools and provide education, vocational and career guidance, familiarization with community organizations, and increased self-esteem…
Economic integration and cross-border economic organizations: The case of San Diego-Tijuana
Directory of Open Access Journals (Sweden)
Jorge Eduardo Mendoza Cota
2017-01-01
Full Text Available The economic integration between the United States and Mexico has affected the economic, political and social relations in the border region. The paper seeks to relate the increasing economic integration and business cycles of the economies of San Diego and Tijuana to the development of both national and binational economic organizations in the border region. The methodology of analysis uses both statistical estimations of the economic integration of San Diego and Tijuana and semi-structured interviews of economic organizations to analyze the increasing economic integration and the role and achievements of the cross-border economic organizations. The results showed that cross-border cooperation is predominately controlled by federal and state governments on both sides of the border. However, the main achievements of cross-border economic cooperation have been accomplished by local private organizations. The perspective of further local economic development greatly depends on both the possibility of increased involvement of federal governments and the growing encouragement of regional organizations.
Murata, T
2001-01-01
Beginnings of the study of Western sciences, "Rangaku," in Kyoto and Osaka in the late 18th century are reviewed. Profiles and achievements of several active learners are briefly described; they include Koishi Genzui (Osaka-Kyoto), Tsuji Ranshitsu (Kyoto), Kimura Kenkadō (Osaka), and Hashimoto Sōkichi (Osaka). Genzui, after having successfully made good relations with Sugita Genpaku and Ohtsuki Gentaku, leading masters of the Edo school, played a role of an advocator for promoting "Rangaku" in Osaka and Kyoto. As a result, Kenkadō attained the publication of his book "Ikkaku Sankō," a monograph of the Western crude drug unicorn, with the help of Gentaku, who had translated a Dutch reference into Japanese for him. Ranshitsu and Sōkichi were taught the Dutch language by Gentaku; Sōkichi is known as the founder of "Rangaku" in Osaka.
Magnetic ground state of quasi-two-dimensional organic conductor, τ-(EDO-S,S-DMEDT-TTF)2(AuCl2)1+y
International Nuclear Information System (INIS)
Nakanishi, T; Yasuzuka, S; Yoshino, H; Fujiwara, H; Sugimoto, T; Nishio, Y; Kajita, K; Anyfantis, G A; Papavassiliou, G C; Murata, K
2006-01-01
To understand the interplay between transport and magnetic properties, quasi-two-dimensional (Q2D) organic conductor τ-(EDO-S,S-DMEDTTTF) 2 (AuCl 2 ) 1+y was studied by measurements of electric resistivity ( ρ a , ρ c ), magnetoresistance (MR), susceptibility (χ) and specific heat (C) in the temperature region between 1 K and 300 K. In spite of the fact that the drastic changes were observed in ρ a , ρ c , MR and χ at T C = 20 K, no anomaly was seen in C. The concentration of spins estimated from M-H curve is about 360 ppm, which is difficult to detect anomaly in C. These data suggest that the number of spins is very small in the ground state like spin-glass system
Diosas y madres, el arquetipo femenino en Diego Rivera
Comisarenco Mirkin, Dina
2010-01-01
En el presente trabajo se estudia la representación del arquetipo femenino en la obra mural de Diego Rivera tomando como punto de partida, no sólo su erudita utilización de símbolos alegóricos tradicionales, sino y particularmente, algunas de las experiencias vitales del artista, en particular aquellas relacionadas con el amor filial, con la maternidad/paternidad, y con sus complejas relaciones amorosas con distinguidas mujeres de su época, que de forma más o menos consciente, el artista entr...
Wood, Emily F; Werb, Dan; Beletsky, Leo; Rangel, Gudelia; Cuevas Mota, Jazmine; Garfein, Richard S; Strathdee, Steffanie A; Wagner, Karla D
2017-03-01
Research among people who inject drugs (PWIDs) in the USA and Mexico has identified a range of adverse health impacts associated with policing of PWIDs. We employed a mixed methods design to investigate how PWIDs from San Diego and Mexico experienced policing in Tijuana, and how these interactions affect PWIDs behavior, stratifying by country of origin. In 2012-2014, 575 PWIDs in San Diego, 102 of whom had used drugs in Mexico in the past six months, were enrolled in the STAHR-II study, with qualitative interviews conducted with a subsample of 20 who had recently injected drugs in Mexico. During this period, 735 PWIDs in Tijuana were also enrolled in the El Cuete-IV study, with qualitative interviews conducted with a subsample of 20 recently stopped by police. We calculated descriptive statistics for quantitative variables and conducted thematic analysis of qualitative transcripts. Integration of these data involved comparing frequencies across cohorts and using qualitative themes to explain and explore findings. Sixty-one percent of San Diego-based participants had been recently stopped by law enforcement officers (LEOs) in Mexico; 53% reported it was somewhat or very likely that they would be arrested while in Mexico because they look like a drug user. Ninety percent of Tijuana-based participants had been recently stopped by LEOs; 84% reported it was somewhat or very likely they could get arrested because they look like a drug user. Participants in both cohorts described bribery and targeting by LEOs in Mexico. However, most San Diego-based participants described compliance with bribery as a safeguard against arrest and detention, with mistreatment being rare. Tijuana-based participants described being routinely targeted by LEOs, were frequently detained, and reported instances of sexual and physical violence. Tijuana-based participants described modifying how, where, and with whom they injected drugs in response; and experienced feelings of stress, anxiety, and
Wood, Emily F.; Werb, Dan; Beletsky, Leo; Rangel, Gudelia; Mota, Jazmine Cuevas; Garfein, Richard S.; Strathdee, Steffanie A.; Wagner, Karla D.
2017-01-01
Background Research among people who inject drugs (PWIDs) in the USA and Mexico has identified a range of adverse health impacts associated with policing of PWIDs. We employed a mixed methods design to investigate how PWIDs from San Diego and Mexico experienced policing in Tijuana, and how these interactions affect PWIDs behavior, stratifying by country of origin. Methods In 2012–2014, 575 PWIDs in San Diego, 102 of whom had used drugs in Mexico in the past six months, were enrolled in the STAHR-II study, with qualitative interviews conducted with a subsample of 20 who had recently injected drugs in Mexico. During this period, 735 PWIDs in Tijuana were also enrolled in the El Cuete-IV study, with qualitative interviews conducted with a subsample of 20 recently stopped by police. We calculated descriptive statistics for quantitative variables and conducted thematic analysis of qualitative transcripts. Integration of these data involved comparing frequencies across cohorts and using qualitative themes to explain and explore findings. Results Sixty-one percent of San Diego-based participants had been recently stopped by law enforcement officers (LEOs) in Mexico; 53% reported it was somewhat or very likely that they would be arrested while in Mexico because they look like a drug user. Ninety percent of Tijuana-based participants had been recently stopped by LEOs; 84% reported it was somewhat or very likely they could get arrested because they look like a drug user. Participants in both cohorts described bribery and targeting by LEOs in Mexico. However, most San Diego-based participants described compliance with bribery as a safeguard against arrest and detention, with mistreatment being rare. Tijuana-based participants described being routinely targeted by LEOs, were frequently detained, and reported instances of sexual and physical violence. Tijuana-based participants described modifying how, where, and with whom they injected drugs in response; and experienced
University of California, San Diego (UCSD) Sky Imager Cloud Position Study Field Campaign Report
Energy Technology Data Exchange (ETDEWEB)
Kleissl, J. [Univ. of California, San Diego, CA (United States); Urquhart, B. [Univ. of California, San Diego, CA (United States); Ghonima, M. [Univ. of California, San Diego, CA (United States); Dahlin, E. [Univ. of California, San Diego, CA (United States); Nguyen, A. [Univ. of California, San Diego, CA (United States); Kurtz, B. [Univ. of California, San Diego, CA (United States); Chow, C. W. [Univ. of California, San Diego, CA (United States); Mejia, F. A. [Univ. of California, San Diego, CA (United States)
2016-04-01
During the University of California, San Diego (UCSD) Sky Imager Cloud Position Study, two University of California, San Diego Sky Imagers (USI) (Figure 1) were deployed the U.S. Department of Energy(DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains SGP) research facility. The UCSD Sky Imagers were placed 1.7 km apart to allow for stereographic determination of the cloud height for clouds over approximately 1.5 km. Images with a 180-degree field of view were captured from both systems during daylight hours every 30 seconds beginning on March 11, 2013 and ending on November 4, 2013. The spatial resolution of the images was 1,748 × 1,748, and the intensity resolution was 16 bits using a high-dynamic-range capture process. The cameras use a fisheye lens, so the images are distorted following an equisolid angle projection.
Extent of Implementation of Post-Basic Economics Curriculum in Senior Secondary Schools in Edo State
Directory of Open Access Journals (Sweden)
E. O. Oleabhiele
2015-05-01
Full Text Available This study focused on the extent of implementation of post-economics curriculum in senior secondary schools in Edo state. Two research questions and two research hypotheses were formulated to guide the study. The research designed used for the study was the descriptive survey. The population for the study were one hundred and twenty-five (125 economics teachers. A structured questionnaire was used for the collection of data for the study while the research questions were answered using the mean and standard deviation and the research hypotheses were tested using the t-test statistics at an alpha level of 0.05. The results of the study revealed that the curriculum content of economics are adequate and in line the objective of the nation on vision 20:2020. And that the instructional strategies employed by economics teachers to implement the curriculum content are appropriate as specified by the curriculum. Based on the findings, it is recommended that economics teachers should trained to select a use instructional strategies that are learners centred and that economics teachers should be encouraged to attend seminars, workshops in order to improve their teaching skills
33 CFR 334.860 - San Diego Bay, Calif., Naval Amphibious Base; restricted area.
2010-07-01
... Amphibious Base; restricted area. 334.860 Section 334.860 Navigation and Navigable Waters CORPS OF ENGINEERS... Bay, Calif., Naval Amphibious Base; restricted area. (a) The Area. The water of the Pacific Ocean in Middle San Diego Bay in an area extending from the northern and eastern boundary of the Naval Amphibious...
International Nuclear Information System (INIS)
Diaz Rizo, O.; Gelen Rudnikas, A.; D'Alessandro Rodriguez, K.; Arado Lopez, J. O.; Dominguez Rodriguez, R.; Gonzalez Hernandez, P.; Melian Rodriguez, C.M.; Suarez Munnoz, M.; Fagundo Castillo, J. R.; Blanco Padilla, D.
2011-01-01
Effects induced by the hurricanes Gustav and Ike on San Diego River mud characteristics have been studied. X-ray fluorescence analysis, gamma spectrometry and measurement of some physic-chemical characteristics in mud samples, collected before and after hurricane impacts, shows that hurricanes induced changes in mud major composition and in some other mud characteristics, affecting its properties for therapeutic uses. The average sedimentation rate determined by gamma spectrometry in San Diego River outlet permit to estimate that the original mud characteristics will be recovered never before than 5-7 years. (Author)
Corporate social responsibility in Japan from the Edo period to the Fukushima nuclear accident
International Nuclear Information System (INIS)
Rolland-Piegue, E.
2011-01-01
Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)
Creating an Engaging Library Orientation: First Year Experience Courses at UC San Diego
Goldman, Crystal; Turnbow, Dominique; Roth, Amanda; Friedman, Lia; Heskett, Karen
2016-01-01
This article focuses on the development of an engaging library orientation module for UC San Diego First Year Experience (FYE) courses. The library module included a brief in-class presentation about research concepts and library services, an online interactive library scavenger hunt given as an in-class activity, and a homework assignment where…
DESCENTRAMIENTO Y COLECTIVIDAD EN LA OBRA DE DIEGO MAQUIEIRA
Directory of Open Access Journals (Sweden)
Matías Ayala
2009-11-01
Full Text Available En este artículo se estudian los sujetos y sus formas de agrupación en dos volúmenes de poesía de Diego Maquieira: La tirana y Los sea harrier. En La tirana, los sujetos se encuentran fuertemente descentrados y relaciones de afiliación son definidas por colectividades que destacan por su uso de la violencia: la mafia y la Inquisición (la combinación de ambos rasgos se presentan aquí como una alegoría política de la dictadura. En Los sea harrier, en cambio, hay sujetos más coherentes y las relaciones sociales también se encuentran más formalizadas en ejércitos o bandas que se pelean. La alegoría política continúa, solo que ahora se trata de la transición política chilena.This article proposes a study of subjectivity and of the various forms of socialization present in two poetical works by Diego Maquieira: La tirana y Los sea harrier. In La tirana the subjects are clearly marginalized and the social relationships are defined by violent collectivities or institutions: mafias and the Inquisition (this characteristics are portrayed as a political allegory of the Chilean dictatorship. In Los sea harrier, on the other hand, there are more articulate subjects and the social relations are also more formalized in armies which are fighting each other. Political allegory is also present in this book, but it deals now with the Chilean political transition.
Vandergast, Amy G.
2017-06-02
Habitat and species conservation plans usually rely on monitoring to assess progress towards conservation goals. Southern California, USA, is a hotspot of biodiversity and home to many federally endangered and threatened species. Here, several regional multi-species conservation plans have been implemented to balance development and conservation goals, including in San Diego County. In the San Diego County Management Strategic Plan Area (MSPA), a monitoring framework for the preserve system has been developed with a focus on species monitoring, vegetation monitoring, threats monitoring and abiotic monitoring. Genetic sampling over time (genetic monitoring) has proven useful in gathering species presence and abundance data and detecting population trends, particularly related to species and threats monitoring objectives. This report reviews genetic concepts and techniques of genetics that relate to monitoring goals and outlines components of a genetic monitoring scheme that could be applied in San Diego or in other monitoring frameworks throughout the Nation.
Incidencia de la enfermedad diarreica aguda en menores de cinco años
Directory of Open Access Journals (Sweden)
Mayelín Ávila Labrada
2015-05-01
Full Text Available La enfermedad diarreica aguda es motivo frecuente de consulta pediátrica, representando un problema grave de salud pública. Los agentes infecciosos son causa frecuente de diarrea aguda. Se realizó un estudio descriptivo, retrospectivo sobre la prevalencia de la enfermedad diarreica aguda en menores de cinco años, atendidos en la clínica “Simón Bolívar” en la ciudad de Mariara del municipio Diego Ibarra, Carabobo, Venezuela; en el periodo comprendido entre enero de 2008 y diciembre de 2012, lo cual ofreció información de cinco años completos. La prevalencia de la enfermedad diarreica aguda disminuyó significativamente en el intervalo 2009-2011, sin embargo, se caracterizó por tener la mayor prevalencia en los años extremos, 2012 y 2008, por ese orden. Los varones y los del grupo de uno a cuatro años fueron los que más incidieron en cada uno de los años estudiados
Sebastián de Benavente y la capilla de San Diego de Alcalá
Directory of Open Access Journals (Sweden)
Cruz Yábar, Juan María
2008-12-01
Full Text Available The correct interpretation of the documents concerning the chapel of San Diego in the convent of Santa María de Jesús in Alcalá de Henares demonstrates that the master-architect Sebastián de Benavente played a fundamental role in its invention and realization, including the main altarpiece. For both documental and stylistic reasons, the author attributes to Benavente the drawing from a Florentine private collection until now attributed to Alonso Cano.
La correcta interpretación de los documentos relativos a la capilla de San Diego en el convento de Santa María de Jesús de Alcalá de Henares demuestra que el maestro arquitecto Sebastián de Benavente tuvo un papel fundamental en su invención y realización, incluido el retablo mayor. Consideramos suyo el dibujo de colección particular florentina hasta ahora atribuido a Alonso Cano, lo que defendemos por razones documentales y estilísticas.
Skagen, Kiki, Ed.
Nine papers comprise the proceedings from the conference on cultural interdependence between the border regions of San Diego, California, and Tijuana, Mexico. The papers discuss the following: (1) insurgence of the Southwest's Spanish-speaking minority since 1960; (2) opportunities for cooperation between the United States and Mexican governments;…
Winkler, A.P.
2016-01-01
The grammar written in Latin, in 1668, by the Jesuit missionary Father Diego Luis de Sanvitores (1627-1672) is the oldest description we have of Chamorro, a language spoken on the Mariana islands. The grammar received a number of bad reviews and as a consequence has become neglected and almost
Decolonizing our plates : analyzing San Diego and vegans of color food politics
Navarro, Marilisa Cristina
2011-01-01
This project focuses on discursive formations of race, gender, class, and sexuality within food justice movements as well as these discursive formations within veganism. In particular, I analyze how mainstream food justice movements in San Diego engage in discourses of colorblindness, universalism, individualism, whiteness, and consumption. I also examine how these movements are centered on possessive individualism, or one's capacity to own private property, as the means through which they se...
75 FR 43225 - Finding of No Significant Impact: San Diego-Tijuana Airport Cross Border Facility
2010-07-23
... agencies' comments and the sponsor's responses to those comments. Need and Purpose The San Diego/Tijuana... continue to be zoned for industrial development. This alternative would not meet the purpose and need of... be required. Construction: Minimizing equipment and truck idling Recycling construction waste and...
Diego García Conde, un militar español en la transición al México Independiente
Directory of Open Access Journals (Sweden)
Moncada Maya, José Omar
2016-08-01
Full Text Available Diego García Conde belonged to a long line of Spanish soldiers who rose to key military positions in the eighteenth century. The four García Conde brothers reached the rank of Field Marshal; two of them performing their duties in Spain, while the others were destined to New Spain. Diego García Conde particularly stood out throughout the time he spent serving both the Spanish colonial Government and the new Mexican independent State: he was Military Commander and Governor, the first Director of Engineers of the new nation, as well as Director of the Military Academy. As a volunteer engineer, he also undertook major scientific work, including drawing up a map of Mexico City.Diego García Conde perteneció a una importante saga familiar de militares españoles del siglo XVIII que alcanzaron posiciones relevantes en la estructura del Ejército. Los cuatro hermanos García Conde alcanzaron el rango de Mariscal de Campo, dos de ellos desarrollaron su actividad en España, mientras que los otros dos fueron destinados a la Nueva España. Diego García Conde destacó en forma particular, toda vez que sirvió tanto al gobierno colonial español como al nuevo Estado independiente mexicano, en funciones de Comandante militar y Gobernador Intendente. Fue el primer Director de Ingenieros de la nueva nación, así como Director de la Academia de Cadetes. Pero, además, como ingeniero voluntario, desarrolló una importante labor técnico-científica. Destaca el mapa que elaboró de la ciudad de México.
Directory of Open Access Journals (Sweden)
Osaretin Oviasu
2016-05-01
Full Text Available Chronic kidney disease (CKD is a growing problem in Nigeria, presenting challenges to the nation’s health and economy. This study evaluates the accessibility to healthcare in Edo State of CKD patients diagnosed between 2006 and 2009. Using cost analysis techniques within a geographical information system, an estimated travel time to the hospital was used to examine the spatial accessibility of diagnosed patients to available CKD healthcare in the state. The results from the study indicated that although there was an annual rise in the number of diagnosed cases, there were no significant changes in the proportion of patients that were diagnosed at the last stage of CKD. However, there were indications that the travel time to the hospital for CKD treatment might be a contributing factor to the number of diagnosed CKD cases. This implies that the current structure for CKD management within the state might not be adequate.
Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634
Directory of Open Access Journals (Sweden)
Coello de la Rosa, Alexandre
2009-06-01
Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.
EPA is taking final action to approve revisions to the San Diego County Air Pollution Control District (SDCAPCD) portion of the California SIP concerning volatile organic compound (VOC) emissions from polyester resin operations.
Assessment of Family Planning Services at Community Pharmacies in San Diego, California
Directory of Open Access Journals (Sweden)
Sally Rafie
2013-10-01
Full Text Available Levonorgestrel emergency contraception and other contraceptive methods are available over-the-counter (OTC; however youth continue to face a number of barriers in accessing healthcare services, including lack of knowledge of the method, fear of loss of privacy, difficulties in finding a provider, and cost. A descriptive, nonexperimental, cross-sectional study of a sample of 112 community pharmacies in San Diego, California was conducted between December 2009 and January 2010 to assess community pharmacy practices related to the availability and accessibility of family planning health pharmacy services and products, particularly to youth. A majority (n = 79/112, 70.5% of the pharmacies carried a wide selection of male condoms; however, the other OTC nonhormonal contraceptive products were either not available or available with limited selection. A majority of the pharmacies sold emergency contraception (n = 88/111, 78.6%. Most patient counseling areas consisted of either a public or a semi-private area. A majority of the pharmacy sites did not provide materials or services targeting youth. Significant gaps exist in providing family planning products and services in the majority of community pharmacies in San Diego, California. Education and outreach efforts are needed to promote provision of products and services, particularly to the adolescent population.
Projectile motion in Diego Hurtado de Mendoza's Mecánica and new Renaissance dynamics
Directory of Open Access Journals (Sweden)
Iommi Echeverría, Virginia
2011-06-01
Full Text Available This article considers Diego Hurtado de Mendoza’s translation of the Aristotelian Mechanics in relation to the humanistic and scientific Italian environment of the Renaissance. From the analysis of the last problems on dynamics, it demonstrates the affinity with the works of Piccolomini and Cardano. It also shows the originality of the exegesis made by the Spanish author of Problem XXXIV, in which he combines latemedieval physics with the Aristotelian explanation.Este artículo examina la traducción hecha por Diego Hurtado de Mendoza de la Mecánica aristotélica en el contexto del ambiente científico-humanista italiano de mediados del siglo XVI. A partir del análisis de los últimos problemas sobre dinámica, se demuestra su estrecha relación con las obras de Piccolomini y Cardano; sugiriéndose además la originalidad de la interpretación hecha por el autor español del problema XXXIV basada en la combinación de la física tardomedieval y la explicación aristotélica.
HIV Transmission Networks in the San Diego-Tijuana Border Region.
Mehta, Sanjay R; Wertheim, Joel O; Brouwer, Kimberly C; Wagner, Karla D; Chaillon, Antoine; Strathdee, Steffanie; Patterson, Thomas L; Rangel, Maria G; Vargas, Mlenka; Murrell, Ben; Garfein, Richard; Little, Susan J; Smith, Davey M
2015-10-01
HIV sequence data can be used to reconstruct local transmission networks. Along international borders, like the San Diego-Tijuana region, understanding the dynamics of HIV transmission across reported risks, racial/ethnic groups, and geography can help direct effective prevention efforts on both sides of the border. We gathered sociodemographic, geographic, clinical, and viral sequence data from HIV infected individuals participating in ten studies in the San Diego-Tijuana border region. Phylogenetic and network analysis was performed to infer putative relationships between HIV sequences. Correlates of identified clusters were evaluated and spatiotemporal relationships were explored using Bayesian phylogeographic analysis. After quality filtering, 843 HIV sequences with associated demographic data and 263 background sequences from the region were analyzed, and 138 clusters were inferred (2-23 individuals). Overall, the rate of clustering did not differ by ethnicity, residence, or sex, but bisexuals were less likely to cluster than heterosexuals or men who have sex with men (p = 0.043), and individuals identifying as white (p ≤ 0.01) were more likely to cluster than other races. Clustering individuals were also 3.5 years younger than non-clustering individuals (p Tijuana epidemics were phylogenetically compartmentalized, five clusters contained individuals residing on both sides of the border. This study sampled ~ 7% of HIV infected individuals in the border region, and although the sampled networks on each side of the border were largely separate, there was evidence of persistent bidirectional cross-border transmissions that linked risk groups, thus highlighting the importance of the border region as a "melting pot" of risk groups. NIH, VA, and Pendleton Foundation.
Mussels as Bioindicators: A Case Study of Tributyltin Effects in San Diego Bay.
As part of a Navy research program to evaluate the environmental effects of tributyltin ( TBT ) antifouling coatings and develop in-situ field...documented temporal and spatial variability in TBT and the effects of TBT on growth, bioaccumulation and survival that have not been previously...the mussel bioidicator for assessing TBT effects in San Diego Bay and establishes a significant refinement in the use of mussels as biological
International Nuclear Information System (INIS)
Diaz Rizo, Oscar; Gelen Rudnikas, Alina Katia; Rodriguez, D'Alessandro; Arado Lopez, Juana O.; Dominguez Rodriguez, Roberto; Gonzalez Hernandez, Patricia; Melian Rodriguez, Clara M.; Suarez Munnoz, Margaret; Fagundo Castillo, Juan R.; Blanco Padilla, Dagoberto
2011-01-01
Effects induced by the hurricanes Gustav and Ike on San Diego River mud characteristics have been studied. X-ray fluorescence analysis, gamma spectrometry and measurement of some physico-chemical characteristics in mud samples, collected before and after hurricane impacts, shows that hurricanes induced changes in mud major composition and in some other mud characteristics. The average sedimentation rate determined by gamma spectrometry in San Diego River outlet permitted to estimate that the original mud characteristics will be recovered never before than 5-7 years. Further studies of the influence of mud characteristics changes due the hurricanes impact in mud therapeutic properties are recommended.(author)
Directory of Open Access Journals (Sweden)
Oscar Acosta
2014-01-01
Full Text Available Carrion’s disease (CD, is a human bartonellosis, that is, endemic in the Andes of Peru, Ecuador, and Colombia. Bartonella bacilliformis, a native hemotrophic bacteria, is the causative agent of CD, and the interaction with the host could have produced changes in the gene frequencies of erythrocyte antigens. The goal here is to investigate the relationship between allele frequencies of blood group systems MNS, Diego, and Duffy and the clinical phases of CD, within a genetic context. In this associative and analytical study, 76 individuals from Bagua Grande, the province of Utcubamba, and the department of Amazonas in Peru, were enrolled. Forty of them resided in Tomocho-Collicate-Vista Hermosa area (high prevalence of cases in chronic phase, verrucous, or eruptive phase, without previous acute phase. Thirty-six individuals were from the area of Miraflores (high prevalence of cases in acute phase only and were evaluated for blood group systems MNS, Diego, and Duffy. This study constitutes one of the first attempts at evaluating the genetic factors and clinical phases of CD. No significant statistical differences (P>0.05 between allele frequencies of blood groups MNS, Diego, and Duffy and the prevalence of chronic and acute phases were detected in the two areas of Amazonas, Peru.
International Nuclear Information System (INIS)
Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L.; LeGac, A.; Bardon, T.; Kazarian, S.G.; Silva, R.J.C.
2011-01-01
Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)
Energy Technology Data Exchange (ETDEWEB)
Pessanha, S.; Madeira, T.I.; Manso, M.; Carvalho, M.L., E-mail: luisa@cii.fc.ul.p [Centro de Fisica Atomica da Universidade de Lisboa, Lisboa (Portugal); LeGac, A. [Departamento Conservacao e Restauro, Universidade Nova de Lisboa, Caparica (Portugal); Bardon, T.; Kazarian, S.G. [Department of Chemical Engineering, Imperial College London (United Kingdom); Silva, R.J.C. [CENIMAT/I3N, Departamento de Ciencia dos Materiais, FCT, Universidade Nova de Lisboa, Caparica (Portugal)
2011-07-01
Full text: In 1543 Portuguese sailors arrived in southern Japan and foreign trade flourished there until they were banned and their missionaries expelled, in the early 1600s. The art that Japanese artists created after this contact has its own name: Namban. This work compares two Namban folding screens that depict the same scene, the arrival in a port which may be Nagasaki. One screen is signed by painter Kano Naizen (1570-1616), contemporaneous of this Namban trade, the other screen is attributed to the Edo period (1615-1868) and is what we could consider a second generation screen, a copy of scenes and characters that appear on the first screen but in increased scale and minor detail. The analysis of the screens was performed in situ using portable EDXRF spectrometry. The equipment used in this study consists on an X-ray generator ECLIPSE II from Amptek, with an Ag anode and an Amptek XR-100CR of Si-PIN thermoelectrically cooled detector. Micro-samples were collected and analysed with Raman spectrometry using the Xplora Confocal Raman microscope by Horiba and analyzed with micro-ATR-FTIR spectroscopy and spectroscopic imaging using a Hyperion FTIR microscope with a Ge crystal and combined with a FPA detector. The palette used by both artists seems very similar, opting to gold, malachite, azurite, vermillion, red lead, white oyster shell, and carbon black. Differences were found, namely the resort to mixtures of pigments in the later screen, namely vermillion with red lead in an orange shade of red, and also the mixture of vermillion and carbon black to obtain a brown color. It was also discovered what seems to be the mineral amazonite in the light blue shades of the screen belonging to the Edo Period. (author)
Frecuencia del antígeno y aloanticuerpos del sistema Diego en donantes de sangre.
Góngora, Fernando B; Chiriboga-Ponce, Rosa F
2018-01-01
El sistema Diego es un sistema sanguíneo irregular involucrado de manera clínica en casos de enfermedad hemolítica del recién nacido y en reacciones postransfusionales, dentro de este sistema de han identificado a 22 antígenos eritrocitarios de los cuales el par Di a /Di b son los de mayor importancia por su potencial inmunogénico. Determinar la frecuencia del antígeno Di a y la identificación del aloanticuerpo en la población ecuatoriana. Se realizó un muestreo aleatorio simple y se testó mediante aglutinación en tubo la presencia o ausencia del antígeno y en metodología en gel la presencia del aloanticuerpo anti-Di a . se estableció una prevalencia del antígeno Di a del 25% frente a un 6.09% de aloinmunización por dicho antígeno en donantes de sangre ecuatorianos; no existieron diferencias significativas en la asociación de las variables, siendo estas independientes de la edad y procedencia del donante, sin embargo se pudo constatar que en Ecuador existe población portadora del antígeno Diego Di a y casos de aloinmunización por este sistema debidos probablemente a la incompatibilidad transfusional sea esta por vía maternofetal o por transfusiones de sangre. La distribución de la frecuencia de antígenos y aloanticuerpos del sistema Diego es casi uniforme dentro de la población de nuestro país, probablemente por ser un territorio con alto grado de mestizaje, por lo que es de vital importancia la implementación de la detección de este sistema sanguíneo y su inclusión dentro de los protocolos de detección de anticuerpos irregulares en los bancos de sangre de Ecuador. Copyright: © 2018 SecretarÍa de Salud
75 FR 19248 - Subject: Safety Zone; Sea World Summer Nights Fireworks, Mission Bay, San Diego, CA
2010-04-14
... can better evaluate its effects on them and participate in the rulemaking process. Small businesses...-AA00 Subject: Safety Zone; Sea World Summer Nights Fireworks, Mission Bay, San Diego, CA AGENCY: Coast... navigable waters of Mission Bay in support of the Sea World Summer Nights Fireworks. This safety zone is...
Directory of Open Access Journals (Sweden)
López Calderón, Carme
2013-12-01
Full Text Available In this article we deal with the sculptural and pictorial ensemble in the presbytery and transept of the Cathedral of Saint Mary of Mondoñedo, carried out by Francisco José Terán between 1769 and 1773. We propound its analysis from an iconographic point of view so as to, once subjects are identified, go into their symbolic values in depth. With this, our aim is to try to reconstruct the program —the “lost piece of evidence”— that justifies its choice. In doing so, we act according to the function given by E. Gombrich to the Iconology, that also demands to look for the concrete meaning that this illustrated story has within the context in which it appears. Of that way, handling visual and written sources of the period —standing out those referred to the frescoes by Lucas Jordan in the church of The Escorial, whose similarities with the Mondoñedo program are, at least, strinking— and considering the Counter-Reformation teachings about the prerogatives of the Deipara and the spiritual progress of the faithful, we offer an interpretation focused in the Marian exaltation, whose last target is to remind the people the mediation that, in honour of their Redemption, Virgin undertakes between them and God.En el presente artículo abordamos el conjunto escultórico-pictórico del presbiterio y crucero de la Catedral de Santa María de Mondoñedo, ejecutado por José Francisco Terán entre 1769 y 1773. Proponemos su análisis en términos iconográficos, para, una vez identificados los temas, ahondar en sus valores simbólicos de cara a intentar reconstruir el programa —la “prueba perdida”— que justifica su elección. Actuamos así conforme a la función dada por E. Gombrich a la Iconología, la cual asimismo exige buscar el significado concreto que dicha historia ilustrada posee dentro del contexto en que se gesta. De esta manera, consultando fuentes de época, visuales y escritas —destacando las referidas a los frescos de Lucas
2013-07-26
...] Notice of Availability of the San Diego Gas & Electric Ocotillo Sol Solar Project Final Environmental...) Ocotillo Sol Solar Project in Imperial County, California, and by this notice is announcing its... Ocotillo Sol Solar Project Final EIS/Proposed CDCA Plan Amendment have been sent to affected Federal, State...
Maragall , corresponsal d'Enric de Fuentes i Diego Ruiz: dues cares del mestratge literari
Directory of Open Access Journals (Sweden)
Imma Farré i Vilalta
2015-12-01
Full Text Available Aquest article reconstrueix el grau d’intervenció de Joan Maragall en l’edició de Romàntics d’ara (1906, d’Enric de Fuentes, i de Contes d’un filòsof (1908, de Diego Ruiz, a la Biblioteca Joventut, a partir de les cartes que el poeta va intercanviar amb tots dos corresponsals. Aquestes ens mostren la cara i la creu del mestratge de Maragall (la tutorització i la complicitat, en el cas de Fuentes, i la impermeabilitat als consells, en el de Ruiz i posen sobre la taula més exemples de la incapacitat de professionalització dels escriptors modernistes. This paper rebuilds the degree of participation of Joan Maragall in the edition of Romàntics d’ara (1906, by Enric de Fuentes, and of Contes d’un filòsof (1908, by Diego Ruiz, in the Biblioteca Joventut, from the letters that the poet exchanged with these two correspondents. They show us the heads and tails of the Maragall’s mastery (the tutelage and complicity, in the case of Fuentes, and the impermeability to the advice, in the case of Ruiz and bring up more exemples of the inability of professionalism of the modernist writers.
2013-06-20
...EPA is proposing to approve a revision to the San Diego Air Pollution Control District (SDAPCD) portion of the California State Implementation Plan (SIP). This revision concerns volatile organic compound (VOC) emissions from architectural coatings. We are proposing to approve a local rule to regulate these emission sources under the Clean Air Act (CAA or the Act).
2013-06-20
...EPA is taking direct final action to approve a revision to the San Diego Air Pollution Control District (SDAPCD) portion of the California State Implementation Plan (SIP). This revision concerns volatile organic compound (VOC) emissions from architectural coatings. We are approving a local rule that regulates this emission source under the Clean Air Act (CAA or the Act).
2010-09-17
...EPA is proposing to approve revisions to the San Diego Air Pollution Control District (SDCAPCD) portion of the California State Implementation Plan (SIP). This revision concerns the definition of volatile organic compounds (VOC). We are proposing to approve a local rule to regulate these emission sources under the Clean Air Act as amended in 1990 (CAA or the Act).
Directory of Open Access Journals (Sweden)
Adediran Daniel Ikuomola
2017-12-01
Full Text Available Generally the growing trend of smartphones and selfies cannot be overemphasised in the discourse of social media and mass communication. Selfie is often highlighted as a domain controlled by the youthful population, relegating the agencies of the aged as active participants in the selfie bug. This article captures the agencies of the aged in the use of selfies as a medium of expression. The study employed qualitative research methodology in the data collection through in-depth interviews among a sample of forty-five (45 elderly persons in Edo State, Nigeria. Narratives reveal the ingenuities, nuances and manoeuvring strategies the elderly regularly employ in the use of selfies in their daily routine and social engagements. These narratives were nevertheless not devoid of the need to show-off their achievements and continuous existence and the influence of the younger generation of children and grandchildren, relatives and friends in the use of smartphones and selfies.
2012-05-15
...] Notice of Availability of the San Diego Gas & Electric Ocotillo Sol Solar Project Draft Environmental... & Electric (SDG&E) Ocotillo Sol Solar Project in Imperial County, California, and by this notice is... comments related to the SDG&E Ocotillo Sol Solar Project by any of the following methods: Web site: http...
Groundwater quality in the San Diego Drainages Hydrogeologic Province, California
Wright, Michael T.; Belitz, Kenneth
2011-01-01
More than 40 percent of California's drinking water is from groundwater. To protect this vital resource, the State of California created the Groundwater Ambient Monitoring and Assessment (GAMA) Program. The Priority Basin Project of the GAMA Program provides a comprehensive assessment of the State's groundwater quality and increases public access to groundwater-quality information. The San Diego Drainages Hydrogeologic Province (hereinafter referred to as San Diego) is one of the study units being evaluated. The San Diego study unit is approximately 3,900 square miles and consists of the Temecula Valley, Warner Valley, and 12 other alluvial basins (California Department of Water Resources, 2003). The study unit also consists of all areas outside defined groundwater basins that are within 3 kilometers of a public-supply well. The study unit was separated, based primarily on hydrogeologic settings, into four study areas: Temecula Valley, Warner Valley, Alluvial Basins, and Hard Rock (Wright and others, 2005). The sampling density for the Hard Rock study area, which consists of areas outside of groundwater basins, was much lower than for the other study areas. Consequently, aquifer proportions for the Hard Rock study area are not used to calculate the aquifer proportions shown by the pie charts. An assessment of groundwater quality for the Hard Rock study area can be found in Wright and Belitz, 2011. The temperatures in the coastal part of the study unit are mild with dry summers, moist winters, and an average annual rainfall of about 10 inches. The temperatures in the mountainous eastern part of the study unit are cooler than in the coastal part, with an annual precipitation of about 45 inches that occurs mostly in the winter. The primary aquifers consist of Quaternary-age alluvium and weathered bedrock in the Temecula Valley, Warner Valley, and Alluvial Basins study areas, whereas in the Hard Rock study area the primary aquifers consist mainly of fractured and
Energy Technology Data Exchange (ETDEWEB)
Rolland-Piegue, E. [Ambassade de France au Japon (Japan)
2011-05-15
Behind an apparently universal adherence to corporate social responsibility, differences in approaches are lurking with roots in distinct traditions of thought. Japanese business values date back to merchants during the Edo period and to the pioneers of Japanese capitalism during the Meiji period. They have always emphasized the diversity of all the parties - and not just shareholders - who contribute to a company's prosperity and should share in the benefits. Imported from Europe in 2003, corporate social responsibility was quickly institutionalized by Japanese firms that want to comply with international standards. This concept, Japanese-style, barely touches on social questions, which are referred to traditional values; but focuses instead on environmental issues and consumer protection. Non governmental organizations are not very active in Japan, and the state refuses to take a leading role even though its pro-business policy supports corporate social responsibility and should help, for example, diffuse the new standard, Iso-26000. Since March 2011, a new phase, laden with uncertainty, has started. The most devastating earthquake since World War II and the crisis at the Fukushima Daiichi nuclear power station should lead the Japanese to raise fundamental questions about what they expect from firms and public authorities. (author)
[Health and globalization in the San Diego-Tijuana region].
Villa-Caballero, Leonel; Caballero-Solano, Víctor Manuel; Andrade-Barreto, Olga Alicia
2008-01-01
The international process of trading goods and services with significant reduction in barriers known as globalization is clearly observed at the San Diego-Tijuana region. This essay addresses issues arising at this unique geographical area associated with the globalization process and its public health consequences. Social, cultural and political aspects have very important implications on the health status of the U.S-Mexican population and in the health care systems on both sides of the border. One of the most powerful world economies borders a developing country resulting in a dramatic comparison that has negative outcomes such as health disparities, high prevalence of chronic diseases and new epidemiological risks. Poverty and migration are a few of the contributing factors triggering this asymmetrical relationship. Challenges in border health require a comprehensive binational participation and the solutions are yet to be determined.
Degradation of tributyltin in San Diego Bay, California, waters
International Nuclear Information System (INIS)
Seligman, P.F.; Valkirs, A.O.; Lee, R.F.
1986-01-01
Several experiments were carried out to determine the degradation rate of tributyltin (TBT) in microcosms containing harbor water. Unlabeled or 14 C-labeled tributyltin was added to water samples collected from two stations in San Diego Bay, CA. Degradation rates were determined by calculating the rate of loss of the added parent TBT compound. Calculated half-lives in water collected from a yacht harbor (ambient concentration was 0.5 μg of TBT/L) were 6 and 7 days for light and dark treatments, respectively. Half-lives from a clean-water site ( 14 CO 2 , proceeded slowly with a half-life of 50-75 days. Tributyltin at high concentrations (744 μg/L) was not degraded in sunlight, indicating that photolysis was not taking place and that biological degradation was the primary degradative process for TBT at low ambient concentrations
2010-09-17
...EPA is taking direct final action to approve revisions to the San Diego County Air Pollution Control District (SDCAPCD) portion of the California State Implementation Plan (SIP). This revision concerns the definition of volatile organic compound (VOC). We are approving a local rule that regulates these emission sources under the Clean Air Act as amended in 1990 (CAA or the Act).
Directory of Open Access Journals (Sweden)
K. Haines
2015-04-01
Full Text Available This paper explores issues in the expansion of environmental justice rhetoric to the developing world, and propose insights from resilience theory, political ecology, and bioregionalism as supplements. I do this from the frame of the San Diego-Tijuana region, where regional inequalities are stark and global processes have a heavy local footprint. Sharing a broadly-defined natural region, the growing evidence of ecological crisis increasingly calls for collaboration between two communities which often perceive themselves as relatively disconnected. Understanding challenges to social-ecological resilience and environmental justice in the San Diego-Tijuana region, however, also requires understanding it as an inflection point for global economic, military, and human migration flows occurring at many scales. It is in the context of building effective regional collaboration that environmental justice must engage the analyses of scale and political economy contained in political ecology as a challenge. I suggest, however, that any environmental justice discourse informed by political ecology cannot remain abstract from the local context. A “bioregional” community forged around shared ecological systems may serve as an important resource for creating social-ecological resilience in politically divided territory.
La deportación y la separación familiar en la frontera San Diego- Tijuana
Directory of Open Access Journals (Sweden)
Olivia Ruiz Marrujo
2017-01-01
Full Text Available Las deportaciones de Estados Unidos han llevado a la separación de miles de padres y madres indocumentados de sus hijos. Basándose en el caso de la zona fronteriza San Diego -Tijuana, el objetivo de este artículo es explorar de qué manera la políti ca migratoria llegó a permitir, y en momentos dictar, la separación f amiliar. El tema es abordado dentro de un marco analítico multidimensional y contextual centrado en el entrecruce de: la globalización de la expulsión; las fuerzas hi stóricas que propagar on el uso de la deportación como instrumento de control poblacional en la zona; la interconexión de los sistemas legislativos que actualmente rigen la inmigración y el bienestar del menor; y la praxis. Se argumenta que la separación familiar forzada es un fenómeno arraigado en la frontera San Diego -Tijuana, en el tejido de los regímenes legislativos y en la praxis, lo cual ha terminado por “normalizar” su ejercicio en la región.
Reclassification of SIDS cases--a need for adjustment of the San Diego classification?
DEFF Research Database (Denmark)
Jensen, Lisbeth Lund; Rohde, Marianne Cathrine; Banner, Jytte
2012-01-01
, now representing 38% of the cases; category IB SIDS constituted 10 (20%) and II SIDS 39 (80%) of the SIDS cases. No cases were classified as IA SIDS. Two hundred eighteen infant cases were identified from the files of the Department of Forensic Medicine, Aarhus University, Denmark over a 16-year....... None of the cases met the criteria for IA SIDS. Problems arose in assessing cases with failure to thrive, fever, and possible asphyxia. Modifications to the San Diego subclassifications might improve the consistency of categorizing these cases....
Anthelmintics: From discovery to resistance II (San Diego, 2016
Directory of Open Access Journals (Sweden)
Richard J. Martin
2016-12-01
Full Text Available The second scientific meeting in the series: “Anthelmintics: From Discovery to Resistance” was held in San Diego in February, 2016. The focus topics of the meeting, related to anthelmintic discovery and resistance, were novel technologies, bioinformatics, commercial interests, anthelmintic modes of action and anthelmintic resistance. Basic scientific, human and veterinary interests were addressed in oral and poster presentations. The delegates were from universities and industries in the US, Europe, Australia and New Zealand. The papers were a great representation of the field, and included the use of C. elegans for lead discovery, mechanisms of anthelmintic resistance, nematode neuropeptides, proteases, B. thuringiensis crystal protein, nicotinic receptors, emodepside, benzimidazoles, P-glycoproteins, natural products, microfluidic techniques and bioinformatics approaches. The NIH also presented NIAID-specific parasite genomic priorities and initiatives. From these papers we introduce below selected papers with a focus on anthelmintic drug screening and development.
Opportunities and obstacles for rangeland conservation in San Diego County, California, USA
Directory of Open Access Journals (Sweden)
Kathleen A. Farley
2017-03-01
Full Text Available Working landscapes such as rangelands are increasingly recognized as having high conservation value, providing a variety of ecosystem services, including food, fiber, habitat, recreation, open space, carbon storage, and water, in addition to a broad range of social benefits. However, conversion of rangelands to other land uses has been prevalent throughout the western United States, leading to greater attention in the conservation community to the importance of collaborating with private landowners. The level of interest in collaborative conservation among private landowners and the types of conservation programs they choose to participate in depend on the social, economic, and environmental context. We used GIS analysis and interviews with ranchers to evaluate rangeland conversion and participation in conservation programs among ranchers in San Diego County, California, USA, which is part of a biodiversity hotspot with high plant species richness and a large number of endemic and rare species. We found that > 25% of rangelands were converted to other uses, primarily urbanization, over the past 25 years while the area of public rangeland increased by 9%. Interviews revealed that ranchers in San Diego County have had limited involvement with most conservation programs, and a critical factor for nonparticipation was providing programs access to private land, along with other issues related to trust and social values. Among ranchers who had participated in conservation programs, the payment level and the agency or organization administering the program were key factors. Our results provide insight into factors influencing whether and when ranchers are likely to participate in conservation initiatives and illustrate that private and public land conservation are strongly linked and would be more effective if the two strategies were better integrated.
2010-04-14
... DEPARTMENT OF THE INTERIOR Bureau of Land Management [CACA 47740, LLCAD07000 L51030000] Notice of Closure of Airport Mesa/Carizzo Creek Shooting Area in Eastern San Diego County, CA AGENCY: Bureau of Land Management, Interior. ACTION: Notice of temporary closure. SUMMARY: The Bureau of Land Management (BLM) has...
Deborah J. Chavez
1995-01-01
Examination of natural resources often leaves out one important component-the human element. To enable resource managers and researchers to exchange information and ideas about the human dimensions of natural resources, the second Symposium on Social Aspects and Recreation Research was held February 23-25, 1994, in San Diego, California. The format of the symposium...
Expanding the Graduate Education Experience at Scripps Institution of Oceanography, UC San Diego
Peach, C. L.; Kilb, D. L.; Zmarzly, D.; Abeyta, E.
2016-02-01
Emerging career pathways for graduate students in earth, ocean and climate sciences increasingly require skills in teaching and communication. This is true of academic careers, in which demonstrated teaching skills make applicants for faculty positions far more competitive, and traditionally less conventional careers outside of academia that require cross-disciplinary collaboration and/or communication to audiences not directly involved in science research (e.g. policy makers, educators, the public). Yet most graduate education programs provide little to no opportunity or incentive for young investigators to develop and hone these skills, and graduate students are often discouraged from deviating from the traditional "research apprenticeship" model during their graduate education. At Scripps, the Birch Aquarium at Scripps, and UC San Diego Extension, we are developing new ways to integrate teaching, communication, and outreach into our graduate education program, thus broadening the scope of graduate training and better serving the needs and evolving career aspirations of our graduate students. This effort is an integral part of our overall outreach strategy a Scripps in which we seek to combine high quality STEM outreach and teaching with opportunities for Scripps graduate students to put their teaching and communications training into practice. The overall effort is a "win-win" both for our students and for the highly diverse K-16 community in San Diego County. In this talk we will summarize the programmatic efforts currently underway at Scripps, our strategic collaboration with UCSD Extension, which is expanding the capacity and reach of our integrated program, and our plans for sustaining these efforts for the long term.
Directory of Open Access Journals (Sweden)
Mazzini, Elena
2011-02-01
Full Text Available This article intends to examine Diego Fabbri's play, 'The Trial of Jesus', and its reception by the Italian Catholic press in the mid Fifties. The play and the comments generated by the press demonstrated how the circulation of Anti-Semitic prejudices is reflected through the mise en scène of Jesus' death provoked, according to theological catholic stereotype, by the Jews. The guilt felt by the Jewish people for having killed the Messiah -the deicide's guilt- had a leading role both in the play and in the Catholic press that have linked this supposed Jewish culpability to the massacres suffered by the Jews over the centuries.
TRIBUTOS E IMPUESTOS EN DIEGO DE AVENDAÑO. UN CAPÍTULO DE ÉTICA COLONIAL
Directory of Open Access Journals (Sweden)
Angel Garcia
2001-01-01
Full Text Available En 1668, Diego de Avendaño, jesuita peruano, publicaba en Amberes su Thesaurus Indicus, obra de contenido ético-jurídico, que –en intención del autor– pretendía ser guía para el Consejo de Indias en referencia al recto gobierno de las colonias americanas. El presente trabajo expone la visión que el jesuita presenta en su obra, sobre los diferentes impuestos y tributos en las colonias.
2013-01-08
...-FF08RSDC00] Otay River Estuary Restoration Project; South San Diego Bay Unit and Sweetwater Marsh Unit of the... scoping with regard to the environmental impact statement (EIS) for the proposed Otay River Estuary... one of the following methods. Email: [email protected] . Please include ``Otay Estuary NOI'' in the...
K. Haines
2015-01-01
This paper explores issues in the expansion of environmental justice rhetoric to the developing world, and propose insights from resilience theory, political ecology, and bioregionalism as supplements. I do this from the frame of the San Diego-Tijuana region, where regional inequalities are stark and global processes have a heavy local footprint. Sharing a broadly-defined natural region, the growing evidence of ecological crisis increasingly calls for collaboration between two communities whi...
2012-08-28
... DEPARTMENT OF THE INTERIOR Bureau of Land Management [CACA-51625, LLCAD07000, L51010000, ER0000, LVRWB10B3800] Notice of Availability of the Record of Decision for San Diego Gas and Electric's East County...&E filed right-of-way (ROW) application CACA-51625 for the ECO Substation Project. The ECO Substation...
Marinkovich, Matt; Wallace, Chelsea; Morris, Pat J; Rideout, Bruce; Pye, Geoffrey W
2016-03-01
The preshipment examination, with associated transmissible disease testing, has become standard practice in the movement of animals between zoos. An alternative disease risk-based approach, based on a comprehensive surveillance program including necropsy and preventive medicine examination testing and data, has been in practice since 2006 between the San Diego Zoo and San Diego Zoo Safari Park. A retrospective analysis, evaluating comprehensive necropsy data and preshipment testing over a 5-yr study period, was performed to determine the viability of this model for use with sending animals to other institutions. Animals (607 birds, 704 reptiles and amphibians, and 341 mammals) were shipped to 116 Association of Zoos and Aquariums (AZA)-accredited and 29 non-AZA-accredited institutions. The evaluation showed no evidence of the specific transmissible diseases tested for during the preshipment exam being present within the San Diego Zoo collection. We suggest that a risk-based animal and institution-specific approach to transmissible disease preshipment testing is more cost effective and is in the better interest of animal welfare than the current industry standard of dogmatic preshipment testing.
Winkler, A.P.
2016-01-01
The grammar written in Latin, in 1668, by the Jesuit missionary Father Diego Luis de Sanvitores (1627-1672) is the oldest description we have of Chamorro, a language spoken on the Mariana islands. The grammar received a number of bad reviews and as a consequence has become neglected and almost forgotten. The main point of criticism has been that Sanvitores used the Latin grammatical framework to explain a language that in many ways does not fit this framework. In this thesis it is argued inst...
Directory of Open Access Journals (Sweden)
Daiane Cobianchi Costa
Full Text Available ABSTRACT BACKGROUND: Red blood cell genes are highly polymorphic with the distribution of alleles varying between different populations and ethnic groups. The objective of this study was to investigate gene polymorphisms of blood groups in the state of Santa Catarina, Southern Brazil. METHODS: Three hundred and seventy-three unrelated blood donors and 31 transfusion-dependent patients were evaluated to investigate polymorphisms of the Rh, Kell, Duffy, Kidd, and Diego blood group systems in a population from the state of Santa Catarina. The subjects, from seven regions that comprise the blood-banking network of the state, were assessed between August 2011 and March 2014. The genotypes of the Rh, Kell, Duffy, Kidd, and Diego systems were determined using the restriction fragment length polymorphism-polymerase chain reaction and allele-specific polymerase chain reaction techniques. RESULTS: The genotype frequencies in this study were significantly different when populations from different regions of Santa Catarina were compared. Furthermore, there were also significant differences in the genetic frequencies compared to other Brazilian states. The genotype frequencies of the Kell and Kidd blood groups are similar to European populations from Naples, Italy and Zurich, Switzerland. CONCLUSION: This article reports for the first time the frequency of polymorphisms of blood group systems in blood donors from Santa Catarina, Southern Brazil.
Entropy-Based Economic Denial of Sustainability Detection
Directory of Open Access Journals (Sweden)
Marco Antonio Sotelo Monge
2017-11-01
Full Text Available In recent years, an important increase in the amount and impact of Distributed Denial of Service (DDoS threats has been reported by the different information security organizations. They typically target the depletion of the computational resources of the victims, hence drastically harming their operational capabilities. Inspired by these methods, Economic Denial of Sustainability (EDoS attacks pose a similar motivation, but adapted to Cloud computing environments, where the denial is achieved by damaging the economy of both suppliers and customers. Therefore, the most common EDoS approach is making the offered services unsustainable by exploiting their auto-scaling algorithms. In order to contribute to their mitigation, this paper introduces a novel EDoS detection method based on the study of entropy variations related with metrics taken into account when deciding auto-scaling actuations. Through the prediction and definition of adaptive thresholds, unexpected behaviors capable of fraudulently demand new resource hiring are distinguished. With the purpose of demonstrate the effectiveness of the proposal, an experimental scenario adapted to the singularities of the EDoS threats and the assumptions driven by their original definition is described in depth. The preliminary results proved high accuracy.
Alquimia, Química y Filosofía Alquímica en la obra del extremeño Diego de Santiago
Directory of Open Access Journals (Sweden)
Teixidó Gómez, Francisco
1998-06-01
Full Text Available In this work a study is made on the work Arte separatoria by Diego de Santiago, royal distiller at Felipe II court. The study proves his ability as an investigator and his thorough knowledge on the elaboration of materials and the remedies to heal diseases, undoubtedly under the influence of Paracelso.
It is pointed out that De Santiago defends romance language versus latin in order to spread his achievements.
En este trabajo se hace un estudio sobre la obra Arte separatoria de Diego de Santiago, destilador real en la corte de Felipe II El estudio pone de manifiesto la actividad investigadora de Santiago, así como el conocimiento detallado que tiene sobre la elaboración de los materiales y los remedios para sanar las distintas enfermedades, sin duda bajo la influencia de Paracelso.
Se hacer notar que De Santiago defiende la lengua vulgar, frente al latín, para difundir sus conocimientos.
Historia, circunstancia y libertad en la obra de Diego Abad de Santillán
Pérez de Blas, Fernando
2002-01-01
Partiendo de la lectura de la obra de Diego Abad de Santillán (1897-1983) pretendo mostrar un modelo de testimonio ético, que nacido de la libertad intenta dar consistencia práxica, real a un ideal nacido en el ámbito crítico-teórico. Este testimonio actúa de equilibrio superador de la tensión dialéctica que existe entre una realidad no acorde con el ideal (circunstancia) y el anhelo de una situación coherente con la utopía concebida. Este tenso entramado vital, que tiene su trasunto históric...
Directory of Open Access Journals (Sweden)
Ekaterina Bustamante
Full Text Available Introducción: El Síndrome de Burnout se ha definido como una respuesta al estrés laboral crónico. Debido a la importancia de la labor realizada por los docentes, y los altos niveles de estrés que esta profesión genera, con los agravantes de la presencia de factores externos personales y organizacionales que puedan estar presentes, se hace evidente la necesidad de estudiar en los docentes el síndrome de burnout. Objetivo: Determinar los niveles del síndrome de burnout existentes en el personal docente de la Escuela de Bioanálisis de la Universidad de Carabobo Sede Aragua, Venezuela. Material y métodos: Estudio de campo de tipo descriptivo y documental. La población estuvo constituida por un total de 96 docentes (ordinarios y contratados. Para la selección de la muestra se empleó un muestreo de tipo no probabilístico de carácter intencional, y quedó representada por un total de 78 docentes. Los datos fueron recolectados por medio de un cuestionario, la versión en español del Maslach Burnout Inventory (MBI. Los datos, fueron analizados usando el programa estadístico Minitab 16 y siguiendo los criterios del Manual de EEUU de Maslach y Jackson en cuanto a los puntos de corte para las dimensiones que mide el cuestionario. Resultados: Se obtuvo un 57,69% de respuesta. Se encontró que el 16% de los docentes bajo estudio presenta el síndrome de burnout; mientras que en el resto de los docentes hubo un predominio de niveles medios en las dimensiones Agotamiento Emocional (53%, Despersonalización (33% y Realización Personal (55%. Conclusión: Se concluye que la población bajo estudio, solo presentan el síndrome el 16% de los docentes. Sin embargo en la mayoría de los docentes, hubo un predominio de niveles medios para las dimensiones Agotamiento Emocional, Despersonalización y Realización personal. Según esta combinación de niveles, si no se toman las medidas preventivas para su afrontamiento estos docentes pueden llegar a
Directory of Open Access Journals (Sweden)
Emiri
2015-08-01
Full Text Available Abstract Libraries all over the world have been faced with the evolving technological advancement globalization and digitization of information. These have led to library automation digital and virtual libraries. This paper discussed the contemporary digital literacy skills DLS among librarians in university libraries the 21st century in Edo and Delta States of Southern Nigeria. The study was guided by six objectives and research questions and one hypothesis. The design of the study is descriptive survey and the population consists of all librarians from university libraries in the aforementioned states in Nigeria. The instrument used to generate data is the questionnaire and the date generated was analyzed using simple percentages and frequency count for research questions and SPSS version 14.0. The findings show that electronic mailing social networking use of PDAs mobile phones and internet surfing are the major DLS amongst librarians. It was also discovered that librarians acquired DLS through colleagues assistance trial and error IT programmes and formal education while librarians level of use of DLS is low amongst other findings. Researcher recommends that management of university libraries should provide training for librarians so as to help update their knowledge in application of digital skills and digital skill competence should be giving more attention during recruitment of librarians amongst others.
Enato, E F O; Mens, P F; Okhamafe, A O; Okpere, E E; Pogoson, E; Schallig, H D F H
2009-05-01
This study evaluated malaria care-seeking behaviour, as well as the prevalence of parasitaemia and anaemia among pregnant women attending antenatal clinics of two tertiary healthcare facilities in Edo State, Nigeria. Malaria was highly prevalent in the study group (20% by microscopy and estimated 25% by PCR), but parasitaemia and incidence decreased with increasing number of pregnancies. Although the level of education of the study participants was relatively high, antimalarial control measures during pregnancy were found to be poorly utilised by the women and malaria care-seeking was often delayed. A minority of the interviewed pregnant women said they had received sulphadoxine/pyrimethamine-based intermittent preventive therapy (IPT) during current pregnancy. Moreover, the use of inferior antimalaria treatment (e.g. chloroquine) was frequent. The majority of the pregnant women, mainly primigravidae, were anaemic. Efforts to improve antimalaria healthcare must be intensified, targeting pregnant women, particularly the primigravidae and secundigravidae and the healthcare providers.
Vid, viñedos y vino en Sefarad : cultivo elaboración y comercio de un vino diferenciador
Directory of Open Access Journals (Sweden)
Ana María Rivera Medina
2007-01-01
Full Text Available Las comunidades hebreas peninsulares, a lo largo de la Edad Media, desarrollaron un complejo sistema de cultivo, elaboración y comercio del vino acorde con prescripciones religiosas ligadas al concepto de pureza. De ahí, que vista su importancia pretendemos analizar su función como bebida en las festividades religiosas y celebraciones; la jurisprudencia relativa a la propiedad, el cultivo y la elaboración del vino judío; y finalmente, mostrar cómo las comunidades sefardíes o sus individuos acceden a la tierra, cómo se trabajan estos viñedos y se genera una industria subsidiaria, a pesar de las diversas restricciones que se imponen desde una sociedad mayoristamente cristiana.The Hebrew communities of the Iberian peninsula, along the Middle Ages, developed a complex system for the cultivation, elaboration and trade of the wine, in agreement with religious prescriptions tied to the concept of purity. In reason to its importance, we will analyze its function like drink in the religious festivities and other celebrations; the jurisprudence relative to the property, cultivation and elaboration of the Jewish wine; and, finally, we will show how the sefardíes communities or their individuals consent to the earth, how these vineyards are worked and a subsidiary industry is generated, in spite of the diverse restrictions that are imposed from a society of Christian majority.
Bennett, Rachel J.; Brodine, Stephanie; Waalen, Jill; Moser, Kathleen; Rodwell, Timothy C.
2014-01-01
Objectives. We determined the prevalence and treatment rates of latent tuberculosis infection (LTBI) in newly arrived refugees in San Diego County, California, and assessed demographic and clinical characteristics associated with these outcomes. Methods. We analyzed data from LTBI screening results of 4280 refugees resettled in San Diego County between January 2010 and October 2012. Using multivariate logistic regression, we calculated the associations between demographic and clinical risk factors and the outcomes of LTBI diagnosis and LTBI treatment initiation. Results. The prevalence of LTBI was highest among refugees from sub-Saharan Africa (43%) and was associated with current smoking and having a clinical comorbidity that increases the risk for active tuberculosis. Although refugees from sub-Saharan Africa had the highest prevalence of infection, they were significantly less likely to initiate treatment than refugees from the Middle East. Refugees with postsecondary education were significantly more likely to initiate LTBI treatment. Conclusions. Public health strategies are needed to increase treatment rates among high-risk refugees with LTBI. Particular attention is required among refugees from sub-Saharan Africa and those with less education. PMID:24524534
Macrofaunal recolonization of copper-contaminated sediments in San Diego Bay.
Neira, Carlos; Mendoza, Guillermo; Porrachia, Magali; Stransky, Chris; Levin, Lisa A
2015-12-30
Effects of Cu-loading on macrofaunal recolonization were examined in Shelter Island Yacht Basin (San Diego Bay, California). Sediments with high and low Cu levels were defaunated and Cu-spiked, translocated, and then placed back into the environment. These demonstrated that the alteration observed in benthic communities associated with Cu contamination occurs during initial recolonization. After a 3-month exposure to sediments with varying Cu levels, two primary colonizing communities were identified: (1) a "mouth assemblage" resembling adjacent background fauna associated with low-Cu levels that was more diverse and predominantly dominated by surface- and subsurface-deposit feeders, burrowers, and tube builders, and (2) a "head assemblage" resembling adjacent background fauna associated with high-Cu concentrations, with few dominant species and an increasing importance of carnivores and mobile epifauna. Cu loading can cause reduced biodiversity and lower structural complexity that may last several months if high concentrations persist, with a direct effect on community functioning. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Regla Caridad Broche Candó
2011-06-01
Full Text Available Introducción: la lactancia materna ha sido la forma de alimentación más segura para el ser humano en toda su historia. Esta leche es la única que asegura al niño pequeño una alimentación adecuada y le protege de las infecciones. Objetivo: determinar el comportamiento de los principales factores socioculturales y psicológicos vinculados a la práctica y abandono de la lactancia materna exclusiva y su repercusión en el estado de salud de los lactantes. Métodos: se realizó un estudio descriptivo de corte transversal, en el municipio Diego Ibarra, Estado de Carabobo, en el año 2008. La muestra estuvo conformada por 96 lactantes cuyas madres dieron su consentimiento informado para participar en este. Resultados: se observó un predominio de las madres adolescentes asociado al abandono de la lactancia materna antes de los 4 meses, la secundaria fue el nivel escolar más frecuente en la serie, sin embargo, el predominio de la categoría de obrera o técnica se asoció a una lactancia menor de 4 meses. Conclusiones: al nacimiento predominó la lactancia materna mixta, con una tendencia progresiva al uso de la lactancia artificial a partir del cuarto mes. Se encontró mayor frecuencia de madres con conocimientos deficientes sobre la lactancia materna, y fueron estas las que lactaron a sus bebés por menor tiempo. Más de las tres cuartas partes de las mujeres refirieron como causa de abandono de la lactancia materna exclusiva, que el niño se quedaba con hambre y la insuficiente disponibilidad de leche en las mamas.Introduction: the breastfeeding has been the more safe feeding way for human being in all its history. This type of milk is the only assuring the infant a proper feeding while protecting him of infections. Objective: to determine the behavior of main sociocultural and psychological factors linked to practice and giving up of the exclusive breastfeeding and its repercussion on infant health status. Methods: a cross-sectional and
Thelen, Brian; French, Nancy H F; Koziol, Benjamin W; Billmire, Michael; Owen, Robert Chris; Johnson, Jeffrey; Ginsberg, Michele; Loboda, Tatiana; Wu, Shiliang
2013-11-05
A study of the impacts on respiratory health of the 2007 wildland fires in and around San Diego County, California is presented. This study helps to address the impact of fire emissions on human health by modeling the exposure potential of proximate populations to atmospheric particulate matter (PM) from vegetation fires. Currently, there is no standard methodology to model and forecast the potential respiratory health effects of PM plumes from wildland fires, and in part this is due to a lack of methodology for rigorously relating the two. The contribution in this research specifically targets that absence by modeling explicitly the emission, transmission, and distribution of PM following a wildland fire in both space and time. Coupled empirical and deterministic models describing particulate matter (PM) emissions and atmospheric dispersion were linked to spatially explicit syndromic surveillance health data records collected through the San Diego Aberration Detection and Incident Characterization (SDADIC) system using a Generalized Additive Modeling (GAM) statistical approach. Two levels of geographic aggregation were modeled, a county-wide regional level and division of the county into six sub regions. Selected health syndromes within SDADIC from 16 emergency departments within San Diego County relevant for respiratory health were identified for inclusion in the model. The model captured the variability in emergency department visits due to several factors by including nine ancillary variables in addition to wildfire PM concentration. The model coefficients and nonlinear function plots indicate that at peak fire PM concentrations the odds of a person seeking emergency care is increased by approximately 50% compared to non-fire conditions (40% for the regional case, 70% for a geographically specific case). The sub-regional analyses show that demographic variables also influence respiratory health outcomes from smoke. The model developed in this study allows a
La deportación y la separación familiar en la frontera San Diego- Tijuana
Olivia Ruiz Marrujo
2017-01-01
Las deportaciones de Estados Unidos han llevado a la separación de miles de padres y madres indocumentados de sus hijos. Basándose en el caso de la zona fronteriza San Diego -Tijuana, el objetivo de este artículo es explorar de qué manera la políti ca migratoria llegó a permitir, y en momentos dictar, la separación f amiliar. El tema es abordado dentro de un marco analítico multidimensional y contextual centrado en el ent...
Ault, Andrew P; Moore, Meagan J; Furutani, Hiroshi; Prather, Kimberly A
2009-05-15
Oceangoing ships emit an estimated 1.2-1.6 million metric tons (Tg) of PM10 per year and represent a significant source of air pollution to coastal communities. As shown herein, ship and other emissions near the Los Angeles and Long Beach Port region strongly influence air pollution levels in the San Diego area. During time periods with regional transport, atmospheric aerosol measurements in La Jolla, California show an increase in 0.5-1 microm sized single particles with unique signatures including soot, metals (i.e., vanadium, iron, and nickel), sulfate, and nitrate. These particles are attributed to primary emissions from residual oil sourcessuch as ships and refineries, as well as traffic in the port region, and secondary processing during transport. During regional transport events, particulate matter concentrations were 2-4 times higher than typical average concentrations from local sources, indicating the health, environmental, and climate impacts from these emission sources must be taken into consideration in the San Diego region. Unless significant regulations are imposed on shipping-related activities, these emission sources will become even more important to California air quality as cars and truck emissions undergo further regulations and residual oil sources such as shipping continue to expand.
Directory of Open Access Journals (Sweden)
Dina Comisarenco Mirkin
2010-11-01
Full Text Available En el presente trabajo se estudia la representación del arquetipo femenino en la obra mural de Diego Rivera que el artista entretejió en sus amplios y complejos programas iconográficos con una extraordinaria imaginación poética. Se postula aquí que por una parte, dicha representación arquetípica partió de su erudita utilización de símbolos alegóricos y de alusiones a divinidades femeninas de distintas épocas y lugares, como medio para asegurar la universalidad del contenido histórico de su pintura, y que por otra parte, y de forma esencial, el origen de sus poderosas imágenes femeninas, se remonta a algunas de las experiencias vitales del artista, en particular a aquellas relacionadas con el amor filial, con la maternidad/paternidad, y con las heterodoxas relaciones amorosas que Rivera mantuvo a lo largo de su vida con sobresalientes mujeres de su época a quienes admiró y reconoció a través de sus impactantes retratos y homenajes pictóricos. Se concluye así que el arte mural fue para Rivera no sólo un instrumento de acción política, tal y como es normalmente reconocido por la crítica especializada, sino también, una oportunidad para elaborar temas de carácter subjetivo, en los que paradójicamente alcanza un mayor grado de generalidad y trascendencia que el que caracteriza a su pintura histórica. Particularmente la expresión simbólica del arquetipo femenino plasmada por Rivera en algunos de sus principales aspectos como la Buena Madre, la Madre Terrible y, la Gran Madre, tal y como los fue viviendo, construyendo y modificando a través de algunas de sus experiencias vitales más significativas y profundas de su vida personal, constituye uno de los logros artísticos más eminentes del artista y uno de sus
Determinants of cord care practices among mothers in Benin City, Edo State, Nigeria.
Abhulimhen-Iyoha, B I; Ibadin, M O
2012-01-01
Mothers care for their infants' umbilical cord stump in various ways. Different cord care practices have been documented; some are beneficial while others are harmful. Who and what influence the cord care practiced by mothers have, however, not been fully explored particularly in the study locale. The objective of this study was to determine the factors that influence cord care practices among mothers in Benin City. The study subjects included 497 mothers who brought their babies to Well Baby/Immunization Clinic at the University of Benin Teaching Hospital (UBTH), Benin City, Edo State, between July and August 2009. A structured questionnaire served as an instrument to extract information on their biodata and possible determinants of cord care practices. Significantly older women (P=0.023), educated mothers (P=0.029), and those who had male babies (P=0.013) practiced beneficial cord stump care practices. Beneficial cord care practice increased with increasing maternal educational status. The best predictors of beneficial cord care practices are maternal level of education (P=0.029) and infant's sex (P=0.013). The use of harmful cord care practices was more common among mothers who delivered outside the Teaching hospitals. Most (71.2%) of the mothers were aware of hygienic/beneficial cord care. The choices of cord care methods eventually practiced by mothers were influenced mainly by the disposition of nurses (51.3%), participants' mothers (32.0%), and their mothers-in-law (5.8%). There was no significant relationship between cord care practice on one hand and maternal parity, tribe, and socioeconomic classes on the other. The need for female education is again emphasized. The current findings strongly justify the need for public enlightenment programs, using the mass media and health talks in health facilities, targeting not only women of reproductive age but also secondary audience like their mothers, mothers-in-law, nurses, and attendants at health facilities
WEST AFRICAN JOURNAL OF MEDICINE
African Journals Online (AJOL)
user1
Departments of *Medicine, University of Benin Teaching Hospital, Benin City, Edo State, †Medicine, College of Health Sciences,. Benue State University, Makurdi, Benue State, Nigeria. *Correspondence: Dr Andrew Edo, PO BOX 10458, Ugbowo, Benin City, Edo State. E-mail: osayumen@yahoo.com. Tel No.
Directory of Open Access Journals (Sweden)
C.I. Cragnolini
2009-12-01
Full Text Available Desde 2001 se observan en viñedos de Córdoba, Argentina, hojas de Vitis vinifera y V. labrusca con manchas cloróticas y centro necrótico. Las plantas presentan nervaduras, pecíolos, raquis y entrenudos con puntos necróticos que al confluir agrietan el tejido cortical. Las bayas pueden marchitarse y desprenderse. En invierno los sarmientos toman color blanquecino con manchas negras, y en ellos y en órganos secos aparecen picnidios con cirros blanco-crema con conidios alfa y beta. El objetivo fue confirmar la presencia de Phomopsis viticola (excoriosis y cuantificar su incidencia. Se realizaron aislamientos a partir de pecíolos, brotes, zarcillos, bayas y sarmientos que produjeron micelio claro con picnidios y conidios alfa (7,5m±1,5 x 2,8m±2 y beta (19m±1 x 1,2m±0,5 o sólo alfa, típicos de P. viticola. La identificación fue confirmada mediante secuenciación molecular. En brotes de las variedades Malbec y Pinot noir inoculados con 3 10(4 conidios/mL, las hojas mostraron lesiones y picnidios 8 días después, y las bayas cirros amarillos a los 15-18 días. P. viticola (Sacc. Sacc. fue reaislado de los cirros y las colonias produjeron picnidios y conidios característicos 10-20 días después. Se detectó excoriosis en 80% de los viñedos evaluados, con mayor incidencia en viñedos añosos de las variedades Pinot noir e Isabella.Leaves with chlorotic spots and necrotic centers have been observed in Vitis vinifera and V. labrusca in vineyards of Córdoba, Argentina, since 2001. Plants exhibit veins, petioles, rachises, and internodes with necrotic spots that coalesce to form cracks in the cortical tissue. Grape berries can shrivel and fall off. Winter canes became whitish with black spots; pycnidia appear in canes and in dry organs, exuding whitish-cream cirri with alpha and beta conidia. The aim of this work was to confirm the presence of Phomopsis viticola (excoriosis and quantify its incidence. Isolates obtained from petioles
Early site review report for the Sundesert site, San Diego Gas and Electric Company. Project No. 558
International Nuclear Information System (INIS)
1977-01-01
The purpose of the report is to present the Nuclear Regulatory Commission's evaluation of several of the matters relating to the suitability of the Sundesert site near Blythe, California, on which the San Diego Gas and Electric Company proposes to build the Sundesert Nuclear Plant, Units 1 and 2. The report summarizes the results of the technical evaluation of the suitability of the proposed Sundesert site for a nuclear plant and delineates the scope of the technical matters considered in evaluating the suitability of the site
Manlutac, Anna Liza M; Giesick, Jill S; McVay, Patricia A
2013-12-01
HIV screening assays have gone through several generations of development in an effort to narrow the "window period" of detection. Utilizing a fourth generation HIV screening assay has the potential to detect earlier HIV infection, thus reducing HIV-1 transmission. To identify acute infections to decrease HIV transmission in San Diego County. Serum specimens were collected from clients seen by multiple submitters in San Diego County. All acceptable specimens were screened using the 4th Gen Combo Assay. Initially reactive specimens were repeated in duplicate and if repeatedly reactive, were confirmed by HIV-1 Immunofluorescent Antibody Assay (IFA). IFA negative/inconclusive specimens were sent for HIV-1 NAT and HIV-2 antibody testing to referral laboratories. BioRad Multispot HIV-1/HIV-2 Rapid Test was also performed on a subset of specimens. Of 14,559 specimens received in 20 months, 14,517 specimens were tested. Of the 14,517 specimens that were tested, a total of 279 (1.9%) specimens were CIA repeatedly reactive and 240 of the 279 confirmed by HIV-1 IFA. Thirty-nine gave IFA negative/inconclusive result and 30 were further tested for HIV-1 NAT and 36 for HIV-2 antibody. Thirteen specimens were considered false positives by CIA and 17 specimens were classified as acute infections. Eleven of 39 IFA negative/inconclusive specimens were further tested by Multispot. Five of the 11 were positive by Multispot. The fourth generation Abbott ARCHITECT HIV Ag/Ab Combo Assay identified 17 patients who may have been missed by the prior HIV-1 screening assay used at San Diego County Public Health Laboratory. Copyright © 2013 Elsevier B.V. All rights reserved.
Quantification of uranium levels in groundwater in the municipality of San Diego de la Union Mexico
International Nuclear Information System (INIS)
Hernandez M, H.; Rios L, M. J.; Gaytan H, D.; Romero G, E. T.
2017-10-01
The objective of this work was to quantify the levels of uranium (U) in groundwater from 22 wells in the municipality of San Diego de la Union Mexico. The sampled wells were classified as not regularized and regularized according to records of the National Water Commission and classified by zones A, B, C, D and E. Samples were collected in triplicate in 1 L bottles, then acidified with ultra pure HNO 3 at 2% v/v and conserved at 4 degrees Celsius until analysis by mass spectrometry with magnetic sector with inductively coupled plasma source (Icp-SFMS). The preparation method was the acid digestion in the open system and re-concentration of the sample. In addition, 1 μg L -1 of indium (In) was used as a tracer to know the performance of the method. Finally, the samples were diluted in 10 ml and introduced to the Icp-SFMS to measure in low resolution the U isotopes (U-234, U-235 and U-238). The average results obtained from total U were: A= 3.65 ± 1.89 μg L -1 , B= 6.37 ± 1.46 μg L -1 , C= 3.20 ± 2.27 μg L -1 , D= 3.87 ± 1.31 μg L -1 and E= 4.44 ± 1.17 μg L -1 . According to the official Mexican standard NOM-014-CONAGUA-2003, the U levels found in the groundwater of San Diego de la Union Mexico do not exceed the permissible limits of 30 μg/L. (Author)
Energy Technology Data Exchange (ETDEWEB)
Hernandez M, H. [Universidad del Centro de Mexico, Capitan Caldera 75, Col. Tequixquiapan, 78250 San Luis Potosi, SLP (Mexico); Rios L, M. J.; Gaytan H, D. [Universidad Autonoma de San Luis Potosi, Facultad de Enfermeria y Nutricion, Unidad de Posgrado, Av. Nino Artillero 130, 78210 San Luis Potosi, SLP (Mexico); Romero G, E. T., E-mail: hector.hernandez520@gmail.com [ININ, Departamento de Quimica, Laboratorio Forense Nuclear, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)
2017-10-15
The objective of this work was to quantify the levels of uranium (U) in groundwater from 22 wells in the municipality of San Diego de la Union Mexico. The sampled wells were classified as not regularized and regularized according to records of the National Water Commission and classified by zones A, B, C, D and E. Samples were collected in triplicate in 1 L bottles, then acidified with ultra pure HNO{sub 3} at 2% v/v and conserved at 4 degrees Celsius until analysis by mass spectrometry with magnetic sector with inductively coupled plasma source (Icp-SFMS). The preparation method was the acid digestion in the open system and re-concentration of the sample. In addition, 1 μg L{sup -1} of indium (In) was used as a tracer to know the performance of the method. Finally, the samples were diluted in 10 ml and introduced to the Icp-SFMS to measure in low resolution the U isotopes (U-234, U-235 and U-238). The average results obtained from total U were: A= 3.65 ± 1.89 μg L{sup -1}, B= 6.37 ± 1.46 μg L{sup -1}, C= 3.20 ± 2.27 μg L{sup -1}, D= 3.87 ± 1.31 μg L{sup -1} and E= 4.44 ± 1.17 μg L{sup -1}. According to the official Mexican standard NOM-014-CONAGUA-2003, the U levels found in the groundwater of San Diego de la Union Mexico do not exceed the permissible limits of 30 μg/L. (Author)
Directory of Open Access Journals (Sweden)
Mónica Núñez Flores
2010-10-01
Full Text Available Las esponjas son uno de los grupos de animales sésiles más abundantes y diversos de los fondos marinos tropicales, siendo un componente importante en los arrecifes coralinos, aunque poco estudiado a nivel de especies. El objetivo de este estudio fue caracterizar la comunidad de esponjas en el gradiente de profundidad de un arrecife coralino en Isla Larga, Parque Nacional San Esteban, Venezuela. Se trabajaron siete profundidades (1, 3, 6, 9, 12, 15 y 18m donde se midió la sedimentación neta y bruta, el índice de rugosidad, y se evaluó la riqueza, densidad y cobertura de las esponjas. Se identificaron 17 especies en 10 familias. La mayor densidad y cobertura se encontró a los 6m (6.03ind/m2, 11%, coincidiendo con la mínima sedimentación neta y la máxima rugosidad del sustrato. Las especies más abundantes fueron Desmapsamma anchorata, Amphimedon erina y Scopalina rueztleri. El análisis de componentes principales arrojó una separación de esta comunidad en 3 zonas, la somera (1 y 3m, donde las esponjas están sometidas a una tensión producida por el oleaje y alta iluminación, y las zonas media (6, 9 y 12m y profunda (15 y 18m, con características más favorables, dada una menor iluminación y sedimentación.Sponges (Porifera distribution along a depth gradient in a coral reef, Parque Nacional San Esteban, Carabobo, Venezuela. Sponges constitute one of the most diverse and abundant animal groups in the marine tropical benthos especially in coral reefs, though poorly studied to species level. The aim of this study is to characterize the sponge community along a depth gradient at Isla Larga (Parque Nacional San Esteban, Venezuela fringe reef. Net and total sedimentation, roughness index, sponge species richness, density and proportion of the bottom covered by sponges, were evaluated at seven depths (1, 3, 6, 9, 12, 15, 18m, 17 species were identified grouped in 10 demosponges families. The highest densities and coverage corresponded to
Evaluation and Analysis of Regional Best Management Practices in San Diego, California (USA)
Flint, K.; Kinoshita, A. M.
2017-12-01
In urban areas, surface water quality is often impaired due to pollutants transported by stormwater runoff. To maintain and improve surface water quality, the United States Clean Water Act (CWA) requires an evaluation of available water quality information to develop a list of impaired water bodies and establish contaminant restrictions. Structural Best Management Practices (BMPs) are designed to reduce runoff volume and/or pollutant concentrations to comply with CWA requirements. Local level policy makers and managers require an improved understanding of the costs and benefits associated with BMP installation, performance, and maintenance. The International Stormwater BMP Database (Database) is an online platform for submittal of information about existing BMPs, such as cost, design details, and statistical analysis of influent and effluent pollutant concentrations. While the Database provides an aggregation of data which supports analysis of overall BMP performance at international and national scales, the sparse spatial distribution of the data is not suitable for regional and local analysis. This research conducts an extensive review of local inventory and spatial analysis of existing permanent BMPs throughout the San Diego River watershed in California, USA. Information collected from cities within the San Diego River watershed will include BMP types, locations, dates of installation, costs, expected removal efficiencies, monitoring data, and records of maintenance. Aggregating and mapping this information will facilitate BMP evaluation. Specifically, the identification of spatial trends, inconsistencies in BMP performances, and gaps in current records. Regression analysis will provide insight into the nature and significance of correlations between BMP performance and physical characteristics such as land use, soil type, and proximity to impaired waters. This analysis will also result in a metric of relative BMP performance and will provide a basis for future
Directory of Open Access Journals (Sweden)
Camilo de Mello Vasconcellos
2005-12-01
Full Text Available This article analysis the representation of the Mexican Independence, through the Mexican painters muralists: Diego Rivera and Juan O'Gorman. These paintings are important visual documents that should be viewed in the context of their production, bringing also together the relation between art and politics in Latin America.
La deportación y la separación familiar en la frontera San Diego-Tijuana
Ruiz Marrujo, Olivia
2017-01-01
Resumen: Las deportaciones de Estados Unidos han llevado a la separación de miles de padres y madres indocumentados de sus hijos. Basándose en el caso de la zona fronteriza San Diego-Tijuana, el objetivo de este artículo es explorar de qué manera la política migratoria llegó a permitir, y en momentos dictar, la separación familiar. El tema es abordado dentro de un marco analítico multidimensional y contextual centrado en el entrecruce de: la globalización de la expulsión; las fuerzas históric...
San Diego Multiple Species Conservation Program (MSCP) Rare Plant Monitoring Review and Revision
McEachern, Kathryn; Pavlik, Bruce M.; Rebman, Jon; Sutter, Rob
2007-01-01
Introduction The San Diego Multiple Species Conservation Program (MSCP) was developed for the conservation of plants and animals in the south part of San Diego County, under the California Natural Community Conservation Planning Act of 1991 (California Department of Fish and Game) and the Federal Endangered Species Act of 1973, as amended (16 U.S. Code 1531-1544.) The Program is on the leading edge of conservation, as it seeks to both guide development and conserve at-risk species with the oversight of both State and Federal agencies. Lands were identified for inclusion in the MSCP based on their value as habitat for at-risk plants or plant communities (Natural Community Conservation Planning, 2005). Since its inception in the mid-1990s the Program has protected over 100,000 acres, involving 15 jurisdictions and the U.S. Fish and Wildlife Service (USFWS) and California Department of Fish and Game (CDFG) in the conservation of 87 taxa. Surveys for covered species have been conducted, and management and monitoring have been implemented at some high priority sites. Each jurisdiction or agency manages and monitors their conservation areas independently, while collaborating regionally for long-term protection. The San Diego MSCP is on the forefront of conservation, in one of the most rapidly growing urban areas of the country. The planning effort that developed the MSCP was state-of-the-art, using expert knowledge, spatial habitat modeling, and principles of preserve design to identify and prioritize areas for protection. Land acquisition and protection are ahead of schedule for most jurisdictions. Surveys have verified the locations of many rare plant populations known from earlier collections, and they provide general information on population size and health useful for further conservation planning. Management plans have been written or are in development for most MSCP parcels under jurisdictional control. Several agencies are developing databases for implementation
Sports celebrities and public health: Diego Maradona's influence on drug use prevention.
Brown, William J; de Matviuk, Marcela Alejandra Chavan
2010-06-01
Exposure to a sports celebrity through media and sporting events can have important influences on a public health issue associated with that celebrity. The battle against drug use by Argentinean soccer icon Diego Maradona has provoked concerns about drug abuse and prevention in Argentina, particularly among young people. The present study analyzes how two forms of involvement with Maradona affected the public's concern and perceptions of drug use after Maradona's drug-related health crisis in 2004. Results indicate that those who had a greater degree of parasocial interaction with Maradona were more likely to have an increased awareness of drug abuse, a greater personal concern about drug abuse, abstained from drug use, and more strongly support drug abuse prevention programs. In contrast, identification with Maradona had a mitigating effect on drug use prevention. Implications of these findings regarding the influence of sports celebrities on substance abuse are discussed.
Isara, A R; Isah, E C
2009-09-01
To assess the knowledge and practice of food hygiene and safety among food handlers in fast food restaurants in Benin City, Edo State. A descriptive cross-sectional study was carried out among 350 respondents who were selected by means of a systematic sampling method and interviewed using a semi-structured researcher-administered questionnaire. An observational checklist was thereafter used to inspect their personal hygiene status. The mean age of the food handlers was 26.4 +/- 6.1 years. Two hundred and twenty eight (65.1%) were females while 34.9% were males. A majority (98%) of the respondents had formal education. There was good knowledge and practice of food hygiene and safety among the respondents. Knowledge was significantly influenced by previous training in food hygiene and safety (p = 0.002). Food handlers who had worked for longer years in the fast food restaurants had better practice of food hygiene and safety (p = 0.036). The level of education of respondents did not significantly influenced their practice of food hygiene and safety (p = 0.084). Although, 299 (85.4%) food handlers were generally clean, skin lesions was seen in 4 (7.3%) of them. This study showed good knowledge and practice of food hygiene and safety by food handlers in the fast food restaurants in Benin City, but there is need for improvement through training and retraining of food handlers by the management of the restaurants and the local government authorities.
Directory of Open Access Journals (Sweden)
Fatimah Mohammed Palmer
2015-08-01
Full Text Available Body tattooing in traditional Nigerian culture was basically believed to be used for identification as well as aesthetic purposes. In some cultures, such as seen amongst the traditional ethnic Hausa and Fulani people, permanent facial marks were used to identify slaves within a community and also used to enhance the beauty and appearance of the women folk especially. In the southern part of Nigeria, amongst the Yorubas, it is used as a tribal identification symbol that provides information about the individual, as well as some culturally-related beliefs. The use of tattoos among the Esan ethnic people transcends the purposes of identification and enhancement of physical appearance as discovered. Thus this study examines the use of tattoo as a curative process for the illness called Udeh among the Esan ethnic people of Edo state Nigeria. Udeh is an illness associated with infection of the spleen. Data was collected through visitation of traditional healing venues, oral interview of some traditional doctors and elders as well as direct observation of the treatment processes. Findings indicated that the practice of Uvinmi has been in existence from time immemorial and it is a familial profession inherited from generation to generation as the most effective medium for treating spleen related diseases among the Esan people. It was also discovered contemporarily modern medical anaesthesia is employed to help reduce the agony felt in the process of blade incision as practiced by one of the traditional doctors. Recommendation made include an indebt study of the herbs used during and after treatment to gauge its efficacy on Western medicinal practices as well as proper sterilisization processes on incision equipments and procedures amongst others.
Directory of Open Access Journals (Sweden)
Julio Fernández Portela
2016-12-01
Full Text Available Resumen: El tema del paisaje se encuentra dentro del currículo de Educación Infantil y de Educación Primaria, a través del cual se puede trabajar otro tipo de contenidos. Este trabajo presenta la pintura como una herramienta didáctica utilizada para el estudio de los temas de paisaje, y que mediante la observación de los cuadros los profesores pueden explicar otros elementos que conforman el espacio geográ co que permitan a los alumnos ver la utilidad del arte como una fuente que les proporciona información del medio que los rodea. Palabras clave: Recurso didáctico, pintura, viñedos, Castilla y León, paisaje. Abstract: The theme of the landscape is in the curriculum of Early Childhood Education and Primary Education, through which you can work other content. This paper presents painting as a didactic tool used to study the issues of landscape, and by observing the pictures teachers can explain other elements of the geographic space that allow students to see the usefulness of art as a source that provides information environment around them.
1983-07-01
SECURITY CLASS. (of chi* report) Los Angeles District, Corps of Engineers Ucasfe P.O. Box 2711, Los Angeles, CA 90053 15&. DEL SI F1CATION/OWNGRAOI...greater potential for the possible occurrence of a large earthquake include the Whittier-Elsinore, Agua Caliente, San Jacinto, and the San Andreas...about 900,000 motor vehicles used within the county. 2.20 Air contaminants monitored within the San Diego Bay air basin include carbon monoxide (CO
Palinkas, Lawrence A; Prussing, Erica; Reznik, Vivian M; Landsverk, John A
2004-01-01
Within one month (March 2001), two separate incidents of school shootings occurred at two different high schools within the same school district in San Diego's East County. To examine community-wide expressions of post-traumatic distress resulting from the shootings that may or may not fulfill DSM-IV criteria for post-traumatic stress disorder (PTSD), but which might interfere with treatment and the prevention of youth violence. A qualitative study was undertaken using Rapid Assessment Procedures (RAP) in four East San Diego County communities over a six-month period following the two events. Semi-structured interviews were conducted with 85 community residents identified through a maximum variation sampling technique. Interview transcripts were analyzed by coding consensus, co-occurrence, and comparison, using text analysis software. Three community-wide patterns of response to the two events were identified: (1) 52.9% of respondents reported intrusive reminders of the trauma associated with intense media coverage and subsequent rumors, hoaxes, and threats of additional acts of school violence; (2) 44.7% reported efforts to avoid thoughts, feelings, conversations, or places (i.e., schools) associated with the events; negative assessment of media coverage; and belief that such events in general cannot be prevented; and (3) 30.6% reported anger, hyper-vigilance, and other forms of increased arousal. Twenty-three (27.1%) respondents reported symptoms of fear, anxiety, depression, drug use, and psychosomatic symptoms in themselves or others. School shootings can precipitate symptoms of post-traumatic stress disorder at the community level. Such symptoms hinder the treatment of individuals with PTSD and the implementation of effective prevention strategies and programs.
Centers for Disease Control (CDC) Podcasts
This podcast describes public health surveillance and communication in hard to reach populations in Tijuana, Mexico, and San Diego County, California. Dr. Marian McDonald, Associate Director of CDC's Health Disparities in the National Center for Emerging and Zoonotic Infectious Diseases, discusses the importance of being flexible in determining the most effective media for health communications.
Cheong Tar Wei; Faisal Muti Al-Hassan; Norris Naim; Aishah Knight; Sanmukh R Joshi
2013-01-01
Background: Diego blood group antigen, Di(a), is very rare among Caucasians and Blacks, but relatively common among the South American Indians and Asians of Mongolian origin. The antibody to Di(a) is clinically significant to cause hemolytic disease in a new-born or hemolytic transfusion reaction. Objectives: This study was designed to determine the prevalence of Di(a) antigen among the blood donors from the three major ethnic groups in Klang Valley of Malaysia as well as to find an incidence...
van Nieukerken, A.
2014-01-01
"Francis Bacon or Diego Velázquez in a dentist’s chair" - pictorial and other kinds of quotations as an addition to a disintegrating life The mature poetry of Tadeusz Różewicz seems to be at odds with both modernist and postmodern literary tenets. It undeniably makes abundant use of intertextuality
Investigating the fate of microplastics in the San Diego Bay area: A paleoenvironmental approach
Fontaine, R. M.; Hangsterfer, A.; Bhattacharya, A.
2017-12-01
Microplastics in marine waste surveys compare the observed amount of microplastic debris in the ocean with constructed models to determine availability of microplastics in the ocean. However, most of these studies have been constrained in the surface ocean and the surveys have found a substantial difference between estimated and observed amount of microplastic in the ocean. One possible reason could be that microplastics are settling along continental shelves or the ocean bottom. Via this research we have collected samples to study marine sediments (collected from increasing depth along the continental shelf around San Diego) for microplastics. Our goal is to determine the relationship between density and microplastic distribution. The main objective is to investigate sinks of microplastic (plastic products sizes less than 1 mm) along continental shelves; more specifically, this small study aims to investigate (a) what are the dominant types of microplastics (for example, heavy plastic or light plastic), (b) shapes of microplastics derived from commonly used heavy and light plastics, (c) is there specific locations (for example floating in water column vs. settling ocean floor along the continental shelves, which would be the first places where one might expect microplastics (that are delivered via river systems or from beaches) typically and finally, (d) is there any marine environmental preference between light and heavy microplastics. In this study, we provide observational evidence about the poorly understood fate of microplastics in the ocean as well as lend itself to the question: if and how long microplastics remain bioavailable. We have targeted four marine environments along San Diego that encompass several important connections between land and the ocean:Bays, river mouth, upwelling region and shelf. At each site listed above, we take four sets of 1-2ft cores: 20ft , 40ft, 60ft, 80ft. We combine traditional measurements (pH, salinity, density, DOC, N, P
Energy Technology Data Exchange (ETDEWEB)
Chin, George
1999-01-11
A workshop on collaborative problem-solving environments (CPSEs) was held June 29 through July 1, 1999, in San Diego, California. The workshop was sponsored by the U.S. Department of Energy and the High Performance Network Applications Team of the Large Scale Networking Working Group. The workshop brought together researchers and developers from industry, academia, and government to identify, define, and discuss future directions in collaboration and problem-solving technologies in support of scientific research.
Neira, Carlos; Vales, Melissa; Mendoza, Guillermo; Hoh, Eunha; Levin, Lisa A
2018-01-01
Polychlorinated biphenyl (PCB) concentrations were determined in surface sediments from three recreational marinas in San Diego Bay, California. Total PCB concentrations ranged from 23 to 153, 31-294, and 151-1387ngg -1 for Shelter Island Yacht Basin (SIYB), Harbor Island West (HW) and Harbor Island East (HE), respectively. PCB concentrations were significantly higher in HE and PCB group composition differed relative to HW and SIYB, which were not significantly different from each other in concentration or group composition. In marina sediments there was a predominance (82-85%) of heavier molecular weight PCBs with homologous groups (6CL-7CL) comprising 59% of the total. In HE 75% of the sites exceeded the effect range median (ERM), and toxicity equivalence (TEQ dioxin-like PCBs) values were higher relative to those of HW and SIYB, suggesting a potential ecotoxicological risk. Copyright © 2017 Elsevier Ltd. All rights reserved.
Oropeza, Sarah; Sadile, Mary Grace; Phung, Chantine Nguyen; Cabiles, Moana; Spackman, Sandy; Abuan, Myleen; Seligman, Fe; Araneta, Maria Rosario
2018-03-01
Asian American, Native Hawaiian, and Pacific Islander (AANHPI) populations have elevated prevalence of dietary-related chronic conditions; however, culturally relevant dietary interventions are lacking. This article describes the methodology for a community-based participatory intervention. Strategies to Reach and Implement the Vision of Health Equity, San Diego! aims to increase access to healthy food in AANHPI restaurants, grocery stores, and farmers' markets. Time series quasi-experimental study design. Dietitians, health promotion specialists, and community partners collaborated with restaurant owners and chefs to develop culturally tailored approaches without compromising traditional flavors. AANHPI restaurants in San Diego County, CA. Twenty restaurants and 600 diners are anticipated and will be sampled at 3 intervals for a total of 1,800 diners. We describe the community-based interventions within restaurants, including (1) analyzing and modifying selected recipes to create and promote healthier dishes; (2) providing nutrition labels on selected food items; (3) marketing healthy menu items through food tastings, signage, and social media promotion; and (4) offering low-sodium soy sauce and other condiments. Temporal changes in availability of healthful options, and the frequency of healthy dining choices. Program evaluation consists of assessment of the nutritional environment in 20 participating restaurants and surveys of customers' opinions and behaviors at baseline and at 3 and 12 months postintervention. Fifteen restaurants have been recruited to date. Copyright © 2017 Society for Nutrition Education and Behavior. Published by Elsevier Inc. All rights reserved.
El tabernáculo de la Catedral de Granada: de Diego de Siloe a Navas Parejo
Directory of Open Access Journals (Sweden)
José Antonio Peinado Guzmán
2010-03-01
Full Text Available Uno de los elementos más olvidados en los estudios acerca de la Catedral de Granada, ha sido, históricamente, el tabernáculo de su Capilla Mayor. El ideado por Diego de Siloe en 1561, supuso la creación de un elemento innovador dentro del ornato de su presbiterio. Este ciborio, venía a completar un programa iconográfico-teológico cargado de simbolismos. El paso del tiempo hizo que tuviese que ser sustituido por otros. Tras el de Siloe, tenemos referencias de la adquisición de uno en 1648 con forma de «Carro de Ezequiel», otro provisional en 1804 y, finalmente, el actual, hecho por Navas Parejo entre 1924-1929.
Directory of Open Access Journals (Sweden)
Cheong Tar Wei
2013-01-01
Full Text Available Background: Diego blood group antigen, Di(a, is very rare among Caucasians and Blacks, but relatively common among the South American Indians and Asians of Mongolian origin. The antibody to Di(a is clinically significant to cause hemolytic disease in a new-born or hemolytic transfusion reaction. Objectives: This study was designed to determine the prevalence of Di(a antigen among the blood donors from the three major ethnic groups in Klang Valley of Malaysia as well as to find an incidence of an antibody of the Diego antigen, anti-Di(a, in a tertiary care hospital to ascertain the need to include Di(a+ red cells for an antibody screen cell panel. Materials and Methods: Serological tests were performed by column agglutination technique using commercial reagents and following instruction as per kit insert. Results: Di(a antigen was found with a frequency of 2.1% among the Malaysians donors in three ethnic groups viz, Malay, Chinese and Indian. It was present among 1.25% of 401 Malay, 4.01% of Chinese and 0.88% of 114 Indian origin donors. None of the 1442 patients, including 703 antenatal outpatients, had anti-Di(a in serum. Conclusion: The prevalence of Di(a antigen was found among the donors of all the three ethnic background with varying frequency. Inclusion of Di(a+ red cells in routine antibody screening program would certainly help in detection of this clinically significant antibody and to provide safe blood transfusion in the Klang Valley, though the incidence of antibody appears to be very low in the region.
Wei, Cheong Tar; Al-Hassan, Faisal Muti; Naim, Norris; Knight, Aishah; Joshi, Sanmukh R
2013-01-01
Diego blood group antigen, Di(a), is very rare among Caucasians and Blacks, but relatively common among the South American Indians and Asians of Mongolian origin. The antibody to Di(a) is clinically significant to cause hemolytic disease in a new-born or hemolytic transfusion reaction. This study was designed to determine the prevalence of Di(a) antigen among the blood donors from the three major ethnic groups in Klang Valley of Malaysia as well as to find an incidence of an antibody of the Diego antigen, anti-Di(a), in a tertiary care hospital to ascertain the need to include Di(a+) red cells for an antibody screen cell panel. Serological tests were performed by column agglutination technique using commercial reagents and following instruction as per kit insert. Di(a) antigen was found with a frequency of 2.1% among the Malaysians donors in three ethnic groups viz, Malay, Chinese and Indian. It was present among 1.25% of 401 Malay, 4.01% of Chinese and 0.88% of 114 Indian origin donors. None of the 1442 patients, including 703 antenatal outpatients, had anti-Di(a) in serum. The prevalence of Di(a) antigen was found among the donors of all the three ethnic background with varying frequency. Inclusion of Di(a+) red cells in routine antibody screening program would certainly help in detection of this clinically significant antibody and to provide safe blood transfusion in the Klang Valley, though the incidence of antibody appears to be very low in the region.
The Role of Social Influences on Pro-Environment Behaviors in the San Diego Region.
Estrada, Mica; Schultz, P Wesley; Silva-Send, Nilmini; Boudrias, Michel A
2017-04-01
From a social psychological perspective, addressing the threats of climate change involves not only education, which imparts objective facts upon a passive individual, but also a socializing process. The Tripartite Integration Model of Social Influence (TIMSI) provides a theoretical framework that connects acquiring climate change knowledge with integration into a community, which results in greater engagement in climate friendly behaviors. Survey data were collected from 1000 residents in San Diego County. Measures included (a) knowledge about climate change; (b) self-efficacy, what pro-environmental actions they felt they could do; (c) identity, to what extent they identified as part of a community that is concerned about climate change; (d) values, endorsement of values of the community that is concerned about climate change; and (e) pro-environmental behavior, engagement in conservation behaviors. Results indicated that self-efficacy and values mediated the relationship between knowledge and pro-environmental behavior.
Viajeros españoles en los países rumanos en el siglo XVI: Diego Galán y su relato sobre Valaquia
Directory of Open Access Journals (Sweden)
Sâmbrian, Oana Andreia
2016-06-01
Full Text Available The article focuses on a very little explored subject to date, within the field of travel literature: the description of Wallachia, made by Diego Galán. Only one article has been published until today on this topic. His author was Alejandro Ciorãnescu and the article was published 50 years ago. Our study intends to provide a different analysis of the text, throughout a double, historical and philological perspective that contributes to understand better the creation and integration of the Romanian space and culture to the Spanish collective imaginary.El artículo se propone traer a colación un tema casi sin estrenar en el campo de la literatura de viajes: el relato de Diego Galán sobre Valaquia, tema sobre el que, hasta la fecha, no existe más que un artículo publicado hace 50 años por Alexandru Ciorãnescu. Nuestro estudio propone un nuevo análisis del texto, desde una doble perspectiva, histórico-filológica, gracias a la cual se podrá indagar mejor en la creación incipiente del prototipo de la cultura y del espacio rumano en la mentalidad española.
Directory of Open Access Journals (Sweden)
Carla Vanina DAGATTI
2015-01-01
Full Text Available La temperatura es la variable que más incide en el desarrollo de Lobesia botrana (Den & Schiff, cuya relación ha sido estudiada mediante modelos matemáticos, como el de Touzeau. En Mendoza, en 2010 se registró la aparición de L. botrana. El objetivo de este trabajo es ajustar el modelo de Touzeau para predecir el comportamiento de la polilla. El estudio se realizó en un viñedo cv. Malbec desde 2012. Se emplearon trampas de feromonas. La temperatura se registró con un sensor datalogger. Se calculó la integral térmica con la fórmula de Touzeau con un umbral de 10ºC desde el 1 de julio de cada año. Los resultados indicaron que el primer vuelo se desarrolló el 18 y el 20 de octubre con 204,05 ± 10,73 grados día, el segundo en la primera decena de diciembre con 728,34 ± 41,95 grados día, el tercero durante la última quincena de enero con 1329,08 ± 151,35 grados día y el cuarto a mediados de febrero de 2012 y 2013, respectivamente con 1721,84 ± 116,63 grados día. Estos resultados son útiles para predecir la aparición de la plaga y como herramienta para establecer un sistema de alarma para los productores.
Macrobenthic community response to copper in Shelter Island Yacht Basin, San Diego Bay, California.
Neira, Carlos; Mendoza, Guillermo; Levin, Lisa A; Zirino, Alberto; Delgadillo-Hinojosa, Francisco; Porrachia, Magali; Deheyn, Dimitri D
2011-04-01
We examined Cu contamination effects on macrobenthic communities and Cu concentration in invertebrates within Shelter Island Yacht Basin, San Diego Bay, California. Results indicate that at some sites, Cu in sediment has exceeded a threshold for "self defense" mechanisms and highlight the potential negative impacts on benthic faunal communities where Cu accumulates and persists in sediments. At sites with elevated Cu levels in sediment, macrobenthic communities were not only less diverse but also their total biomass and body size (individual biomass) were reduced compared to sites with lower Cu. Cu concentration in tissue varied between species and within the same species, reflecting differing abilities to "regulate" their body load. The spatial complexity of Cu effects in a small marina such as SIYB emphasizes that sediment-quality criteria based solely on laboratory experiments should be used with caution, as they do not necessarily reflect the condition at the community and ecosystem levels. Copyright © 2011 Elsevier Ltd. All rights reserved.
LLW (Low-Level Waste) Forum meeting report, February 10-13, 1998, San Diego, CA
International Nuclear Information System (INIS)
1998-01-01
The Low-Level Radioactive Waste Forum met in San Diego, California, on February 10--13, 1998. Twenty-four Forum Participants, Alternate Forum Participants, and meeting designees representing 19 compacts, host states, and unaffiliated states participated. Additional information was provided by 19 resource people from, variously, the States of California, Colorado, and Utah; the National Governors' Association; the Department of the Army; EPA; DOE and DOE's National Low-Level Waste Management Program; NRC; the Electric Power Research Institute and the Nuclear Energy Institute; US Ecology, Chem-Nuclear Systems, Envirocare of Utah, and Waste Control Specialists (represented by Egan and Associates); and Rocketdyne Propulsion and Power. Also in attendance, as observers, were six other state and compact officials; a staff person from DOE's National Low-Level Waste Management Program; one NRC headquarters staff person; and seven representatives of other interested parties, including a regional generators' organization, two generators, one California anti-nuclear group, and two private companies
92 INSULIN RESISTANCE: CAUSES AND METABOLIC ...
African Journals Online (AJOL)
drclement
2009-12-01
Dec 1, 2009 ... Edo State Institute of Technology and Management. Usen, Edo State ... type 2 diabetes mellitus. The cause of the vast ... Insulin (molecular mass 6000D) consists of 51 amino acids .... Experimental Biology and. Medicine 2004 ...
Bosse, Casey; Rosen, Gunther; Colvin, Marienne; Earley, Patrick; Santore, Robert; Rivera-Duarte, Ignacio
2014-08-15
The bioavailability and toxicity of copper (Cu) in Shelter Island Yacht Basin (SIYB), San Diego, CA, USA, was assessed with simultaneous toxicological, chemical, and modeling approaches. Toxicological measurements included laboratory toxicity testing with Mytilus galloprovincialis (Mediterranean mussel) embryos added to both site water (ambient) and site water spiked with multiple Cu concentrations. Chemical assessment of ambient samples included total and dissolved Cu concentrations, and Cu complexation capacity measurements. Modeling was based on chemical speciation and predictions of bioavailability and toxicity using a marine Biotic Ligand Model (BLM). Cumulatively, these methods assessed the natural buffering capacity of Cu in SIYB during singular wet and dry season sampling events. Overall, the three approaches suggested negligible bioavailability, and isolated observed or predicted toxicity, despite an observed gradient of increasing Cu concentration, both horizontally and vertically within the water body, exceeding current water quality criteria for saltwater. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Rotimi Rufus Ipinmoroti
2014-06-01
Full Text Available A study was conducted to assess nutrient dynamics of soils under old and young cocoa, coffee and cashew plantations and the leaf nutrient contents of the crops at Uhonmora, Edo State, Nigeria for proper cultural and soil fertility management of the plantations. Soil and crop leaf samples were collected from each plantation using a random sampling technique. The samples were analyzed using standard procedures for sand, silt, clay, pH (H2O, electrical conductivity (EC, total N, available P, K, Ca, Mg, Na, and Effective Cation Exchange Capacity (ECEC. Leaf samples were analyzed for N, P, K, Ca, Mg and Na. Data were compared with the corresponding soil and foliar critical nutrient values for each crop. Results indicated that the soils were texturally sandy clay loam and acidic. The soils varied in their nutrient contents, with soil P for the old cocoa, young coffee and cashew plantations far below critical values. The young cashew plot was low in N content but adequate for other plots. However, the soil ECEC increased with the increasing of calcium contents. Leaf N was below critical for all the crops. Leaf K was low for cocoa and coffee plants, leaf Ca was low for the young cashew plants, while leaf Mg was low for the young cocoa and old cashew. The high soil Mg/K ratio of 8.7- 22.3 as against the established value of 2.0 might have resulted in gross nutrient imbalance which must have affected the absorption and utilization of other nutrients. Hence, adequate soil N did not translate the same availability to the crops. The ECEC showed that the soil needs to be improved upon for sustainable productivity. Soil nutrient content variation across the plantations with age of establishment will necessitate the need for consistent routine soil nutrient assessment for proper and balanced soil nutrient supply to the crops, for healthy crop growth and optimum yield. Management practices of soil surface mulching using organic wastes and cover crops under
Zhou, M; Ye, J
2017-11-28
Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.
Arte, literatura y acción colectiva en Tijuana-San Diego
Directory of Open Access Journals (Sweden)
Aurelio Meza Valdez
2014-01-01
Full Text Available Aquí se describe y analiza el impacto de las acciones colectivas en los campos artístico- literarios de Tijuana y San Diego. Se expone que estos campos se conforman generalmente por acciones colectivas, algunas con impacto local y a corto plazo (desde abajo, y otras con el apoyo de aparatos institucionales (desde arriba. Se distingue entre colectivos formativos y consolida - dos, con funciones diversas. Los casos estudiados (Colectivo Intransigente, Agitprop Art Space y Cog∙nate Collective, dado su carácter independiente, surgieron con funciones formativas, y sus acciones eran desde abajo. Sin embargo, su participación en proyectos colectivos ha contribuido a su consolidación, individual o grupalmente, en los campos restringidos. Después, se esboza el marco teórico para describir las acciones colectivas y los tipos de colectivos que existen de acuer - do con su función. Se analizan algunos ejemplos de acción colectiva en los grupos escogidos, su finalidad y estrategia a seguir, así como sus repercusiones en los campos artístico y literario. Por último, se hace un pequeño recuento de las actitudes de sociólogos y filósofos en torno al arte contemporáneo, y cómo los casos estudiados modifican o refuerzan estas reflexiones.
Elder, John P; Holub, Christina K; Arredondo, Elva M; Sánchez-Romero, Luz María; Moreno-Saracho, Jessica E; Barquera, Simón; Rivera, Juan
2014-01-01
Consumption of water may help promote health and prevent obesity in children by decreasing consumption of sugar-sweetened beverages. This study used evidence-based strategies to increase water consumption in Mexican-American and Mexican children. In 2012, two schools in San Diego, USA and two other in Tlaltizapan, Mexico were recruited to Agua para Niños (Water for Kids), a program designed to promote water consumption among elementary grade students. Guided by operant psychology, the intervention focused on school and classroom activities to encourage water consumption. One control and one intervention school in each country were included. Agua para Niños resulted in increases in observed water consumption and bottle possession among US and Mexican students. Teacher receptivity to the program was very positive in both countries. Agua para Niños yielded sufficiently positive behavioral changes to be used in a future fully randomized design, and to contribute to school nutrition policy changes.
Centers for Disease Control (CDC) Podcasts
2010-08-10
This podcast describes public health surveillance and communication in hard to reach populations in Tijuana, Mexico, and San Diego County, California. Dr. Marian McDonald, Associate Director of CDC's Health Disparities in the National Center for Emerging and Zoonotic Infectious Diseases, discusses the importance of being flexible in determining the most effective media for health communications. Created: 8/10/2010 by National Center for Emerging and Zoonotic Infectious Diseases, National Center for Immunization and Respiratory Diseases. Date Released: 8/10/2010.
Soil Characteristics, Microbial Compostion of Plot, Leaf Count and ...
African Journals Online (AJOL)
Soil Characteristics, Microbial Compostion of Plot, Leaf Count and Sprout Studies of Cocoyam ( Colocasia [Schott] and Xanthosoma [Schott], Araceae) Collected in Edo State, ... Science, Technology and Arts Research Journal ... Government Areas (LGA) in Edo state and describe them based on leaf count and sprout
Tangeman, Andrew Gerrit
Since its inception, the No Child Left Behind Act of 2001 (NCLB) and recent additions to the U.S. Elementary and Secondary Education Act (ESEA) have elicited a broad swath of responses from the educational community. These responses include critical discussions of how standardized testing requirements proliferate a "teach for the test" mentality that transforms how reading, writing, and mathematics are taught in public schools. This thesis focused specifically on "literacy" in relation to the policies that challenge its status as a subjective form of communication, knowledge sharing, and story-telling. Embedded within the term "literacy" are sets of socially-constructed dualisms such as "good school" vs. "bad school," "literate" vs. "illiterate," and "reader" vs. "test-taker" that are propagated under education reform. Investigating these dualisms involved a mixed methods approach, which included the use of critical theory, geovisualization, and geographic analysis. The resulting data allows for a comprehensive look into the economic, political, social, and cultural forces involved in the production of literate space(s) in San Diego, California.
Directory of Open Access Journals (Sweden)
Rábade Obradó, María del Pilar
2002-12-01
Full Text Available The present work studies the foundation of Saint Anthony´s hospital of Segovia during the XVth century. The foundation was an initiative of Diego Arias de Ávila, one of the most influential personalities of the reign of Henry IV of Castila. The foundation was determined on very varied reasons, not only charitative and religious reasons. Among these reasons, the use of the hospital as an instrument of the family strategies. These family strategies tried to hidden the hebrew origins of the lineage. They also tried to guarantee the perennity of the lineage, and to leave an endurable memory behind. Lasdy, these family strategies tried to consolidate the domination that the lineage had on Segovia.
El presente trabajo estudia la fundación del hospital de San Antonio de Segovia en el siglo XV. La fundación fue una iniciativa de Diego Arias de Ávila, uno de los personajes más influyentes durante el reinado de Enrique IV de Castilla. La fundación estuvo determinada por motivaciones muy diversas, no sólo caritativas y religiosas. Entre ellas, el uso del hospital como instrumento de las estrategias familiares. Esas estrategias familiares pretendían ocultar los orígenes judíos del linaje, garantizar su perennidad, dejar una memoria perdurable del mismo, y, finalmente, consolidar la dominación que el linaje ejercía sobre Segovia.
[Diego de Cisneros and novo-Hispanic astrological and geographical medicine].
Rodríguez-Sala, M L
1994-01-01
The collection of geographical information about the New World which was originated during the XVI century started being organized during the XVI century started being organized and explained, in the field of medicine, towards the end of the century and continued during the earliest decades of the following. Writers in the medical profession of these days are characterized by their interest, sometimes coexisting with or alternated with the outlooks of geography of illness and astrology. Diego Cisneros is a outstanding writer of a single place of valuable work so far Known, who was born in Madrid, became a doctor at Alcala de Henares and then arrive in New Spain in 1612. His book represents the incipient baroque of the time and is a valuable contribution to the Knowledge of geography and medicine and is also a piece of art work. It contains one of the first plans of the City of Mexico and its neighbouring sites drawn ina a typical baroque style. The scientific importance of the book consists of the clearcut separation between science and belief leading to assert the freedom of Mankind to put an end to medieval astrology which imprisoned the individual. Because of his leanings towards the Alcala School he upholds the idea of the utility of science and experience linked up to objective clinical observation. Cisneros contributes through his work to the unfolding of two significant processes in the history of national culture: one relates to identity and the other one to scientific community. These pages contain an analysis of the development of his work.
Directory of Open Access Journals (Sweden)
Susana Aparecida da Silva
2012-08-01
Full Text Available Esta pesquisa reflete a respeito da possibilidade de se analisar a idéia de tempo na Espanha Barroca do século XVII através de cinco retratos feitos pelo pintor espanhol Diego Velázquez (1599-1660. Estes retratos são feitos após o período em que o pintor é admitido na corte de Felipe IV da Espanha (1605-1665 como pintor oficial. As fontes visuais selecionadas para esta pesquisa no sentido de possibilitar a análise da idéia de tempo são retratos do rei feitos por Diego Velázquez e representam o rei jovem e posteriormente envelhecido. Acredita-se que a idéia de tempo para Velázquez tenha estreita relação com a sociedade barroca espanhola do século XVII na qual ele está inserido. Neste sentido, as representações do poder e do envelhecimento do monarca possíveis de serem vistas nas pinturas de Velázquez contribuem para se pensar a concepção de tempo do artista e da sociedade espanhola daquele período
Directory of Open Access Journals (Sweden)
Jesús Rodrigo Comino
2015-01-01
Full Text Available El presente trabajo pretende examinar la respuesta erosiva del suelo en áreas cultivadas de viñe-dos sobre laderas en pendientes elevadas en el Valle del Ruwer (Alemania a través de diferentes técnicas. Los experimentos se desarrollan entre los meses de septiembre y diciembre durante di-ferentes épocas de manejo del suelo: antes, durante y después de la vendimia. En primer lugar, se realiza un análisis de la variación geométrica de tres rills para cuantificar su expansión lateral (de 7 a 13 cm y vertical (1 a 4 cm. El movimiento del suelo confirma una elevada variabilidad en los procesos hidro-geomorfológicos de la ladera. A continuación, a través del cálculo del coeficiente teórico de escorrentía a partir del número de curva y lluvias simuladas en diferentes épocas del año, se observan unas elevadas tasas de infiltración, aunque con resultados muy diferentes entre técnicas. Por último, con el cálculo de la RUSLE (Revised Universal Soil Loss Ecuation y el aná-lisis de las marcas botánicas en los tocones de las parras, se calcula el impacto negativo de la ero-sión con el manejo agrícola del ser humano sobre los suelos de los viñedos. Con ambos métodos, se han obtenido 11.28 t ha-1 y 3.4 t ha-1 año de pérdida de suelo, respectivamente.
Sanchez-Flack, Jennifer C; Baquero, Barbara; Linnan, Laura A; Gittelsohn, Joel; Pickrel, Julie L; Ayala, Guadalupe X
2016-01-01
To inform the design of a multilevel in-store intervention, this qualitative study utilized in-depth semistructured interviews with 28 managers and 10 employees of small-to-medium-sized Latino food stores (tiendas) in San Diego, California, to identify factors within the tienda that may influence Latino customers' grocery-shopping experiences and behaviors. Qualitative data analysis, guided by grounded theory, was performed using open coding. Results suggest that future interventions should focus on the physical (i.e., built structures) and social (i.e., economic and sociocultural) dimensions of store environments, including areas where the two dimensions interact, to promote the purchase of healthy food among customers.
Sanchez-Flack, Jennifer C.; Baquero, Barbara; Linnan, Laura A.; Gittelsohn, Joel; Pickrel, Julie L.; Ayala, Guadalupe X.
2016-01-01
To inform the design of a multilevel in-store intervention, this qualitative study utilized in-depth semistructured interviews with 28 managers and 10 employees of small-to-medium-sized Latino food stores (tiendas) in San Diego, California, to identify factors within the tienda that may influence Latino customers’ grocery-shopping experiences and behaviors. Qualitative data analysis, guided by grounded theory, was performed using open coding. Results suggest that future interventions should focus on the physical (i.e., built structures) and social (i.e., economic and socio-cultural) dimensions of store environments, including areas where the two dimensions interact, to promote the purchase of healthy food among customers. PMID:26800243
Directory of Open Access Journals (Sweden)
María Fernanda de la Rosa
2014-06-01
Anarchism found in internationalism an essential element to unite the libertarian movement. There were many anarchist thinkers who sought to accomplish this goal and who, in their role of theorists-activists, not only contributed to the creation of the anarchist intellectual universe in Buenos Aires in the first decades of the 20th century but also, in their role of active agents in the process of conceiving of, receiving and spreading ideas, tried to relate local anarchism to Latin American and European anarchism. Diego Abad de Santillán was an outstanding character in this group. He was a fundamental piece in the libertarian intellectual machinery deployed between Europe and Latin America.
liquid soap production with blends of rubber seed oil (rso)
African Journals Online (AJOL)
Department of Chemical Engineering, Edo State Institute of Technology and Management, Usen,. P.M.B 1104, Benin City, Edo State. ... The basic processes for making soap have re- mained unchanged for the past 200 years. How- ... palm kernel oil for good quality liquid soap using locally produced caustic potash from ...
2012-04-27
or 39% of the value of such contracts. Next, a group of nine firms—EDO Communications and Countermeasures Systems, Lockheed Martin, Sociedad ...49,437,854.00 5.94% SOCIEDAD ESPAIOLA DE MONTAJES INDUSTRIALES SA $60,000,000.00 7.21% LOCKHEED MARTIN CORPORATION $79,342,491.00 9.54% EDO
Cocoa Farmers Attitude towards Utilisation of Integrated Pest ...
African Journals Online (AJOL)
The study examined cocoa farmers' attitude towards the utilization of integrated pest management (IPM) in Edo and Ogun States of Nigeria. In Edo State, 60 respondents were randomly selected out of 100 trained cocoa farmers. Random selection of 60 respondents from registered cocoa farmers that were not trained in IPM ...
Directory of Open Access Journals (Sweden)
Ole Kayser
2012-03-01
Full Text Available Uni- or bilateral ejaculatory duct obstruction (EDO is a rare but correctable cause of infertility, chronic pelvic pain and postejaculatory pain. EDO is a congenital or acquired condition, it is the underlying cause of infertility in approximately 5% of infertile men. If acquired, the etiology often remains unresolved, but prostatitis or urethritis with post-inflammatory adhesion of the duct walls seems to be a common underlying pathomechanism. Although a certain constellation of physicochemical semen parameters may lead to correct diagnosis, EDO often resembles a diagnosis by exclusion. Imaging of acquired EDO remains a challenge and the established surgical therapy, transurethral resection of the ejaculatory ducts (TURED, leads to a low rate of natural conception and a high rate of complications such as reflux of urine and epididymitis. We present a case of a male with suspected EDO who underwent a combined approach to both, semi-invasive diagnosis and therapy by transrectal puncture of the seminal vesicles and antegrade balloon-dilation of the ejaculatory ducts. Possibilities and pitfalls of this procedure are described and the literature is reviewed. Furthermore, we suggest a CT- or MRI-guided, percutaneous intervention for treatment of ejaculatory duct obstruction by balloon dilation and demonstrate initial steps of this procedure with a body donor. We call this new procedure PTED (percutaneous transgluteal ejaculatory ductoplasty.
[Diego Rivera: a great master and a didactic and discerning medical historian].
Cabello C, Felipe
2014-11-01
Diego Rivera is one of the artistic giants of the 20th century. His many original creations included landscapes, portraits and large murals created in both Mexico and the United States. Rivera ventured into many styles-cubism, naturalism and narrative realism-with great success. Rivera's murals build on those of the Renaissance, pre-historic and colonial civilizations of Mexico. Biological and medical topics and their history form an important concern in Rivera's work, present in many of his murals in a highly informative and creative manner. His two History of Cardiology murals present an original and comprehensive account of the developments of this medical specialty from pre-historic to modern times. His History of Medicine in Mexico (The people demands health) mural is a creatively and vigorously fashioned and highly dynamic and synthetic vision of the relationships between pre-historic and modern medicine in Mexico and its social foundations. Medical topics such as vaccines and vaccination, embryology and surgery are inventively and accurately presented in the large mural, Detroit Industry. The trigger and impetus for the concern of Rivera for these topics of life and death, and the exceedingly ground-breaking way he presents them, appear to stem from his rational materialism, his concern for collective wellbeing, his belief in progress through scientific developments and political action and his commitment to understand Mexican and American history.
Management of Brackish Groundwater Extraction, San Diego-Tijuana area, USA and Mexico
Danskin, W. R.
2017-12-01
Management of brackish groundwater extraction from coastal sediment in the transboundary San Diego-Tijuana area, USA and Mexico, involves monitoring storage depletion, seawater intrusion, and land subsidence. In 2017, five additional extraction wells were installed, doubling capacity of the Reynolds Groundwater Desalination Facility. Environmental permits to expand capacity of the facility, and the recently-enacted Sustainable Groundwater Management Act (SGMA) by the State of California require monitoring the possible adverse effects of the additional extraction. Fortuitously, over the past 14 years, 12 deep multiple-depth, monitoring-well sites were installed by the United States Geological Survey (USGS) to aid in mapping the coastal geology and groundwater conditions. Now these sites are being used for groundwater management. Storage depletion is monitored daily via water levels measured using transducers installed permanently in each of the 4-6 piezometers at each site and transmitted automatically to the Internet. Seawater intrusion is tracked annually via electromagnetic geophysical logging in the deepest piezometer at each site, 500-800 meters below land surface, about twice the depth of the extraction wells. Land subsidence is determined annually from surveys of reference points installed at the well sites and from Interferometric Synthetic Aperature Radar (InSAR) satellite data. Management also involves use of a regional hydrologic model to simulate the likely location and timing of future storage depletion, seawater intrusion, and land subsidence.
ISLAM IN THE NON-MUSLIM AREAS OF NORTHERN NIGERIA, c
African Journals Online (AJOL)
QUADRI Y A
sculptures, drawings, paintings, animations, sounds, film, video and video games and most predominantly in this modern era, the internet, to portray its sexual themes. Who are the Owan People? The Owan are people of Edo extraction currently scattered around the Owan River in the Northern fringe of Edo State. 19 . They ...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...
The influence of family factors on delinquent adolescents in ...
African Journals Online (AJOL)
This study was carried out with the aim of finding out the influence of family factors on delinquent adolescents in secondary schools in Edo South Senatorial District of Edo State. This study ascertained the extents to which family factors such as parent child rearing style, family type and parent socio economic background ...
Education in a Global Age: An Inter-California Strategy for the Tijuana-San Diego Region
Directory of Open Access Journals (Sweden)
Olga A. Vásquez
2002-01-01
Full Text Available Este artículo presenta un bosquejo para una estrategia Inter-California que enlazaría las áreas de San Diego y Tijuana como una sola fuerza regional. Esto intenta conceptualizar dos distintas y frecuentemente contradictorias áreas como una sola, haciendo una aproximación a grosso modo de las desiguales condiciones económicas y educativas en ambos lados de la frontera. Se discute la colaboración binacional en el pasado en educación, y se plantean las posibilidades para el futuro de dicha colaboración, ofreciendo recomendaciones y predicciones de las metas que podrían alcanzarse. Llamando a la región Inter-California, el artículotambién argumenta por una identidad global, y específicamente, por una educación que es relevante para la nueva economía, asi como los avances científicos y tecnológicos que están iluminando cada vez más una nueva sociedad global.
INTERCAMBIO TRASFRONTERIZO DE SERVICIOS DE SALUD Y MEDICINAS EN LA REGIÓN DE TIJUANA Y SAN DIEGO
Directory of Open Access Journals (Sweden)
José G. Vargas-Hernández
2010-12-01
The objective of this article is to analyze the border exchange in the Tijuana-San Diego region of medical services, health care and medicines. Despite the numerous research studies conducted, there are still many questions regarding the impact from this exchange on regional development. The exploratory method, documentary analysis and a review of the literature were utilized. This article is focused on the transboundary market of southern California and the Tijuana border area, the motivations of users and buyers, the main barriers, characteristics and typology. Some areas for future studies are specified, and lastly, some proposals with implications for public policies are formulated. This study sheds light on the possibilities of increasing income from commerce in health services, improving the satisfaction of users and consumers, and mitigating the negative consequences associated with the design of policies and initiatives at the multilateral, binational and regional levels.
Long Term Land Use Effects of New Rail Investment: Lessons from San Diego
Directory of Open Access Journals (Sweden)
David A. King
2018-01-01
Full Text Available In recent decades, U.S. cities have invested in rail transit for reasons beyond supplying alternatives to driving. Increasingly, rail investments are specifically promoted to reshape the built environment for property-led economic development. In these cases, new investment in rail transit is claimed to facilitate particular types of land use changes, mostly in the form of dense multi-family residential and mixed-use developments. Although rail’s effects on land use are widely claimed, scholarly evaluations offer mixed results. This paper examines two potential reasons for these mixed results. First, as most empirical examinations tend to be conducted shortly after new transit investment opens analysis is often criticized on the basis that short time frames may not allow land use changes to materialize. The second is that rail investment often includes changes to local zoning and land use regulations, creating opportunities for types of development that were previously outlawed. This paper evaluates these two critiques through an analysis of long-term land use effects associated with new rail transit service in San Diego, California. The results suggest that even after three decades of development cycles, rail transit has not led to consistent regulatory patterns of increased density or new mixed-use development.
Deaths involving 1,1-difluoroethane at the San Diego County Medical Examiner's Office.
Vance, Chris; Swalwell, Christopher; McIntyre, Iain M
2012-01-01
Intentional abuse of 1,1-difluoroethane has been reported to cause transient symptoms such as confusion, tremors, pulmonary irritation, loss of consciousness and, rarely, coma. In the last five years, 17 cases from the San Diego County Medical Examiner's Office showed the presence of 1,1-difluoroethane in postmortem tissues, and the gas was cited in the cause of death in 13 of those cases. Detected during routine ethanol screening, 1,1-difluoroethane was evaluated for concentrations in peripheral blood, central blood and vitreous humor by a slightly modified method published by Avella et al. In many cases, death from abuse of 1,1-difluoroethane seemed to occur within minutes of intentional abuse; large concentrations (>100 mg/L) of the gas were still in the blood. It is important that forensic toxicology laboratories have routine screening procedures to detect 1,1-difluoroethane because cases exist in which evidence of use from cans may not be present in proximity to the decedent, or may be undiscovered in the debris of a motor vehicle accident. It is also important to quantify concentrations of 1,1-difluoroethane in both peripheral blood and central blood, whose ratio may be useful in interpreting how recently the use of the 1,1-difluoroethane occurred.
Aristizabal, Paula; Fuller, Spencer; Rivera, Rebeca; Beyda, David; Ribeiro, Raul C.; Roberts, William
2015-01-01
In 2007, the 5-year survival rate for children with acute leukemia in Baja California, Mexico was estimated at 10% (vs. 88% in the United States). In response, stakeholders at St. Jude Children’s Research Hospital, Rady Children’s Hospital San Diego, and the Hospital General de Tijuana (HGT) implemented a transcultural partnership to establish a pediatric oncology program. The aim was to improve clinical outcomes and overall survival for children in Baja California. An initial needs assessment evaluation was performed and a culturally sensitive, comprehensive, 5-year plan was designed and implemented. After six years, healthcare system accomplishments include the establishment of a fully functional pediatric oncology unit with 60 new healthcare providers (vs. five in 2007). Patient outcome improvements include a rise in 5-year survival for leukemia from 10 to 43%, a rise in new cases diagnosed per year from 21 to 70, a reduction in the treatment abandonment rate from 10% to 2%, and a 45% decrease in the infection rate. More than 600 patients have benefited from this program. Knowledge sharing has taken place between teams at the HGT and Rady Children’s Hospital San Diego. Further, one of the most significant outcomes is that the HGT has transitioned into a regional referral center and now mentors other hospitals in Mexico. Our results show that collaborative initiatives that implement long-term partnerships along the United States–Mexico border can effectively build local capacity and reduce the survival gap between children with cancer in the two nations. Long-term collaborative partnerships should be encouraged across other disciplines in medicine to further reduce health disparities across the United States–Mexico border. PMID:26157788
Aristizabal, Paula; Fuller, Spencer; Rivera, Rebeca; Beyda, David; Ribeiro, Raul C; Roberts, William
2015-01-01
In 2007, the 5-year survival rate for children with acute leukemia in Baja California, Mexico was estimated at 10% (vs. 88% in the United States). In response, stakeholders at St. Jude Children's Research Hospital, Rady Children's Hospital San Diego, and the Hospital General de Tijuana (HGT) implemented a transcultural partnership to establish a pediatric oncology program. The aim was to improve clinical outcomes and overall survival for children in Baja California. An initial needs assessment evaluation was performed and a culturally sensitive, comprehensive, 5-year plan was designed and implemented. After six years, healthcare system accomplishments include the establishment of a fully functional pediatric oncology unit with 60 new healthcare providers (vs. five in 2007). Patient outcome improvements include a rise in 5-year survival for leukemia from 10 to 43%, a rise in new cases diagnosed per year from 21 to 70, a reduction in the treatment abandonment rate from 10% to 2%, and a 45% decrease in the infection rate. More than 600 patients have benefited from this program. Knowledge sharing has taken place between teams at the HGT and Rady Children's Hospital San Diego. Further, one of the most significant outcomes is that the HGT has transitioned into a regional referral center and now mentors other hospitals in Mexico. Our results show that collaborative initiatives that implement long-term partnerships along the United States-Mexico border can effectively build local capacity and reduce the survival gap between children with cancer in the two nations. Long-term collaborative partnerships should be encouraged across other disciplines in medicine to further reduce health disparities across the United States-Mexico border.
Preliminary experiment research of explosively driven opening switch
International Nuclear Information System (INIS)
Li Xiaolin; Chen Dongqun; Li Da; Cao Shengguang; Chen Yingcong
2010-01-01
In pulse power technology field, many loads require high current pulse with fast risetime, but sometimes, the common high current pulse powers don't satisfy request, thus there need pulse erection switches of sorts to shorten pulse risetime. Explosively driven opening switch (EDOS) is a good choice, it has simple structure and excellent performance, the primary parameters of EDOS are opening time, opening resistance, opening current and dissipation energy, which determine its performance and range for applications. For this, two kinds of EDOS are designed and manufactured, in the later experiments, the power supply is a 200 μF capacitor and the conductor is 0.03 mm copper foil, the results indicate that the two kinds of EDOS have good performance, the opening time is about 1-3 μs, the opening resistance is about 1-2 Ω, the opening current is about 24-31 kA and the average dissipation energy is about 0.125-0.34 kJ per groove, the capability of conduction current is adjusted by the thickness of conductor along with different opening current. (authors)
Energy Technology Data Exchange (ETDEWEB)
1988-08-01
In the previous 17 meetings held within the framework of the International Working Group on Gas-Cooled Reactors, a wide variety of topics and components have been addressed, but the San Diego meeting represented the first time that a group of specialists had been convened to discuss circulator and blower related technology. A total of 20 specialists from 6 countries attended the meeting in which 15 technical papers were presented in 5 sessions: circulator operating experience I and II (6 papers); circulator design considerations I and II (6 papers); bearing technology (3 papers). A separate abstract was prepared for each of these papers. Refs, figs and tabs.
International Nuclear Information System (INIS)
LaBrecque, J.J.; Rosales, P.A.; Cordoves, P.R.
2002-01-01
Soils were collected at different elevations (m.a.s.l.) near the two roadways, that pass through the Henri Pittier National Park (Edo, Aragua, Venezuela) in order to determine the distribution of the concentrations of the 137 Cs fallout and its relation to the tropical cloud forest. Duplicate samples were taken at most elevations between 2-5 cm below the soil surface to confirm that the samples were representative of the area. In many cases, it was difficult or impossible to locate areas that were undisturbed by man or nature. The 137 Cs (Bq/kg) content was determined by conventional high resolution gamma ray spectroscopy employing a standard comparison method. The background of the 137 Cs fallout in soils, below the cloud (fog) baseline was calculated to be about 5 Bq/kg on both the south (land) side and north (ocean) side for both roadways. The concentrations of 137 Cs (Bq/kg) were between 2-3 times higher at the baseline of the cloud (fog) on both sides of the mountain range. The 137 Cs values at the highest elevations (1105 and 1625 m.a.s.l.) near the roadways were about 5-6 times higher than the determined background levels. Our estimates of the baseline of the cloud (fog) are in good agreement with other visual observations. It was concluded that the distribution of 137 Cs in soils in cloud forests can be employed to estimate the baseline and the concentrations of 137 Cs fallout can be related to the relative density of the cloud (fog) when it was deposited. (author)
Directory of Open Access Journals (Sweden)
Alejandra Araya
2008-11-01
Full Text Available La obra Convento Espiritual, de la religiosa Úrsula de San Diego, posiblemente escrita en el siglo XVI en Granada, España, forma parte de una tradición de escritura de mujeres como ejercicio ascético-místico en la vida religiosa y devota a ambos lados del Atlántico. En este trabajo se presenta un modo de leerlo en tanto género textual derivado de prácticas de organización del conocimiento provenientes de las artes de la memoria y, como tal, una forma de construcción del sujeto. Estas características son notables en este texto, y si bien no son exclusivas de él, es importante por formar parte de la historia de los primeros impresos en Chile luego de la independencia indicando con ello el reconocimiento pedagógico de este tipo de escritura femenina en las sociedades del Antiguo Régimen.The book Convento Espiritual (Spiritual Convent ofthe Spanish nun Ursula de San Diego, possibly written during the sixteenth century in Granada, Spain, is part of a tradition of womens' writing as an exercise in mystical-ascetic and devout religious life on both sides of the Atlantic. This essay proposes a reading this text within the frame of a textual genre originated in those practices of knowledge organization derived from the arts of memory; as a textual genre, it can also be understood as aform of subject construction. These are remarkable features to be foundin this text, and though they are not exclusive to it, they are important because the Convento espiritual belongs to the history of the early books printed in Chile after the Independence; this points out to the recognition of the educational value of this type of writing women in those societies belonging to the Old Regime.
Shirasugi, Etsuo
2007-03-01
There are two ukiyoe, Japanese woodblock prints, that were produced around 1850 and give a good picture of the images of the insides of the human body that were widely accepted among the common people in the Edo period. The Inshoku yojo kagami (Rules of Dietary Life) shows a man drinking sake. The Boji yojo kagami (Rules of Sexual Life) shows a woman, apparently a courtesan. The purpose of the two ukiyoe was to educate viewers about the functions of the principal inner organs in the traditional East Asian concept of the body and to admonish them against excessive eating, drinking and sexual intercourse. The contrivance of the two ukiyoe lies in their fusion of two formats. One is the format of a see-through body displaying the internal organs. The other is that of explaining the functions of the various internal organs in the form of familiar scenes from the living space of cities and households. Miniature sketches can be seen in the prints of people at work, performing the tasks believed to be that of each organ. However, the scheme of the two ukiyoe was not an innovation of the author of the ukioye. Already in the kibyoshi (Yellow Cover booklets), the scheme of likening the interior of the body to a living space had been adopted. After entering the 18th century, Chinese medical knowledge and anatomical drawings became available. As sex manuals, Yellow Cover booklets, and ukiyoe publications, incorporated and disseminated the newly acquired medical knowledge and the medical concept of the body gradually became the common sense view among people in the street.
Kuo, Grace M; Ma, Joseph D; Lee, Kelly C; Halpert, James R; Bourne, Philip E; Ganiats, Theodore G; Taylor, Palmer
2011-02-01
Clinical application of evidence-based pharmacogenomics information has the potential to help healthcare professionals provide safe and effective medication management to patients. However, there is a gap between the advances of pharmacogenomics discovery and the health professionals' knowledge regarding pharmacogenomics testing and therapeutic uses. Furthermore, pharmacogenomics education materials for healthcare professionals have not been readily available or accessible. Pharmacogenomics Education Program (PharmGenEd™) is an evidence-based pharmacogenomics education program developed at the University of California San Diego Skaggs School of Pharmacy and Pharmaceutical Sciences and the School of Medicine (CA, USA), with funding support from the Centers for Disease Control and Prevention. Program components include continuing education modules, train-the-trainer materials and shared curriculum modules based on therapeutic topics, and virtual communities with online resources.
Elgueta, Mario; Flores, Gustavo Ernesto; Roig Junent, Fidel Alejandro
2015-01-01
En la presente contribución se entrega información sobre la identificación y antecedentes por primera vez de tres especies de coleópteros de las islas Diego Ramírez. Hasta el momento se reconoció la presencia de insectos en estas islas solo a nivel de familias o géneros. Se presenta un comentario zoogeográfico. Fil: Elgueta, Mario. Area Entomología, Museo Nacional de Historia Natural; Chile; Fil: Flores, Gustavo Ernesto. Consejo Nacional de Invest.cientif.y Tecnicas. Centro Cientifico T...
Tra utopia e rivoluzione: le visioni di Diego Rivera al Rockefeller Center di New York
Directory of Open Access Journals (Sweden)
Amalda Cuka
2016-11-01
Full Text Available I murales eseguiti da Diego Rivera (1886–1957 al Rockefeller Center di New York nel 1933 sono fra le più note opere d’arte scomparse. Ad aver reso celebre il dipinto non è stato il successo di pubblico, data la rimozione del lavoro ancora in corso d’opera, ma il ricchissimo dibattito alimentato dalla stampa intorno alla concezione dell’immagine, considerata negli Stati Uniti totalmente rivoluzionaria per la particolare tecnica dell’affresco utilizzata da Rivera, per i riferimenti all’arte precolombiana e per le idee politiche esposte. Un’occasione di riflessione è offerta in questa sede dall’attenzione che uno dei principali organi di stampa americani, il New York Times, ha dedicato all’argomento: dalla lettura dei numerosi interventi emerge, da una parte, la capacità di Rivera di entrare in comunicazione con un vasto pubblico, e dall’altra il ruolo avuto dalla stampa nella diffusione - quasi involontaria - del suo messaggio. Rivera è riuscito a raggiungere in tal modo, almeno parzialmente, il suo scopo: l’opera non è stata accessibile al grande pubblico, ma la conoscenza dei principi che voleva celebrare si è diffusa in maniera ancor più capillare.
La influencia de Maquiavelo en las «Empresas políticas» de Diego de Saavedra Fajardo
Directory of Open Access Journals (Sweden)
Jesús VILLANUEVA LÓPEZ
2009-12-01
Full Text Available RESUMEN: A partir de la localización de cerca de treinta lugares de la Idea de un príncipe político cristiano (1640 de Diego de Saavedra Fajardo que constituyen préstamos literales del Príncipe y los Discursos de Maquiavelo, con lo que se amplía un anterior tratamiento por K. H. Mulagk (1973, se analiza la «influencia» maquiaveliana en tres niveles: en el simple aprovechamiento de ejemplos o comentarios históricos aislados de las obras de Maquiavelo; en la elaboración de un ideal de príncipe como alternativa consciente al de Maquiavelo, especialmente en el capítulo 18 del Príncipe, aunque reteniendo muchos elementos de éste; y en la consideración de los problemas de cómo asentar un gobierno «nuevo» (o sea, tras una sucesión en una monarquía y de cómo convertir una tiranía en un gobierno legítimo y justo. Se concluye que pese a la diferencia entre las pretensiones de uno y otro autor, Saavedra ha asumido de buen grado la problemática propia del maquiavelismo, aunque busca la solución a través de una síntesis con el pensamiento ortodoxo.ABSTRACT: Resting on the identification of nearly thirty places in Diego de Saavedra Fajardo's Idea of a Politico-Christian Prince (1640 which happen to be literal borrowings from Machiavelli's Prince and Discourses, and so enlarging a previous treatment by ?. H. Mulakg (1973, the author proceeds to analyze the Machiavellian «influence» in three levels: in the simple recourse to isolated historical examples or commentaries from Machiavelli's works; in the composition of an ideal of the prince as a conscious alternative to that of Machiavelli's, displayed especially in the Prince chapter 18, though adopting many elements from the later; and in the reflexion about how to settle a «new» government (that is, after a succession in a monarchy and how to transform a tyranny into a legitimate and just government. It is concluded that, due weight being given to the difference between the
International Nuclear Information System (INIS)
Eze, Kenneth C.
2012-01-01
Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them
Energy Technology Data Exchange (ETDEWEB)
Eze, Kenneth C., E-mail: ezechallenge@yahoo.co.uk [Department of Radiology, Faculty of Medicine, College of Health Sciences, Nnamdi Azikiwe University, Nnewi Campus, Anambra State (Nigeria)
2012-09-15
Background: Musculoskeletal injuries are common in developing countries, but access to high quality orthopedic care is not. Traditional bone setters (TBS) serve to fill the gap, but the nature and quality of their treatment are largely understudied. Traditional bone setting in Idunmunkpaghan clan of Ogwa community, Edo State, Nigeria, was founded by Odion Ekhimere between about 1680 and 1705. The TBS practice in this community is studied to find out the complications and co-morbidities associated with it. Methods: A prospective community-based study of the patients admitted in the traditional bone setters’ homes was done at Ogwa over a -2-year period by studying the admission and discharge radiographs of patients treated in the community and by interviewing the TBS and patients. Result: Ninety patients with radiographs of the lesion sites were followed up from admission to discharge at the TBS homes, comprising 53 males (53.89%) and 37 females (41.11%) with a male to female ratio of 1.4:1. Sixty five patients (72.2%) had fracture or dislocation. Forty four of the 65 patients (67.7%) with fracture/dislocation had complications including mal-union 31(70.4%), secondary osteoarthritis 8 (18.2%), non-reduction of dislocation 7 (11.9%), non-union 8 (18.2%), and others 12 (27.2%). Co-morbidities were identified in 15 patients (16.7%) and included severe osteoarthritis 7 (46.7%), diabetic foot ulcer 4 (26.7%), severe hypertension with cardiomegaly 4 (26.7%), metastatic carcinoma of the prostate 3 (20.0%), septic arthritis 2 (13.3%), pulmonary tuberculosis 1 (6.7%) and others 3 (20.0%). Conclusion: The practice of traditional bone setting is well established in Idunmunkpaghan clan in Ukpogo quarter of Ogwa. Education and training of the TBS is the key to reduction of complications and co-morbidities seen in their practices as they have high patronage and the patients have high regards for them and will continue to patronize them.
Verhagen, Lilly M; Incani, Renzo N; Franco, Carolina R; Ugarte, Alejandra; Cadenas, Yeneska; Sierra Ruiz, Carmen I; Hermans, Peter W M; Hoek, Denise; Campos Ponce, Maiza; de Waard, Jacobus H; Pinelli, Elena
2013-01-01
Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children. This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score) and acute (weight-for-height and Body Mass Index (BMI)-for-age Z score in respectively children under 5 years of age and children aged 5 years and above) malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism. Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18%) while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37%) and Trichuris trichiura (40% in both regions). The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%). Anemia prevalence was highest in the Amazon Region (24%). Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20). In rural populations in Venezuela helminthiasis and giardiasis were associated with acute and chronic
Verhagen, Lilly M.; Incani, Renzo N.; Franco, Carolina R.; Ugarte, Alejandra; Cadenas, Yeneska; Sierra Ruiz, Carmen I.; Hermans, Peter W. M.; Hoek, Denise; Campos Ponce, Maiza; de Waard, Jacobus H.; Pinelli, Elena
2013-01-01
Background Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children. Methods This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score) and acute (weight-for-height and Body Mass Index (BMI)-for-age Z score in respectively children under 5 years of age and children aged 5 years and above) malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism. Results Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18%) while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37%) and Trichuris trichiura (40% in both regions). The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%). Anemia prevalence was highest in the Amazon Region (24%). Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20). Conclusions In rural populations in Venezuela helminthiasis and giardiasis were
Directory of Open Access Journals (Sweden)
Lilly M Verhagen
Full Text Available Children in rural areas experience the interrelated problems of poor growth, anemia and parasitic infections. We investigated the prevalence of and associations between intestinal helminth and protozoan infections, malnutrition and anemia in school-age Venezuelan children.This cross-sectional study was conducted in 390 children aged 4-16 years from three rural areas of Venezuela: the Amazon Region, Orinoco Delta and Carabobo State. Stool samples were collected for direct parasitic examinations. Anthropometric indicators of chronic (height-for-age Z score and acute (weight-for-height and Body Mass Index (BMI-for-age Z score in respectively children under 5 years of age and children aged 5 years and above malnutrition were calculated. Multivariate linear and logistic regression models were built to determine factors associated with nutritional status and polyparasitism.Hookworm and Strongyloides stercoralis prevalences were highest in children from the Amazon rainforest (respectively 72% and 18% while children from the Orinoco Delta and Carabobo State showed higher rates of Ascaris lumbricoides (respectively 28% and 37% and Trichuris trichiura (40% in both regions. The prevalence of Giardia lamblia infection was not significantly different between regions (average: 18%. Anemia prevalence was highest in the Amazon Region (24%. Hemoglobin levels were significantly decreased in children with a hookworm infection. Malnutrition was present in respectively 84%, 30% and 13% of children from the Amazon Region, Orinoco Delta and Carabobo State. In multivariate analysis including all regions, G. lamblia and helminth infections were significantly and negatively associated with respectively height-for-age and weight-for-height/BMI-for-age Z scores. Furthermore, hemoglobin levels were positively associated with the height-for-age Z score (0.11, 95% CI 0.02 - 0.20.In rural populations in Venezuela helminthiasis and giardiasis were associated with acute and
Orosco Benites, Juan Carlos Felipe; Orosco Benites, Juan Carlos Felipe
2004-01-01
El presente trabajo de investigación, trate de explicar en forma didáctica los conocimientos necesarios para poder hacer un análisis y diseño de una protección contra inundaciones en zonas urbanas. En este caso se tomará como ejemplo la urbanización San Diego, en el distrito de San Martín de Porres, el cual periódicamente sufre graves peligros en los meses de enero a marzo por las crecidas del río Chillón. Por tal motivo, se buscó darle una solución técnica a este problema, por...
International Nuclear Information System (INIS)
Taylor, D.
1997-07-01
The Department of Physics at San Diego State University has maintained a Neutron Generator facility in room P-32C since the mid 1960's. This facility has provided students and faculty with a resource for the study of neutron interactions with matter, such as activation analysis, flux determinations, cross section determinations and shielding studies. The model 9500 was built by Texas Nuclear Research in the early 1960's, and could be used for either photon or neutron generation, depending on the source ions introduced into the accelerator's plasma bottle and the target material. In February of 1988, the Texas Nuclear Research neutron generator was replaced by a unit manufactured by Kaman Sciences Corporation. The Texas Nuclear unit was then removed and stored for later disassembly and disposal. In the summer of 1993, the neutron generator was disassembled into three large sections consisting of the titanium-tritide target, the oil diffusion pump and the corona shield/accelerator tube assembly. The target was packaged and stored in room P-33A and the other 2 assemblies were wrapped in plastic for storage. In June of 1995 the neutron generator was further disassembled to enable storage in 55 gallon drums and thoroughly surveyed for loose surface contamination. Openings on the disassembled hardware components were closed off using either duct tape or bolted stainless steel flanges to prevent the possible spread of contamination. Significant levels of removable surface contamination could be found on system internal and some external surfaces, up to five hundred thousand disintegrations per minute. Initial analysis of the removable contamination using aluminum absorbers and a Geiger-Meuller tube indicated beta particle or possibly photon emitters with an energy of approximately 180 keV. This apparent radiation energy conflicted with what one would be expected to find, given knowledge of the source material and the possible neutron activated products that would be
TRAINING IN ETHICS OF HUMAN CAPITAL TO BUSINESS DEVELOPMENT
Neyda Ibañez; Rubén Castillo
2009-01-01
The purpose of the investigation was to interpret training in ethics for action business students an introduction to the economy of the Faculty of Social and Economic Sciences at the University of Carabobo, as part of professional development in business studies. The investigation was addressed within the paradigm post positivist using ethnographic and hermeneutic method, descriptive mode of scientific research and technique participant-observation. It concludes that training in ethics manage...
Robson Laverdi
2016-01-01
Entrevistador - Robson Laverdi Doutor em História Social pela Universidade Federal Fluminense. Professor da Universidade Estadual de Ponta Grossa. Transcrição - Laura Ortiz Doutoranda do Programa de Historia Oral. Universidad de Buenos Aires. Bolsista CONICET, Argentina. Entrevista concedida na cidade de Montevidéu, em 14 de agosto de 2014. * Diego Sempol é graduado pelo Instituto de Profesores Ar...
Kawamoto, M; Mikage, M
1999-01-01
The rhizome of Coptis plant of the family ranunculaceae has been used in traditional Chinese medicine as a crude drug (Huanglian in present Chinese). In Japan, the rhizome of Coptis japonica Makino (the botanical name of which is "Ohren" in modern Japanese) has been utilized as a crude drug since the Nara era. The Japanese name in those days was "Kakumakusa based on descriptions in old books written in the Heian era. It changed to "Kakumikusa" early in the Edo era, and then changed again to Kakumakusa later in the Edo era. Through this herbological study, it was conjectured as follows: The resemblance between Chinese characters (or MA) and (or MI) in cursive style caused mis-copying of the character. After the "Honzo-wamyo, written in the Heian era, was revised in the late Edo era, and on which the name was accurately written as Kakumakusa, the mistake was corrected.
Diosas y madres, el arquetipo femenino en Diego Rivera
Directory of Open Access Journals (Sweden)
Dina Comisarenco Mirkin
2010-11-01
Full Text Available En el presente trabajo se estudia la representación del arquetipo femenino en la obra mural de Diego Rivera que el artista entretejió en sus amplios y complejos programas iconográficos con una extraordinaria imaginación poética. Se postula aquí que por una parte, dicha representación arquetípica partió de su erudita utilización de símbolos alegóricos y de alusiones a divinidades femeninas de distintas épocas y lugares, como medio para asegurar la universalidad del contenido histórico de su pintura, y que por otra parte, y de forma esencial, el origen de sus poderosas imágenes femeninas, se remonta a algunas de las experiencias vitales del artista, en particular a aquellas relacionadas con el amor filial, con la maternidad/paternidad, y con las heterodoxas relaciones amorosas que Rivera mantuvo a lo largo de su vida con sobresalientes mujeres de su época a quienes admiró y reconoció a través de sus impactantes retratos y homenajes pictóricos. Se concluye así que el arte mural fue para Rivera no sólo un instrumento de acción política, tal y como es normalmente reconocido por la crítica especializada, sino también, una oportunidad para elaborar temas de carácter subjetivo, en los que paradójicamente alcanza un mayor grado de generalidad y trascendencia que el que caracteriza a su pintura histórica. Particularmente la expresión simbólica del arquetipo femenino plasmada por Rivera en algunos de sus principales aspectos como la Buena Madre, la Madre Terrible y, la Gran Madre, tal y como los fue viviendo, construyendo y modificando a través de algunas de sus experiencias vitales más significativas y profundas de su vida personal, constituye uno de los logros artísticos más eminentes del artista y uno de sus principales aportes iconográficos al arte universal. Sus excelsas imágenes de diosas y madres nos permiten re-conectarnos con el inconciente colectivo, y particularmente con el poder tradicionalmente
Mendez, Gregory O.; Majewski, Michael S.; Foreman, William T.; Morita, Andrew Y.
2015-01-01
In 1998, the U.S. Geological Survey, in cooperation with the Sweetwater Authority, began a study to assess the overall health of the Sweetwater watershed in San Diego County, California. This study was designed to provide a data set that could be used to evaluate potential effects from the construction and operation of State Route 125 within the broader context of the water quality and air quality in the watershed. The study included regular sampling of water, air, and surficial bed sediment at Sweetwater Reservoir (SWR) for chemical constituents, including volatile organic compounds (VOCs), base-neutral and acid- extractable organic compounds (BNAs) that include polycyclic aromatic hydrocarbons (PAHs), pesticides, and metals. Additionally, water samples were collected for anthropogenic organic indicator compounds in and around SWR. Background water samples were collected at Loveland Reservoir for VOCs, BNAs, pesticides, and metals. Surficial bed-sediment samples were collected for PAHs, organochlorine pesticides, and metals at Sweetwater and Loveland Reservoirs.
Fortmann, Addie L; Gallo, Linda C; Walker, Chris; Philis-Tsimikas, Athena
2010-09-01
This study used a social-ecological framework to examine predictors of depression, diabetes self-management, and clinical indicators of health risk among Hispanics with type 2 diabetes residing in the United States (U.S.)-Mexico border region in San Diego County, California, United States of America. Important links were observed between greater social-environmental support for disease management and less depression, better diabetes self-management, and lower body mass index and serum triglyceride concentrations. Less depressive symptomatology was also related to lower hemoglobin A1c levels. Findings suggest that programs aiming to improve diabetes self-management and health outcomes in Hispanics with type 2 diabetes should consider multilevel, social, and environmental influences on health, behavior, and emotional well-being.
Directory of Open Access Journals (Sweden)
Addie L. Fortmann
2010-09-01
Full Text Available This study used a social-ecological framework to examine predictors of depression, diabetes self-management, and clinical indicators of health risk among Hispanics with type 2 diabetes residing in the United States (U.S.-Mexico border region in San Diego County, California, United States of America. Important links were observed between greater social-environmental support for disease management and less depression, better diabetes self-management, and lower body mass index and serum triglyceride concentrations. Less depressive symptomatology was also related to lower hemoglobin A1c levels. Findings suggest that programs aiming to improve diabetes self-management and health outcomes in Hispanics with type 2 diabetes should consider multilevel, social, and environmental influences on health, behavior, and emotional well-being.En este estudio se utilizó un marco socioecológico para analizar los factores predictivos de la depresión, la autogestión de la diabetes y los indicadores clínicos de riesgo para la salud en hispanos que padecen diabetes tipo 2 residentes en la zona fronteriza entre México y los Estados Unidos del Condado de San Diego en California. Se observaron vínculos importantes entre un mayor apoyo socioambiental para el manejo de la enfermedad y una presencia menor de la depresión, una mejor autogestión de la diabetes, y menores índices de masa corporal y concentraciones de triglicéridos séricos. La presencia menor de síntomas depresivos también se relacionó con niveles inferiores de hemoglobina A1c. Estos resultados indican que los programas dirigidos a mejorar la autogestión de la diabetes y los resultados en materia de salud en los hispanos que padecen diabetes tipo 2 deben tener en cuenta las influencias sociales y ambientales sobre la salud, el comportamiento y el bienestar emocional.
Cardona Zapata, Carlos Alberto; Castaño Cortés, Erika; Lopera Ossa, Mónica Stella
2016-01-01
Tesis (Maestría en Educación y Desarrollo Humano). Universidad de Manizales. Facultad de Ciencias Sociales y Humanas. CINDE, 2016 El presente proyecto de investigación denominado “Prácticas de educación inclusiva en tres instituciones públicas del municipio de Itagüí: Juan Nepomuceno Cadavid, Diego Echavarría Misas y Concejo Municipal de Itagüí”, está fundado en tres debates, que para los investigadores son fundamentales: el de la concepción contemporánea del sujeto, el del paradigma educa...
服部, 銈二郎
1985-01-01
The rapid modernization of Japan during the Edo, Meiji, Taisho and Showa Periods has made the modern Japan one of the top-level countries in material terms at least. The traditional culture of Japan of the Edo Period was transformed through the Western civilization introduced with the Meiji Restoration. The life style of the Japanese as well as Japan's politics, economy and culture was rapidly westernized. Both the government and the common people of Japan considered that their urgent objecti...
Boudrias, M. A.; Estrada, M.; Anders, S.; Silva-Send, N. J.; Yin, Z.; Schultz, P.; Young, E.
2012-12-01
The San Diego Regional Climate Education Partnership has formed an innovative and collaborative team whose mission is to implement a research-based climate science education and communications program to increase knowledge about climate science among highly-influential leaders and their communities and foster informed decision making based on climate science and impacts. The team includes climate scientists, behavioral psychologists, formal and informal educators and communication specialists. The Partnership's strategic plan has three major goals: (1) raise public understanding of the causes and consequences of climate change; (2) identify the most effective educational methods to educate non-traditional audiences (Key Influentials) about the causes and consequences of climate change; and (3) develop and implement a replicable model for regional climate change education. To implement this strategic plan, we have anchored our project on three major pillars: (1) Local climate science (causes, impacts and long-term consequences); (2) theoretical, research-based evaluation framework (TIMSI); and (3) Key! Influentials (KI) as primary audience for messages (working w! ith and through them). During CCEP-I, the Partnership formed and convened an advisory board of Key Influentials, completed interviews with a sample of Key Influentials, conducted a public opinion survey, developed a website (www.sandiego.edu/climate) , compiled inventories on literature of climate science education resources and climate change community groups and local activities, hosted stakeholder forums, and completed the first phase of on an experiment to test the effects of different messengers delivering the same local climate change message via video. Results of 38 KI Interviews provided evidence of local climate knowledge, strong concern about climate change, and deeply held values related to climate change education and regional leadership. The most intriguing result was that while 90% of Key
Scherer, Michael; Romano, Eduardo; Caldwell, Susan; Taylor, Eileen
2018-02-17
Driving under the influence (DUI) citations are still a serious concern among drivers aged 16-20 years and have been shown to be related to increased risk of fatal and nonfatal crashes. A battery of laws and policies has been enacted to address this concern. Though numerous studies have evaluated these policies, there is still a need for comprehensive policy evaluations that take into account a variety of contextual factors. Previous effort by this research team examined the impact of 20 minimum legal drinking age-21 laws in the state of California, as they impacted alcohol-related crash rates among drivers under 21 years of age while at the same time accounting for alcohol and gas taxes, unemployment rates, sex distribution among drivers, and sobriety checkpoints. The current research seeks to expand this evaluation to the county level (San Diego County). More specifically, we evaluate the impact of measures subject to county control such as retail beverage service (RBS) laws and social host (SH) laws, as well as media coverage, city employment, alcohol outlet density, number of sworn officers, alcohol consumption, and taxation policies, to determine the most effective point of intervention for communities seeking to reduce underage DUI citations. Annual DUI citation data (2000 to 2013), RBS and SH policies, and city-wide demographic, economic, and environmental information were collected and applied to each of the 20 cities in San Diego County, California. A structural equation model was fit to estimate the relative contribution of the variables of interest to DUI citation rates. Alcohol consumption and alcohol outlet density both demonstrated a significant increase in DUI rates, whereas RBS laws, SH laws, alcohol tax rates, media clusters, gas tax rates, and unemployment rates demonstrated significant decreases in DUI rates. At the county level, although RBS laws, SH laws, and media efforts were found to contribute to a significant reduction in DUI rates, the
International Nuclear Information System (INIS)
Tran, K.; Yu, C.C.; Zeng, E.Y.
1997-01-01
The results from the measurements of aliphatic hydrocarbons suggest that hydrocarbons suggest that hydrocarbons in the Point Loma Wastewater Treatment Plant (PLWTP) effluents are mainly petroleum derived; those in the Tijuana River runoff have largely originated from terrestrial plants with visible petroleum contamination; and those in the sea surface microlayer, sediment traps, and sediments at various coastal locations off San Diego have mostly resulted from biogenic contributions with enhanced microbial products in the summer season. Rainfall in the winter season appeared to amplify the inputs from terrestrial higher plants to the coastal areas. The PLWTP discharged approximately 3.85 metric tons of n-alkanes (C 10 -C 35 ) in 1994, well below the level (136 metric tons) estimated in 1979. The input of aliphatic hydrocarbons from the Tijuana River was about 0.101 metric tons in 1994. Diffusion, solubilization, evaporation, and microbial degradation seemed partially responsible for the difference in the concentrations and compositions of aliphatic hydrocarbons in different sample media, although the relative importance of each mechanism cannot be readily discerned from the available data. The results from analyses of aliphatic hydrocarbon compositional indices are generally consistent with those of polycyclic aromatic hydrocarbons
Actitud de las madres en el cumplimiento del calendario de vacunación de niños menores de 6 años
Mariana Boscan; Belén Salinas; Maria Luisa Trestini; Maria Tomat
2012-01-01
The purpose of this study was to determine the attitude of mothers regarding compliance with the vaccination calendar of children less than 6 years of age in the pediatrics hospitalization service at the children hospital Dr. Jorge Lizarraga, in Valencia, Carabobo State. This was a descriptive cross-sectional, non-experimental study. A survey designed by the author was applied, after validation and informed consent to 71 mothers. The data was displayed in graphs and tabulated showing absolute...
International Nuclear Information System (INIS)
Silva-Send, Nilmini; Anders, Scott; Narwold, Andrew
2013-01-01
California's overarching mandate to achieve 1990 levels of greenhouse gases (GHGs) in 2020 (AB 32, 2005), and the ensuing recent regulations (SB 375, CEQA updates) require local and regional governments to assess GHG mitigation policies, including on-road transportation. The regulations do not make cost-effectiveness a primary criteria for choosing measures but cost remains important to a variety of stakeholders. This communication summarizes results from GHG and cost analysis for seven actual San Diego County road transportation policies: telecommute, vanpools, a bicycle strategy, an increase in mass transit use, parking policies (parking pricing, preferred parking for electric vehicles), an increased local fuel tax and speed harmonization (signal re-timing, roundabouts). Net costs are calculated as the sum of direct costs and benefits to the administering agency, the employer and the individual. Net costs per metric ton GHG abated vary greatly across measures, from negative to high positive (more than US $1000). We find that local GHG cost cannot be sensibly compared to other carbon or GHG policy costs outside the local context for a variety of reasons, but especially because measures have not been adopted primarily for carbon or GHG abatement potential or on the basis of cost effectiveness
Directory of Open Access Journals (Sweden)
Alejandra Araya
2008-01-01
Full Text Available La obra Convento Espiritual, de la religiosa Úrsula de San Diego, posiblemente escrita en elsiglo XVI en Granada, España, forma parte de una tradición de escritura de mujeres como ejercicio ascético-místico en la vida religiosa y devota a ambos lados del Atlántico. En este trabajo se presenta un modo de leerlo en tanto género textual derivado de prácticas de organización del conocimiento provenientes de las artes de la memoria y, como tal, una forma de construcción del sujeto. Estas características son notables en este texto, y si bien no son exclusivas de él, es importante por formar parte de la historia de los primeros impresos en Chile luego de la independencia indicando con ello el reconocimiento pedagógico de este tipo de escritura femenina en las sociedades del Antiguo Régimen.
Ryan, Holly F.; Conrad, James E.; Paull, C.K.; McGann, Mary
2012-01-01
The San Diego trough fault zone (SDTFZ) is part of a 90-km-wide zone of faults within the inner California Borderland that accommodates motion between the Pacific and North American plates. Along with most faults offshore southern California, the slip rate and paleoseismic history of the SDTFZ are unknown. We present new seismic reflection data that show that the fault zone steps across a 5-km-wide stepover to continue for an additional 60 km north of its previously mapped extent. The 1986 Oceanside earthquake swarm is located within the 20-km-long restraining stepover. Farther north, at the latitude of Santa Catalina Island, the SDTFZ bends 20° to the west and may be linked via a complex zone of folds with the San Pedro basin fault zone (SPBFZ). In a cooperative program between the U.S. Geological Survey (USGS) and the Monterey Bay Aquarium Research Institute (MBARI), we measure and date the coseismic offset of a submarine channel that intersects the fault zone near the SDTFZ–SPBFZ junction. We estimate a horizontal slip rate of about 1:5 0:3 mm=yr over the past 12,270 yr.
FACTORS THAT PROMOTE THE DEFECTION OF THE VIRTUAL CLASSROOM
Jenniz La Madriz
2016-01-01
It education virtual is a resource that allows leverage them Tics for reduce barriers of space / time to learn and decrease the dropout school. The research had by objective determine them factors that promote the desertion of the classroom virtual of the subject of methods I, of support to them classes face-to-face, in the Faculty of Sciences economic and social, of the University of Carabobo. The methodological design was based on the quantitative paradigm and as technical survey, obtainin...
Superconductivity in Bismuth. A New Look at an Old Problem.
Mata-Pinzón, Zaahel; Valladares, Ariel A; Valladares, Renela M; Valladares, Alexander
2016-01-01
To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan's formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy.
Energy Technology Data Exchange (ETDEWEB)
Chen, Lin [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Xingchao [North Night Vision Technology (NNVT) Co., Ltd., Nanjing 210110 (China); Tian, Jinshou, E-mail: tianjs@opt.ac.cn [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Liu, Chunliang [Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Hulin [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Chen, Ping [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wei, Yonglin; Sai, Xiaofeng [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) Co., Ltd., Nanjing 210110 (China); Wang, Xing; Lu, Yu [Key Laboratory of Ultra-fast Photoelectric Diagnostics Technology, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); and others
2016-12-21
To obtain a high spatial resolution of a image intensifier based on microchannel plate (MCP), the long tail in the exit energy distribution of the output electrons (EDOE) is undesirable. The existing solution is increasing the penetration depth of the MCP output electrode, which will result in a serious gain reduction. Coating the MCP output electrode with efficient secondary electron yield (SEY) materials is supposed to be an effective approach to suppress the unfavorable tail component in the EDOE without negative effects on the gain. In our work, a three-dimensional MCP single channel model is developed in CST STUDIO SUITE to systematically investigate the dependences of the EDOE and the gain on the SEY property of the coated material, based on the Finite Integral Technique and Monte Carlo method. The results show that besides the high SEY of the coated material, the low incident energy corresponding to the peak SEY is another essential element affecting the electron yield in the final stage of multiplication and suppressing the output energy spread.
Sadler, Ryan A; Lamberski, Nadine; Christopher, Mary M
2016-06-01
Captive waterbuck ( Kobus ellipsiprymnus ) that appear clinically healthy have been noted to have high serum bilirubin concentrations compared with other ruminants; however, questions remain about the physiologic factors affecting bilirubin concentration and its potential association with underlying disease and icteric serum or mucous membranes. Serum bilirubin concentrations of healthy and diseased waterbuck housed at the San Diego Zoo Safari Park from 1989 to 2012 were retrospectively analyzed to determine any link between icteric serum, total bilirubin concentration (tBili), and disease entities in this species. Total bilirubin and direct (dBili) bilirubin concentrations and the prevalence of icteric serum were compared by subspecies, age group, and health status; associations with complete blood count and biochemical results and clinical diagnosis were assessed. No significant differences were found in tBili or dBili between Ellipsen (n = 32) and Defassa (n = 29) subspecies or in juveniles (n = 22) versus adults (n = 39). Clinically healthy waterbuck (n = 40) had significantly higher tBili (mean ± 2SD, 7.9 ± 1.2 mg/dl; P bilirubin (2.2-6.2 mg/dl). These results suggest healthy waterbuck have relatively high tBili and dBili compared with related species. Icteric serum may be seen in up to 15% of healthy animals in the absence of icteric tissues.
Danskin, Wesley R.
2012-01-01
Local water agencies and the United States Geological Survey are using a combination of techniques to better understand the scant freshwater resources and the much more abundant brackish resources in coastal San Diego, California, USA. Techniques include installation of multiple-depth monitoring well sites; geologic and paleontological analysis of drill cuttings; geophysical logging to identify formations and possible seawater intrusion; sampling of pore-water obtained from cores; analysis of chemical constituents including trace elements and isotopes; and use of scoping models including a three-dimensional geologic framework model, rainfall-runoff model, regional groundwater flow model, and coastal density-dependent groundwater flow model. Results show that most fresh groundwater was recharged during the last glacial period and that the coastal aquifer has had recurring intrusions of fresh and saline water. These intrusions disguise the source, flowpaths, and history of ground water near the coast. The flow system includes a freshwater lens resting on brackish water; a 100-meter-thick flowtube of freshwater discharging under brackish estuarine water and above highly saline water; and broad areas of fine-grained coastal sediment filled with fairly uniform brackish water. Stable isotopes of hydrogen and oxygen indicate the recharged water flows through many kilometers of fractured crystalline rock before entering the narrow coastal aquifer.
Freckleton, John R.
1981-01-01
The Santa Ysabel (consisting of three tracts) and Mesa Grande Indian Reservations are in north-central San Diego County, Calif. On both reservations fractured and weathered igneous and metamorphic rocks and alluvium are water bearing; however, no wells are known to derive their water entirely from alluvium. Well yields range from 2.5 to 250 gallons per minute. Springs occur where saturated fractured or weathered material intersects the land surface. Spring discharge ranged from 0 gallon per minute (November 1979) to 9.4 gallons per minute (November 1979). Few data are available for the surface water characteristics of the study area. One-time measurements of discharge at selected stream sites were made in late November 1979 and late May 1980; discharges ranged from less than 0.01 cubic foot per second to an estimated 3 cubic feet per second. Further study of the surface-water systems would provide a basis for estimating their development potential. The existing water-supply development on the Santa Ysabel Indian Reservation is adequate for the present residents. The Mesa Grande reservation was unoccupied in 1952, was reportedly unoccupied in November 1979, and has no developed water supply. Additional water can be developed for both reservations from the igneous and metamorphic rock, from presently undeveloped springs, and from perennial reaches of the larger streams. Except for excessive iron and sodium at some ground-water sites and excessive sodium at a few surface-water sites, the water is of suitable quality for domestic and agricultural use. (USGS)
Martinez, SM; Rhee, K; Blanco, E; Boutelle, K
2015-01-01
© 2015 Academy of Nutrition and Dietetics. This study aimed to explore the attitudes and behaviors of Latino mothers around feeding their children. Using qualitative methods, we conducted four focus groups in Spanish with 41 Latino mothers of elementary school-age children in San Diego County, CA. Latino mothers' mean age was 41 years; 90% were foreign-born; and 74% had a high school education or less. We explored cultural viewpoints around feeding and cooking and feeding strategies used. Foc...
Martinez, SM; Rhee, K; Blanco, E; Boutelle, K
2014-01-01
This study aimed to explore the attitudes and behaviors of Latino mothers around feeding their children. Using qualitative methods, we conducted four focus groups in Spanish with 41 Latino mothers of elementary school-age children in San Diego County, CA. Latino mothers' mean age was 41 years; 90% were foreign-born; and 74% had a high school education or less. We explored cultural viewpoints around feeding and cooking and feeding strategies used. Focus groups were analyzed based on a priori a...
Análisis por espectroscopia infrarroja de algunas arcillas colombianas
Directory of Open Access Journals (Sweden)
Yolanda O. de Bravo
2009-06-01
Full Text Available Se estudiaron once muestras procedentes de distintos puntos del yacimiento Mondoñedo (Mosquera, Cundinamarca. A la fracción arcillosa menor de 2 micras, separadas, según el método de Jackson, se les tomó para su caracterización, los correspondientes espectros IR. Las muestras analizadas contienen como mineral predominante caolinita y en menor proporción cuarzo. Es de anotar la presencia de hidróxidos de hierro y de aluminio. La similitud en la composición mineralógica de las muestras permite inferir la homogenidad del yacimiento de Mondoñedo.
THE SOCIAL PHENOMENON IN PARTICIPATORY PROCESSES OF COMMUNITY COUNCILS
Directory of Open Access Journals (Sweden)
María Lourdes Sánchez
2016-07-01
Full Text Available The objective of this research is to interpret the social phenomenon in participatory processes of Community Councils of Carabobo State, centering participation within these organizations is an indispensable condition to conceive citizens as active subjects in management public affairs. It is inserted into a document type from the qualitative approach. Eventually you will reach a reflection that the success of citizen participation in these organizations rely on training, degree of commitment, teamwork, sense of belonging, responsibility and communication from their cultural worldview.
Use of synthetic cathinones and cannabimimetics among injection drug users in San Diego, California.
Wagner, Karla D; Armenta, Richard F; Roth, Alexis M; Maxwell, Jane C; Cuevas-Mota, Jazmine; Garfein, Richard S
2014-08-01
Use of synthetic cathinones (SC) and cannabimimetics (i.e., "THC homologues" [TH]) is associated with adverse health effects. We investigated the epidemiology of synthetic drug use among a cohort of injection drug users (IDUs) in San Diego, California. We used logistic regression analysis to identify correlates of SC and TH use among 485 IDUs enrolled from June 2012 to September 2013. Seven percent of participants reported ever using SC and 30% reported ever using TH. In multivariate logistic regression, age and recent hospitalization were significantly associated with odds of SC use (Adjusted Odds Ratio [AOR] 0.93, 95% Confidence Interval [C.I.] 0.90, 0.97; and AOR 2.34 95% C.I. 1.00, 5.49, respectively) and TH use (AOR 0.96, 95% C.I. 0.94, 0.98; and AOR 2.62, 95% C.I. 1.47, 4.68, respectively). Use of methamphetamine (AOR 9.35, 95% C.I. 1.20, 72.79) and club drugs in the past six months (AOR 3.38, 95% C.I. 1.17, 9.76) were significantly associated with SC use. Being on probation/parole (AOR 2.42, 95% C.I. 1.44, 4.07), initiating injection drug use with stimulants (AOR 1.89 95% C.I. 1.13, 3.16), and past six-month marijuana (AOR 9.22, 95% C.I. 4.49, 18.96) and prescription drug use (AOR 1.98, 95% C.I. 1.20, 3.27) were significantly associated with TH use. A considerable proportion of IDU use synthetic drugs and may experience harms associated with their use. Findings have implications for criminal justice system management. Prevention efforts should emphasize the risks associated with rapidly changing synthetic formulations, and the potential harms associated with polydrug use. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Velásquez Pérez, Argiro
2013-01-01
Ubicación en Biblioteca USB Medellín (San Benito): CD-2737t.-- Grupo de Investigación en Estudios Interdisciplinarios sobre Educación (ESINED).-- Línea de Investigación: Gestión Educativa - Currículo.-- Área: gestión educativa y currículo en las prácticas contemporáneas.-- Tema: proyectos pedagógicos alternativos, integradores e incluyentes La investigación aborda el problema que se presenta en la Institución Educativa Diego Echavarría Misas-Medellín en relación con una gestión curricular ...
Población commuter de la frontera norte: el caso de Mexicali-Calexico y Tijuana-San Diego
Directory of Open Access Journals (Sweden)
Germán Vega Briones
2016-01-01
Full Text Available El objetivo central de este trabajo es analizar el perfil sociodemográfico de los trabajadores transfronterizos o commuters de las ciudades de Tijuana-San Diego y Mexicali- Calexico de acuerdo con el sexo y el lugar donde se encuentra el trabajo. Los trabajadores transfronterizos o commuters son los individuos que residen en alguna ciudad de la frontera norte de México, pero cotidianamente cruzan la línea fronteriza para trabajar en la ciudad estadounidense contigua. La información que se utiliza para realizar este estudio es la obtenida por el Censo de Población y Vivienda mexicano del año 2010; sin embargo, el análisis sobre el perfil de los commuters se complementa con información de carácter etnográfico producto de diversas entrevistas realizadas a los trabajadores transfronterizos, principalmente en las ciudades de Tijuana y Mexicali. Consideramos que esta población tiene una imagen individual y cotidiana más completa de la compleja relación que se da en la frontera México-Estados Unidos, dada su característica principal de interacción continua entre ambos lados de la frontera. Ello al mismo tiempo nos permite contar con una visión más profunda de una realidad fronteriza que se basa en la dependencia creada y recreada en las sociedades tanto mexicana como estadounidense.
Directory of Open Access Journals (Sweden)
Liliana Vence Márquez
2012-10-01
Full Text Available Among the functions of evaluation, the control and environmental monitoring of the uses of existing water sources in Cesar was studied by the Corporación Autónoma Regional del Cesar, CORPOCESAR, to evaluate the quality of groundwater located in 93 wells in the municipalities of La Paz and San Diego (Cesar in 2009 in accordance with decree 1575/07 and resolution 2115/07 of the Ministerio de Protección Social (Ministry of Social Protection and the Ministerio de Ambiente, Vivienda y Desarrollo Territorial (Ministry of Environment, Housing and Territorial Development. Were characterized microbiological properties (determined from Psuedomona aeruginosa and protozoan pathogens and physiochemical properties (conductivity, pH, temperature, total dissolved solids, salinity, acidity, basicity, turbidity, chlorides, ammonia, nitrites, iron, magnesium, sodium and calcium; the last three elements being necessary for the calculation of the viability of irrigation, with the end of quantifying the quality of the water supplying the inhabitants of these lands. The Detection of P. aeruginosa was achieved via filtration through a membrane and protozoa through the flotation technique by centrifugation with zinc sulfate. Of the samples analyzed, 84.94% contained P. aeruginosa. Were identified five genera of protozoa, Giardia sp being the pathogen of highest prevalence at 46.1 %, followed by Cryptosporidium sp at 22.18%. Respecting the physiochemical results, only 4.3% of the wells sampled were determined to be suitable for irrigation without jeopardizing public health and safety.
Commercializing a U.S. piezoceramic linear motor
Diehl, Rick W.
2000-06-01
A small low-cost piezoceramic linear motor has been developed in the US and is being commercialized by EDO Corporation, working with a leading motion control OEM and with a prominent US corporate research laboratory. First generation motor design has emphasized high displacement at up to 200mm per second velocity with 3.5 Newtons force with high resolution, short time constant and a 15 volt power supply at a cost of less than 100 dollars. Motor dimensions of 30 by 50 by 4 mm allow broad configuration choices, al hidden within the motion control slide. The EDO approach was to build on its core competence in high reliability electroceramic material engineering and production, and to use a strategy of back-integrating, or outsourcing of recent advances outside Edo in piezoceramics, while forward- integrating into specific emerging applications known intimately by the OEM in the market. The strategy provided design focus that has led to a cost-effective advance in 'solid-state actuation and control'. This is considered a classic case of successful industrial integration of an enabling technology across organizations in order to access the needed mix of technology for development of an innovative and competitive solution.
En California dos pioneros: Uno en el pasado y otro en el presente
Directory of Open Access Journals (Sweden)
Mauricio Bermúdez
2002-11-01
Full Text Available Agost on Haraszthy buscando un clima para alivio de su enfermedad arribó en 1849 al sur de California donde se convirtió en el pionero al importar, sembrar y producir vino con Zinfandel, una entre otras muchas vides europeas. Construyó el viñedo Buena Vista diseñado para esa época con las mejores facilidades, no obstante, la empresa estaba destinada al colapso financiero por el incumplimiento del Estado de California; la vida de Agost on fue una aventura y tras su muerte una leyenda. En 1976 Peter Haywood decide cambiar su vida dedicada a las finanzas, deja Nueva York y viaja a California, allí compra un terreno para adecuarlo como viñedo; en 1980 obtiene su primera producción comercial y gracias a la fuerte demanda se vio obligado a incrementar su producción. El Zinfandel producido en el viñedo los Chamizales de la casa Haywood ha sido galardonado y declarado como el mejor. ¿Cuáles serán las caracte-rísticas del vino para lograr esa gran acogida?
[Simejigahara, a place noted for moxa].
Oda, R
1996-01-01
Shimejigahara is a place-name often used in old Waka (Japanese poems). It was reputed in the past to be a site rich in the plants moxa and mugwort. A study of this placed carried out. Shimejigahara, as mentioned in the literature of the Heian to Kamakura eras, seems to have been located at the site of the current Tochigi City. During the Edo era, however, Senjogahara in Nikko came to be referred to as Shimejigahara. In addition, some other places in what is now called Utsunomiya City, on Ibuki Mountain in Shiga Prefecture, and in Chiba City were referred to as Shimejigahara during the Edo era. When the types of wild mugwort seen in these various sites called "Shimejigahara" were searched for, Artemisia princeps P. was found in the cities of Tochigi, Utsunomiya and Chiba, while A. montana P. was seen in Senjogahara and on Ibuki Mountain. Papers published during the Edo era suggest that moxa, gathered in the Shimejigahara, was on the market during that period. It is, however, doubtful that the moxa produced from Shimejigahara was really commercialized, like the well-known "Ibuki moxa."
TRAINING IN ETHICS OF HUMAN CAPITAL TO BUSINESS DEVELOPMENT
Directory of Open Access Journals (Sweden)
Neyda Ibañez
2009-04-01
Full Text Available The purpose of the investigation was to interpret training in ethics for action business students an introduction to the economy of the Faculty of Social and Economic Sciences at the University of Carabobo, as part of professional development in business studies. The investigation was addressed within the paradigm post positivist using ethnographic and hermeneutic method, descriptive mode of scientific research and technique participant-observation. It concludes that training in ethics management must transcend the economic theories located in the teleological by financial or economic interests toward the teleological including humanism.
Actitud de las madres en el cumplimiento del calendario de vacunación de niños menores de 6 años
Boscan, Mariana; Salinas, Belén; Trestini, Maria Luisa; Tomat, Maria
2012-01-01
La finalidad de este estudio fue determinar la actitud de las madres hacia el cumplimiento del calendario de vacunación de niños menores de 6 años en el servicio de hospitalización del hospital de niños Dr. Jorge Lizarraga, en Valencia, Estado Carabobo. Fue un estudio transversal, descriptivo, no experimental; se aplicó una encuesta, previa validación y consentimiento informado a 71 madres. Los datos fueron tabulados y graficados mostrándose frecuencias absolutas y porcentajes. En los resulta...
Gene : CBRC-PTRO-14-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available icted protein [Nematostella vectensis] gb|EDO44122.1| predicted protein [Nematostella vectensis] 5e-22 27% MHIPYTYIPYICISH...IYVYPYTYIPHICIYRPYTYIPYICIAHIHISHIHISHIYMFIPYTYIPYPYIPCTCISHIRISHVHVYPISVYPMYMYIPYPYIPCTCISHIR...ISHVHVYPVSVYPMYMYIPYPYIPCTCISHIRISHVHVYPVSVYPMYMYILYPYIPCTCISRIRISHVYVYPIYVYPMYMYNPYTYIPYISCVCIYKYPVCIYIYPVCIYIYISCVCVCVYIYIHTHTYSSVFLFLFYFIF ...
Directory of Open Access Journals (Sweden)
Marcos Carrasco
2008-06-01
Full Text Available Net radiation (Rn is the main energy balance component controlling evaporation and transpiration processes. In this regard, this study evaluated two models to estimate Rno above a commercial vineyard (Vitis vinifera cv. Cabernet Sauvignon located in Pencahue Valley, Maule Region (35º22’ S; 71°47’ Wl; 75 m.a.s.l.. An automatic meteorological station (AMS was installed in the central part of the vineyard and used to measure Rn, solar radiation (Rsi, air temperature (Ta, canopy temperature (Tf and relative humidity (RH. On a 30 min interval, results indicated that model Rne1 (assuming Ta ≠ Tf and model Rne2 (assuming Ta = Tf were able to estimate Rn with a mean absolute error (MAE of less than 40 W m-2 and root mean square error (RMSE of less than 61 W m-2. On daily intervals, the two models estimated Rno with MAE and RMSE values of less than 1.68 and 1.75 MJ m-2 d-1, respectively. In global terms, the models presented errors below 9 and 11% on 30 min and daily intervals, respectively. Furthermore, this study indicated that the incorporation of canopy temperature did not improve the Rno estimation substantially, in spite of having a temperature gradient (dT = Tf - Ta between -3 and to 4ºC. These results suggest that an Rne2 model could be used to estimate Rno using Rsi, Ta and RH measurements.El flujo de radiación neta (Rn es el principal componente del balance de energía que determina los procesos de evaporación y transpiración. En este contexto, este estudio evaluó dos modelos para estimar Rno sobre un viñedo (Vitis vinifera L. cv. Cabernet Sauvignon comercial ubicado en el Valle de Pencahue, Región del Maule (35º22’ S; 71º47’ Oeste; 75 m.s.n.m.. Para esto, se ubicó una estación meteorológica automática (AME en la parte central del viñedo para medir Rn, radiación solar (Rsi, temperatura del aire (Ta, temperatura del dosel (Tf y humedad relativa (HR. En intervalos de tiempo de 30 min, los resultados indicaron que el
Directory of Open Access Journals (Sweden)
Rosa Amaya-de Rebolledo
2010-12-01
Full Text Available ResumenLa formación permanente del docente juega un papel clave en el cambio educativo; sin embargo, su con- creción práctica representa un reto epistemológico y metodológico. La problemática ha sido abordada des- de diferentes ángulos, en los cuales la relación entre cultura docente y formación permanente no ha sido claramente desvelada. En este artículo, que constituye un avance en la investigación de tesis doctoral de la Facultad de Ciencias de la Educación de la Universidad de Carabobo, se analiza por qué la cultura docente necesita ser reconocida como una realidad dinámica, dialéctica y relacional que afecta la calidad de la for- mación permanente del docente venezolano.AbstractThe continuous training of the teacher plays a key role in educational change; however, to take it to the practice rep- resents an epistemological and meth- odological challenge. The problem has been approached from different angles, where the relation between culture of the teacher and continuous training has not been clearly discussed. In this article, which constitutes an advance in the investigation of doctoral thesis of the Faculty of Sciences of the Education of Carabobo's University, it is analyzed why the culture of the teacher needs to be recognized as a dynamic reality, dialectic and relational that affects the quality of the continuous training in Venezuelan.RésuméLa formation continue des enseignants joue un rôle essentiel dans le changement éducatif, cependant, sa concrétion prati- que représente un défi épistémologique et méthodologique. La problématique a été envisagée dès perspectives différen- tes, dans lesquelles la relation entre la culture de l'enseignant et la formation continue n'a pas encore été nettement dévoilée. Dans cet article, qui constitue une avance dans la recherche de thèse doctorale de la Faculté de Sciences de l'Éducation de l'Université de Carabobo, on
Directory of Open Access Journals (Sweden)
Raquel Herranz
2015-12-01
Full Text Available La cianamida hidrogenada (CH es un eficaz estimulante de la brotación de las yemas habitualmente utilizado en viticultura tropical, pero manipular esta materia activa conlleva un alto riesgo por su elevada toxicidad. Según algunos estudios tratamientos alternativos podrían llegar a producir sobre las yemas efectos similar a la CH, compensado la falta de horas de frío en viñedos situados en zonas tropicales, como los ubicados en la costa sur ecuatoriana. De entre todos los tratamientos evaluados destacan los efectos producidos por la aplicación directa sobre las yemas de peróxido de hidrógeno al 5%. Este tratamiento consigue estimular la brotación de la práctica totalidad de las yemas, adelantando e incrementando el desarrollo vegetativo y duplicando el rendimiento de las cepas, sin mermar la calidad de los racimos producidos. Por tanto podemos afirmar que los tratamientos con peróxido de hidrógeno son una alternativa viable, más económica y sostenible, a las aplicaciones de CH en estas condiciones de cultivo Abstract Hydrogen cyanamide (CH is an effective stimulant bud breaking usually used in tropical viticulture, but handling this active substance carries a high risk because of their high toxicity. According to some studies alternative treatments could potentially produce a similar effect on the buds to CH, offset the lack of chilling hours in vineyards located in areas without a sufficient period of chilling hours, such as those located on the southern coast of Ecuador. Among all treatments evaluated the effects include direct application to the buds of hydrogen peroxide 5%. This treatment gets stimulate bud breaking of almost all of the buds, advancing and increasing vegetative growth and doubling the performance of the strains, without compromising the quality of the grapes produced. Therefore we can say that the hydrogen peroxide treatments are a viable, economical and sustainable, alternative to CH applications in these
Thudium, Karen; Bilic, Sanela; Leipold, Douglas; Mallet, William; Kaur, Surinder; Meibohm, Bernd; Erickson, Hans; Tibbitts, Jay; Zhao, Hong; Gupta, Manish
2013-01-01
The American Association of Pharmaceutical Scientists (AAPS) National Biotechnology Conference Short Course "Translational Challenges in Developing Antibody-Drug Conjugates (ADCs)," held May 24, 2012 in San Diego, CA, was organized by members of the Pharmacokinetics, Pharmacodynamics and Drug Metabolism section of AAPS. Representatives from the pharmaceutical industry, regulatory authorities, and academia in the US and Europe attended this short course to discuss the translational challenges in ADC development and the importance of characterizing these molecules early in development to achieve therapeutic utility in patients. Other areas of discussion included selection of target antigens; characterization of absorption, distribution, metabolism, and excretion; assay development and hot topics like regulatory perspectives and the role of pharmacometrics in ADC development. MUC16-targeted ADCs were discussed to illustrate challenges in preclinical development; experiences with trastuzumab emtansine (T-DM1; Genentech) and the recently approved brentuximab vedotin (Adcetris; Seattle Genetics) were presented in depth to demonstrate considerations in clinical development. The views expressed in this report are those of the participants and do not necessarily represent those of their affiliations.
Joyce-Zuniga, Nicole M; Roesler, Jennifer; Andrus, Chris Hamlin; Sutherland-Smith, Meg; Rideout, Bruce A; Pye, Geoffrey W
2014-03-01
The recent classification as threatened status of the northern koala (Phascolarctos cinereus) by the Australian Government highlights the importance of the conservation and health management of this iconic Australian marsupial. This case series describes gastrointestinal torsion and intussusception in six northern koalas (three males, three females, 2-11 yr old) at the San Diego Zoo from 1976 to 2012. Two koalas died shortly after presentation. Diagnoses of ileocecal intussusception, resulting from enteritis in one case and cecal torsion in the other, were made at postmortem examination. One koala died 4 days after an exploratory laparotomy, with negative findings, and an acute double colonic intussusception was diagnosed at postmortem examination. Two small intestinal mesenteric torsion and one proximal colon mesenteric torsion cases were successfully corrected surgically. In the case of colonic mesenteric torsion, the koala had recurrent clinical signs 2 wk later, and a second surgery requiring resection and anastomosis of ischemic jejunum was performed, with the koala dying shortly afterward. One koala with small intestinal torsion had a recurrence of torsion 22 mo later and subsequently died. The koala with the second case of small intestinal torsion remains alive 14 mo postsurgical correction. All six koalas presented with signs of colic that included anorexia, lethargy, depression, acute abdominal distension, abdominal stretching, decreased fecal output, open-mouth gasping, or a combination of symptoms. Abdominal radiographs may show stacked gastrointestinal linear gas patterns and contrast stasis. Prevalence of torsion and intussusception is low at this institution (2%), although recurrence in individuals is common (50%) and overall survival is poor (83%), which emphasizes the importance of timely recognition, surgical correction, and postoperative management. While inciting etiologies were unable to be determined in these cases, monitoring generalized
Directory of Open Access Journals (Sweden)
Carlos ORTIZ DE URBINA MONTOYA
2009-11-01
Full Text Available RESUMEN: En las postrimerías del siglo XVIII, la pionera de la Sociedades Económicas fundadas en los territorios de la Corona borbónica española, la Real Sociedad Bascongada de los Amigos del País, establecería en Vitoria de la mano de su subsecretario, Diego Lorenzo del Prestamero, un gabinete numismático que se nutriría de las aportaciones de sus socios, tanto peninsulares como coloniales. La Guerra de la Convención, que daría lugar a la invasión y ocupación francesa de buena parte del territorio de Guipúzcoa y en última instancia de la ciudad de Vitoria, marcaría el punto de inflexión en la existencia de la Bascongada, y en consecuencia de sus actividades y, entre ellas, de su monetario. Adquirida por la Diputación Foral de Álava, esta colección numismática se encuentra en la actualidad depositada en el Palacio de Bendaña de Vitoria-Gasteiz a la espera de su ubicación definitiva.ABSTRACT: In the last years of of the 18th century, the pioneer of the economic societies established in the Spanish Bourbon kingdoms, the Real Sociedad Bascongada de Amigos del País, founded a numismatic collection in Vitoria, inspired by its under-secretary, Diego Lorenzo del Prestamero, and funded by the contributions of members in both the Peninsular and the colonies. The War of the Convention, that caused France to invade and occupy a large part of Guipúzcoa and eventually the city of Vitoria, marked the turning point in the existence of the Bascongada and, consequently, of its activities, including its numismatic activity. Acquired by the Leasehold Delegation (Diputación Foral of Álava, this numismatic collection is now in the Palace of Bendaña in Vitoria-Gasteiz, awaiting its definitive location.
Larrick, James W; Alfenito, Mark R; Scott, Jamie K; Parren, Paul W H I; Burton, Dennis R; Bradbury, Andrew R M; Lemere, Cynthia A; Messer, Anne; Huston, James S; Carter, Paul J; Veldman, Trudi; Chester, Kerry A; Schuurman, Janine; Adams, Gregory P; Reichert, Janice M
Antibody Engineering & Therapeutics, the largest meeting devoted to antibody science and technology and the annual meeting of The Antibody Society, will be held in San Diego, CA on December 11-15, 2016. Each of 14 sessions will include six presentations by leading industry and academic experts. In this meeting preview, the session chairs discuss the relevance of their topics to current and future antibody therapeutics development. Session topics include bispecifics and designer polyclonal antibodies; antibodies for neurodegenerative diseases; the interface between passive and active immunotherapy; antibodies for non-cancer indications; novel antibody display, selection and screening technologies; novel checkpoint modulators / immuno-oncology; engineering antibodies for T-cell therapy; novel engineering strategies to enhance antibody functions; and the biological Impact of Fc receptor engagement. The meeting will open with keynote speakers Dennis R. Burton (The Scripps Research Institute), who will review progress toward a neutralizing antibody-based HIV vaccine; Olivera J. Finn, (University of Pittsburgh School of Medicine), who will discuss prophylactic cancer vaccines as a source of therapeutic antibodies; and Paul Richardson (Dana-Farber Cancer Institute), who will provide a clinical update on daratumumab for multiple myeloma. In a featured presentation, a representative of the World Health Organization's INN expert group will provide a perspective on antibody naming. "Antibodies to watch in 2017" and progress on The Antibody Society's 2016 initiatives will be presented during the Society's special session. In addition, two pre-conference workshops covering ways to accelerate antibody drugs to the clinic and the applications of next-generation sequencing in antibody discovery and engineering will be held on Sunday December 11, 2016.
Basilio, Anthony; Searcy, Steven; Thompson, Andrew R
2017-01-01
The West Coast of the United States experienced variable and sometimes highly unusual oceanographic conditions between 2012 and 2015. In particular, a warm mass of surface water known as the Pacific Warm Anomaly (popularly as "The Blob") impinged on southern California in 2014, and warm-water conditions remained during the 2015 El Niño. We examine how this oceanographic variability affected delivery and individual characteristics of larval spotted sand bass (Paralabrax maculatofasciatus) to an estuarine nursery habitat in southern California. To quantify P. maculatofasciatus settlement patterns, three larval collectors were installed near the mouth of Mission Bay, San Diego CA, and retrieved weekly from June-October of 2012-2015. During 'Blob' conditions in 2014 and 2015, lower settlement rates of spotted sand bass were associated with higher sea surface temperature and lower wind speed, chlorophyll a (chl a) and upwelling. Overall, the number of settlers per day peaked at intermediate chl a values across weeks. Individual characteristics of larvae that settled in 2014-2015 were consistent with a poor feeding environment. Although settlers were longer in length in 2014-15, fish in these years had slower larval otolith growth, a longer larval duration, and a trend towards lower condition, traits that are often associated with lower survival and recruitment. This study suggests that future settlement and recruitment of P. maculatofasciatus and other fishes with similar life histories may be adversely affected in southern California if ocean temperatures continue to rise in the face of climate change.
Directory of Open Access Journals (Sweden)
Paloma Vargas Montes
2016-05-01
Full Text Available The following discussion offers a panorama of the hermeneutical horizon from which the philological annotation apparatus of the Libro de los ritos critical edition was created. The book, written by the Dominican friar Diego Durán in 1579, describes the religious life of the Nahua people with emphasis in the Mexicas or Aztecs of the postclassical period. Also, this work offers some considerations about the ethnohistorical value of the Libro de los ritos and explains how this idea was used as a hypothesis to create the philological annotation apparatus of the critical edition. The value of the analysis of this experience is the contribution that it offers to the discussion between philologists about the proper methodology that must be used for the critical annotation of the Indian chronicles, documents that conserve the memory of the Native American people.
A quality assurance program for environmental data operations involving waste management processes
International Nuclear Information System (INIS)
Johnson, G.L.; Blacker, S.M.
1990-01-01
This paper describes the 'core' elements needed in an effective Quality Program for environmental data operations involving nuclear, mixed, or non-nuclear wastes. For each core element, this paper examines the minimum components needed for an effective Quality Program for EDOs, and compares approaches to Quality Programs currently required by the U.S. DOE and the U.S. EPA. The comparison suggests how the Quality Program requirements used at DOE, and defined by NQA-1 and its supplements, and those used by EPA through its QAMS program guidance, may provide a basis for developing a harmonized Quality Program for EDOs involving any waste management processes, nuclear, non-nuclear, or mixed. (orig./DG)
Ericka Henao Jaramillo
2006-01-01
Joachim hezberG es un ingeniero agrónomo de origen Alemán, un hombre carismático, que llegó a Colombia hace más de 20 años para liderar un proyecto del gobierno Alemán, e incorporar variedades de uva a la región de Boyacá. Se enamoró de Villa de Leyva y desde 1985 jalona un proyecto vinícola conocido como Viñedo Guananí, que en lengua indígena significa tierra prometida. Y así es, su viñedo podría considerarse como la tierra prometida para el vino en Colombia. En éste, además del cultivo de l...
Funciones de la supervición escolar en Venezuela. Aproximación a un modelo
Directory of Open Access Journals (Sweden)
Mogollón de González, Amada
2006-12-01
Full Text Available Resumen:Esta investigación tiene como propósito presentar la aproximación a un Modelo para las funciones de la supervisión escolar en Venezuela sustentado en los ámbitos, acción supervisora y funciones denominadas: Técnicas, Administrativas, Sociales, de Asistencia y Mediación. El modelo se fundamentó teóricamente en Kaufman, Stufflebeam, Teoría de Sistemas de Bertalanffy, enfoque humanista y jerarquía de las necesidades de Maslow. Es una investigación de campo realizada en Venezuela en los estados: Nueva Esparta, Distrito Federal, Carabobo, Lara, Táchira, Barinas y Delta Amacuro. El instrumento arrojó resultados que evidenciaron deficiencias, omisiones y ausencias durante el hecho supervisorio y su validación condujo a garantizar el éxito y calidad en la supervisión educativa venezolana.Abastract: This investigation must like intention present/display the approach to a Model for the functions of the scholastic supervision in Venezuela sustained in the scopes, supervisora action and denominated functions: Techniques, Administrative, Social, of Attendance and Mediation. The model was based theoretically on Kaufman, Stufflebeam, Theory of Systems of Bertalanffy, focuses humanist and hierarchy of the necessities of Maslow. It is an investigation of field made in Venezuela in the states: Nueva Esparta, Federal District, Carabobo, Lara, Táchira, Barinas and Delta Amacuro. The instrument threw results that demonstrated deficiencies, omissions and absences during the fact supervisorio and its validation lead to ensure the success and quality in the Venezuelan educative supervision.
Directory of Open Access Journals (Sweden)
Javier Ayala Calderón
2012-02-01
Full Text Available Este artículo tiene como finalidad enunciar y explicar las ideas religiosas expresadas en un grabado elaborado en el siglo XVI por el fraile franciscano Diego Valadés. Aunque esta obra ha sido interpretada de maneras diferentes por Francisco de la Maza y Esteban J. Palomera, la complejidad de sus contenidos exige un nuevo intento por descifrarlo. Para lograrlo se propone aquí un enfoque de acuerdo con las ideas imperantes en la época con respecto al orden necesario del mundo y las relaciones existentes entre sus componentes. For the development of a humanist education it is necessary to center the pedagogical paradigm on the individual person, and to consider this person as an integrated totality. In this paradigm, education is considered to be a creative experience, and significant existential lessons are extracted from the learner’s own experience using active learning methods. Likewise, flexible, multi and trans-disciplinary programs are indispensible. In addition, self-evaluation is a permanent process of refl ection that can be applied to all aspects of life, not only those in the classroom. Finally, the most important values that the model promotes are respect, tolerance, and freedom, all of which are basic to human coexistence.
Garib, Daniela; De Cássia Moura Carvalho Lauris, Rita; Calil, Louise Resti; De Medeiros Alves, Arthur César; Janson, Guilherme; De Almeida, Araci Malagodi; Cevidanes, Lúcia Helena Soares; Lauris, José Roberto Pereira
2017-01-01
Introduction The purpose of this 2-arm parallel study was to evaluate the dentoskeletal effects of rapid maxillary expansion with differential opening (EDO) compared with the hyrax expander in patients with complete bilateral cleft lip and palate. Methods A sample of patients with complete bilateral cleft lip and palate was prospectively and consecutively recruited. Eligibility criteria included participants in the mixed dentition with lip and palate repair performed during early childhood and maxillary arch constriction with a need for maxillary expansion before the alveolar bone graft procedure. The participants were consecutively divided into 2 study groups. The experimental and control groups comprised patients treated with rapid maxillary expansion using EDO and the hyrax expander, respectively. Cone-beam computed tomography examinations and digital dental models of the maxillary dental arches were obtained before expansion and 6 months postexpansion. Standardized cone-beam computed tomography coronal sections were used for measuring maxillary transverse dimensions and posterior tooth inclinations. Digital dental models were used for assessing maxillary dental arch widths, arch perimeters, arch lengths, palatal depths, and posterior tooth inclinations. Blinding was used only during outcome assessment. The chi-square test was used to compare the sex ratios between groups (P <0.05). Intergroup comparisons were performed using independent t tests with the Bonferroni correction for multiple tests. Results Fifty patients were recruited and analyzed in their respective groups. The experimental group comprised 25 patients (mean age, 8.8 years), and the control group comprised 25 patients (mean age, 8.6 years). No intergroup significant differences were found for age, sex ratio, and dentoskeletal variables before expansion. No significant differences were found between the EDO and the hyrax expander groups regarding skeletal changes. The EDO promoted significantly
Fast processing of microscopic images using object-based extended depth of field.
Intarapanich, Apichart; Kaewkamnerd, Saowaluck; Pannarut, Montri; Shaw, Philip J; Tongsima, Sissades
2016-12-22
Microscopic analysis requires that foreground objects of interest, e.g. cells, are in focus. In a typical microscopic specimen, the foreground objects may lie on different depths of field necessitating capture of multiple images taken at different focal planes. The extended depth of field (EDoF) technique is a computational method for merging images from different depths of field into a composite image with all foreground objects in focus. Composite images generated by EDoF can be applied in automated image processing and pattern recognition systems. However, current algorithms for EDoF are computationally intensive and impractical, especially for applications such as medical diagnosis where rapid sample turnaround is important. Since foreground objects typically constitute a minor part of an image, the EDoF technique could be made to work much faster if only foreground regions are processed to make the composite image. We propose a novel algorithm called object-based extended depths of field (OEDoF) to address this issue. The OEDoF algorithm consists of four major modules: 1) color conversion, 2) object region identification, 3) good contrast pixel identification and 4) detail merging. First, the algorithm employs color conversion to enhance contrast followed by identification of foreground pixels. A composite image is constructed using only these foreground pixels, which dramatically reduces the computational time. We used 250 images obtained from 45 specimens of confirmed malaria infections to test our proposed algorithm. The resulting composite images with all in-focus objects were produced using the proposed OEDoF algorithm. We measured the performance of OEDoF in terms of image clarity (quality) and processing time. The features of interest selected by the OEDoF algorithm are comparable in quality with equivalent regions in images processed by the state-of-the-art complex wavelet EDoF algorithm; however, OEDoF required four times less processing time. This
Effects Based Operations (EDO) Endstate
National Research Council Canada - National Science Library
James, Ron; Daniels, Troy
2005-01-01
.... An analysis of the combination of physical (e.g. petroleum, electric power) and behavioral (e.g. leadership) COGs at the operational level models was performed and the results were incorporated in the EndState Tool...
Pérez Barrero, Bernardo Ricardo; Duharte Garbey, Carelia; Perdomo Estrada, Cristina; Ferrer Mustelier, Ania; Gan Caldero, Bárbara
2011-01-01
Se realizó un estudio de casos y controles en el consultorio Adaca, del área de salud integral comunitaria El Socorro en el municipio de Valencia, estado venezolano de Carabobo, para valorar los principales factores de riesgo que influyeron en la aparición de gingivitis crónica en 75 adolescentes de 15-18 años durante el período comprendido desde agosto de 2009 hasta enero de 2010. La selección para ambos grupos se efectuó a través del muestreo no probabilístico intencional (por orden de lleg...
Caracterización clínico-epidemiólogica del parasitismo intestinal en niños de 0 a 5 años
Urquiza Yero, Yisell; Domínguez Caises, Liset María; Artiles Yanes, Melva
2011-01-01
Objetivo: realizar la caracterización clínico epidemiológica del parasitismo intestinal en niños de 0 a 5 años pertenecientes al consultorio médico Altos de Uslar, Libertador, Carabobo, Venezuela. Métodos: se realizó un estudio descriptivo, de corte transversal durante los meses de enero a diciembre de 2006, en el que se estudiaron 83 niños que presentaban sintomatología de parasitismo intestinal o no, a los que se les tomó muestras de heces fecales. La información se obtuvo a través de encue...
Yisell Urquiza Yero; Liset María Domínguez Caises; Melva Artiles Yanes
2011-01-01
Objetivo: realizar la caracterización clínico epidemiológica del parasitismo intestinal en niños de 0 a 5 años pertenecientes al consultorio médico Altos de Uslar, Libertador, Carabobo, Venezuela. Métodos: se realizó un estudio descriptivo, de corte transversal durante los meses de enero a diciembre de 2006, en el que se estudiaron 83 niños que presentaban sintomatología de parasitismo intestinal o no, a los que se les tomó muestras de heces fecales. La información se obtuvo a través de encue...
pitting corrosion susceptibility pitting corrosion susceptibility of aisi
African Journals Online (AJOL)
eobe
2DEPARTMENT OF MECHANICAL ENGINEERING, UNIVERSITY OF BENIN, BENIN- CITY, EDO STATE, NIGERIA. E-mail addresses: ... fluids and aggressive chemicals. Pitting corrosion ... the kitchen, food manufacturing and dispensing and.
Construcción de poder y ascenso social en una frontera colonial: el caso de Diego Trillo
Directory of Open Access Journals (Sweden)
Mar\\u00EDa Eugenia Alemano
2013-01-01
Full Text Available Hacia 1760, la intensificación de la circulación mercantil en el sur de los dominios hispánicos en América, la instalación de nuevos grupos araucanos y las políticas defensivas desarrolladas por los funcionarios borbónicos condujeron a la articulación de la frontera sur del imperio, enlazando diversos territorios coloniales e indígenas desde el Atlántico al Pacífico. Es en este escenario que nos proponemos, a partir de una historia de vida, demostrar las oportunidades que se generaron para el desarrollo de estrategias de construcción de poder y ascenso social desde la frontera. Para ello, analizaremos las prácticas políticas y los mecanismos económicos que sustentaron la trayectoria social del español Diego Trillo, quien hacia fines de la década de 1750 se asentó en el norte de la jurisdicción del Cabildo porteño, fue pulpero y hacendado, Sargento Mayor de milicias y Alcalde de la Hermandad y logró una importante acumulación económica. En particular, nos interesa identificar las mutuas relaciones establecidas entre su estrategia y proceso de acumulación económica, ciertas formas de representación e identificación y el desempeño de funciones estatales en un contexto de frontera. Argumentaremos que su trayectoria social respondió tanto a cuestiones y estrategias individuales como a cambios y continuidades en las condiciones políticas, económicas y culturales presentes en el Río de la Plata del último período colonial.
Escutia, Gabriela; McDonald, Eric; Rodríguez-Lainz, Alfonso; Healy, Jessica
2018-06-01
Most Zika disease cases diagnosed in the continental US have been associated with travel to areas with risk of Zika transmission, mainly the Caribbean and Latin America. Limited information has been published about the demographic and travel characteristics of Zika case-patients in the United States, besides their age and gender. During 2016-2017 the County of San Diego Health and Human Services Agency, California, expanded the scope and completeness of demographic and travel information collected from Zika case-patients for public health surveillance purposes. The majority (53.8%) of travel-related Zika virus infection case-patients (n = 78) in the county were Hispanic, significantly higher (p ≤ 0.05) than the 33.0% of Hispanics in the county. Foreign-born residents, mainly from Mexico, were also overrepresented among cases compared to their share in the county population (33.3 vs. 23.0%; p ≤ 0.05). Seventeen (21.8%) patients reported a primary language other than English (14 Spanish). Most case-patients traveled for tourism (54%) or to visit friends and relatives (36%). This surveillance information helps identify higher-risk populations and implement culturally targeted interventions for Zika prevention and control.
Directory of Open Access Journals (Sweden)
Anthony Basilio
Full Text Available The West Coast of the United States experienced variable and sometimes highly unusual oceanographic conditions between 2012 and 2015. In particular, a warm mass of surface water known as the Pacific Warm Anomaly (popularly as "The Blob" impinged on southern California in 2014, and warm-water conditions remained during the 2015 El Niño. We examine how this oceanographic variability affected delivery and individual characteristics of larval spotted sand bass (Paralabrax maculatofasciatus to an estuarine nursery habitat in southern California. To quantify P. maculatofasciatus settlement patterns, three larval collectors were installed near the mouth of Mission Bay, San Diego CA, and retrieved weekly from June-October of 2012-2015. During 'Blob' conditions in 2014 and 2015, lower settlement rates of spotted sand bass were associated with higher sea surface temperature and lower wind speed, chlorophyll a (chl a and upwelling. Overall, the number of settlers per day peaked at intermediate chl a values across weeks. Individual characteristics of larvae that settled in 2014-2015 were consistent with a poor feeding environment. Although settlers were longer in length in 2014-15, fish in these years had slower larval otolith growth, a longer larval duration, and a trend towards lower condition, traits that are often associated with lower survival and recruitment. This study suggests that future settlement and recruitment of P. maculatofasciatus and other fishes with similar life histories may be adversely affected in southern California if ocean temperatures continue to rise in the face of climate change.
Directory of Open Access Journals (Sweden)
Julián Monge-Nájera
2010-12-01
Full Text Available Bibliometric studies have found that male researchers have their greatest productivity around the age of 40, that female researchers produce less than their male colleagues, that incentives for collaboration are slow to affect productivity and that, just like humans, research institutes become larger, less productive, more expensive to maintain and less able to raise money as they grow old. Almost invariably, these conclusions come from statistical studies of large numbers of European and American scientists, and there are practically no studies about tropical researchers. We present an in-depth analysis of the productivity of an internationally recognized tropical botanist and conservationist, Luis Diego Gómez Pignataro, based on the totality of his published work and on our own knowledge, as co-workers and friends, of the life frame in which that scientific output was produced. His life output departs from the expected pattern in that he had the highest productivity before reaching the expected peak productivity age, and that when he reached it his productivity fell and never recovered. Furthermore, marriage did not produce the expected fall in productivity. A close analysis of his life indicates that in the middle of his career he switched to intense teaching and conservation activities, and this better explains why his output of scientific research articles was low afterwards. This switch may occur in other tropical scientists. Rev. Biol. Trop. 58 (4: 1093-1114. Epub 2010 December 01.Los estudios bibliométricos han encontrado que los investigadores de sexo masculino tienen su mayor productividad aproximadamente a los 40 años; que las investigadoras producen menos que sus colegas masculinos, que los incentivos para la colaboración tardan en aumentar la productividad y que, al igual que los seres humanos, los institutos de investigación se hacen más grandes, menos productivos, más costosos y menos capaces de recaudar dinero a medida que
African Journals Online (AJOL)
2013), Market Sanitation: A Case Study of Oregbeni Market Benin - City Edo ... Pathophysiology and Evidence Based Intervention Strategy, Abstract PDF ... Hormones on Gamma Immunoglobulin Density (Ig-Gp) and Apgar ...
year surveillance of wound infections at a rural tertiary hospital in ...
African Journals Online (AJOL)
EB
Conclusions: Staphylococcus aureus was the most predominant etiologic agent of wound infection among in and out patients. ... methicillin – resistant Staphylococus aureus (MRSA) and ... Northeast local government area of Edo State,.
Socio-Economic Characteristics of Registered Cocoa Farmers in ...
African Journals Online (AJOL)
PROF HORSFALL
ABSTRACT: This study examined the socio-economic characteristics of registered cocoa farmers in Edo State; ... Key words: socio-economics, characteristics, registered cocoa farmers. ... international exchange market in two world currencies ...
Counsellor (The) - Vol 33, No 1 (2014)
African Journals Online (AJOL)
Open Access DOWNLOAD FULL TEXT ... Communication in marital homes and work performance among Secondary School ... Predictive value of parenting styles on the academic achievement of adolescent students in Edo State, Nigeria.
The attitudes of clergy in Benin City, Nigeria towards persons with ...
African Journals Online (AJOL)
Department of Clinical Services, Federal Psychiatric Hospital, Benin City, Edo State, Nigeria ... Their attitudes concerning mental illnesses would influence community mental health ... distributed to ministers at convenient group meetings, e.g..
Haematopoietic stem cell transplantation: activities (2014 report) in a ...
African Journals Online (AJOL)
PROMOTING ACCESS TO AFRICAN RESEARCH ... Introduction: Hematopoietic Stem Cell transplantation (HSCT) is the only curative therapy for ... Activities: The stem cell transplant centre at the University of Benin Teaching Hospital Edo ...
Prevalence of urinary schistosomiasis in Nigeria, 1994–2015 ...
African Journals Online (AJOL)
A. Abdulkadir
2017-03-14
Mar 14, 2017 ... Introduction: The Global significance of schistosomiasis started waning ... prevalence of schistosomiasis in Nigeria, and its six geo-political zones. ...... schistosomiasis in a rural community in Edo state, Nigeria: eosinophil-.
PERCEPTION OF HOST COMMUNITIES TOWARD THE ...
African Journals Online (AJOL)
DORCAS
Department of Forestry and Wildlife, University of Benin, Benin city, Edo state, Nigeria. Corresponding ... park laws relating to wildlife conservation in Okomu National Park. The Park ..... Parks. Federal. Government Press, Lagos, Nigeria.
design and implementation of a microcontroller-based adjustable ...
African Journals Online (AJOL)
HOD
1, DEPARTMENT OF COMPUTER ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE, NIGERIA ... ICs, to design a user friendly charger circuit that manually adjusts the voltage .... the multivibrator integrated circuit does it.
Evaluation of the Influence of Salt Treatment on the Structure of ...
African Journals Online (AJOL)
MICHAEL HORSFALL
Department of Chemical Engineering, University of Benin, Edo State, Nigeria. ABSTRACT: This paper ... activated carbon obtained by chemical activation exhibits a larger surface ..... A master thesis from Faculty of. Engineering, Zonguldak ...
Wagner, Karla D; Moynihan, Matthew J; Strathdee, Steffanie A; Cuevas-Mota, Jazmine; Clark, Maureen; Zúñiga, María Luisa; Volkmann, Tyson A; Teshale, Eyasu; Garfein, Richard S
2012-01-01
The authors report the results of qualitative (n = 19) and quantitative (n = 545) interviews with young injection drug users (IDUs) in San Diego, California about their experiences using drugs in Tijuana, Mexico, and associated risks for HIV infection. Young IDUs who have ever traveled to Mexico (n = 365) used a variety of injection (54%) and noninjection (30%) drugs there and appear to be heavier users than those who have never traveled to Mexico. Sociocultural themes influencing drug use in Mexico included interactions among the purpose of travel, drug preference, and route of administration; familiarity with the border region; evolving relationships with the United States and Mexican drug markets; and the experience of crossing the U.S.-Mexico border. Interventions for IDUs in border regions need to be sensitive to the ethnicity, familiarity with the border region, and life history of participants, as well as differences in national policies that could influence drug use and risk for HIV on both sides of the border.
Sawyer, Mark H; Peddecord, K Michael; Wang, Wendy; Deguire, Michelle; Miskewitch-Dzulynsky, Michelle; Vuong, David D
2012-09-01
A public health department-supported intervention to increase influenza immunization among hospital-based health care practitioners (HCPs) in San Diego County took place between 2005 and 2008. The study included all major hospitals in the county, with a population of approximately 3.5 million. Information on hospital activities was collected from before, during and after initiative activities. Vaccination status and demographics were collected directly from HCP using hospital-based and random-dialed telephone surveys. Between 2006 and 2008, hospitals increased promotion activities and reported increases in vaccination rates. Based on the random-dialed surveys, HCP influenza vaccination coverage rates did not increase significantly. Vaccination rates were significantly higher in HCPs who reported that employers provided free vaccination and those who believed that their employers mandated influenza vaccination. This local public health initiative and concurrent state legislation were effective in increasing employer efforts to promote influenza vaccination; however, population-based surveys of HCPs did not show significant increases in influenza vaccination. Overall, this study suggests that public health leadership, intensive employer promotion activities, and state-required declinations alone were not sufficient to significantly increase HCP influenza vaccination. Policymakers and employers should consider mandates to achieve optimal influenza vaccination among HCPs. Copyright © 2012 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.
Relationship Between Body Weight and Growth Traits of Crossbred ...
African Journals Online (AJOL)
SH
Pearson's correlation coefficient between body weight and other measured traits. .... management system where routine and ..... 13th Annual Conference of Animal ... and Genetic variation among local chickens in Edo State of Nigeria. Ed.
African Journals Online (AJOL)
AUNTY TEE
EJOTMAS: EKPOMA JOURNAL OF THEATRE AND MEDIA ARTS. 169 ... social, political and economic significance during the struggle for independence ..... was again appointed a Commissioner for Arts, Culture, and Tourism in. Edo State ...
African Journals Online (AJOL)
FINEPRINT
Farmers are exposed to certain occupational hazards which predispose ... sectional survey carried out among farmers in an agricultural industry in Edo ... general health services for farm workers. ..... industrial workers in cement, coal, steel.
Stork, David G.; Furuichi, Yasuo
2009-02-01
Diego Velázquez's Las meninas (1656) has been called by some art experts "the most important painting of the 17th century," "a theology of painting," and even "the world's greatest painting"; it has been the subject of intensive study. The work depicts a complex scene in the Alcázar palace of King Philip IV of Spain, and includes mirror reflections of the king and queen, apparently standing in place of the viewer, as well as the artist himself standing before an enormous canvas on an easel. Nevertheless, questions remain about the studio and the proper viewing configuration: Is the artist looking toward the perspectivally correct position of the viewer in the museum space (center of projection), outside the picture space? Does the perspectivally correct position correspond to the locations of the king and queen seen reflected in the mirror? Is the bright illumination on the king and queen (as revealed in the mirror) consistent with the lighting in the tableau itself? We addressed these questions in a new way: by building a full computer graphics model of the figures and tableau as well as the viewer's space outside the painting. In our full model, the painting itself is represented as a translucent window onto which the picture space is projected toward the center of projection, that is, the viewer. Our geometric and (new) lighting evidence confirm Janson's and Snyder's contention that the plane mirror on the back wall reflects the other side of the large painting depicted within the tableau, not the king and queen themselves in the studio. We believe our computer graphics synthesis of both the tableau within the painting and the viewer's space in the real world is the first of its kind to address such problems in the history of art.
International Nuclear Information System (INIS)
Suzuki, T.; Morita, M.; Yoneda, M.; Yoshinaga, J.
1998-01-01
Lead concentration and isotopic composition of prehistoric (middle and latest Jomon era, 2000-4500 BP, n=6), historic (Edo era, 130-400 BP, n=10), and contemporary (died in 1987-88, n=15) Japanese bones, and deciduous teeth from contemporary Japanese children born during 1985-88 (n=17) were analyzed by inductively coupled plasma mass spectrometry. Lead concentration was lowest in Jomon bones and was higher in rural Edo, contemporary, and urban Edo, in that order. Elevated Pb concentration in historic Edo people, as reported previously, was reconfirmed. The average isotopic ratios ( 207 Pb/ 206 Pb and 208 Pb/ 206 Pb) in excavated (prehistoric and historic) bones, contemporary bones, and deciduous teeth were different from each other. The contemporary bones had the least radiogenic composition (mean 207 Pb/ 206 Pb: 0.879; mean 208 Pb/ 206 Pb: 2.126) while the excavated bones the most (0.848; 2.098), and teeth intermediate (0.866; 2.111). The comparison with the literature data of isotopic compositions of environmental samples showed that the isotopic composition of the excavated bones was within the range of Japanese ores, rocks and soils, indicating the absence of foreign Pb sources in preindustrialized Japan. That of the contemporary bones was closer to the average gasoline Pb, the use of which had been banned in the late 1970s, than to the Pb in airborne particulate matter or refuse incineration ash of 1980s. The average Pb isotopic ratios in the deciduous teeth was close to the isotopic ratios of Pb in airborne particulate matter and refuse incineration ash. These data indicated that the contemporary Japanese population was exposed to foreign Pb which had different isotopic composition from domestic Pb. Exposure to Pb of foreign origin was particularly evidently recorded in people born before the leaded gasoline ban. The history of human Pb contamination in Japan is discussed based on the present results and other previously published data. (Copyright (c) 1998
Robertson, Angela M; Garfein, Richard S; Wagner, Karla D; Mehta, Sanjay R; Magis-Rodriguez, Carlos; Cuevas-Mota, Jazmine; Moreno-Zuniga, Patricia Gonzalez; Strathdee, Steffanie A
2014-02-12
Policymakers and researchers seek answers to how liberalized drug policies affect people who inject drugs (PWID). In response to concerns about the failing "war on drugs," Mexico recently implemented drug policy reforms that partially decriminalized possession of small amounts of drugs for personal use while promoting drug treatment. Recognizing important epidemiologic, policy, and socioeconomic differences between the United States-where possession of any psychoactive drugs without a prescription remains illegal-and Mexico-where possession of small quantities for personal use was partially decriminalized, we sought to assess changes over time in knowledge, attitudes, behaviors, and infectious disease profiles among PWID in the adjacent border cities of San Diego, CA, USA, and Tijuana, Baja California, Mexico. Based on extensive binational experience and collaboration, from 2012-2014 we initiated two parallel, prospective, mixed methods studies: Proyecto El Cuete IV in Tijuana (n = 785) and the STAHR II Study in San Diego (n = 575). Methods for sampling, recruitment, and data collection were designed to be compatible in both studies. All participants completed quantitative behavioral and geographic assessments and serological testing (HIV in both studies; hepatitis C virus and tuberculosis in STAHR II) at baseline and four semi-annual follow-up visits. Between follow-up assessment visits, subsets of participants completed qualitative interviews to explore contextual factors relating to study aims and other emergent phenomena. Planned analyses include descriptive and inferential statistics for quantitative data, content analysis and other mixed-methods approaches for qualitative data, and phylogenetic analysis of HIV-positive samples to understand cross-border transmission dynamics. Investigators and research staff shared preliminary findings across studies to provide feedback on instruments and insights regarding local phenomena. As a result, recruitment and data
Directory of Open Access Journals (Sweden)
Odalis López Soria
2011-09-01
Full Text Available Se realizó un estudio descriptivo y transversal para evaluar la prescripción de medicamentos contra infecciones del tracto respiratorio en niños y niñas menores de 5 años, pertenecientes al área de salud Libertador en el municipio del mismo nombre, estado de Carabobo (Venezuela, desde septiembre de 2006 hasta marzo de 2007, motivado por el incremento de indicaciones de ciertos antimicrobianos para combatirlas, dificultades en la calidad del plan terapéutico y ausencia de estadísticas al respecto. Los fármacos más prescritos fueron los betalactámicos (penicilinas, fenoximetilpenicilina y amoxicilina, aunque generalmente de forma inadecuada por obviarse la individualización del tratamiento. Se presentaron reacciones adversas medicamentosas, en su mayoría leves, por lo cual primó la satisfacción de los usuarios con el servicio de salud recibido.A descriptive and cross-sectional study was carried out from September, 2006 to March, 2007 in order to assess the drug prescription against infections of the respiratory duct in boys and girls under 5 years of age belonging to Libertador health area in the municipality with the same name from Carabobo state, Venezuela. The study was motivated by the increase of antimicrobial prescriptions to treat them, the difficulties in the quality of the therapeutic plan, and the absence of statistics regarding this matter. Most prescribed drugs were as follows: beta-lactams (penicillin, phenoxymethylpenicillin, and amoxycillin; however, they were generally prescribed in an inadequate way because individualization of treatment was overlooked. Some side effects, most of them mild, were observed. Thus, the health service received by patients was satisfactory.
ARQUITECTURA DE LA RED VIRTUAL DE APRENDIZAJE PARA EL CICLO BÁSICO (FACES-UC
Directory of Open Access Journals (Sweden)
Neyda Ibañez
2011-11-01
Full Text Available La sociedad del siglo XXI demanda una universidad adaptada a la nueva realidad que ofrece el desarrollo de la comunicación basada en la tecnología digital computarizada. En virtud de ello, la investigación tuvo como objetivo el diseñar la red virtual de aprendizaje para facilitadores y estudiantes del Ciclo Básico de la Facultad de Ciencias Económicas y Sociales de la Universidad de Carabobo (FaCES-UC, siendo este uno de los objetivos del proyecto LOCTI titulado Formación, capacitación y fortalecimiento a facilitadores del Ciclo Básico y de las Escuelas de FaCES-UC, en el manejo de entornos virtuales como herramientas de aprendizaje. Metodológicamente, el estudio se ubicó en el paradigma positivista de tipo descriptivo, con una población de 72 profesores, calculándose una muestra de 237 estudiantes, con muestreo aleatorio simple, utilizando la técnica de observación directa y aplicando como instrumento el cuestionario simple con 27 preguntas cerradas y dicotómicas. Los resultados arrojaron que más del 95 por ciento de los estudiantes y más del 37 por ciento de los profesores aportaron al diseño de la red virtual de aprendizaje. Se concluye la arquitectura del sitio Web a través de la clasificación de tres criterios que persiguen brindar a la comunidad tanto interna como externa a la Universidad de Carabobo, un portal que ofrezca y difunda información y servicios del Ciclo Básico de FaCES-UC y de sus diversas Cátedras que lo conforman.
Journal of Agriculture and Social Research (JASR) Vol. 16, No. 1 ...
African Journals Online (AJOL)
Ekunwe
The study examined the profitability of snail marketing in Benin metropolis, Edo state, Nigeria. Random ... Agricultural marketing can be defined as the performance of all business activities included in the flow of ..... Principles and Applications.
Population dynamics of Rodents and Insectivores in lowland tropical ...
African Journals Online (AJOL)
ADOWIE PERE
2018-03-19
Mar 19, 2018 ... ecosystem of Okomu National Park, Edo State, Nigeria. OMOGBEME, MI; OKE, CO. Department of Animal and Environmental Biology, University of Benin, P.M.B 1154, Benin City, Nigeria. ..... University Press ... IUCN (2017).
Beshiru, Abeni; Okareh, Oladapo T; Chigor, Vincent N; Igbinosa, Etinosa O
2018-06-09
Surface waters are important to humans because they are a significant water supply source. They are, however, under serious environmental stress and are being threatened as a consequence of developmental activities. The present study describes the physicochemical properties and water quality indices of five different rivers used for drinking and other domestic activities in rural and pre-urban communities in Edo North, Nigeria. The physicochemical variable ranges include pH [wet season (6.47 ± 0.30-6.89 ± 0.11), dry season (6.61 ± 0.14-7.84 ± 0.24)], electrical conductivity (EC) [wet season (3.33 ± 0.57-12.33 ± 2.51 μS/cm), dry season (5.33 ± 0.57-21.33 ± 2.08 μS/cm)], water temperature [wet season (24.23 ± 0.98-25.40 ± 1.15 °C), dry season (26.20 ± 0.55-27.10 ± 0.75 °C)], TDS [wet season (417.00 ± 15.87-433.33 ± 18.50 mg/L), dry season (319.33 ± 16.50-372.66 ± 22.30 mg/L)], turbidity [wet season (1.01 ± 0.11-2.08 ± 0.99 NTU), dry season (3.11 ± 0.01-5.41 ± 0.24 NTU)], and DO [wet season (2.65 ± 0.37-3.99 ± 0.01 mg/L), dry season (2.12 ± 0.11-2.44 ± 0.01 mg/L)]. For the wet and dry seasons, the water quality indices were 120.225 and 585.015 for River Osolo, 119.849 and 445.751 for River Foreign, 200.474 and 587.833 for Ijoh River, 105.261 and 512.498 for Ole River, and 150.114 and 489.992 for Ole Extension River, respectively. The pH was negatively correlated with DO (r = -0.648), and EC was negatively correlated with DO (r = -0.635). Most of the evaluated parameters were within recommended water safety guidelines. However, the water quality index shows that the water quality was very poor and/or unsuitable for drinking and other domestic uses, especially during the dry season. It is suggested that river water be treated prior to its use for drinking and other domestic purposes.
Directory of Open Access Journals (Sweden)
Leonardo Cazorla Papis
2013-02-01
Full Text Available El interés de esta investigación fue identificar los rasgos característicos de las Pyme venezolanas de los Estados Aragua y Carabobo, que condicionan sus decisiones de endeudamiento, así como identificar los factores internos que condicionan su estructura de capital.Se estudiaron las variables : riesgo empresarial, rentabilidad sobre activos, oportunidades de crecimiento, tamaño, reputación, concentración de capital y estrategias empresariales.Los resultados obtenidos demostraron que las variables: Riesgo empresarial, rentabilidad sobre activos, oportunidad de crecimiento, explican en un 60% la estructura de capital de las pequeñas y medianas empresas
Pino,Luz A.; Matinella,Liboria; Morales C.,Gustavo
1999-01-01
Se infectaron experimentalmente 9 lotes de 32 caracoles B. glabrata (de 5 a 7mm de diámetro) con miracidios de la cepa C5 de Schistosoma mansoni a razón de 5 miracidios por caracol, pertenecientes a las siguientes cepas: En el área endémica de transmisión de Esquistosomiasis mansoni a) Sector Puerta Negra, Lago Valencia, b) Cagua c) Ingenio Bolívar (Estado Aragua) d) Mariara e) Caserío El 25 f) Güigüe (Estado Carabobo). Fuera del área endémica de transmisión g) Anzoátegui (Estado Lara), h) Ch...
Nature of ergastic substances in some Poaceae seeds
African Journals Online (AJOL)
ajl yemi
2011-08-29
Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.
African Journals Online (AJOL)
PROF. MADUKWE
Participation of Women in the Third National Fadama Development Programme in. Edo State ... The project targets the rural poor [farmers, .... Divorced. Widowed. 10.7. 61.3. 07.3. 20.7. Educational attainment. No formal education primary.
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...
African Journals Online (AJOL)
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo Central, Nigeria. ... Journal of Agriculture and Social Research (JASR). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current ...
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and ...
African Journals Online (AJOL)
Fruits and Seeds Production of Irvingia Gabonensis (O' Rorke) and Its Economic Importance in Edo ... Journal of Agriculture and Social Research (JASR) ... Irvingia gabonensis is one of the most important indigenous fruit trees cultivated and ...
Determination of water quality index and portability of Iguedo stream ...
African Journals Online (AJOL)
Determination of water quality index and portability of Iguedo stream in Edo ... has been found functional in assessing the water quality of this stream based on the ... Key words: Water quality index, physicochemical parameters, Iguedo Stream.
DECEMBER JMBR 13 - 2 correction.cdr
African Journals Online (AJOL)
Fine Print
pregnant women attending antenatal clinic in Etsako East LGA, Edo State. Methodology: A descriptive ... by being a leading cause of anaemia in. 2 pregnancy. Plasmodium ... For the prevention and control of malaria during pregnancy in ...
Awareness of high blood pressure status, treatment and control in a ...
African Journals Online (AJOL)
west LGA of Edo State to assess the level of awareness of high blood pressure status, treatment and control. Cluster sampling method was used to select participants and data collection was by researcher administered questionnaire. Blood ...
African Journals Online (AJOL)
2016-01-31
Jan 31, 2016 ... Chemical Society; and IRMS Informatics India (J-Gate) ... Health Care, Ambrose Alli University, Edo State. ... Bridging the gaps of inequality in health care service delivery ... rich and poor, men and women, urban and rural.
African Journal of Urology - Vol 23, No 2 (2017)
African Journals Online (AJOL)
Management of the exstrophy-epispadias complex in adolescents and adults · EMAIL ... An unusual presentation of advanced prostate cancer in a 56-year old ... psychosocial impediments to self reporting of erectile dysfunction by men in Edo ...
Attention Deficit Hyperactivity Disorder Intervention: Strategies ...
African Journals Online (AJOL)
Edo Journal of Counselling. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 2, No 2 (2009) >. Log in or Register to get access to full text downloads.
chemical and mineralogical characterization of lateritic iron ore
African Journals Online (AJOL)
DJFLEX
2010-04-22
Apr 22, 2010 ... The laterite iron ore deposit at Auchi, Edo State, Nigeria was studied chemically and mineralogically. The results of the chemical ... SAMPLE PREPARATION. The samples .... 2µm) and were subjected to X-ray diffraction using.
monosymptomatic childhood nocturnal enuresis in Benin City, Nigeria
African Journals Online (AJOL)
Only children with a history of bed-wetting since birth were recruited. ... The parents of children in public primary and secondary schools in Egor local government area, Edo State, were interviewed ..... fertility control in a developing country.
Directory of Open Access Journals (Sweden)
Julián Monge-Nájera
2010-12-01
Full Text Available Bibliometric studies have found that male researchers have their greatest productivity around the age of 40, that female researchers produce less than their male colleagues, that incentives for collaboration are slow to affect productivity and that, just like humans, research institutes become larger, less productive, more expensive to maintain and less able to raise money as they grow old. Almost invariably, these conclusions come from statistical studies of large numbers of European and American scientists, and there are practically no studies about tropical researchers. We present an in-depth analysis of the productivity of an internationally recognized tropical botanist and conservationist, Luis Diego Gómez Pignataro, based on the totality of his published work and on our own knowledge, as co-workers and friends, of the life frame in which that scientific output was produced. His life output departs from the expected pattern in that he had the highest productivity before reaching the expected peak productivity age, and that when he reached it his productivity fell and never recovered. Furthermore, marriage did not produce the expected fall in productivity. A close analysis of his life indicates that in the middle of his career he switched to intense teaching and conservation activities, and this better explains why his output of scientific research articles was low afterwards. This switch may occur in other tropical scientists. Rev. Biol. Trop. 58 (4: 1093-1114. Epub 2010 December 01.
African Journals Online (AJOL)
Awareness of health risks associated with body piercing and tattooing among tertiary students in Auchi, Edo state, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T.A. Ehwarieme, F.O. Amieghemie ...
African Journals Online (AJOL)
User
because they cannot appreciate the extra protection afforded by ITN. ... To determine the factors affecting utilization of ITN by pregnant women in Etsako West LGA, Edo. State. A descriptive cross-sectional study design was employed. Using a ...
1448-IJBCS-Article-Orjiekwe Chike
African Journals Online (AJOL)
hp
The pollution of Ogbese River in Ovia North-East L.G.A. of Edo State, Nigeria was studied. Parameters like pH ... Keywords: Water pollution, environment, water analysis. INTRODUCTION ..... metal pollution in streams in Zhozhon city in China.
International Journal of Pedagogy, Policy and ICT in Education - Vol ...
African Journals Online (AJOL)
Prevalence of conduct disorder among adolescents in a senior secondary school in Benin City, Edo State, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EE Omotunde, O Philomena, 15-28 ...
African Journals Online (AJOL)
Items 601 - 650 of 1463 ... Vol 4, No 1 (2004), Gender inequality and domestic violence: ... in contraceptive use among educated women in Edo state, Nigeria, Abstract PDF ... women: a cross-sectional study from coastal South India, Abstract PDF.
Journal of Agriculture and Social Research (JASR) Vol. 11, No. 1 ...
African Journals Online (AJOL)
C.P. Kalu
The study examined the economic potential of taungya system in Edo state, using of data ... potential of taungya so as to convert all the possible potentials to reality. ..... issues of university of Britain Colombia Press, Vancouver, 497-504.
Directory of Open Access Journals (Sweden)
Mario Albornoz
Full Text Available Desde hace tiempo es un tema de debate en Argentina explicar cómo fue posible que un país escasamente industrializado y tecnológicamente poco desarrollado lograra alcanzar una capacidad sorprendente en materia de ciencia y tecnología nuclear, mientras que, por contraste, en otros temas se profundizaba la brecha tecnológica. El mismo hecho de que a través de gobiernos disímiles y antagónicos, civiles y militares, se hubiera mantenido en for ma constante una política que demandaba cuantiosas inversiones en un país en el que no sobraban los recursos, y que todo ello hubiera sucedido -durante la mayor parte del tiempo- a la sombra de una de las fuerzas armadas no ha facilitado los acuerdos entre los analistas de tal proceso, sino que ha añadido nuevos matices, vinculados a menudo con enconos no saldados de la historia reciente. Una oportunidad para pensar esta cuestión la proporciona el reciente libro de Diego Hurtado, que es comentado aquí.
Climate Change Adaptation Needs of Male and Female Oil Palm ...
African Journals Online (AJOL)
User
2008 and Ayodele, 2010) and also results in an increase in demand for palm oil. The demand .... climate change adaptation practice needs of oil palm entrepreneurs in Edo State, .... female respondents had one form of education or the other.
IGBO POLITICAL ORGANIZATION AND IMPUNITY Ifeyinwa ...
African Journals Online (AJOL)
JONATHAN
2016-07-01
Jul 1, 2016 ... The focus of this paper is on the Democratic village Republican ... some other communities such as Yoruba, Hausa, Edo etc, but they have their own style of ... and in a democratic manner that abhors autocratic leadership.
2018-03-05T17:24:19Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
article/55691 2018-03-05T17:24:19Z ajrh:ART Vulnerability of Nigerian Secondary School to Human Sex Trafficking in Nigeria Omorodion, FI Adolescents; Delta State; Edo State; in-school students; Nigeria; sex trafficking Sex trafficking ...
African Journals Online (AJOL)
Diabetic Patients Attending the University Teaching Hospital, Ado Ekiti, Nigeria Abstract · Vol 5, No 3 (2009) - Articles Plasma Zinc Levels of Pregnant Women Visiting Irrua Specialist Teaching Hospital, Irrua, Edo State, Nigeria Abstract · Vol 5, No ...
Edo Journal of Counselling: Editorial Policies
African Journals Online (AJOL)
Benue State, Nigeria Professor Adriana G. McEachern Florida Inter. University, Miami. USA. Professor Bryan Hiebert University of Calgary, Alberta. Canada Professor Beatrz Malik Universidad Nacional de Educación a Distancia (UNED) Madrid, Spain Professor Jim Athanasou University of Technology, Sydney. Australia.
African Journals Online (AJOL)
E. (Eshiobo) Irekpita
2017-05-03
May 3, 2017 ... b Dept. of Surgery, Irrua Specialist Teaching Hospital, Irrua, Nigeria c Dept. of Medicine .... the hospital as the treatment facility, while, the others either did .... pros and cons of reporting and creating an appropriate environment.
Psychological empowerment and development | Oladipo | Edo ...
African Journals Online (AJOL)
Using the archival method of investigation, this paper explores the subject of psychological empowerment (particularly in relation to youths) and national development. The specific objective of the paper is to explore and establish the importance of psychological empowerment of the masses and particularly the youths, ...
Lagos Historical Review - Vol 13 (2013)
African Journals Online (AJOL)
Human Trafficking in Edo State (Nigeria): A Socio- Economic Study · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Lawal, 17-30. http://dx.doi.org/10.4314/lhr.v13i1.2 ...
ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...
African Journals Online (AJOL)
Administrator
18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.
Nigerian Journal of Horticultural Science - Vol 6, No 1 (2002)
African Journals Online (AJOL)
The Economic Potentials of Pineapple Marketing in Edo State, Nigeria. EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. G.O. Alufohal, 20-24. http://dx.doi.org/10.4314/njhs.v6i1.3340 ...
African Journals Online (AJOL)
AFFECTING THEIR AGRICULTURAL PRODUCTIVITY 'IN EDO STATE,. NIGERIA .... Divorce 2 1.7. Widow/widowed 3 ' 2.5. 40 .... as also reflected in Table 2 when illiteracy was rated high as one of the factors affecting prevalence of health ...
Evaluation of Questionnaire, Reagent Strip and Egg Count as ...
African Journals Online (AJOL)
A longitudinal study covering 55 months evaluated the three diagnostic tools used for confirmation of prevalence of urinary schistosomiasis among 1151 consented primary school pupils in 13 communities of Edo State, Nigeria. Questionnaire, reagent strip method and parasitological examination were employed.
West African Journal of Medicine - Vol 29, No 2 (2010)
African Journals Online (AJOL)
Pregnancy Associated with Recurrent Acromegaly: A Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Edo, A Eregie. http://dx.doi.org/10.4314/wajm.v29i2.68207 ...
Assessment of serum biochemistry in West African Dwarf (WAD ...
African Journals Online (AJOL)
Jane
2011-06-29
Jun 29, 2011 ... in our local breeds of goats such as West African Dwarf. (WAD) does. ... Farm, Faculty of Agriculture, Ambrose Alli University, Ekpoma in. Edo State ... degree North and latitude 6 degree North located in the rainforest zone of ...
growth and physiological performance of west african dwarf goats
African Journals Online (AJOL)
user
2014-09-02
Sep 2, 2014 ... Faculty of Agriculture, University of Benin, Benin, Edo State, Nigeria. ... Twenty young growing West African Dwarf (WAD) goats of both sexes with an average body weight of 5.77kg ... Northern part of the country (Ugwu and.
Socio-Economic status of parents as a correlate of re-entry of girls ...
African Journals Online (AJOL)
economic status (SES) and re-entry of girls into school in Edo State, Nigeria. One research question and one hypothesis were formulated for the study. Two research instruments, the “Socio-Economic Status of Parents” and the “Reentry into ...
African Journals Online (AJOL)
2016-11-04
Nov 4, 2016 ... Nelson-Immu JC, Mowatt L, Walters C.A. Patterns of ocular trauma presenting to the ... 11 hospital, Addis Ababa. Ethiop J Health Dev 2001;15:131-7. 12. ... injuries in Irrua Specialist Teaching Hospital, Irrua, Edo State Nigeria.
Directory of Open Access Journals (Sweden)
Nikos Gurfield
2017-04-01
Full Text Available The Pacific coast tick, Dermacentor occidentalis Marx, is found throughout California and can harbor agents that cause human diseases such as anaplasmosis, ehrlichiosis, tularemia, Rocky Mountain spotted fever and rickettsiosis 364D. Previous studies have demonstrated that nonpathogenic endosymbiotic bacteria can interfere with Rickettsia co-infections in other tick species. We hypothesized that within D. occidentalis ticks, interference may exist between different nonpathogenic endosymbiotic or nonendosymbiotic bacteria and Spotted Fever group Rickettsia (SFGR. Using PCR amplification and sequencing of the rompA gene and intergenic region we identified a cohort of SFGR-infected and non-infected D. occidentalis ticks collected from San Diego County. We then amplified a partial segment of the 16S rRNA gene and used next-generation sequencing to elucidate the microbiomes and levels of co-infection in the ticks. The SFGR R. philipii str. 364D and R. rhipicephali were detected in 2.3% and 8.2% of the ticks, respectively, via rompA sequencing. Interestingly, next generation sequencing revealed an inverse relationship between the number of Francisella-like endosymbiont (FLE 16S rRNA sequences and Rickettsia 16S rRNA sequences within individual ticks that is consistent with partial interference between FLE and SFGR infecting ticks. After excluding the Rickettsia and FLE endosymbionts from the analysis, there was a small but significant difference in microbial community diversity and a pattern of geographic isolation by distance between collection locales. In addition, male ticks had a greater diversity of bacteria than female ticks and ticks that weren’t infected with SFGR had similar microbiomes to canine skin microbiomes. Although experimental studies are required for confirmation, our findings are consistent with the hypothesis that FLEs and, to a lesser extent, other bacteria, interfere with the ability of D. occidentalis to be infected with
Directory of Open Access Journals (Sweden)
Bernardo Ricardo Pérez Barrero
2011-09-01
Full Text Available Se realizó un estudio de casos y controles en el consultorio Adaca, del área de salud integral comunitaria El Socorro en el municipio de Valencia, estado venezolano de Carabobo, para valorar los principales factores de riesgo que influyeron en la aparición de gingivitis crónica en 75 adolescentes de 15-18 años durante el período comprendido desde agosto de 2009 hasta enero de 2010. La selección para ambos grupos se efectuó a través del muestreo no probabilístico intencional (por orden de llegada a la consulta: el primero estuvo integrado por 25 con gingivitis crónica (diagnosticados mediante el índice gingival de Loë y Silness y el segundo por 50 (2 sanos por cada paciente. En la casuística se obtuvo que los varones fueron los más afectados por esa inflamación en las encías, directamente relacionada con la higiene bucal deficiente y el hábito de fumar.A case-control study was carried out at Adaca doctor's office, belonging to Socorro, a comprehensive community health area, from Valencia municipality in Carabobo state, Venezuela, in order to assess the primary risk factors which influenced on the chronic gingivitis occurrence in 75 teenagers aged 15-18 years from August, 2009 to January, 2010. The selection of both groups was made through the intentional non-probability sampling (that is to say, according to the arrival order. The first group was composed of 25 patients with chronic gingivitis (diagnosed through Loë and Silness´ gingival index, while the second group consisted of 50 patients (2 healthy teenagers per each patient. In the case material, male teenagers were the most affected by the aforementioned gum inflammation, directly related to poor oral hygiene and smoking habit.
Directory of Open Access Journals (Sweden)
Manuelle Peloille
2010-01-01
Full Text Available “Es mucha la atracción que ejerce sobre mí este pueblo y mucha aún la pena que siento por no poder estar aquí y seguir estudiando tantas cosas nuevas", escribe Diego Hidalgo en sus notas de viaje a la URSS recogidas en Un notario español en Rusia . El autor de este volumen, publicado en Madrid en 1929 por la editorial Cénit, no es dirigente de una organización popular como lo eran Fernando de los Ríos, Ángel Pestaña o Rodolfo Llopis; no pertenece a la clase obrera preferentemente interesada en el experimento ruso; tampoco es corresponsal como lo fue Sofía Casanova. Oficialmente, viaja para examinar el derecho soviético y su aplicación, pero declara ante todo querer comprobar la certeza de lo que se viene diciendo de la Unión Soviética en España desde 1917. Asumiendo su estatuto de miembro de la burguesía, se distancia tanto de las representaciones hostiles como de la aprobación beata. El interés de este libro reside en cómo lo que entonces fue una novedad histórica (cualquiera que sea el juicio que podamos formular sobre ésta ejerce el papel de polo de atracción entre individuos de una clase social a priori no interesados en ella.Palabras Clave: Rusia, URSS, relato de viaje, intelectuales, tópicos, burguesía, hegemonía___________________________Abstract:"Es mucha la atracción que ejerce sobre mí este pueblo y mucha aún la pena que siento por no poder estar aquí y seguir estudiando tantas cosas nuevas", writted Diego Hidalgo in his travel notes about USSR, collected in Un notario español en Rusia. The author of this book, published in 1929 by the marxist editor Cénit, is not a leader of popular organization at all like Fernando de los Ríos, Ángel Pestaña o Rodolfo Llopis, neither belongs to the working class, potentially more interested in the development of the Soviet experience. The official aim of his travel is to get information about Soviet laws and their applying. But before everything he wants to check
Directory of Open Access Journals (Sweden)
Manuelle Peloille
2011-01-01
Full Text Available “Es mucha la atracción que ejerce sobre mí este pueblo y mucha aún la pena que siento por no poder estar aquí y seguir estudiando tantas cosas nuevas", escribe Diego Hidalgo en sus notas de viaje a la URSS recogidas en Un notario español en Rusia . El autor de este volumen, publicado en Madrid en 1929 por la editorial Cénit, no es dirigente de una organización popular como lo eran Fernando de los Ríos, Ángel Pestaña o Rodolfo Llopis; no pertenece a la clase obrera preferentemente interesada en el experimento ruso; tampoco es corresponsal como lo fue Sofía Casanova. Oficialmente, viaja para examinar el derecho soviético y su aplicación, pero declara ante todo querer comprobar la certeza de lo que se viene diciendo de la Unión Soviética en España desde 1917. Asumiendo su estatuto de miembro de la burguesía, se distancia tanto de las representaciones hostiles como de la aprobación beata. El interés de este libro reside en cómo lo que entonces fue una novedad histórica (cualquiera que sea el juicio que podamos formular sobre ésta ejerce el papel de polo de atracción entre individuos de una clase social a priori no interesados en ella.Palabras Clave: Rusia, URSS, relato de viaje, intelectuales, tópicos, burguesía, hegemonía___________________________Abstract:"Es mucha la atracción que ejerce sobre mí este pueblo y mucha aún la pena que siento por no poder estar aquí y seguir estudiando tantas cosas nuevas", writted Diego Hidalgo in his travel notes about USSR, collected in Un notario español en Rusia. The author of this book, published in 1929 by the marxist editor Cénit, is not a leader of popular organization at all like Fernando de los Ríos, Ángel Pestaña o Rodolfo Llopis, neither belongs to the working class, potentially more interested in the development of the Soviet experience. The official aim of his travel is to get information about Soviet laws and their applying. But before everything he wants to check
78 FR 24765 - Notice of Intent To Close 16 Field Offices
2013-04-26
...; Dallas, TX; Lubbock, TX; Tucson, AZ; Fresno, CA; Sacramento, CA; San Diego, CA; and Spokane, WA. HUD is..., AZ; Fresno, CA; Sacramento, CA; San Diego, CA; and Spokane, WA. Employees who work in the... office--HUD will retain the field office in Phoenix, AZ. j. Sacramento, San Diego, and Fresno field...
Palinkas, Lawrence A; Prussing, Erica; Landsverk, John; Reznik, Vivian
2003-01-01
In March, 2001, 2 separate incidents of school shootings occurred within the same school district in San Diego's East County. To examine community explanatory models of the causes of the school shootings and strategies for preventing such events. A qualitative study was undertaken in 4 East County communities over a 6-month period following the 2 events. Semistructured interviews were conducted with 85 community residents identified through maximum variation sampling. Interview transcripts were analyzed by coding consensus, co-occurrence and comparison, using NVivo text analysis software. Four sets of theories as to the cause of these events were identified, based on the following: 1) unique or idiosyncratic characteristics of the 2 shooters (newcomer to community who was a victim of bullying, victim of child abuse with a history of mental illness), 2) universal factors (culture of violence, violence in the media), 3) family-centered characteristics (single-parent households, dysfunctional relationships), and 4) community-specific characteristics (reputation for social intolerance, widespread access to guns). Beliefs in family-centered and community-centered theories of etiology were associated with optimism in preventing such events from occurring in the future through increased recognition and response to problem behaviors, while beliefs in idiosyncratic or universal determinants of youth violence were associated with pessimistic assessments of prevention. In this community, youth-violence-prevention programs that focus on taking responsibility for recognizing and responding to problem behaviors in at-risk youth are more likely to gain community support and participation than programs that focus on increased security, surveillance, or behavior change.
Directory of Open Access Journals (Sweden)
Tejero Encinas Silvia
2003-01-01
Full Text Available Fundamento: La tuberculosis pulmonar en España tiene una frecuencia superior a la que le correspondería, dado su desarrollo social y sanitario. Aparte de algunos estudios puntuales, la incidencia se conoce a partir del Sistema de Notificación como Enfermedad de Declaración Obligatoria (EDO, en el que se ha detectado algún grado de infradeclaración. Se ha planteado si se puede mejorar esta información empleando además otro registro, concretamente el Conjunto Mínimo Básico de Datos (CMBD. Métodos: Se trata de un estudio retrospectivo del periodo 1996-2000, llevado a cabo en la población de un área de salud de 220.572 habitantes. Se han utilizado los datos del registro EDO en el nivel de asistencia especializada y los del registro CMBD con el diagnóstico de tuberculosis pulmonar. Se calcularon las tasas de incidencia para cada fuente y según el método captura-recaptura. Se analizaron características epidemiológicas de las personas como: edad, género, lugar de residencia, condición de bacilífero, y datos asistenciales de los casos ingresados como, estancia media, tipo de ingreso, tipo de alta, servicio clínico. Resultados: La incidencia media anual registrada en el nivel de atención especializada fue de 16,6 por 10(5 habitantes en el registro EDO, 20,4 casos por 10(5 habitantes en el CMBD y de 23,1 por 10(5 habitantes combinando ambas fuentes. La incidencia estimada con el método captura-recaptura fue de 24,4 por 10(5 hab. (IC95%: 23,5-25,3. Conclusiones: Cualquier sistema de información que aporte datos fiables sirve para mejorar la vigilancia epidemiológica aunque haya sido diseñado con otro fin. Se trata de conocer sus limitaciones y peculiaridades. El CMBD proporciona información de interés epidemiológico no contenida en los partes de EDO. La aplicación del método captura-recaptura es una alternativa para estimar tasas más reales de tuberculosis pulmonar.
Directory of Open Access Journals (Sweden)
Silvia Tejero Encinas
2003-01-01
Full Text Available Fundamento: La tuberculosis pulmonar en España tiene una frecuencia superior a la que le correspondería, dado su desarrollo social y sanitario. Aparte de algunos estudios puntuales, la incidencia se conoce a partir del Sistema de Notificación como Enfermedad de Declaración Obligatoria (EDO, en el que se ha detectado algún grado de infradeclaración. Se ha planteado si se puede mejorar esta información empleando además otro registro, concretamente el Conjunto Mínimo Básico de Datos (CMBD. Métodos: Se trata de un estudio retrospectivo del periodo 1996- 2000, llevado a cabo en la población de un área de salud de 220.572 habitantes. Se han utilizado los datos del registro EDO en el nivel de asistencia especializada y los del registro CMBD con el diagnóstico de tuberculosis pulmonar. Se calcularon las tasas de incidencia para cada fuente y según el método captura-recaptura. Se analizaron características epidemiológicas de las personas como: edad, género, lugar de residencia, condición de bacilífero, y datos asistenciales de los casos ingresados como, estancia media, tipo de ingreso, tipo de alta, servicio clínico. Resultados: La incidencia media anual registrada en el nivel de atención especializada fue de 16,6 por 105 habitantes en el registro EDO, 20,4 casos por 105 habitantes en el CMBD y de 23,1 por 105 habitantes combinando ambas fuentes. La incidencia estimada con el método captura-recaptura fue de 24,4 por 105 hab. (IC95%: 23,5- 25,3. Conclusiones: Cualquier sistema de información que aporte datos fiables sirve para mejorar la vigilancia epidemiológica aunque haya sido diseñado con otro fin. Se trata de conocer sus limitaciones y peculiaridades. El CMBD proporciona información de interés epidemiológico no contenida en los partes de EDO. La aplicación del método captura-recaptura es una alternativa para estimar tasas más reales de tuberculosis pulmonar.
Valdez, Michelle M; Liwanag, Maureen; Mount, Charles; Rodriguez, Rechell; Avalos-Reyes, Elisea; Smith, Andrew; Collette, David; Starsiak, Michael; Green, Richard
2018-03-14
Inefficiencies in the command approval process for publications and/or presentations negatively impact DoD Graduate Medical Education (GME) residency programs' ability to meet ACGME scholarly activity requirements. A preliminary review of the authored works approval process at Naval Medical Center San Diego (NMCSD) disclosed significant inefficiency, variation in process, and a low level of customer satisfaction. In order to facilitate and encourage scholarly activity at NMCSD, and meet ACGME requirements, the Executive Steering Council (ESC) chartered an interprofessional team to lead a Lean Six Sigma (LSS) Rapid Improvement Event (RIE) project. Two major outcome metrics were identified: (1) the number of authored works submissions containing all required signatures and (2) customer satisfaction with the authored works process. Primary metric baseline data were gathered utilizing a Clinical Investigations database tracking publications and presentations. Secondary metric baseline data were collected via a customer satisfaction survey to GME faculty and residents. The project team analyzed pre-survey data and utilized LSS tools and methodology including a "gemba" (environment) walk, cause and effect diagram, critical to quality tree, voice of the customer, "muda" (waste) chart, and a pre- and post-event value stream map. The team selected an electronic submission system as the intervention most likely to positively impact the RIE project outcome measures. The number of authored works compliant with all required signatures improved from 52% to 100%. Customer satisfaction rated as "completely or mostly satisfied" improved from 24% to 97%. For both outcomes, signature compliance and customer satisfaction, statistical significance was achieved with a p methodology and tools to improve signature compliance and increase customer satisfaction with the authored works approval process, leading to 100% signature compliance, a comprehensive longitudinal repository of all
Libros colombianos raros y curiosos Mayo de 1961
Directory of Open Access Journals (Sweden)
Ignacio Rodríguez Guerrero
1961-05-01
Full Text Available FALLON DIEGO. (1834-1905. Arte de leer, escribir y dictar música. Sistema alfabético por Diego Fallon comparado con la notación conocida. Obra destinada para servir de texto de enseñanza. Bogotá, 1885. Imprenta musical de Diego Fallon. 18 x 27. p. 308.
Annals of Biomedical Sciences - Vol 17, No 1 (2018)
African Journals Online (AJOL)
Assessment of career specialty preferences among medical students at the University of Benin, Benin city, Edo state · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.E. Obarisiagbon, G. Owoeye, J.C. Chukwu, V. Onwuchekwa ...
36 Dry Season Phytoplankton Composition Of Ibiekuma Dam ...
African Journals Online (AJOL)
`123456789jkl''''#
freshwater algae of Edo State. To benefit from ... Algae. (phytoplankton) are the source of oxygen in aquatic systems and are the main ... be used in determining water pollution level. A dam is a ... taken in situ, using a mercury in bulb glass.
Biochemical assessement of liver enzymes in immunocompromised ...
African Journals Online (AJOL)
Aim: This study aims at the estimation of serum alkaline phosphatase (ALP), alanine aminotransferase (ALT), Aspartate aminotransferase (AST), and glutmyltransferase GGT (Liver enzymes) in Human immunodeficiency virus(HIV) and/or Acquired immune deficiency syndrome(AIDS) patients in parts of Edo State, Nigeria.
Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. ...
African Journals Online (AJOL)
Spatio-Temporal Variation in Water Quality of Orle River Basin, S.W. Nigeria. ... Abstract. The water quality of small streams in Auchi area of Edo State, S.W. Nigeria was investigated with a view to ... and ecosystems. The study was carried out
Maize cob losses and their effects on the poverty status of maize
African Journals Online (AJOL)
This study analysed fresh maize cob losses and its effect on the poverty status of maize farmers in Edo State,. Nigeria. The specific .... is the poverty gap for ... Total cost. 162,367.48. 100.00. Returns. Total expected yield (N). 327,966.63. _.
Letters and Viewpoints Studies on the Effect of Laundry Effluent on ...
African Journals Online (AJOL)
topsoil, laundry effluent, soil physiochemical properties, pH, available phosphorus, exchangeable sodium, potassium, exchangeable sodium percentage, percentage base saturation, soil buffering capacity, cation exchange capacity, Edo, Nigeria Résume Des résidus issus des blanchisseries ont toujours prouvé leur effet ...
Women's land rights and the challenge of patriachy: lessons from ...
African Journals Online (AJOL)
Women's land rights and the challenge of patriachy: lessons from ozalla community, edo state, Nigeria. ... production output and ensuring higher incomes. KEYWORDS: Cultural practices, customary, economic life, food crisis, food production, gender equity, land rights, patriarchy, rural agriculture, rural areas, social justice ...
impact of quality improvement in primary schools (quips) programme ...
African Journals Online (AJOL)
Elizabeth
teachers in the school as well as the assistance that the programme has given to ... Edo Journal of Counselling. Vol. 2, No .... and compulsory at least at the elementary level. ... in order to get the opinions of the members of the Parent Teachers.
African Journals Online (AJOL)
FIRST LADY
Determinants of Rural Development in Edo State, Nigeria: An Overview (Pp ... half of this population is without proper-formal education (World Bank. 2005). Data for this ..... forestry, tourism) based on rural resources. The identification ... Olayide, B. (2002) Sustainable Settlement Development Constraints and. Strategies.
A survey of the parasites of the African white-bellied pangolin ...
African Journals Online (AJOL)
Phataginus tricuspis) in Edo State, Nigeria. They were purchased at Ekiuwa Market in Benin City, where they are sold and people consume the meat as a good source of protein and the animal can also be used for medicinal purposes. Four (4) ...
Assessing the knowledge of asthma among community pharmacists ...
African Journals Online (AJOL)
Purpose: To assess the knowledge of community pharmacists about asthma and its management. Methods: Seventy-six registered community pharmacists in. Edo State completed a structured questionnaire consisting of open and close ended questions which addressed issues relating to their knowledge of asthma
Heiser, Walter
1979-01-01
Considers action's impact and intent as proof; analyzes language, purpose, and legislative history of civil rights statutes; and concludes that the Supreme Court will likely require proof of intent to sustain a prima facie case of discrimination. Available from San Diego Law Review Association, University of San Diego School of Law, San Diego,…
1 Étude des marées océaniques et environnementale radioactif de ...
African Journals Online (AJOL)
ASIMANANA
Etude oceanic tide end environment radioactive the bay the diego-suarez. Post analysis of three samples taken in the Bay of Diego Suarez specifically in the English pool, we find or we notice that fortunately the Bay of Diego Suarez is unpolluted and we must continue the conquest to convince people not to throw waste in ...
Helminth parasites of Silurana tropicalis from the Okomu National ...
African Journals Online (AJOL)
Silurana tropicalis, the edible clawed-frog, collected from the Okomu National Park, Edo State, Nigeria, was examined for helminth parasitic infections. From 142 specimens collected, ten endo-helminth parasites spread across four classes were recovered. These included Cestoda: Cephalochlamys compactus and the cyst ...
Original Researc Original Research
African Journals Online (AJOL)
RAGHAVENDRA
2009-09-17
Sep 17, 2009 ... agriculture systems in Edo state, Nigeria and char ... were inferred as different varieties of the species of th ... tate, Nigeria and characterize them using molecular marker ... Article Information ... The development of Polymerase Chain Reaction (PCR) ... Quarters, University of Benin Teaching Hospital.
assessment of the activity of glucose-6-phosphate dehydrogenase
African Journals Online (AJOL)
Uwaifoh
2012-10-31
Oct 31, 2012 ... Chemical Pathology, Irrua Specialist Teaching Hospital, Irrua, Edo ... in type 2 diabetes mellitus patients and control subjects using enzymatic ... inappropriate antioxidation process. ... without a previous diagnosis of diabetes develop a ... variants. It confers protection against malaria, which accounts for its ...
Ultraviolet spectroscopic evaluation of bioactive saponin fraction ...
African Journals Online (AJOL)
This study was to evaluate and characterize the saponin principles, using chromatographic and ..... triterpenoids, reducing sugars, amino acids, flavonoids, ..... blood glucose levels of diabetic rats. Int. J. Biol. Chem. ... homeostatic plants in Edo and Delta. States of ... mellitus: Systematic review and meta- analysis. BMJ,.
Effect of Consuming Rooftop Harvested Rainwater from Esan ...
African Journals Online (AJOL)
MICHAEL HORSFALL
ABSTRACT: This study assessed the effects of some local sources of drinking water in. Okiagbem, Uromi and Ubiaja communities of Esan Edo State Nigeria on the biochemical, ... International reviews have shown that .... failure multiple myeloma, nutritional deficiencies etc. ..... Caffeine effects on short-term performance.
Influence of job frustration, narcissism and demographic variables ...
African Journals Online (AJOL)
The study examines the hypothesised relationship among job frustration, narcissism, demographic variables and professional ethical behaviour among Nigerian Police officers. One hundred policemen drawn from four police divisions of Benin Area Command of Edo State participated in the study. There were 18 females ...
Knowledge and Attitude of Public Secondary School Teachers ...
African Journals Online (AJOL)
The study investigated knowledge and attitude of public secondary school teachers towards continuous assessment (CA) practices in Edo Central Senatorial District, Nigeria. The study was undertaken to determine the influence of gender, age, years of experience and area of educational specialization on teachers' attitude ...
Nigerian Journal of General Practice - Vol 11, No 1 (2013)
African Journals Online (AJOL)
Prevalence and pattern of Dyslipidaemia among adult hypertensives in the general pratice clinic of University of Benin Teaching Hospital, Benin City Edo State Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DD Uyagu, O Ebomwonyi, PO Dienye ...
Demographics as predictors of practice of HIV voluntary counselling ...
African Journals Online (AJOL)
This study assessed the demographic variables predicting the practice of HIV Voluntary Counselling among secondary school adolescents in Edo State. Thus, a descriptive survey research was adopted for the study. One thousand, nine hundred and eighty eight (1988) secondary school adolescents were sampled from ...
The challenges facing commercial motorcycle occupation in Etsako ...
African Journals Online (AJOL)
This study examined the challenges facing commercial motorcycle occupation in Edo State, Nigeria. A descriptive survey design was adopted. Data were collected through questionnaires and in-depth interviews (IDIs) among selected motorcyclists, police officers and road safety officials in Etsako West Local Government ...
STECH, 3(3), S/NO 12, SEPTEMBER, 2014
African Journals Online (AJOL)
DR Nneka
2014-09-12
Sep 12, 2014 ... the Nigerian Economy through Integrated Rural Development. Okosun ... Department of General Studies, ... Benin City, Edo State, Nigeria .... create a vast network of growth centres in town and villages. ... farmers to form cooperative farming. ..... Country Case Study Towards a Global Strategy for Cassava.
Awareness of health risks associated with body piercing and ...
African Journals Online (AJOL)
Recently, there has been a widespread practice of tattooing and body piercing among youths despite the increased number of potential complications associated to the practice. This study aims to assess the awareness of health risk associated with body piercing and tattooing in Federal Polytechnic Auchi, Edo state.
Test anxiety, attitude to schooling, parental influence, and peer ...
African Journals Online (AJOL)
This study investigated test anxiety, attitude to schooling, parental influence, and peer pressure as predictors of cheating tendencies in examination among secondary school students in Edo State, Nigeria. Ex-post facto research design was adopted for the study. Using stratified random sampling technique, 1200 senior ...
Farmers\\' Characteristics And Adoption Of Recommended Practices ...
African Journals Online (AJOL)
The study focused on farmers under the fadama project scheme in Edo State, Nigeria with emphasis on the relationship between farmers\\' characteristics and adoption of recommended technologies. Analyses of data obtained from a random sample of 80 respondents reveals that fadama farming was dominated by females ...
International Journal of Basic, Applied and Innovative Research ...
African Journals Online (AJOL)
Prevalence and association of asymptomatic prostatitis with urinary tract infection among apparently healthy men in Ekpoma, Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Turay, AI Obadan, GRA Okagun, MA Okadua, AEJ Okwori, 72-79 ...
Gender and environmental influence on laterality functions among ...
African Journals Online (AJOL)
Background: A semi‑structured questionnaire was designed to ascertain laterality functions in randomly sampled population of 400 preclinical students of the University of Benin, Benin City, Edo State, Nigeria. Methodology: Frequency in use of limbs in physical activities categorized as: Always if (>80%), usually if ...
Relationship between relative humidity and the dew point ...
African Journals Online (AJOL)
This research was aimed at determining the relationship between relative humidity and the dew point temperature in Benin City, Edo State, Nigeria. The dew point temperature was approximated from the measured air temperature and relative humidity with the aid of a currently self-designed weather monitoring system.
Relationship between Knowledge and Attitude towards HIV ...
African Journals Online (AJOL)
The study assessed the relationship between knowledge and attitude towards HIV voluntary counselling among secondary school adolescents in Edo State. One hypothesis guided the study. This was a descriptive correlational study based on survey research design. The population of the study was one hundred and ...
Errata: Reasons For Tooth Extraction Among Nigerian Children ...
African Journals Online (AJOL)
Dental caries was the predominant reason for exodontia in Nigeria children attending a general dental practice in Uselu, Edo State. Extensive prevention programmes targeted at children with high caries risk in schools and the communities is a necessity. Key words: exodontia, reasons, children, general dental practice ...
Estimation Of Measles Sero-conversion in Children Vaccinated ...
African Journals Online (AJOL)
A study of seroconversion of 115 children between 9 months to 5 years vaccinated against measles was conducted in Oriowon local government area of Edo State. This has to establish the immune status of the children against measles after immunisation. Haemagglutination inhibition technique was used. Prevaccination ...
Phytochemical screening and antimicrobial evaluation of the ...
African Journals Online (AJOL)
Piper umbellatum is widely distributed tropical plant species. The plant has been reported to possess an array activity including anti-inflammatory, antioxidant, antifungal, analgesic and skin protection. It is consumed as a vegetable and used ethnomedicinally in the treatment of stomach pain in Edo state, Nigeria.
Assessment of creatine kinase and lactate dehydrogenase activities ...
African Journals Online (AJOL)
Ina bid to investigate the influence of menopausal on coronary heart disease, plasma creatine kinase (CK) and lactate dehydrogenase (LDH) enzymes were analysed on a prospective cohort of 100 women attending Irrua Specialist Teaching Hospital (ISTH), Irrua, Edo state-Nigeria. They were divided into two groups; ...
African Journals Online (AJOL)
user
ABSTRACT. Onchocerciasis among 278 children (0-15yrs) of Ekpan village, a hyperendemic community in Uhunmwode. Local Government Area of Edo State, Nigeria was investigated using the prevalence of nodules as index. The overall prevalence of palpable nodules was 26.3%. Nodule prevalence increased with age ...
eudiometric theoretic eudiometric theoretic-approach to modelling
African Journals Online (AJOL)
eobe
2016-01-01
Jan 1, 2016 ... 2 DEPARTMENT OF PRODUCTION ENGINEERING, UNIVERSITY OF BENIN, BENIN CITY, EDO STATE NIGERIA ... phenomenon of chemical adsorption and desorption of DO at molecular level in a .... Again, few authors have applied linear regression in .... Our goal in modelling is to replicate this natural.
Llorens Planella, Maria Teresa (Teresa Canepa)
2015-01-01
This dissertation focused on the prolific early European trade and consumption of three Asian manufactured goods: Chinese silk and porcelain, and Japanese lacquer in the sixteenth and early seventeenth centuries, and has shown how the material cultures of late Ming China and Momoyama/early Edo Japan
10 CFR 1.32 - Office of the Executive Director for Operations.
2010-01-01
... supervision and direction of the Chairman as provided in Reorganization Plan No. 1 of 1980. (b) The EDO supervises and coordinates policy development and operational activities in the following offices: The Office... Office of Information Services, the Office of Investigations, the Office of Small Business and Civil...
Comparison of gold leaf thickness in Namban folding screens using X-ray fluorescence
Energy Technology Data Exchange (ETDEWEB)
Pessanha, Sofia; Madeira, Teresa I.; Manso, Marta [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Guerra, Mauro; Carvalho, Maria Luisa [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Universidade Nova de Lisboa, Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Caparica (Portugal); Gac, Agnes le [Centro de Fisica Atomica da Universidade de Lisboa, Lisbon (Portugal); Universidade Nova de Lisboa, Departamento de Conservacao e Restauro, Faculdade de Ciencias e Tecnologia, Caparica (Portugal)
2014-09-15
In this work, the thickness of the gold leaf applied in six Japanese folding screens is compared using a nondestructive approach. Four screens belonging to the Momoyama period (∝1573-1603) and two screens belonging to the early Edo period (∝1603-1868) were analyzed in situ using energy dispersive X-ray fluorescence, and the thickness of the applied gold leaf was evaluated using a methodology based on the attenuation of the different characteristic lines of gold in the gold leaf layer. Considering that the leaf may well not be made of pure gold, we established that, for the purpose of comparing the intensity ratios of the Au lines, layers made with gold leaf of high grade can be considered identical. The gold leaf applied in one of the screens from the Edo period was found to be thinner than the gold leaf applied in the other ones. This is consistent with the development of the beating technology to obtain ever more thin gold leafs. (orig.)
Services of Economic Development Organisations in Győr
Directory of Open Access Journals (Sweden)
Adrienn Reisinger
2017-12-01
Full Text Available Economic development of a municipality is highly depended on organizations and institutions, which services target local entrepreneurs and other economic actors. In the summer of 2015 we have collected and mapped the services of organizations with the function of economic development in the Hungarian city, Győr. Through our research we could identify the services and the characteristics of linkages and cooperation of the economic development organizations (EDOs. Most important findings of the study are the followings: activity of the organizations has a wide range. Some of them are presented in more organizations at the same time. Level of diversification is quite low. Directions of cooperation are mainly based on personal or ad hoc relations. We conducted that EDOs know about each other, despite of this fact the number of linkages is low. In this paper we provide findings about Győr, but the results can be used for other settlements’ economic development, too.
Comparison of gold leaf thickness in Namban folding screens using X-ray fluorescence
International Nuclear Information System (INIS)
Pessanha, Sofia; Madeira, Teresa I.; Manso, Marta; Guerra, Mauro; Carvalho, Maria Luisa; Gac, Agnes le
2014-01-01
In this work, the thickness of the gold leaf applied in six Japanese folding screens is compared using a nondestructive approach. Four screens belonging to the Momoyama period (∝1573-1603) and two screens belonging to the early Edo period (∝1603-1868) were analyzed in situ using energy dispersive X-ray fluorescence, and the thickness of the applied gold leaf was evaluated using a methodology based on the attenuation of the different characteristic lines of gold in the gold leaf layer. Considering that the leaf may well not be made of pure gold, we established that, for the purpose of comparing the intensity ratios of the Au lines, layers made with gold leaf of high grade can be considered identical. The gold leaf applied in one of the screens from the Edo period was found to be thinner than the gold leaf applied in the other ones. This is consistent with the development of the beating technology to obtain ever more thin gold leafs. (orig.)
78 FR 58878 - Safety Zone; San Diego Shark Fest Swim; San Diego Bay, San Diego, CA
2013-09-25
... Act (APA) (5 U.S.C. 553(b)). This provision authorizes an agency to issue a rule without prior notice... Security Management Directive 023-01 and Commandant Instruction M16475.lD, which guide the Coast Guard in...
Supracondylar and infratubercular processes observed in the ...
African Journals Online (AJOL)
SERVER
2007-11-05
Nov 5, 2007 ... 1Department of Anatomy, School of Basic Medical Sciences, Igbinedion University, Okada, P.M.B. 0006, Benin City,. Edo State. Nigeria. 2Department ... reliance on computer imaging in diagnostic medicine. (Harry et al., 1997). ... origins, because the proximal epiphyses are absent. The proximal epiphysis ...
Seroprevalence of Hepatitis C Virus in People Exposed to ...
African Journals Online (AJOL)
This study was therefore undertaken to determine the seroprevalence of hepatitis C virus (HCV) infection in people who had been exposed to traditional surgical practices in Edo State, Nigeria. Sera from the subjects were tested for HCV antibodies using Clinotech Diagnostic test device supplied by Clinotech Diagnostic and ...
Parents' occupation as correlate of students' career aspiration in ...
African Journals Online (AJOL)
This study investigated the relationship between parents' occupation and students' career aspiration in public secondary schools in Esan West Local Government Area of Edo State. The correlational research design was adopted for the study. A sample of 320 students was drawn for by simple random sampling technique ...
Factors Militating Against Effective Implementation of the 6-3-3-4 ...
African Journals Online (AJOL)
Nneka Umera-Okeke
4 education policy in Nigeria, using Esan North East Local Government Area of Edo. State as a case study. ... Human Rights (1948), the International Covenant on Economic, Social and Cultural .... The following research questions were formulated to guide this study: (a) Does ... The role of technical education in South.
Economic analysis of the marketing of plantain: a case study of ...
African Journals Online (AJOL)
This study concentrated on economic analysis of the marketing of plantain in Uhunmwode and Ovia North East Local Government Areas of Edo State. Six markets, made up of three from each local governmnet were selected because of their high population of plantain marketers and their approximate equal sizes.
International Journal of Basic, Applied and Innovative Research ...
African Journals Online (AJOL)
The incidence and pattern of supernumerary digital flexion creases amongst the population of Ekpoma in Edo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VA Uko, AO Nwaopara, MA Olugbenga, GP Oyadonghan, P Imah, D Aimiosior, 57 - 62 ...
Journal of Community Medicine and Primary Health Care - Vol 30 ...
African Journals Online (AJOL)
Assessment of occupational hazards, health problems and safety practices of petrol station attendants in Uyo, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL ... Fitness to drive among commercial intercity drivers in Benin-City, Edo State · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Evaluating Basic Technology Instruction in Nigerian Secondary ...
African Journals Online (AJOL)
It is an important technique which when appropriately adopted results into effective teaching and learning of practical subjects. This study focused on identification of evaluating techniques aimed at improving the teaching of Basic technology in Edo State. The area of study comprises of the eighteen Local Government Areas ...
Trichomonas vaginalis infection among adolescent girls in some ...
African Journals Online (AJOL)
Trichomonasvaginalisis the most common non-viral sexually transmitted disease (STD) and one of the neglected parasitic infections. This study aimed to determine the prevalence of T. vaginalisinfection among adolescent girls in some secondary schools in Edo State, Nigeria. A total of 272 girls were recruited in this study.
Population dynamics of Rodents and Insectivores in lowland tropical ...
African Journals Online (AJOL)
The community structure of rodents and insectivores in the lowland tropical rainforest of Okomu National Park, Edo State, Nigeria was assessed using a combination of live-trapping and sighting techniques during the dry and wet seasons. Seventeen species (14 species of rodent, 3 species of insectivores) were captured, ...
Study habit skills as correlate of academic performance of ...
African Journals Online (AJOL)
Study habit is one of the major factors that could influence students' academic attainment. Thus, this study examined study habit skills as correlate of academic performance of undergraduates in Edo state, Nigeria. It employed a correlation research design, using multistage sampling technique. Two hundred and forty eight ...
African Journals Online (AJOL)
Items 1 - 50 of 55 ... Vol 33, No 1 (2014), Coping strategies for marital stress as reported by ... On Managing Adolescents' Aggressiveness Among Senior Secondary ... of the gifted Students in the Inclusive classroom among secondary ... in the classroom among Secondary School teachers in benin - City, Edo State, Abstract.
Federal government financing of grassroots decay in Nigeria: the ...
African Journals Online (AJOL)
... self-reproduction project typical of patron-client politics. In this context, it is assumed that phenomenal growth in statutory and allied revenues accruing to rural locales has not produced the desired development, but undesired decay. Key Words: Nigeria – Federal financing, Edo State, public administration, political science ...
Job Satisfaction and Psychological Health of Long Distance Drivers ...
African Journals Online (AJOL)
This cross-sectional analytical study was designed to assess the level of and factors affecting job satisfaction and psychological health among long distance drivers in Benin City, Edo, Nigeria. A 21-item Job satisfaction questionnaire and the Golberg's General Health Questionnaire (GHQ 28) were used for data collection ...
A Study of the Constraint to Formulation and Implementation of ...
African Journals Online (AJOL)
In recent years, Benin metropolis has been faced with solid waste management problems. Solid wastes generated from household and commercial activities are dump indiscriminately in the metropolis. The Edo state government has made effort in policy formulation and funding in line with the national policy on the ...
African Journals Online (AJOL)
Geophysical Exploration of Gravel Deposits in Abudu Area of Edo State, Nigeria Abstract · Vol 20, No 1 (2012) - Articles Transformation of the Hubbard Hamiltonian to the t-J Hamiltonian using the Raleigh- Schrodinger Perturbation Expansion Abstract. ISSN: 1116-4336. AJOL African Journals Online. HOW TO USE AJOL.
Effects of counselling techniques in rehabilitating emotional ...
African Journals Online (AJOL)
This study investigated the effectiveness of Rational Emotive therapy (RET) and Systematic Desensitization (SD) in promoting emotional adjustment among adolescents in Edo state. Quasi Experimental design was used for the study. A total number of eighty four (84) students were randomly selected for the study and three ...
Relative Contributions of Socio-Cultural Variables to the Prediction ...
African Journals Online (AJOL)
Erah
the Prediction of Maternal Mortality in Edo South. Senatorial ... variables across the two locations (rural and urban) was early marriage/early child bearing (R2 = 0.200;. F = 401.40 ... severe bleeding, infections, obstructed or prolonged .... Analytical System (SAS) mode. Descriptive .... incontinence of urine and faeces due to.
10 CFR 20.1007 - Communications.
2010-01-01
... addressed to the Executive Director for Operations (EDO), and sent either by mail to the U.S. Nuclear... Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, via Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the NRC to...
Causes and Management of Domestic Conflicts among Couples ...
African Journals Online (AJOL)
Whereas the issue of domestic conflict is universal, its manifestation differs between and within ethnographic regions of the world. This paper examines the phenomenon of domestic conflict among couples in Esan-speaking area of Edo State. Particularly the paper addresses the main causes of the problem and the ...