Activation of human IK and SK Ca2+ -activated K+ channels by NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime)

DEFF Research Database (Denmark)

Strøbaek, Dorte; Teuber, Lene; Jørgensen, Tino D

2004-01-01

We have identified and characterized the compound NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime) as a potent activator of human Ca2+ -activated K+ channels of SK and IK types, whereas it is devoid of effect on BK type channels. IK- and SK-channels have previously been reported to be activated...

Two reduction waves of oximes and imine formation in acidic media

Czech Academy of Sciences Publication Activity Database

Celik, H.; Ludvík, Jiří; Zuman, P.

2006-01-01

Roč. 51, č. 26 (2006), s. 5845-5852 ISSN 0013-4686 R&D Projects: GA MŠk 1P05ME785 Institutional research plan: CEZ:AV0Z40400503 Keywords : oximes * electroreduction * polarography Subject RIV: CG - Electrochemistry Impact factor: 2.955, year: 2006

A Highly Efficient Catalyst for Oxime Ligation and Hydrazone-Oxime Exchange Suitable for Bioconjugation

OpenAIRE

Rashidian, Mohammad; Mahmoodi, Mohammad M.; Shah, Rachit; Dozier, Jonathan K.; Wagner, Carston R.; Distefano, Mark D.

2013-01-01

Imine-based reactions are useful for a wide range of bioconjugation applications. Although aniline is known to catalyze the oxime ligation reaction under physiological conditions, it suffers from slow reaction kinetics, specifically when a ketone is being used or when hydrazone-oxime exchange is performed. Here, we report on the discovery of a new catalyst that is up to 15 times more efficient than aniline. That catalyst, m-phenylenediamine (mPDA), was initially used to analyze the kinetics o...

The Preparation and Intramolecular Radical Cyclisation Reactions of Chiral Oxime Ethers

Directory of Open Access Journals (Sweden)

Booth Susan E.

1998-01-01

Full Text Available Chiral oxime ether 2 and Oxime ester 4 have been prepared by alkylation and esterification of the oxime 1. Racemic hydroxylamine 6 and chiral hydroxylamine 10 have been synthesised from N-hydroxysuccinimide and the corresponding alcohol in the presence of diethylazodicarboxylate, the two products were converted into the oxime ethers 7 and 11 respectively. The intramolecular radical cyclisation reactions of these oxime ethers and esters has been studied, successful reaction was observed to produce alkyl hydroxylamines 3, 8 and 12.

Synthesis, spectra and X-ray crystallography of dipyridin-2-ylmethanone oxime and its CuX2(oxime)2 complexes: Thermal, Hirshfeld surface and DFT analysis

Science.gov (United States)

Warad, Ismail; Abdoh, Muneer; Al Ali, Anas; Shivalingegowda, Naveen; Kumara, Karthik; Zarrouk, Abdelkader; Lokanath, Neartur Krishnappagowda

2018-02-01

Dipyridin-2-ylmethanone oxime (C11H9N3O), was prepared using di-2-pyridyl ketone. The oxime ligand and its neutral CuX2 (oxime)2 (X = Cl or Br) complexes have been identified with the aid of several spectroscopic techniques such as: IR, EI-MS, EA, UV-visible, TG, 1H-NMR and finally the structure of the free oxime ligand was confirmed by X-ray diffraction studies. The oxime crystallizes in the monoclinic space group P21/c, with cell parameters a = 8.8811 (8) Å, b = 10.6362 (8) Å, c = 11.2050 (8) Å, β = 109.085 (4) º, V = 1000.26 (14) Å3 and Z = 4. The molecular conformation is stabilized by a strong intramolecular Osbnd H⋯N hydrogen bonding between the hydroxyl group of the oxime moiety and the nitrogen of the pyridine ring. Since the oxime structure was solved by XRD, the ligand structure parameters like bond length and angles were compared to the DFT computed one, the UV-visible to TD-SCF and Hirshfeld surface to MEP analysis.

Reaction of the oximes of aliphatic aldehydes and ketones with alkoxyethenes

International Nuclear Information System (INIS)

Voronkov, M.G.; Keiko, N.A.; Shuvashev, Yu.A.; Kalikhman, I.D.; Keiko, V.V.

1987-01-01

In the reaction of acetone oxime with alkyl vinyl ethers in the presence of zinc chloride variable amounts of acetone 0,0'-(2-propylidene)dioxime, acetaldehyde dialkyl acetal, acetaldehyde 0-(1-alkoxyethyl)oxide, and acetone 0-(1-alkoxy-1-methylethyl)oxime, depending on the reaction conditions, are formed in addition to acetone 0-(1-alkoxyethyl)oxime (the initial addition product). In the reaction of acetaldehyde oxime with alkyl vinyl ethers in the presence of zinc chloride acetaldehyde oxime with alkyl vinyl ethers in the presence of zinc chloride acetaldehyde dialkyl acetal was isolated in addition to acetaldehyde 0-(1-alkoxyethyl)oxime. A mechanism for the formation of the obtained compounds is proposed

Indirubin-3-Oxime Prevents H2O2-Induced Neuronal Apoptosis via Concurrently Inhibiting GSK3β and the ERK Pathway.

Science.gov (United States)

Yu, Jie; Zheng, Jiacheng; Lin, Jiajia; Jin, Linlu; Yu, Rui; Mak, Shinghung; Hu, Shengquan; Sun, Hongya; Wu, Xiang; Zhang, Zaijun; Lee, Mingyuen; Tsim, Wahkeung; Su, Wei; Zhou, Wenhua; Cui, Wei; Han, Yifan; Wang, Qinwen

2017-05-01

Oxidative stress-induced neuronal apoptosis plays an important role in many neurodegenerative disorders. In this study, we have shown that indirubin-3-oxime, a derivative of indirubin originally designed for leukemia therapy, could prevent hydrogen peroxide (H 2 O 2 )-induced apoptosis in both SH-SY5Y cells and primary cerebellar granule neurons. H 2 O 2 exposure led to the increased activities of glycogen synthase kinase 3β (GSK3β) and extracellular signal-regulated kinase (ERK) in SH-SY5Y cells. Indirubin-3-oxime treatment significantly reversed the altered activity of both the PI3-K/Akt/GSK3β cascade and the ERK pathway induced by H 2 O 2 . In addition, both GSK3β and mitogen-activated protein kinase inhibitors significantly prevented H 2 O 2 -induced neuronal apoptosis. Moreover, specific inhibitors of the phosphoinositide 3-kinase (PI3-K) abolished the neuroprotective effects of indirubin-3-oxime against H 2 O 2 -induced neuronal apoptosis. These results strongly suggest that indirubin-3-oxime prevents H 2 O 2 -induced apoptosis via concurrent inhibiting GSK3β and the ERK pathway in SH-SY5Y cells, providing support for the use of indirubin-3-oxime to treat neurodegenerative disorders caused or exacerbated by oxidative stress.

A comprehensive evaluation of novel oximes in creation of butyrylcholinesterase-based nerve agent bioscavengers

Energy Technology Data Exchange (ETDEWEB)

Katalinić, Maja; Maček Hrvat, Nikolina [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Baumann, Krešimir; Morasi Piperčić, Sara; Makarić, Sandro; Tomić, Srđanka; Jović, Ozren; Hrenar, Tomica [Department of Chemistry, Faculty of Science, University of Zagreb, HR-10001 Zagreb (Croatia); Miličević, Ante [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Jelić, Dubravko [Fidelta Ltd., HR-10001 Zagreb (Croatia); Žunec, Suzana [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Primožič, Ines, E-mail: ines.primozic@chem.pmf.hr [Department of Chemistry, Faculty of Science, University of Zagreb, HR-10001 Zagreb (Croatia); Kovarik, Zrinka, E-mail: zkovarik@imi.hr [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia)

2016-11-01

A well-considered treatment of acute nerve agents poisoning involves the exogenous administration of butyrylcholinesterase (BChE, EC 3.1.1.8) as a stoichiometric bioscavenger efficient in preventing cholinergic crises caused by acetylcholinesterase (AChE, EC 3.1.1.7) inhibition. An additional improvement in medical countermeasures would be to use oximes that could reactivate BChE as well to upgrade bioscavenging from stoichiometric to oxime-assisted catalytic. Therefore, in this paper we investigated the potency of 39 imidazolium and benzimidazolium oximes (36 compounds synthesized for the first time) to be considered as the reactivators specifically designed for reactivation of phosphylated human BChE. Their efficiency in the reactivation of paraoxon-, VX-, and tabun-inhibited human BChE, as well as human AChE was tested and compared with the efficiencies of HI-6 and obidoxime, used in medical practice today. A comprehensive analysis was performed for the most promising oximes defining kinetic parameters of reactivation as well as interactions with uninhibited BChE. Furthermore, experimental data were compared with computational studies (docking, QSAR analysis) as a starting point in future oxime structure refinement. Considering the strict criteria set for in vivo applications, we determined the cytotoxicity of lead oximes on two cell lines. Among the tested oxime library, one imidazolium compound was selected for preliminary in vivo antidotal study in mice. The obtained protection in VX poisoning outlines its potential in development oxime-assisted OP-bioscavenging with BChE. - Highlights: • 36 new imidazolium and benzimidazolium oximes were designed and synthesized. • In vitro reactivation kinetics of phosphylated butyrylcholinesterase was studded. • The modes of actions were elucidated by QSAR and docking simulations. • Protection in VX poisoning was 6.3 × LD{sub 50} in in vivo antidotal study in mice. • Imidazolium oxime-assisted catalysis is

A comprehensive evaluation of novel oximes in creation of butyrylcholinesterase-based nerve agent bioscavengers

International Nuclear Information System (INIS)

Katalinić, Maja; Maček Hrvat, Nikolina; Baumann, Krešimir; Morasi Piperčić, Sara; Makarić, Sandro; Tomić, Srđanka; Jović, Ozren; Hrenar, Tomica; Miličević, Ante; Jelić, Dubravko; Žunec, Suzana; Primožič, Ines; Kovarik, Zrinka

2016-01-01

A well-considered treatment of acute nerve agents poisoning involves the exogenous administration of butyrylcholinesterase (BChE, EC 3.1.1.8) as a stoichiometric bioscavenger efficient in preventing cholinergic crises caused by acetylcholinesterase (AChE, EC 3.1.1.7) inhibition. An additional improvement in medical countermeasures would be to use oximes that could reactivate BChE as well to upgrade bioscavenging from stoichiometric to oxime-assisted catalytic. Therefore, in this paper we investigated the potency of 39 imidazolium and benzimidazolium oximes (36 compounds synthesized for the first time) to be considered as the reactivators specifically designed for reactivation of phosphylated human BChE. Their efficiency in the reactivation of paraoxon-, VX-, and tabun-inhibited human BChE, as well as human AChE was tested and compared with the efficiencies of HI-6 and obidoxime, used in medical practice today. A comprehensive analysis was performed for the most promising oximes defining kinetic parameters of reactivation as well as interactions with uninhibited BChE. Furthermore, experimental data were compared with computational studies (docking, QSAR analysis) as a starting point in future oxime structure refinement. Considering the strict criteria set for in vivo applications, we determined the cytotoxicity of lead oximes on two cell lines. Among the tested oxime library, one imidazolium compound was selected for preliminary in vivo antidotal study in mice. The obtained protection in VX poisoning outlines its potential in development oxime-assisted OP-bioscavenging with BChE. - Highlights: • 36 new imidazolium and benzimidazolium oximes were designed and synthesized. • In vitro reactivation kinetics of phosphylated butyrylcholinesterase was studded. • The modes of actions were elucidated by QSAR and docking simulations. • Protection in VX poisoning was 6.3 × LD 50 in in vivo antidotal study in mice. • Imidazolium oxime-assisted catalysis is feasible

21 CFR 524.1446 - Milbemycin oxime solution.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Milbemycin oxime solution. 524.1446 Section 524...) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS OPHTHALMIC AND TOPICAL DOSAGE FORM NEW ANIMAL DRUGS § 524.1446 Milbemycin oxime solution. (a) Specifications. Each tube contains 0.25 milliliter of a 0.1 percent solution...

New Cinchona Oximes Evaluated as Reactivators of Acetylcholinesterase and Butyrylcholinesterase Inhibited by Organophosphorus Compounds

Directory of Open Access Journals (Sweden)

Maja Katalinić

2017-07-01

Full Text Available For the last six decades, researchers have been focused on finding efficient reactivators of organophosphorus compound (OP-inhibited acetylcholinesterase (AChE and butyrylcholinesterase (BChE. In this study, we have focused our research on a new oxime scaffold based on the Cinchona structure since it was proven to fit the cholinesterases active site and reversibly inhibit their activity. Three Cinchona oximes (C1, C2, and C3, derivatives of the 9-oxocinchonidine, were synthesized and investigated in reactivation of various OP-inhibited AChE and BChE. As the results showed, the tested oximes were more efficient in the reactivation of BChE and they reactivated enzyme activity to up to 70% with reactivation rates similar to known pyridinium oximes used as antidotes in medical practice today. Furthermore, the oximes showed selectivity towards binding to the BChE active site and the determined enzyme-oxime dissociation constants supported work on the future development of inhibitors in other targeted studies (e.g., in treatment of neurodegenerative disease. Also, we monitored the cytotoxic effect of Cinchona oximes on two cell lines Hep G2 and SH-SY5Y to determine the possible limits for in vivo application. The cytotoxicity results support future studies of these compounds as long as their biological activity is targeted in the lower micromolar range.

Recent advances in evaluation of oxime efficacy in nerve agent poisoning by in vitro analysis

International Nuclear Information System (INIS)

Worek, F.; Eyer, P.; Aurbek, N.; Szinicz, L.; Thiermann, H.

2007-01-01

The availability of highly toxic organophosphorus (OP) warfare agents (nerve agents) underlines the necessity for an effective medical treatment. Acute OP toxicity is primarily caused by inhibition of acetylcholinesterase (AChE). Reactivators (oximes) of inhibited AChE are a mainstay of treatment, however, the commercially available compounds, obidoxime and pralidoxime, are considered to be rather ineffective against various nerve agents, e.g. soman and cyclosarin. This led to the synthesis and investigation of numerous oximes in the past decades. Reactivation of OP-inhibited AChE is considered to be the most important reaction of oximes. Clinical data from studies with pesticide-poisoned patients support the assumption that the various reactions between AChE, OP and oxime, i.e. inhibition, reactivation and aging, can be investigated in vitro with human AChE. In contrast to animal experiments such in vitro studies with human tissue enable the evaluation of oxime efficacy without being affected by species differences. In the past few years numerous in vitro studies were performed by different groups with a large number of oximes and methods were developed for extrapolating in vitro data to different scenarios of human nerve agent poisoning. The present status in the evaluation of new oximes as antidotes against nerve agent poisoning will be discussed

Simple, Efficient and Green Synthesis of Oximes under Ultrasound ...

African Journals Online (AJOL)

NICO

Faculty of Chemistry, Bu-Ali Sina University, Hamadan 65174, Iran. ... The condensation of aldehydes and ketones with hydroxylamine hydrochloride gives oximes in 81–95 ... Oximes are important in organic synthesis not only for protec-.

A Structure-Activity Analysis of the Variation in Oxime Efficacy Against Nerve Agents

Science.gov (United States)

2008-01-01

cyclosarin. Analysis of in vivo oxime protection was conducted with oxime protective ratios (PR) from guinea pigs receiving oxime and atropine therapy ...in our study confirmed previous assessments that oxime protection varies drama - tically against different military nerve agents (Aas, 2003; Dawson... therapy ofacutepoisonings inducedbyanti-cholinesterase neuroparalytic substances. In:Monov, A., Dishovsky, C. (Eds.), Medical Aspects of Chemical and

Adsorption equilibrium of uranium from seawater on chelating resin containing amide oxime group

International Nuclear Information System (INIS)

Hori, Takahiro; Saito, Kyoichi; Furusaki, Shintaro; Sugo, Takanobu; Okamoto, Jiro.

1987-01-01

Chelating resins containing amide oxime group were synthesized by radiation-induced graft polymerization. The amount of the amide oxime groups was controlled below about 0.1 mol per kg of base polymer. The adsorption equilibrium of uranium from seawater on this resin was investigated. It was suggested that two neighboring amide oxime groups on the grafted chain captured one uranyl ion, and that single amide oxime ligand had little capacity for the adsorption of uranium. The adsorption equilibrium was correlated by a Langmuir-type equation. The content of neighboring amide oxime groups was 0.406 x 10 -3 mol per kg of base polymer, which corresponded to 0.39 % of the total amount of amide oxime groups. The apparent stoichiometric stability constant for the complex of uranyl ion with the neighboring amide oxime groups in seawater was calculated to be 10 -21.7 . (author)

Binding of reactive organophosphate by oximes via hydrogen bond

Indian Academy of Sciences (India)

In this contribution, the ability of simple oximes to bind a well-known nerve agent simulant (dimethylmethylphosphonate, DMMP) via hydrogen bond is reported. UV/Vis measurements indicate the formation of 1:1 complexes. 1H-, 31P-NMR titrations and T-ROESY experiments confirm that oximes bind the organophosphate ...

Fluoren-9-one oxime

Directory of Open Access Journals (Sweden)

Bernhard Bugenhagen

2014-03-01

Full Text Available In the title molecule, C13H9NO, the fluorene system and the oxime group non-H atoms are essentially coplanar, with a maximum deviation from the fluorene mean plane of 0.079 (2 Å for the oxime O atom. A short intramolecular C—H...O generates an S(6 ring. In the crystal, molecules related by a twofold screw axis are connected by O—H...N hydrogen bonds, forming [100] chains Within these chains, molecules related by a unit translation along [100] show π–π stacking interactions between their fluorene ring systems with an interplanar distance of 3.347 (2 Å. The dihedral angle between the fluorene units of adjacent molecules along the helix is 88.40 (2°. There is a short C—H...π contact between the fluorene groups belonging to neighbouring chains.

Development of a 117mSn preparation method

International Nuclear Information System (INIS)

Moraes, Vanessa; Osso Junior, Joao Alberto

2000-01-01

117m Sn is a radioisotope with suitable characteristics to be used in nuclear medicine as radiotherapy, when labeled with DTPA. The aim of this work is the preparation of 117m Sn from irradiation of the natural tin with proton beam at the cyclotron CV-28 of IPEN-CNEN/SP via the nuclear reaction nat Sn (p, xn) 117 Sb to 117m Sn. Due to the formation of the Sb precursor it is necessary to perform a chemical separation for Sb-Sn. The separation method used was the ion exchange, due to its utilization facilities for radioactive material. Chemical, radiochemical and radionuclidic methods were also developed for the quality control of the final product, the 117m Sn. (author)

Studies on the polymerization of acrolein oxime, 6

International Nuclear Information System (INIS)

Masuda, Seizo; Tamai, Harumi; Ota, Tadatoshi; Torii, Munetomo; Tanaka, Masami.

1979-01-01

Radiation-induced polymerization and copolymerization of acrolein oxime are investigated in different solvents and at a wide range of temperature for obtaining information on the reaction mechanism. Acrolein oxime is polymerized ionically, irrespective of dryness of the sample. Arrhenius plots for the polymerization rate, which do not yield a linear relation, can be adequately approximated by two straight lines. An anionic mechanism is operative above the room temperature, while a cationic mechanism predominates below -23 0 C. The reaction in the intermediate temperature range proceeds by a competitive mechanism, and the rate of the anionic and cationic polymerizations becomes equal at the temperature near -5 0 C. The reaction rate is proportional to the square root of dose rate at room temperature and -23 0 C. On the basis of these data, it is proposed that the polymerization of acrolein oxime by γ-irradiation proceeds by free-ionic mechanisms. (author)

Centrally Acting Oximes in Reactivation of Tabun-Phosphoramidated AChE

Science.gov (United States)

Kovarik, Zrinka; Maček, Nikolina; Sit, Rakesh K.; Radić, Zoran; Fokin, Valery V.; Sharpless, K. Barry; Taylor, Palmer

2012-01-01

Organophosphates (OP) inhibit acetylcholinesterase (AChE, E.C.3.1.1.7), both in peripheral tissues and central nervous system (CNS), causing adverse and sometimes fatal effects due to the accumulation of neurotransmitter acetylcholine (ACh). The currently used therapy, focusing on the reactivation of inhibited AChE, is limited to peripheral tissues because commonly used quaternary pyridinium oxime reactivators do not cross the blood brain barrier (BBB) at therapeutically relevant levels. A directed library of thirty uncharged oximes that contain tertiary amine or imidazole protonable functional groups that should cross the BBB as unionized species was tested as tabun-hAChE conjugate reactivators along with three reference oximes: DAM (diacetylmonoxime), MINA (monoisonitrosoacetone), and 2-PAM. The oxime RS150D [N-((1-(3-(2-((hydroxyimino)methyl)-1H-imidazol-1-yl)propyl)-1H-1,2,3-triazol-4-yl)methyl)benzamide] was highlighted as the most promising reactivator of the tabun-hAChE conjugate. We also observed that oximes RS194B [N-(2-(azepan-1-yl)ethyl)-2-(hydroxyimino)acetamide] and RS41A [2-(hydroxyimino)-N-(2-(pyrrolidin-1-yl)ethyl)acetamide], which emerged as lead uncharged reactivators of phosphylated hAChE with other OPs (sarin, cyclosarin and VX), exhibited only moderate reactivation potency for tabun inhibited hAChE. This implies that geometry of oxime access to the phosphorus atom conjugated to the active serine is an important criterion for efficient reactivation, along with the chemical nature of the conjugated moiety: phosphorate, phosphonate, or phosphoramidate. Moreover, modification of the active center through mutagenesis enhances the rates of reactivation. The phosphoramidated-hAChE choline-binding site mutant Y337A showed three-times enhanced reactivation capacity with non-triazole imidazole containing aldoximes (RS113B, RS113A and RS115A) and acetamide derivative (RS194B) than with 2PAM. PMID:22960624

Cutaneous exposure to vesicant phosgene oxime: Acute effects on the skin and systemic toxicity

International Nuclear Information System (INIS)

Tewari-Singh, Neera; Goswami, Dinesh G; Kant, Rama; Croutch, Claire R; Casillas, Robert P; Orlicky, David J; Agarwal, Rajesh

2017-01-01

significant for developing a phosgene oxime-induced skin injury model.

Cutaneous exposure to vesicant phosgene oxime: Acute effects on the skin and systemic toxicity

Energy Technology Data Exchange (ETDEWEB)

Tewari-Singh, Neera, E-mail: Neera.tewari-singh@ucdenver.edu [Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of Colorado Anschutz Medical Campus, Aurora, CO 80045 (United States); Goswami, Dinesh G; Kant, Rama [Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of Colorado Anschutz Medical Campus, Aurora, CO 80045 (United States); Croutch, Claire R; Casillas, Robert P [MRIGlobal, Kansas City, MO 64110 (United States); Orlicky, David J [Department of Pathology, School of Medicine, University of Colorado Anschutz Medical Campus, Aurora, CO 80045 (United States); Agarwal, Rajesh [Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of Colorado Anschutz Medical Campus, Aurora, CO 80045 (United States)

2017-02-15

significant for developing a phosgene oxime-induced skin injury model.

Oxime Ethers of (E)-11-Isonitrosostrychnine as Highly Potent Glycine Receptor Antagonists

DEFF Research Database (Denmark)

Mohsen, Amal M Y; Mandour, Yasmine M; Sarukhanyan, Edita

2016-01-01

of the crystal structure of the α3 glycine receptor indicated the same orientation of the strychnine core for all analogues. For the most potent oxime ethers, the ether substituent was accommodated in a lipophilic receptor binding pocket. The findings identify the oxime hydroxy group as a suitable attachment...

Comparison of oxime reactivation and aging of nerve agent-inhibited monkey and human acetylcholinesterases.

Science.gov (United States)

Luo, Chunyuan; Tong, Min; Maxwell, Donald M; Saxena, Ashima

2008-09-25

Non-human primates are valuable animal models that are used for the evaluation of nerve agent toxicity as well as antidotes and results from animal experiments are extrapolated to humans. It has been demonstrated that the efficacy of an oxime primarily depends on its ability to reactivate nerve agent-inhibited acetylcholinesterase (AChE). If the in vitro oxime reactivation of nerve agent-inhibited animal AChE is similar to that of human AChE, it is likely that the results of an in vivo animal study will reliably extrapolate to humans. Therefore, the goal of this study was to compare the aging and reactivation of human and different monkey (Rhesus, Cynomolgus, and African Green) AChEs inhibited by GF, GD, and VR. The oximes examined include the traditional oxime 2-PAM, two H-oximes HI-6 and HLo-7, and the new candidate oxime MMB4. Results indicate that oxime reactivation of all three monkey AChEs was very similar to human AChE. The maximum difference in the second-order reactivation rate constant between human and three monkey AChEs or between AChEs from different monkey species was 5-fold. Aging rate constants of GF-, GD-, and VR-inhibited monkey AChEs were very similar to human AChE except for GF-inhibited monkey AChEs, which aged 2-3 times faster than the human enzyme. The results of this study suggest that all three monkey species are suitable animal models for nerve agent antidote evaluation since monkey AChEs possess similar biochemical/pharmacological properties to human AChE.

Design and Biological Evaluation of Antifouling Dihydrostilbene Oxime Hybrids.

Science.gov (United States)

Moodie, Lindon W K; Cervin, Gunnar; Trepos, Rozenn; Labriere, Christophe; Hellio, Claire; Pavia, Henrik; Svenson, Johan

2018-04-01

By combining the recently reported repelling natural dihydrostilbene scaffold with an oxime moiety found in many marine antifoulants, a library of nine antifouling hybrid compounds was developed and biologically evaluated. The prepared compounds were shown to display a low antifouling effect against marine bacteria but a high potency against the attachment and growth of microalgae down to MIC values of 0.01 μg/mL for the most potent hybrid. The mode of action can be characterized as repelling via a reversible non-toxic biostatic mechanism. Barnacle cyprid larval settlement was also inhibited at low μg/mL concentrations with low levels or no toxicity observed. Several of the prepared compounds performed better than many reported antifouling marine natural products. While several of the prepared compounds are highly active as antifoulants, no apparent synergy is observed by incorporating the oxime functionality into the dihydrostilbene scaffold. This observation is discussed in light of recently reported literature data on related marine natural antifoulants and antifouling hybrids as a potentially general strategy for generation of improved antifoulants.

Fast and low-temperature sintering of silver complex using oximes as a potential reducing agent for solution-processible, highly conductive electrodes

International Nuclear Information System (INIS)

Yoo, Ji Hoon; Park, Su Bin; Kim, Ji Man; Han, Dae Sang; Chae, Jangwoo; Kwak, Jeonghun

2014-01-01

Highly conductive, solution-processed silver thin-films were obtained at a low sintering temperature of 100 °C in a short sintering time of 10 min by introducing oximes as a potential reductant for silver complex. The thermal properties and reducibility of three kinds of oximes, acetone oxime, 2-butanone oxime, and one dimethylglyoxime, were investigated as a reducing agent, and we found that the thermal decomposition product of oximes (ketones) accelerated the conversion of silver complex into highly conductive silver at low sintering temperature in a short time. Using the acetone oxime, the silver thin-film exhibited the lowest surface resistance (0.91 Ω sq −1 ) compared to those sing other oximes. The silver thin-film also showed a high reflectance of 97.8%, which is comparable to evaporated silver films. We also demonstrated inkjet printed silver patterns with the oxime-added silver complex inks. (paper)

76 FR 12563 - Oral Dosage Form New Animal Drugs; Spinosad and Milbemycin Oxime

Science.gov (United States)

2011-03-08

... spinosad and milbemycin oxime in dogs for the treatment and prevention of flea infestations and for the... and milbemycin oxime) Chewable Tablets in dogs for the treatment and prevention of flea infestations... Friday. Under section 512(c)(2)(F)(ii) of the Federal Food, Drug, and Cosmetic Act (21 U.S.C. 360b(c)(2...

Chromatographic analysis of toxic phosphylated oximes (POX): a brief overview.

Science.gov (United States)

Becker, Christian; Worek, Franz; John, Harald

2010-10-01

Poisoning with organophosphorus compounds (OP), e.g. pesticides and nerve agents, causes inhibition of acetylcholinesterase (AChE) by phosphylation of the active site serine residue. Consequently, accumulation of stimulating acetylcholine in the synaptic cleft induces cholinergic crisis which ultimately may lead to death. For standard causal therapy, enzyme reactivators are administered representing oxime derivatives of quarternary pyridinium compounds, e.g. pralidoxime (2-PAM), obidoxime and HI 6. The mechanism of action includes removal of the phosphyl moiety by a nucleophilic attack of the oximate molecule substituting the enzyme and forming a phosphylated oxime (POX). POX is produced in stoichiometric amounts of reactivated enzyme and exhibits a significantly enhanced toxicity (inhibition rate constant) when compared to the parent OP. However, stability of POX under physiological conditions appears to be highly limited. Nevertheless, the presence of POX reveals a potential critical issue for both therapeutic efficacy in vivo and pharmacokinetic and pharmacodynamic (PK-PD) modelling based on cholinesterase activity data. Detailed characterization represents an important need for elaboration of the entire oxime pharmacology.Nevertheless, reports on POX toxicity and analysis are quite rare and may therefore be indicative of the challenge of POX analysis. This review provides a concise overview of chromatographic approaches applied to POX separation. Chromatography represents the key technology for POX purification and quantification in kinetic in vitro studies using buffers and biological fluids. Applications based on reversed-phase chromatography (RPC), ion pair chromatography (IPC) and an affinity approach as well as thin layer chromatography (TLC) are discussed and novel applications and data are presented. Copyright © 2010 John Wiley & Sons, Ltd.

Organic Process Technology Valuation: Cyclohexanone Oxime Syntheses

Science.gov (United States)

Cannon, Kevin C.; Breen, Maureen P.

2010-01-01

Three contemporary processes for cyclohexanone oxime synthesis are evaluated in a case study. The case study introduces organic chemistry students to basic cost accounting to determine the most economical technology. Technical and financial aspects of these processes are evaluated with problem-based exercises that may be completed by students…

Synthesis and Antifungal Activity of Novel 3-Caren-5-One Oxime Esters.

Science.gov (United States)

Huang, Min; Duan, Wen-Gui; Lin, Gui-Shan; Li, Kun; Hu, Qiong

2017-09-12

A series of novel 3-caren-5-one oxime esters were designed and synthesized by multi-step reactions in an attempt to develop potent antifungal agents. Two E - Z stereoisomers of the intermediate 3-caren-5-one oxime were separated by column chromatography for the first time. The structures of all the intermediates and target compounds were confirmed by UV-Vis, FTIR, NMR, ESI-MS, and elemental analysis. The antifungal activity of the target compounds was preliminarily evaluated by the in vitro method against Fusarium oxysporum f. sp. cucumerinum , Physalospora piricola , Alternaria solani , Cercospora arachidicola , Gibberella zeae, Rhizoeotnia solani , Bipolaris maydis , and Colleterichum orbicalare at 50 µg/mL. The target compounds exhibited best antifungal activity against P. piricola , in which compounds ( Z )- 4r (R = β -pyridyl), ( Z )- 4q (R = α -thienyl), ( E )- 4f' (R = p -F Ph), ( Z )- 4i (R = m -Me Ph), ( Z )- 4j (R = p -Me Ph), and ( Z )- 4p (R = α -furyl) had inhibition rates of 97.1%, 87.4%, 87.4%, 85.0%, 81.9%, and 77.7%, respectively, showing better antifungal activity than that of the commercial fungicide chlorothanil. Also, compound ( Z )- 4r (R = β -pyridyl) displayed remarkable antifungal activity against all the tested fungi, with inhibition rates of 76.7%, 82.7%, 97.1%, 66.3%, 74.7%, 93.9%, 76.7% and 93.3%, respectively, showing better or comparable antifungal activity than that of the commercial fungicide chlorothanil. Besides, the E-Z isomers of the target oxime esters were found to show obvious differences in antifungal activity. These results provide an encouraging framework that could lead to the development of potent novel antifungal agents.

Inhibition of the voltage-dependent chloride channel of Torpedo electric organ by diisopropylfluorophosphate and its reversal by oximes

International Nuclear Information System (INIS)

Abalis, I.M.; Chiang, P.K.; Wirtz, R.A.; Andre, R.G.

1986-01-01

Diisopropylfluorophosphate (DFP), a potent organophosphate inhibitor of cholinesterases, was found to inhibit the specific binding of [ 35 S]t-butylbicyclophosphorothionate (TBPS), specific chloride channels ligand, to the electric organ membranes of Torpedo, with a Ki of 21 +/- 3 μM. The binding sites of [ 35 S]TBPS in the Torpedo membranes were found not to be GABA receptors or nicotinic acetylcholine receptors as previously described. Interestingly, a stimulation of the binding of [ 35 S]TBPS was observed in the presence of atropine and three oximes, monopyridinium oxime 2-PAM, bispyridinium bis-oxime TMB-4 and H-oxime HI-6. The maximal stimulation was 300-500% of control, after which, the stimulation was reversed at higher concentrations. The three oximes protected by more than 95% the inhibition by 1 mM DFP of the binding of [ 35 S]TBPS to the voltage-dependent chloride channel. However, atropine protected only 20% of the inhibited channel. These results, thus, suggest that the protection against the toxic effects of DFP or other anticholinesterase agents by the tested oximes may not be solely a result of the reactivation of cholinesterases but also the protection of the voltage-dependent chloride channel

Multiple QSAR models, pharmacophore pattern and molecular docking analysis for anticancer activity of α, β-unsaturated carbonyl-based compounds, oxime and oxime ether analogues

Science.gov (United States)

Masand, Vijay H.; El-Sayed, Nahed N. E.; Bambole, Mukesh U.; Quazi, Syed A.

2018-04-01

Multiple discrete quantitative structure-activity relationships (QSARs) models were constructed for the anticancer activity of α, β-unsaturated carbonyl-based compounds, oxime and oxime ether analogues with a variety of substituents like sbnd Br, sbnd OH, -OMe, etc. at different positions. A big pool of descriptors was considered for QSAR model building. Genetic algorithm (GA), available in QSARINS-Chem, was executed to choose optimum number and set of descriptors to create the multi-linear regression equations for a dataset of sixty-nine compounds. The newly developed five parametric models were subjected to exhaustive internal and external validation along with Y-scrambling using QSARINS-Chem, according to the OECD principles for QSAR model validation. The models were built using easily interpretable descriptors and accepted after confirming statistically robustness with high external predictive ability. The five parametric models were found to have R2 = 0.80 to 0.86, R2ex = 0.75 to 0.84, and CCCex = 0.85 to 0.90. The models indicate that frequency of nitrogen and oxygen atoms separated by five bonds from each other and internal electronic environment of the molecule have correlation with the anticancer activity.

Dicty_cDB: VFL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

Synthesis and Antifungal Activity of Novel 3-Caren-5-One Oxime Esters

Directory of Open Access Journals (Sweden)

Min Huang

2017-09-01

Full Text Available A series of novel 3-caren-5-one oxime esters were designed and synthesized by multi-step reactions in an attempt to develop potent antifungal agents. Two E-Z stereoisomers of the intermediate 3-caren-5-one oxime were separated by column chromatography for the first time. The structures of all the intermediates and target compounds were confirmed by UV-Vis, FTIR, NMR, ESI-MS, and elemental analysis. The antifungal activity of the target compounds was preliminarily evaluated by the in vitro method against Fusarium oxysporum f. sp. cucumerinum, Physalospora piricola, Alternaria solani, Cercospora arachidicola, Gibberella zeae, Rhizoeotnia solani, Bipolaris maydis, and Colleterichum orbicalare at 50 µg/mL. The target compounds exhibited best antifungal activity against P. piricola, in which compounds (Z-4r (R = β-pyridyl, (Z-4q (R = α-thienyl, (E-4f′ (R = p-F Ph, (Z-4i (R = m-Me Ph, (Z-4j (R = p-Me Ph, and (Z-4p (R = α-furyl had inhibition rates of 97.1%, 87.4%, 87.4%, 85.0%, 81.9%, and 77.7%, respectively, showing better antifungal activity than that of the commercial fungicide chlorothanil. Also, compound (Z-4r (R = β-pyridyl displayed remarkable antifungal activity against all the tested fungi, with inhibition rates of 76.7%, 82.7%, 97.1%, 66.3%, 74.7%, 93.9%, 76.7% and 93.3%, respectively, showing better or comparable antifungal activity than that of the commercial fungicide chlorothanil. Besides, the E-Z isomers of the target oxime esters were found to show obvious differences in antifungal activity. These results provide an encouraging framework that could lead to the development of potent novel antifungal agents.

Preparation of phenacylchloride, morpholinophenacyl and N-Piperidinophenacyl oximes and study of their complexation with Copper (II) and Cobalt (II) ions

International Nuclear Information System (INIS)

Ali, Kamal Eldin Ahmed

1999-01-01

The aim of the present work is to prepare phenacyl chloride oxime and phenacyl of N-Piperidine and morpholine derivatives, and mainly to study their complexes with Cu(II) and Co(II) ions with objective ascertaining that one of these ligands can be used in quantitative extraction of these metal ions from the aqueous solution. Copper (II) salts form 1:1 complexes with the phenyacyl oximes of N-piperidine and morpholine and 1:2 complex with phenacyl chloride oxime. However, cobalt(II) salts form 1:2 complexes with phenacyl oxime of N-piperidine and morpholine but does not complex with phenacyl chloride oxime. The stoichiometry of these complexes were determined by UV/VIS spectrophotometry using the mole ratio, continuous variation and slope ratio methods.The stability constants of the five complexes were calculated from aberrances using Job's method. They showed that the copper (II) and cobalt (II) complexes with N-piperidinophenacy oxime are more stable than those with morpholinophenacyl oxime. Copper (II) complexes with any of these two ligands are more stable than those of cobalt (II). IR spectra of the complexes of copper (II) and cobalt (II) with phenacyl oxime of N-piperidine and morpholine show diminished peaks of hydrogen bonds between N and O atoms of the ligand. Specific extractabilities using amylalcohol of copper (II) complexes with the three ligands increase from PH4 to reach its maximum at PH8. The high value for N-piperidinophenacyl oxime ligand (96%-97%) indicates that, this ligand can be used as analytical reagent for the quantitative spectrophotometric determination of copper (II) salts in aqueous media. Cobalt (II) complexes were formed and extracted from solution only at PH6 (specific PH). The extractabilities ranging from 81.6-87.2% warrants the use of these ligands in quantitative spectrophotometric determination of cobalt (II).(Author)

Deprotection of oximes using urea nitrate under microwave irradiation

Indian Academy of Sciences (India)

Abstract. A new mild and efficient method for the cleavage of oximes to carbonyl compounds using readily available urea nitrate in acetonitrile-water (95 : 5), under microwave irradiation within 2 min, in good yields is reported.

Conversion of Natural Aldehydes from Eucalyptus citriodora, Cymbopogon citratus, and Lippia multiflora into Oximes: GC-MS and FT-IR Analysis †

Directory of Open Access Journals (Sweden)

Igor W. Ouédraogo

2009-08-01

Full Text Available Three carbonyl-containing extracts of essential oils from Eucalyptus citriodora (Myrtaceae, Cymbopogon citratus (Gramineae and Lippia multiflora (Verbenaceae were used for the preparation of oximes. The reaction mixtures were analyzed by GC-MS and different compounds were identified on the basis of their retention times and mass spectra. We observed quantitative conversion of aldehydes to their corresponding oximes with a purity of 95 to 99%. E and Z stereoisomers of the oximes were obtained and separated by GC-MS. During GC analysis, the high temperature in the injector was shown to cause partial dehydratation of oximes and the resulting nitriles were readily identified. Based on FT-IR spectroscopy, that revealed the high stability and low volatility of these compounds, the so-obtained oximes could be useful for future biological studies.

Peripheral site ligand conjugation to a non-quaternary oxime enhances reactivation of nerve agent-inhibited human acetylcholinesterase

NARCIS (Netherlands)

Koning, M.C. de; Grol, M. van; Noort, D.

2011-01-01

Commonly employed pyridinium-oxime (charged) reactivators of nerve agent inhibited acetylcholinesterase (AChE) do not readily pass the blood brain barrier (BBB) because of the presence of charge(s). Conversely, non-ionic oxime reactivators often suffer from a lack of reactivating potency due to a

Synthesis of 2-hydroxy-3-(2-methyl-propenyl-1,4-naphthoquinone and related oxime derivatives

Directory of Open Access Journals (Sweden)

Patricia S. Oliveira

2012-06-01

Full Text Available The condensation reaction of commercial 2-hydroxy-1 ,4-naphthoquinone 1 (lawsone with isobutyraldehyde 2 furnishs norlapachol 3 (2-hydroxy-3-(2-methyl-propenyl -1,4-naphthoquinone with yields ranging from 66 to 93% depending on the different conditions tested, and a reaction temperature factor determinant for the formation of the desired product. It was treated with hydroxylamine hydrochloride in alkaline (NaOH to provide the oxime 4 from regioselective modification of the carbonyl C-1 with 91% yield. The regioselectivity of the reaction can be explained by analyzing the different resonance structures which can be seen that the carbonyl C-4 is less electrophilic than C-1. In this work was also obtained the oxime 5, 6 and 7 from lapachol, αlpha and β-lapachone, respectively, in yields of 64-85%. The oximes of αlpha and β-norlapachone, 8 and 9 are in obtention. All the products were analyzed by IR and NMR, and were observed that oximes of lapachol and norlapachol are isolated as E/Z mixtures. Two-dimensional NOE-type experiments of the corresponding acylated derivative will be made to help identify the proportion of the mixture.

A comprehensive evaluation of the efficacy of leading oxime therapies in guinea pigs exposed to organophosphorus chemical warfare agents or pesticides

Energy Technology Data Exchange (ETDEWEB)

Wilhelm, Christina M., E-mail: wilhelmc@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Snider, Thomas H., E-mail: snidert@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Babin, Michael C., E-mail: babinm@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Jett, David A., E-mail: jettd@ninds.nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States); Platoff, Gennady E., E-mail: platoffg@niaid.nih.gov [National Institutes of Health/National Institute of Allergy and Infectious Diseases, Bethesda, MD 20892 (United States); Yeung, David T., E-mail: dy70v@nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States)

2014-12-15

The currently fielded pre-hospital therapeutic regimen for the treatment of organophosphorus (OP) poisoning in the United States (U.S.) is the administration of atropine in combination with an oxime antidote (2-PAM Cl) to reactivate inhibited acetylcholinesterase (AChE). Depending on clinical symptoms, an anticonvulsant, e.g., diazepam, may also be administered. Unfortunately, 2-PAM Cl does not offer sufficient protection across the range of OP threat agents, and there is some question as to whether it is the most effective oxime compound available. The objective of the present study is to identify an oxime antidote, under standardized and comparable conditions, that offers protection at the FDA approved human equivalent dose (HED) of 2-PAM Cl against tabun (GA), sarin (GB), soman (GD), cyclosarin (GF), and VX, and the pesticides paraoxon, chlorpyrifos oxon, and phorate oxon. Male Hartley guinea pigs were subcutaneously challenged with a lethal level of OP and treated at approximately 1 min post challenge with atropine followed by equimolar oxime therapy (2-PAM Cl, HI-6 DMS, obidoxime Cl{sub 2}, TMB-4, MMB4-DMS, HLö-7 DMS, MINA, and RS194B) or therapeutic-index (TI) level therapy (HI-6 DMS, MMB4-DMS, MINA, and RS194B). Clinical signs of toxicity were observed for 24 h post challenge and blood cholinesterase [AChE and butyrylcholinesterase (BChE)] activity was analyzed utilizing a modified Ellman's method. When the oxime is standardized against the HED of 2-PAM Cl for guinea pigs, the evidence from clinical observations, lethality, quality of life (QOL) scores, and cholinesterase reactivation rates across all OPs indicated that MMB4 DMS and HLö-7 DMS were the two most consistently efficacious oximes. - Highlights: • First comprehensive evaluation of leading AChE oxime reactivators • All oximes are compared against current U.S. therapy 2-PAM Cl. • Relative therapeutic oxime efficacies against OP CWNA and pesticides • Contribution to more effective

Efficacy of the Tertiary Oxime Monoisonitrosoacetone (MINA) Against Lethal Sarin Intoxication in the Guinea Pig

Science.gov (United States)

2007-10-01

Sarin 5a. CONTRACT NUMBER Intoxication in the Guinea Pig 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Koplovitz, I and...efficacy of MINA as a treatment for lethal sarin (GB) intoxication in guinea pigs . Male animals were challenged subcutaneously (s.c.) with 2 LD50s...oximes that are readily able to enter the brain. 15. SUBJECT TERMS oximes, brain, sarin, reactivation, nerve agents, guinea pigs 16. SECURITY

t-3-Benzyl-r-2,c-6-diphenylpiperidin-4-one oxime

Directory of Open Access Journals (Sweden)

R. Arulraj

2016-12-01

Full Text Available In the title compound, C24H24N2O [systematic name: (E-3-benzyl-2,6-diphenylpiperidin-4-one oxime], the piperidine ring adopts a slightly distorted chair conformation and the phenyl rings and the benzyl group substituents are attached equatorially. The oxime group makes a dihedral angle of 42.88 (12° with the piperidine ring. The dihedral angle between the phenyl rings is 71.96 (8°. The benzyl ring makes dihedral angles of 63.01 (8 and 59.35 (8° with the two phenyl rings. In the crystal, molecules are linked by O—H...N hydrogen bonds, forming C(7 chains along the c axis. The chains are linked by C—H...π interactions, forming slabs lying parallel to the bc plane.

Binding of Reactive Organophosphate by Oximes via Hydrogen Bond

Indian Academy of Sciences (India)

Giuseppe Trusso

Stoichiometries of the complexes were investigated by the Job plot method using spectrophotometric measurements. The samples were prepared by mixing equimolecular stock solutions (3.7 x 10. -3. M) in dry CH3CN of the appropriate oxime and DMMP to cover the whole range of molar fractions keeping constant the total ...

Theoretical NMR and conformational analysis of solvated oximes for organophosphates-inhibited acetylcholinesterase reactivation

Science.gov (United States)

da Silva, Jorge Alberto Valle; Modesto-Costa, Lucas; de Koning, Martijn C.; Borges, Itamar; França, Tanos Celmar Costa

2018-01-01

In this work, quaternary and non-quaternary oximes designed to bind at the peripheral site of acetylcholinesterase previously inhibited by organophosphates were investigated theoretically. Some of those oximes have a large number of degrees of freedom, thus requiring an accurate method to obtain molecular geometries. For this reason, the density functional theory (DFT) was employed to refine their molecular geometries after conformational analysis and to compare their 1H and 13C nuclear magnetic resonance (NMR) theoretical signals in gas-phase and in solvent. A good agreement with experimental data was achieved and the same theoretical approach was employed to obtain the geometries in water environment for further studies.

Spectrophotometric determination of pKa's of 1-hydroxybenzotriazole and oxime derivatives in 95% acetonitrile-water

International Nuclear Information System (INIS)

Fathallah, M.F.; Khattab, S.N.

2011-01-01

1-hydroxybenzotriazole derivatives are used with carbodiimide as additives to generate active esters during peptide bond formation. They are also used as additives during the peptide bond formation. Dissociation constants of the 1-hydroxybenzotriazole (HOBt) and its derivatives, 1-hydroxy-6-chloro benzotriazole, 1-hydroxy-6-trifluoro methylbenzotriazole, 1-hydroxy-6-nitrobenzo-triazole were determined spectrophotometrically in 95% acetonitrile-water. In addition, 7-aza-1-hydroxybenzotriazole (7-HOAt) and 4-aza-1-hydroxybenzotriazole (4-HOAt) were also studied. Recently, oxyma was reported as a good replacement for the benzotriazole derivatives. As alcoholic components of active esters, the oximes seem to be good leaving groups. Therefore it was expected, that the strongly acidic and nucleophilic oximes, which possess electron-withdrawing groups in the molecule, are suitable as additives during the peptide bond formation. The dissociation constant of some oximes, such as diethyl 2-(hydroxyimino)malonate, ethyl 2-cyano-2-(hydroxyimino)acetate (oxyma), hydroxycarbonimidoyl dicyanide and N-hydroxypicolinimidoyl cyanide in 95% acetonitrile-water are reported. (author)

Glycoconjugate Oxime Formation Catalyzed at Neutral pH: Mechanistic Insights and Applications of 1,4-Diaminobenzene as a Superior Catalyst for Complex Carbohydrates.

Science.gov (United States)

Østergaard, Mads; Christensen, Niels Johan; Hjuler, Christian T; Jensen, Knud J; Thygesen, Mikkel B

2018-04-18

The reaction of unprotected carbohydrates with aminooxy reagents to provide oximes is a key method for the construction of glycoconjugates. Aniline and derivatives serve as organocatalysts for the formation of oximes from simple aldehydes, and we have previously reported that aniline also catalyzes the formation of oximes from the more complex aldehydes, carbohydrates. Here, we present a comprehensive study of the effect of aniline analogues on the formation of carbohydrate oximes and related glycoconjugates depending on organocatalyst structure, pH, nucleophile, and carbohydrate, covering more than 150 different reaction conditions. The observed superiority of the 1,4-diaminobenzene (PDA) catalyst at neutral pH is rationalized by NMR analyses and DFT studies of reaction intermediates. Carbohydrate oxime formation at pH 7 is demonstrated by the formation of a bioactive glycoconjugate from a labile, decorated octasaccharide originating from exopolysaccharides of the soil bacterium Mesorhizobium loti. This study of glycoconjugate formation includes the first direct comparison of aniline-catalyzed reaction rates and equilibrium constants for different classes of nucleophiles, including primary oxyamines, secondary N-alkyl oxyamines, as well as aryl and arylsulfonyl hydrazides. We identified 1,4-diaminobenzene as a superior catalyst for the construction of oxime-linked glycoconjugates under mild conditions.

Reaction of Non-Symmetric Schiff Base Metallo-Ligand Complexes Possessing an Oxime Function with Ln Ions

Directory of Open Access Journals (Sweden)

Jean-Pierre Costes

2018-03-01

Full Text Available The preparation of non-symmetric Schiff base ligands possessing one oxime function that is associated to a second function such as pyrrole or phenol function is first described. These ligands, which possess inner N4 or N3O coordination sites, allow formation of cationic or neutral non-symmetric CuII or NiII metallo-ligand complexes under their mono- or di-deprotonated forms. In presence of Lanthanide ions the neutral complexes do not coordinate to the LnIII ions, the oxygen atom of the oxime function being only hydrogen-bonded to a water molecule that is linked to the LnIII ion. This surprising behavior allows for the isolation of LnIII ions by non-interacting metal complexes. Reaction of cationic NiII complexes possessing a protonated oxime function with LnIII ions leads to the formation of original and dianionic (Gd(NO352− entities that are well separated from each other. This work highlights the preparation of well isolated mononuclear LnIII entities into a matrix of diamagnetic metal complexes. These new complexes complete our previous work dealing with the complexing ability of the oxime function toward Lanthanide ions. It could open the way to the synthesis of new entities with interesting properties, such as single-ion magnets for example.

Synthesis and antimicrobial activities of new oxime carbamates of 3 ...

Indian Academy of Sciences (India)

Abstract. S-alkylation of 3-aryl-2-thioquinazolin-4(3H)-one (1) with chloroacetone gave 2-(propanonyl thio)-3-arylquinazol-4(3H)ones (2). Further, the treatment of compound (2) with hydroxylamine hydrochloride gave the corresponding oximes (3) which on reaction with phenyl isocyanate in THF yielded corresponding.

Diprotonated hydrazones and oximes as reactive intermediates in electrochemical reductions

Czech Academy of Sciences Publication Activity Database

Baymak, M. S.; Celik, H.; Ludvík, Jiří; Lund, H.; Zuman, P.

2004-01-01

Roč. 45, č. 26 (2004), s. 5113-5115 ISSN 0040-4039 R&D Projects: GA ČR GA203/01/1093; GA AV ČR IAA4040304 Institutional research plan: CEZ:AV0Z4040901 Keywords : hydrazones * oximes * diprotonation Subject RIV: CG - Electrochemistry Impact factor: 2.484, year: 2004

Selective Tandem Synthesis of Oximes from Benzylic Alcohols Catalyzed with 2, 3-Dichloro-5, 6-dicyanobenzoquinone

Energy Technology Data Exchange (ETDEWEB)

Aghapour, Ghasem; Mohamadian, Samaneh [Damghan University, Damghan (Iran, Islamic Republic of)

2012-04-15

In spite of many reports in the literature concerning with oxidation of benzylic alcohols to carbonyl compounds with 2,3-dichloro-5,6-dicyanobenzoquinone (DDQ) in stoichiometric amounts or even more, we surprisingly found that benzylic alcohols are directly oxidized to oximes using a catalytic amount of DDQ in the presence of hydroxylamine hydrochloride under solvent-free conditions. The present tandem catalytic method can be efficiently used for preparation of oximes in the presence of some other functional groups with excellent chemoselectivity

Eco-friendly synthesis, physicochemical studies, biological assay and molecular docking of steroidal oxime-ethers

Science.gov (United States)

Alam, Mahboob; Lee, Dong-Ung

2015-01-01

The aim of this study was to report the synthesis of biologically active compounds; 7-(2′-aminoethoxyimino)-cholest-5-ene (4), a steroidal oxime-ether and its derivatives (5, 6) via a facile microwave assisted solvent free reaction methodology. This new synthetic, eco-friendly, sustainable protocol resulted in a remarkable improvement in the synthetic efficiency (85-93 % yield) and high purity using basic alumina. The synthesized compounds were screened for their antibacterial against six bacterial strains by disc diffusion method and antioxidant potential by DPPH assay. The binding capabilities of a compound 6 exhibiting good antibacterial potential were assessed on the basis of molecular docking studies and four types of three-dimensional molecular field descriptors. Moreover the structure-antimicrobial activity relationships were studied using some physicochemical and quantum-chemical parameters with GAMESS interface as well as WebMO Job Manager by using the basic level of theory. Hence, this synthetic approach is believed to provide a better scope for the synthesis of steroidal oxime-ether analogues and will be a more practical alternative to the presently existing procedures. Moreover, detailed in silico docking studies suggested the plausible mechanism of steroidal oxime-ethers as effective antimicrobial agents. PMID:27330525

Insights into the mechanism and catalysis of oxime coupling chemistry at physiological pH.

Science.gov (United States)

Wang, Shujiang; Gurav, Deepanjali; Oommen, Oommen P; Varghese, Oommen P

2015-04-07

The dynamic covalent-coupling reaction involving α-effect nucleophiles has revolutionized bioconjugation approaches, due to its ease and high efficiency. Key to its success is the discovery of aniline as a nucleophilic catalyst, which made this reaction feasible under physiological conditions. Aniline however, is not so effective for keto substrates. Here, we investigate the mechanism of aniline activation in the oxime reaction with aldehyde and keto substrates. We also present carboxylates as activating agents that can promote the oxime reaction with both aldehyde and keto substrates at physiological pH. This rate enhancement circumvents the influence of α-effect by forming H-bonds with the rate-limiting intermediate, which drives the reaction to completion. The combination of aniline and carboxylates had a synergistic effect, resulting in a ∼14-31-fold increase in reaction rate at pD 7.4 with keto substrates. The biocompatibility and efficiency of carboxylate as an activating agent is demonstrated by performing cell-surface oxime labeling at physiological pH using acetate, which showed promising results that were comparable with aniline. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Efficient Conversion of Oximes to the Corresponding Carbonyl Compounds with Tetrabutylammonium Chromate under Aprotic Conditions

International Nuclear Information System (INIS)

Pourali, Ali Reza; Goli, Arezou

2006-01-01

The solubility in several solvents, mildness, simple work-up and absence of side reactions provide advantages of using TBAC in deoximation reactions. This is an efficient and selective method for homogeneous deoximation of structurally different compounds under the moderately acidic and aprotic conditions in high yields. Regeneration of ketones and aldehydes from their oximes has assumed added importance since the discovery of the Barton reaction in which oximes are produced at non-activated hydrocarbon sites. Also, their synthesis from non-carbonyl compounds, such as by nitrosation of an active methylene group, nitrosation of an α-halo carbonyl compound and condensation of a nitro-alkene with an aldehyde provides a valid alternative pathway to carbonyl compounds. Therefore, there has been a continued interest in the effective regeneration of carbonyl compounds from the corresponding oximes especially under mild conditions. Oxidative and reductive methods have been found to show advantages over the classical hydrolytic methods. Although many oxidizing agents have been used, only a limited number of methods are efficient because of the low solubility of these metallic reagents in most organic solvents

Differential pulse polarographic determination of molybdenum (VI) in phosphoric medium by benzoin alpha oxime

International Nuclear Information System (INIS)

Chergouche, S.

1992-02-01

The extraction of Molybdenum (VI) using both 4-Methylpentane-2-one (hexone) and chloroform dissolved Benzoin-alpha-oxime has been investigated in order to develop a simple and sensitive polarographic method allowing the analysis of Molybdenum (VI) contained in industrial phosphoric acid produced in ANNABA (Eastern Algeria). The investigation takes into account various parameters such as: The stirring time, solvent rate, the number of stages ... as well as the organic phase conditioning during the polarographic analysis

Efficacy of two anthelmintic treatments, spinosad/milbemycin oxime and ivermectin/praziquantel in dogs with natural Toxocara spp. infection.

Science.gov (United States)

Heredia Cardenas, Rafael; Romero Núñez, Camilo; Miranda Contreras, Laura

2017-11-30

Toxocara canis is one of the most important zoonotic parasites of dogs. The aim of the present study was to compare the efficacy of spinosad/milbemycin oxime and ivermectin/praziquantel in dogs naturally infected with Toxocara spp. We studied 200 dogs with a positive diagnosis of Toxocara spp. Through coproparasitoscopic analysis, two study groups of 100 dogs each were assigned: spinosad/milbemycin oxime at a dose of 30-60mg/kg and 0.75-1.0mg/kg, respectively, or ivermectin/praziquantel administered at a dose of 0.2mg/kg and 5mg/kg, respectively. Both groups received a single dose. Three stool samples, one at day 0 before treatment, and at 14 and 28days post-treatment were examined using concentration-flotation techniques. In both treatments, the number of Toxocara spp. eggs decreased; with spinosad/milbemycin oxime treatment, eggs decreased by 87% at 14days (P=0.008) and 94% at 28days after treatment, compared with 71% at day 14 and 88% at day 28 in dogs medicated with ivermectin/praziquantel. The spinosad/milbemycin oxime treated group showed a greater decrease in the number of Toxocara spp. positive dogs compared to the group receiving ivermectin/praziquantel. Copyright © 2017 Elsevier B.V. All rights reserved.

The Efficacy Of Milbemycin Oxime In The Treatment Of Naturally Acquired Infestations Of Sarcoptes Scabiei On Dogs

OpenAIRE

Xu Q; Guo S; Li J; Wang Y; Shen Z; Yanping Wang; Ying Z; Zhang Z; Fu S; Ma L; Yang L; Wang J; Duanhui Ma

2013-01-01

Milbemycin oxime tablets were evaluated for efficacy against sarcoptic mange mites in naturally infested dogs. Sixty-five dogs were allocated to two groups and were housed individually. Fifty of the dogs were treated orally with milbemycin oxime at the proposed dose. The other fifteen were treated orally with vehicle. Study day 0 was defined as the first day of treatment administration. Dogs were treated on days 0, 7 and 14, and efficacy was assessed by counting viable mites recovered from sk...

Kinetic analysis of interactions of paraoxon and oximes with human, Rhesus monkey, swine, rabbit, rat and guinea pig acetylcholinesterase.

Science.gov (United States)

Worek, Franz; Aurbek, Nadine; Wille, Timo; Eyer, Peter; Thiermann, Horst

2011-01-15

Previous in vitro studies showed marked species differences in the reactivating efficiency of oximes between human and animal acetylcholinesterase (AChE) inhibited by organophosphorus (OP) nerve agents. These findings provoked the present in vitro study which was designed to determine the inhibition, aging, spontaneous and oxime-induced reactivation kinetics of the pesticide paraoxon, serving as a model compound for diethyl-OP, and the oximes obidoxime, pralidoxime, HI 6 and MMB-4 with human, Rhesus monkey, swine, rabbit, rat and guinea pig erythrocyte AChE. Comparable results were obtained with human and monkey AChE. Differences between human, swine, rabbit, rat and guinea pig AChE were determined for the inhibition and reactivation kinetics. A six-fold difference of the inhibitory potency of paraoxon with human and guinea pig AChE was recorded while only moderate differences of the reactivation constants between human and animal AChE were determined. Obidoxime was by far the most effective reactivator with all tested species. Only minor species differences were found for the aging and spontaneous reactivation kinetics. The results of the present study underline the necessity to determine the inhibition, aging and reactivation kinetics in vitro as a basis for the development of meaningful therapeutic animal models, for the proper assessment of in vivo animal data and for the extrapolation of animal data to humans. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

Successful oxime therapy one hour after soman intoxication in the rat

NARCIS (Netherlands)

Wolthuis, O.L.; Kepner, L.A.

1978-01-01

The bisquarternary mono-oxime HI-6, and to a lesser extent HS-6, caused functional recovery of neuromuscular transmission in vivo and in vitro when given 60 min after soman, i.e. when the soman-cholinesterase (AChE) complex is said to be fully 'aged'. Atropinised rats, with the tracheas intubated,

Refinement of Structural Leads for Centrally Acting Oxime Reactivators of Phosphylated Cholinesterases*

Science.gov (United States)

Radić, Zoran; Sit, Rakesh K.; Kovarik, Zrinka; Berend, Suzana; Garcia, Edzna; Zhang, Limin; Amitai, Gabriel; Green, Carol; Radić, Božica; Fokin, Valery V.; Sharpless, K. Barry; Taylor, Palmer

2012-01-01

We present a systematic structural optimization of uncharged but ionizable N-substituted 2-hydroxyiminoacetamido alkylamine reactivators of phosphylated human acetylcholinesterase (hAChE) intended to catalyze the hydrolysis of organophosphate (OP)-inhibited hAChE in the CNS. Starting with the initial lead oxime RS41A identified in our earlier study and extending to the azepine analog RS194B, reactivation rates for OP-hAChE conjugates formed by sarin, cyclosarin, VX, paraoxon, and tabun are enhanced severalfold in vitro. To analyze the mechanism of intrinsic reactivation of the OP-AChE conjugate and penetration of the blood-brain barrier, the pH dependence of the oxime and amine ionizing groups of the compounds and their nucleophilic potential were examined by UV-visible spectroscopy, 1H NMR, and oximolysis rates for acetylthiocholine and phosphoester hydrolysis. Oximolysis rates were compared in solution and on AChE conjugates and analyzed in terms of the ionization states for reactivation of the OP-conjugated AChE. In addition, toxicity and pharmacokinetic studies in mice show significantly improved CNS penetration and retention for RS194B when compared with RS41A. The enhanced intrinsic reactivity against the OP-AChE target combined with favorable pharmacokinetic properties resulted in great improvement of antidotal properties of RS194B compared with RS41A and the standard peripherally active oxime, 2-pyridinealdoxime methiodide. Improvement was particularly noticeable when pretreatment of mice with RS194B before OP exposure was combined with RS194B reactivation therapy after the OP insult. PMID:22343626

Studies on the polymerization of acrolein oxime, 13

International Nuclear Information System (INIS)

Ota, Tadatoshi; Mori, Yoshikazu; Tamai, Harumi; Masuda, Seizo; Tanaka, Masami.

1980-01-01

The radiation-induced polymerization of acrolein oxime was carried out at temperatures ranging from room temperature to -78 0 C, and the resulting low molecular products were analyzed by gas chromatography-mass spectrometry. Acetaldoxime, propionaldoxime, propenylhydroxylamines, dioximes etc. were obtained. Initial processes of the polymerization are discussed on the basis of these reaction products. The present work offers further corroborating evidence for the already-described postulation that an anionic mechanism is operative above room temperature, and a cationic mechanism is predominant below -23 0 C. (author)

Catalytic activity of some oxime-based Pd(II-complexes in Suzuki coupling of aryl and heteroaryl bromides in water

Directory of Open Access Journals (Sweden)

Kamal M. Dawood

2017-05-01

Full Text Available The catalytic activity of four Pd(II-complexes of benzoazole-oximes was extensively studied in Suzuki–Miyaura C–C cross coupling reactions in water, as an eco-friendly green solvent, under both thermal heating as well as microwave irradiation conditions. The cross-coupling reactions included different activated and deactivated aryl- or heteroaryl-bromides with several arylboronic acids. The protected oxime-complexes were found to be more efficient than the free ones.

Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

International Nuclear Information System (INIS)

Collange, B.; Wheelock, C.E.; Rault, M.; Mazzia, C.; Capowiez, Y.; Sanchez-Hernandez, J.C.

2010-01-01

Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg -1 chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (≤1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

Energy Technology Data Exchange (ETDEWEB)

Collange, B. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Wheelock, C.E. [Division of Physiological Chemistry II, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, SE 171 77, Stockholm (Sweden); Rault, M.; Mazzia, C. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Capowiez, Y. [INRA, Unite PSH, Site AGROPARC, F-84914 Avignon Cedex 09 (France); Sanchez-Hernandez, J.C., E-mail: juancarlos.sanchez@uclm.e [Laboratory of Ecotoxicology, Faculty of Environmental Science, University of Castilla-La Mancha, Avda. Carlos III s/n, 45071, Toledo (Spain)

2010-06-15

Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg{sup -1} chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (<=1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

Selective and Efficient Solvent Extraction of Copper(II Ions from Chloride Solutions by Oxime Extractants

Directory of Open Access Journals (Sweden)

Zahra Kaboli Tanha

2016-06-01

Full Text Available Oxime extractants 3-tert-butyl-2-hydroxy-5-methyl benzaldehyde oxime (HL1 and 3-tert-butyl-2-hydroxy-5-methoxy benzaldehyde oxime (HL2 were synthesized and characterized by conventional spectroscopic methods. Suitable lipophilic nature of the prepared extractants allowed examining the ability of these molecules for extraction-separation of copper from its mixture with normally associated metal ions by performing competitive extraction experiments of Cu(II, Co(II, Ni(II, Zn(II, Cd(II and Pb(II ions from chloride solutions. Both ligands transfer selectively the copper ions into dichloromethane by a cation exchange mechanism. Conventional log-log analysis and isotherm curves showed that Cu(II ions are extracted as the complexes with 1:2 metal to ligand ratio by both extractants. Verification of the effect of the organic diluent used in the extraction of copper ions by HL1 and HL2 demonstrated that the extraction efficiency varies as: dichloromethane ~ dichloroethane > toluene > xylene > ethylacetate. Time dependency investigation of the extraction processes revealed that the kinetics of the extraction of copper by HL2 is more rapid than that of HL1. The application of the ligands for extraction-separation of copper ions from leach solutions of cobalt and nickel-cadmium filter-cakes of a zinc production plants was evaluated.

Synthesis of Imidazopyridines via Copper-Catalyzed, Formal Aza-[3 + 2] Cycloaddition Reaction of Pyridine Derivatives with α-Diazo Oxime Ethers.

Science.gov (United States)

Park, Sangjune; Kim, Hyunseok; Son, Jeong-Yu; Um, Kyusik; Lee, Sooho; Baek, Yonghyeon; Seo, Boram; Lee, Phil Ho

2017-10-06

The Cu-catalyzed, formal aza-[3 + 2] cycloaddition reaction of pyridine derivatives with α-diazo oxime ethers in trifluoroethanol was used to synthesize imidazopyridines via the release of molecular nitrogen and elimination of alcohol. These methods enabled modular synthesis of a wide range of N-heterobicyclic compounds such as imidazopyridazines, imidazopyrimidines, and imidazopyrazines with an α-imino Cu-carbenoid generated from the α-diazo oxime ethers and copper.

Electrochemical determination of 5-dodecylsalicylaldoxime and 2′-hydroxy-5′-nonylacetophenone oxime in commercial extractants

Directory of Open Access Journals (Sweden)

Elizalde María P.

2017-01-01

Full Text Available A differential pulse voltammetric method using a hanging mercury drop electrode (HMDE was optimized for the determination of 5-dodecylsalicylaldoxime in hydro-alcoholic solutions using factorial and central composite designs. The Taguchi design methodology was used to extend the formerly optimized method to the determination of 2′-hydroxy-5′-nonylacetophenone oxime. The method was successfully applied to quantify 5-dodecylsalicylaldoxime and 2′-hydroxy-5′-nonylacetophenone oxime in samples of commercial extractants over the concentration range 0.05–2.45 and 0.07–0.82 mg L-1, respectively, with detection limits of 0.034 and 0.019 mg L-1, respectively.

SYNTHESIS OF OXIMES WITH THE DOPED POTASSIUM FLUORIDE ANIMAL BONE MEAL AS A CATALYST

Directory of Open Access Journals (Sweden)

M. AIT TALEB

2017-12-01

Full Text Available The potassium fluoride doped Animal Bone Meal (KF/ABM was prepared and characterized using several techniques to identify the structural properties. After, it has been used as a new and eco-friendly catalyst for the preparation of from aldehydes and ketones oximes under solvent-free conditions. It is clearly shown that this reaction (using this catalyst can lead to the corresponding oximes in good yields (80 % to excellent yields (96 %. In the case of dissymmetric aldehydes and ketones, this catalyst can lead to a mixture of Z- and E- isomers (Z/E = 86/14–90/10. The remarkable advantages of this catalyst are high conversion, short reaction times, cleaner reaction profiles, reusability up to 8 times without significant loss of activity, and reduction in catalyst toxicity.

Synthesis and Bioactivities of Novel Pyrazole Oxime Derivatives Containing a 5-Trifluoromethylpyridyl Moiety

Directory of Open Access Journals (Sweden)

Hong Dai

2016-02-01

Full Text Available In this study, in order to find novel biologically active pyrazole oxime compounds, a series of pyrazole oxime derivatives containing a 5-trifluoromethylpyridyl moiety were synthesized. Preliminary bioassays indicated that most title compounds were found to display good to excellent acaricidal activity against Tetranychus cinnabarinus at a concentration of 200 μg/mL, and some designed compounds still showed excellent acaricidal activity against Tetranychus cinnabarinus at the concentration of 10 μg/mL, especially since the inhibition rates of compounds 8e, 8f, 8l, 8m, 8n, 8p, and 8q were all 100.00%. Interestingly, some target compounds exhibited moderate to good insecticidal activities against Plutella xylostella and Aphis craccivora at a concentration of 200 μg/mL; furthermore, compounds 8e and 8l possessed outstanding insecticidal activities against Plutella xylostella under the concentration of 50 μg/mL.

The effect of the conditions of amidoximation on the adsorptive characteristics of amide oxime resin for uranium recovery from seawater

International Nuclear Information System (INIS)

Hori, Takahiro; Furusaki, Shintaro; Sugo, Takanobu; Okamoto, Jiro.

1987-01-01

A hollow-fiber type chelating resin containing the amide oxime group for the recovery of uranium from seawater was synthesized by radiation-induced graft polymerization. The effect of the conditions of amidoximation on the amount and/or distribution of the functional groups and on the durability to the recycle adsorption was investigated. The amount of adsorbed copper on the resin increased with the reaction time of the amidoximation, but that of adsorbed hydrochloric acid gradually decreased after reaching the maximum. From the results of elemental analysis, infrared adsorption spectra, visible light and ultraviolet adsorption spectra and the observation of coloration of the resin by alkaline treatment, the amidoximation was found to be a consecutive reaction. The results also suggested that, after the introduction of the amide oxime group, the acidic amide, hydroxamic acid and/or cyclic functional groups were formed. From the measurement of the distribution of adsorbed copper by X-ray microanalyzer, it was confirmed that the amidoximation occured uniformly across the resin. An experiment was carried out on the recycle adsorption of the amide oxime resin using natural seawater, and the sufficient durability was recognized for the case that the resin was taken out from the hydroxylamine solution at the time when the amount of adsorbed hydrochloric acid reached the maximum. In this case the resin contained the largest amount of the amide oxime group and least amount of the by-products formed from the secondary reactions. (author)

Innovative approach for the electrochemical detection of non-electroactive organophosphorus pesticides using oxime as electroactive probe

International Nuclear Information System (INIS)

Dong, Jing; Hou, Juying; Jiang, Jianxia; Ai, Shiyun

2015-01-01

Highlights: • Novel approach for electrochemical detection of non-electroactive OPs was proposed. • PAM was used as electroactive probe for the first time. • The detection system displayed high sensitivity and promptness. • The developed sensor was used in real samples with satisfactory results. - Abstract: An innovative approach for sensitive and simple electrochemical detection of non-electroactive organophosphorus pesticides (OPs) was described in this report. The novel strategy emphasized the fabrication of an oxime-based sensor via attaching pralidoxime (PAM) on graphene quantum dots (GQDs) modified glassy carbon electrode. The introduction of GQDs significantly increased the effective electrode area, and then enlarged the immobilization quantity of PAM. Thus, the oxidation current of PAM was obviously increased. Relying on the nucleophilic substitution reaction between oxime and OPs, fenthion was detected using PAM as the electroactive probe. Under optimum conditions, the difference of oxidation current of PAM was proportional to fenthion concentration over the range from 1.0 × 10 −11 M to 5.0 × 10 −7 M with a detection limit of 6.8 × 10 −12 M (S/N = 3). Moreover, the favorable detection performance in water and soil samples heralded the promising applications in on-site OPs detection

K3[Fe(CN)6].3H2O supported on silica gel: An efficient and selective ...

Indian Academy of Sciences (India)

Department of Chemistry, Payame Noor University, 19395-4697 Tehran, I. R. of IRAN e-mail: ... K3[Fe(CN)6].3H2O, Silica gel; oxime; aldehyde; ketone. 1. Introduction .... ysis, hydrogenation, etc., using organic and inorganic reagents. Besides ...

Separation of fission 99Mo by alpha-benzoin oxime precipitation in nitric medium

International Nuclear Information System (INIS)

Yamaura, Mitiko; Freitas, Antonio A.; Egute, Nayara dos S.; Camilo, Ruth L.; Araujo, Izilda C.; Forbicini, Christina A.L.G. de O.

2011-01-01

Since 2009, the production of generators 99 Mo/ 99 mTc suffers a crisis of global supply due to technical problems of the two reactors which account for 64% of world production of fission 99 Mo. By the project of Brazilian Multipurpose Reactor (RMB), the Brazilian government invests in the construction of the first multipurpose reactor suitable for the domestic production of 99 Mo from LEU targets in order to supply of fission 99 Mo in the coming decades. The IPEN started the research of the technology and production of fission 99 Mo from acid and alkaline dissolutions of Low Enriched Uranium (LEU) targets as well as other used radioisotopes in nuclear medicine. This work is part of the research of the technology of the fission 99 Mo from acid dissolution of the LEU targets that is being developed at the IPEN. In this study the separation of the Mo by precipitation with alpha-benzoin oxime in nitric medium and the recovery by dissolution were investigated. The precipitation studies were performed by batch assays with nitric solution of Mo(VI), containing 99 Mo tracer, and uranyl ions. Influence of concentration of permanganate from 0.03 to 2.5%, dissolution temperature at 30 deg C and 150 deg C and the uranium concentration from 74 g.L -1 to 115 g.L -1 was studied. Results indicated that the precipitation of Mo with alpha-benzoin oxime from nitric medium is highly efficient, and its recovery by dissolution with basic solution of H 2 O 2 gave a high yield. (author)

Synthesis and 5α-Reductase Inhibitory Activity of C21 Steroids Having 1,4-diene or 4,6-diene 20-ones and 4-Azasteroid 20-Oximes

Directory of Open Access Journals (Sweden)

Eunsook Ma

2011-12-01

Full Text Available The synthesis and evaluation of 5α-reductase inhibitory activity of some 4-azasteroid-20-ones and 20-oximes and 3β-hydroxy-, 3β-acetoxy-, or epoxy-substituted C21 steroidal 20-ones and 20-oximes having double bonds in the A and/or B ring are described. Inhibitory activity of synthesized compounds was assessed using 5α-reductase enzyme and [1,2,6,7-3H]testosterone as substrate. All synthesized compounds were less active than finasteride (IC50: 1.2 nM. Three 4-azasteroid-2-oximes (compounds 4, 6 and 8 showed good inhibitory activity (IC50: 26, 10 and 11 nM and were more active than corresponding 4-azasteroid 20-ones (compounds 3, 5 and 7. 3β-Hydroxy-, 3β-acetoxy- and 1α,2α-, 5α,6α- or 6α,7α-epoxysteroid-20-one and -20-oxime derivatives having double bonds in the A and/or B ring showed no inhibition of 5α-reductase enzyme.

In Vitro Ability of Currently Available Oximes to Reactivate Organophosphate Pesticide-Inhibited Human Acetylcholinesterase and Butyrylcholinesterase

Directory of Open Access Journals (Sweden)

Kamil Musilek

2011-03-01

Full Text Available We have in vitro tested the ability of common, commercially available, cholinesterase reactivators (pralidoxime, obidoxime, methoxime, trimedoxime and HI-6 to reactivate human acetylcholinesterase (AChE, inhibited by five structurally different organophosphate pesticides and inhibitors (paraoxon, dichlorvos, DFP, leptophos-oxon and methamidophos. We also tested reactivation of human butyrylcholinesterase (BChE with the aim of finding a potent oxime, suitable to serve as a “pseudocatalytic” bioscavenger in combination with this enzyme. Such a combination could allow an increase of prophylactic and therapeutic efficacy of the administered enzyme. According to our results, the best broad-spectrum AChE reactivators were trimedoxime and obidoxime in the case of paraoxon, leptophos-oxon, and methamidophos-inhibited AChE. Methamidophos and leptophos-oxon were quite easily reactivatable by all tested reactivators. In the case of methamidophos-inhibited AChE, the lower oxime concentration (10−5 M had higher reactivation ability than the 10−4 M concentration. Therefore, we evaluated the reactivation ability of obidoxime in a concentration range of 10−3–10−7 M. The reactivation of methamidophos-inhibited AChE with different obidoxime concentrations resulted in a bell shaped curve with maximum reactivation at 10−5 M. In the case of BChE, no reactivator exceeded 15% reactivation ability and therefore none of the oximes can be recommended as a candidate for “pseudocatalytic” bioscavengers with BChE.

The Design, Synthesis and Screening of Potential Pyridinium Oxime Prodrugs

Science.gov (United States)

1984-02-01

Our intent is to take advantage of this trapping mechanism using nucleophiles (X) such as SCN, SO3H, I, Br and OCN, which we hope will be as labile...pH 3.5-10.5. The advantage of the system stemmed from the fact that each pyridinium oxime regenerator has a discrete -max which is pH dependent. 2-PAM...with matching 3 cm guard columns. Normal phase analysis was performed "on an Alltech 0.5 x 25 cm silica gel 10 p column with 3 cm guard column and

Cp*Co(III) Catalyzed Site-Selective C-H Activation of Unsymmetrical O-Acyl Oximes: Synthesis of Multisubstituted Isoquinolines from Terminal and Internal Alkynes.

Science.gov (United States)

Sun, Bo; Yoshino, Tatsuhiko; Kanai, Motomu; Matsunaga, Shigeki

2015-10-26

The synthesis of isoquinolines by site-selective C-H activation of O-acyl oximes with a Cp*Co(III) catalyst is described. In the presence of this catalyst, the C-H activation of various unsymmetrically substituted O-acyl oximes selectively occurred at the sterically less hindered site, and reactions with terminal as well as internal alkynes afforded the corresponding products in up to 98 % yield. Whereas the reactions catalyzed by the Cp*Co(III) system proceeded with high site selectivity (15:1 to 20:1), use of the corresponding Cp*Rh(III) catalysts led to low selectivities and/or yields when unsymmetrical O-acyl oximes and terminal alkynes were used. Deuterium labeling studies indicate a clear difference in the site selectivity of the C-H activation step under Cp*Co(III) and Cp*Rh(III) catalysis. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Oxidation of primary amines to oximes with molecular oxygen using 1,1-diphenyl-2-picrylhydrazyl and WO3/Al2O3 as catalysts.

Science.gov (United States)

Suzuki, Ken; Watanabe, Tomonari; Murahashi, Shun-Ichi

2013-03-15

The oxidative transformation of primary amines to their corresponding oximes proceeds with high efficiency under molecular oxygen diluted with molecular nitrogen (O2/N2 = 7/93 v/v, 5 MPa) in the presence of the catalysts 1,1-diphenyl-2-picrylhydrazyl (DPPH) and tungusten oxide/alumina (WO3/Al2O3). The method is environmentally benign, because the reaction requires only molecular oxygen as the terminal oxidant and gives water as a side product. Various alicyclic amines and aliphatic amines can be converted to their corresponding oximes in excellent yields. It is noteworthy that the oxidative transformation of primary amines proceeds chemoselectively in the presence of other functional groups. The key step of the present oxidation is a fast electron transfer from the primary amine to DPPH followed by proton transfer to give the α-aminoalkyl radical intermediate, which undergoes reaction with molecular oxygen and hydrogen abstraction to give α-aminoalkyl hydroperoxide. Subsequent reaction of the peroxide with WO3/Al2O3 gives oximes. The aerobic oxidation of secondary amines gives the corresponding nitrones. Aerobic oxidative transformation of cyclohexylamines to cyclohexanone oximes is important as a method for industrial production of ε-caprolactam, a raw material for Nylon 6.

Efficient Construction of Energetic Materials via Nonmetallic Catalytic Carbon-Carbon Cleavage/Oxime-Release-Coupling Reactions.

Science.gov (United States)

Zhao, Gang; He, Chunlin; Yin, Ping; Imler, Gregory H; Parrish, Damon A; Shreeve, Jean'ne M

2018-03-14

The exploitation of C-C activation to facilitate chemical reactions is well-known in organic chemistry. Traditional strategies in homogeneous media rely upon catalyst-activated or metal-mediated C-C bonds leading to the design of new processes for applications in organic chemistry. However, activation of a C-C bond, compared with C-H bond activation, is a more challenging process and an underdeveloped area because thermodynamics does not favor insertion into a C-C bond in solution. Carbon-carbon bond cleavage through loss of an oxime moiety has not been reported. In this paper, a new observation of self-coupling via C-C bond cleavage with concomitant loss of oxime in the absence of metals (either metal-complex mediation or catalysis) results in dihydroxylammonium 5,5-bistetrazole-1,10-diolate (TKX-50) as well as N, N'-([3,3'-bi(1,2,4-oxadiazole)]-5,5'-diyl)dinitramine, a potential candidate for a new generation of energetic materials.

Energetics of Ortho-7 (oxime drug translocation through the active-site gorge of tabun conjugated acetylcholinesterase.

Directory of Open Access Journals (Sweden)

Vivek Sinha

Full Text Available Oxime drugs translocate through the 20 Å active-site gorge of acetylcholinesterase in order to liberate the enzyme from organophosphorus compounds' (such as tabun conjugation. Here we report bidirectional steered molecular dynamics simulations of oxime drug (Ortho-7 translocation through the gorge of tabun intoxicated enzyme, in which time dependent external forces accelerate the translocation event. The simulations reveal the participation of drug-enzyme hydrogen bonding, hydrophobic interactions and water bridges between them. Employing nonequilibrium theorems that recovers the free energy from irreversible work done, we reconstruct potential of mean force along the translocation pathway such that the desired quantity represents an unperturbed system. The potential locates the binding sites and barriers for the drug to translocate inside the gorge. Configurational entropic contribution of the protein-drug binding entity and the role of solvent translational mobility in the binding energetics is further assessed.

Possible Deformed States in 115In and 117ln

International Nuclear Information System (INIS)

Baecklin, A.; Fogelberg, B.; Malmskog, S.G.

1967-01-01

Levels and transitions in 115 In and 117 In have been studied from the beta decay of 2.3-day 115g Cd and 2.5-h 117g Cd. Using a Ge(Li) detector and a double focussing beta spectrometer energies, intensities, conversion coefficients and multipolarities were obtained for the following transitions (energies in keV and multipolarities are given): 115 In: 35.63 (97.0 % M1 + 3.0 % E2), 231.47 (E1), 260.80 (M1), 267, 336. 23 (M4 + 117 In: 71.0, 89.80 (E2 + 115 In and for 3 levels in 117 In. Energies, spins, parities and half lives are given for the following levels: In: 597.03, 3/2 - ; 828.39, 3/2 + , 5.4 ns; 863.95, l/2 + or 3/2 + , 1.1 ns. 117 In: 588.59, 3/2 - ; 0.20 ns; 659.56, 3/2 + , 58.7 ns; 749.37, 1/2 + or 3/2 + , 4.3 ns. Reduced transition probabilities are given for several transitions in both nuclei. The E2 transition rates between the two excited positive parity states in both nuclei were found to be about 100 s. p. u. indicating a possible deformation of these states. The energy spacing and transition rates between these states can be well accounted for within the Nilsson model assuming the states to form a K = 1/2 + rotational band. A deformation δ of about 0.20 is obtained for both nuclei

Cryogenics around the 11.7 T MRI Iseult magnet

International Nuclear Information System (INIS)

Bredy, P.; Belorgey, J.; Chesny, P.; Hervieu, B.; Lannou, H.; Juster, F. P.; Abdel-Maksoud, W.; Mayri, C.; Molinie, F.; Payn, A.

2010-01-01

As part of the Iseult/Inumac project, the development of a 500 MHz whole body MRI magnet has been launched in 2006. This magnet with a central field of 11.7 T in a warm bore of 900 mm has outstanding specifications with respect to usual MRI systems. The normal operation of this magnet will need the construction of a cryo-plant able to cool its superconducting coils with pressurized HeII 1.8 K. A helium liquefier and 4.2 K/1.8 K refrigeration stage will be installed in the vicinity of the magnet. Before that, a magnet test facility (Seht-'station d'essais huit teslas') installed at CEA/Saclay has been built in order to validate technical and control-process aspects during all operating phases: cooling down, nominal operation, quench event. The cryogenic system has been designed according to the principles foreseen for Iseult. The facility integration, commissioning, and operating results will be presented. The design of the final cryogenic installation for Iseult magnet, adapted to the facility experiences, is previously described. (authors)

HSPC117 deficiency in cloned embryos causes placental abnormality and fetal death

International Nuclear Information System (INIS)

Wang, Yingying; Hai, Tang; Liu, Zichuan; Zhou, Shuya; Lv, Zhuo; Ding, Chenhui; Liu, Lei; Niu, Yuyu; Zhao, Xiaoyang; Tong, Man; Wang, Liu; Jouneau, Alice; Zhang, Xun; Ji, Weizhi; Zhou, Qi

2010-01-01

Somatic cell nuclear transfer (SCNT) has been successfully used in many species to produce live cloned offspring, albeit with low efficiency. The low frequency of successful development has usually been ascribed to incomplete or inappropriate reprogramming of the transferred nuclear genome. Elucidating the genetic differences between normal fertilized and cloned embryos is key to understand the low efficiency of SCNT. Here, we show that expression of HSPC117, which encodes a hypothetical protein of unknown function, was absent or very low in cloned mouse blastocysts. To investigate the role of HSPC117 in embryo development, we knocked-down this gene in normal fertilized embryos using RNA interference. We assessed the post-implantation survival of HSPC117 knock-down embryos at 3 stages: E9 (prior to placenta formation); E12 (after the placenta was fully functional) and E19 (post-natal). Our results show that, although siRNA-treated in vivo fertilized/produced (IVP) embryos could develop to the blastocyst stage and implanted without any difference from control embryos, the knock-down embryos showed substantial fetal death, accompanied by placental blood clotting, at E12. Furthermore, comparison of HSPC117 expression in placentas of nuclear transfer (NT), intracytoplasmic sperm injection (ICSI) and IVP embryos confirmed that HSPC117 deficiency correlates well with failures in embryo development: all NT embryos with a fetus, as well as IVP and ICSI embryos, had normal placental HSPC117 expression while those NT embryos showing reduced or no expression of HSPC117 failed to form a fetus. In conclusion, we show that HSPC117 is an important gene for post-implantation development of embryos, and that HSPC117 deficiency leads to fetal abnormalities after implantation, especially following placental formation. We suggest that defects in HSPC117 expression may be an important contributing factor to loss of cloned NT embryos in vivo.

Synthesis, Crystal Structure, and Magnetic Properties of Giant Unit Cell Intermetallics R117Co52+δSn112+γ (R = Y, La, Pr, Nd, Ho

Directory of Open Access Journals (Sweden)

Ping Chai

2016-12-01

Full Text Available Ternary intermetallics R117Co52+δSn112+γ (R = Y, La, Pr, Nd, and Ho have been prepared by arc-melting followed by annealing at 800 °C. All the compounds belong to the Tb117Fe52Ge112 structure type (space group Fm 3 ¯ m characterized by a complex giant cubic unit cell with a ~ 30 Å. The single-crystal structure determination of Y- and La-containing compounds reveals a significant structural disorder. A comparison of these and earlier reported crystal structures of R117Co52+δSn112+γ suggests that more extensive disorder occurs for structures that contain larger lanthanide atoms. This observation can be explained by the need to maintain optimal bonding interactions as the size of the unit cell increases. Y117Co56Sn115 exhibits weak paramagnetism due to the Co sublattice and does not show magnetic ordering in the 1.8–300 K range. Ho117Co55Sn108 shows ferromagnetic ordering at 10.6 K. Both Pr117Co54Sn112 and Nd117Co54Sn111 exhibit antiferromagnetic ordering at 17 K and 24.7 K, respectively, followed by a spin reorientation transition at lower temperature.

Effect of interstitial nitrogen on magnetism and entropy change of LaFe11.7Si1.3 compound

International Nuclear Information System (INIS)

Balli, M.; Rosca, M.; Fruchart, D.; Gignoux, D.

2009-01-01

Crystal structure, magnetism and magnetocaloric properties of LaFe 11.7 Si 1.3 N y (y=0, 1.3) compounds have been studied by X-ray diffraction and magnetic measurements. The LaFe 11.7 Si 1.3 N y compounds present a cubic NaZn 13 -type structure. Insertion of 1.3 nitrogen atoms per LaFe 11.7 Si 1.3 formula increases the lattice parameter and Curie temperature from 11.467 to 11.733 A and from 190 to ∼230 K, respectively. Besides, the absorption of nitrogen drives drastically the magnetic transition from first to second order and accordingly strongly decreases the magnetocaloric effect compared to the parent alloy. Under an external field change of 5 T, the value of isothermal entropy change -ΔS is about 28 and 3.5 J/kg K for LaFe 11.7 Si 1.3 and LaFe 11.7 Si 1.3 N 1.3 , respectively, close to their Curie temperature. However, the relative cooling power RCP(S) of the nitride is about half that of the parent alloy

Therapeutic efficacy of milbemycin oxime/praziquantel oral formulation (Milbemax® against Thelazia callipaeda in naturally infested dogs and cats

Directory of Open Access Journals (Sweden)

Motta Bruna

2012-05-01

of 0.5 mg/kg and 2 mg/k in dogs and cats, respectively, showed a high therapeutic efficacy in curing T. callipaeda infestations. The advantages of an oral application are additionally increased by the large spectrum of activity of praziquantel and milbemycin oxime against Cestodes and Nematodes infesting dogs and cats.

Production and application of Sn-117m

International Nuclear Information System (INIS)

Vucina, J.; Nikolic, N.; Orlic, M.

2005-01-01

For targeted therapy in nuclear medicine, besides the usually used, like 32 P, 89 Sr, 131 I, 186,188 Re, new radioisotopes are intensively investigated. Particular interest is devoted to 117m Sn. It decays by isomeric transition with the emission of low energy conversion electrons and short range. Their potent lethality, due to high LET, particularly when the emitter is located inside the cell, on or near nucleus, is well known. The accompanying gamma rays (Eγ = 159 keV) are also suitable for detection. At present, the specific activity which can be achieved in nuclear reactors is is sufficient for the production of agents for bone palliation. The best results so far were achieved with 117m Sn(IV)-DTPA. It is expected that the use of this radioisotope will increase when a method of its production in the no-carrier form will be developed. In the paper the production of 117m Sn and 117m Sn radiopharmaceuticals is briefly reviewed. (author) [sr

Synthesis of a hollow fiber type porous chelating resin containing the amide oxime group by radiation induced graft polymerization for the uranium recovery

International Nuclear Information System (INIS)

Hori, Takahiro; Saito, Kyoichi; Furusaki, Shintaro; Sugo, Takanobu; Okamoto, Jiro.

1986-01-01

A hollow fiber type porous chelating resin containing amide oxime as a functional group was synthesized and used as an adsorbent for the recovery of uranium. Hollow fiber type porous polyethylene was used as a base polymer. Acrylonitrile was grafted onto it by the radiation-induced graft polymerization. By changing the reaction time, four kinds of graft polymer were obtained. The degree of grafting ranged from 79 % to 127 %. Each resin was soaked in hydroxylamine solution, and the cyano group was converted to amide oxime group. By elemental analysis, the amount of nitrogen introduced on the graft polymer resin in amidoximation was determined to range from 4.3 mmol to 8.5 mmol per 1 g of base polymer. Most of the nitrogen is considered to belong to the amide oxime group. The pore radius, which was initially distributed broadly from about 500 A to 10000 A for the base polymer, was changed to about 1000 A with narrow distribution by the grafting. The pore volume was 1.2 ∼ 1.4 cm 3 per 1 gram of the amide oxime resin, which was about half of that of the initial base polymer. But the pore volume per 1 g base polymer of the amide oxime resin increased with an increase in the grafting degree, e.g. 4.5 cm 3 /g base polymer at 127 % of grafting degree. Specific surface area, which was 30 m 2 /g in base polymer, decreased with an increase in the grafting degree, e.g. 15 m 2 /g at 127 % of grafting degree. Both the amounts of the adsorbed hydrochloric acid and the adsorbed copper were about 1.5 times of the amount of nitrogen introduced in the amidoximation. The reason is considered to be caused by the formation of hydroxamic acid and amide from the measurements of the IR spectra. The amount of uranium adsorbed on the resin was 64 % of the amount of nitrogen introduced in the amidoximation. (author)

1H, 13C and 13N chemical shifts and 1H-15N and 13C-15N heteronuclear spin-spin coupling constants n the NMR spectra of 5-substituted furfural oximes

International Nuclear Information System (INIS)

Popelis, Yu.Yu.; Liepin'sh, E.E.; Lukevits, E.Ya.

1986-01-01

The 1 H, 13 C, and 15 N NMR spectra of 15 N-enriched 5-substituted furfural oximes were investigated. It was shown that the chemical shifts of the ring atoms and the oxime group correlate satisfactorily with the F and R substituent constants, whereas their sensitivity to the effect of the substituents is lower than in monosubstituted furan derivatives. The constants of spin-spin coupling between the ring protons and the oxime group were determined. An analysis of the 1 H- 1 H spin-spin coupling constants (SSCC) on the basis of their stereospecificity indicates that the E isomers have primarily an s-trans conformation in polar dimethyl sulfoxide, whereas the Z isomers, on the other hand, have an s-cis conformation. The signs of the direct and geminal 13 C- 15 N SSCC were determined for 5-trimethylsilylfurfural oxime

Docking and molecular dynamics studies of peripheral site ligand–oximes as reactivators of sarin-inhibited human acetylcholinesterase

NARCIS (Netherlands)

Almeida, J.S.F.D. de; Cuya Guizado, T.R.; Guimarães, A.P.; Ramalho, T.C.; Gonçalves, A.S.; Koning, M.C. de; França, T.C.C.

2016-01-01

In the present work, we performed docking and molecular dynamics simulations studies on two groups of long-tailored oximes designed as peripheral site binders of acetylcholinesterase (AChE) and potential penetrators on the blood brain barrier. Our studies permitted to determine how the tails anchor

14 CFR 171.117 - Reports.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.117 Section 171.117... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Simplified Directional Facility (SDF) § 171.117 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the time...

Steric control of reactivity: formation of oximes, benzodiazepinone N-oxides and isoxazoloquinolinones

OpenAIRE

Heaney, Frances; Bourke, Sharon; Cunningham, Desmond; McArdle, Patrick

1998-01-01

Reaction of the alkenyl carbonyl compounds 1 with hydroxylamine can lead to the formation of the oximes 2, the benzodiazepinone N-oxides 3 or the isoxazoloquinolinones 5. The product(s) of reaction are shown to depend on the electronic nature of the terminal olefinic substituent R3 and the space filling capacity of the substituents R1, R2 and R4. When the olefinic centre is electron poor (R3 = CO2Et) ketocarbonyls convert exclusively to bicyclic nitrones 3 whereas aldehydes are more sensitive...

33 CFR 117.841 - Smith Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smith Creek. 117.841 Section 117.841 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.841 Smith Creek. The draw of the S117-S133...

Purity of antidotal oxime HI-6 DMS as an active pharmaceutical ingredient for auto-injectors and infusions.

Science.gov (United States)

Bogan, Reinhard; Koller, Marianne; Klaubert, Bernd

2012-01-01

As reactivators of inhibited acetylcholinesterase, oximes are essential antidotes in poisoning by organophosphorus compounds. Due to its superior efficacy in cases of soman, cyclosarin, and sarin poisoning, the oxime HI-6 represents a promising option for an active pharmaceutical ingredient (API) in the further development of antidote therapy for nerve agent poisoning. Developmental lots of HI-6 DMS (dimethanesulfonate) provided by different manufacturers were examined with respect to their content and purity with a view to their future use as an API. There are distinct differences in the HI-6 content from three manufacturers. With respect to purity, gradual differences arise with the known synthetic by-products as well as with unknown accompanying compounds. It became apparent that in the case of a modified synthesis using protective groups, the proportion of some synthesis by-products decreases considerably. With one exception, they are thus below the reporting threshold for API in accordance with pertinent regulatory guidelines. In HI-6, an unknown impurity always occurs, whose percentage necessitates identification due to regulations. This unknown impurity, which has not been described so far, could be identified as an isomer. These findings supply data required for the description of pharmaceutical quality in accordance with module 3 of a Common Technical Document (CTD). They thus contribute to the marketing authorization of this substance as an API for auto-injectors and infusions. Copyright © 2012 John Wiley & Sons, Ltd.

Original Article. Protection studies of new bis quaternary 2-(hydroxyimino-N-(pyridin-3yl acetamide derivatives (HNK-series oximes against acute poisoning by dichlorvos (DDVP in Swiss albino mice

Directory of Open Access Journals (Sweden)

Kumar Pravin

2016-12-01

Full Text Available The available antidotal therapy against acute poisoning by organophosphates involves the use of atropine alone or in combination with one of the oximes, e.g. 2-PAM, Obidoxime, TMB-4 or HI-6. Each of these oximes has some limitation, raising the question of the universal antidotal efficacy against poisoning by all OPs/nerve agents. In the present study, newly synthesized bis quaternary 2-(hydroxyimino-N-(pyridin-3yl acetamide derivatives (HNK-series oximes were evaluated for their antidotal efficacy against DDVP intoxicated Swiss mice, in terms of the Protection Index (PI and AChE reactivation in brain and serum. The inhibition concentration (IC50 was determined in brain and serum after optimizing the time point for maximum inhibition (60 min post DDVP exposure. AChE reactivation efficacy of the HNK series was evaluated at IC50 and compared with 2-PAM. HNK-102 showed a ~2 times better Protection Index (PI as compared to 2-PAM against DDVP toxicity. IC50 at 60 min DDVP post exposure was found to be approximately one fifth and one half of the LD50 dose for brain and serum AChE, respectively. Out of three HNK oximes, HNK-102 & 106 at 0.20 LD50 dose significantly reactivated DDVP intoxicated brain AChE (p<0.05 as compared to 2-PAM at double IC50 dose of DDVP. In light of double PI and higher AChE reactivation, HNK 102 was found to be a better oxime than 2-PAM in the treatment of acute poisoning by DDVP.

Theoretical study of the nucleophilic addition of oximes to the nitrile complexes trans-/cis-[ReCl4(NCCH3)2

International Nuclear Information System (INIS)

Klestova-Nadeeva, E. A.; Kuznetsov, M. L.; Dement'ev, A. I.

2005-01-01

The reaction of nucleophilic addition of oximes (HON=CRR 1 ) to organic nitriles coordinated in the rhenium complexes trans-/cis-[ReCl 4 (NCCH 3 ) 2 ] was theoretically studied by the Hartree-Fock and density functional theory (B3LYP) methods. The reaction mechanism involves (I) the initial change of the oxime conformation; (II) the formation of the orientation complex with the coordinated nitrile molecule, which transforms into a four-membered transition state; (III) the formation of the addition product in a less stable conformation; and (IV) the formation of the ultimate addition product. The calculations make it possible to interpret the activation of nitriles in terms of the activated complex theory as a result of stabilization of the transition state in going from the free to the coordinated nitrile [ru

Mass of 48K

International Nuclear Information System (INIS)

Weisser, D.C.; Zeller, A.F.; Ophel, T.R.; Hebbard, D.F.

1978-08-01

The mass excess of 48 K was measured to be -32.117 +or- .027 MeV using the 48 Ca( 7 Li, 7 Be) 48 K reaction at 52 MeV. The result is consistent with predictions and a previous less accurate measurement. There is evidence for an excited state in 48 K at 0.58 MeV

33 CFR 117.917 - Battery Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw of...

33 CFR 117.959 - Chocolate Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chocolate Bayou. 117.959 Section 117.959 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.959 Chocolate Bayou. The draw of the Union...

32 CFR 724.117 - Discharge review.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level of...

33 CFR 117.457 - Houston River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of the...

33 CFR 117.324 - Rice Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Rice Creek. 117.324 Section 117.324 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.324 Rice Creek. The CSX Railroad Swingbridge, mile...

33 CFR 117.231 - Brandywine Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Brandywine Creek. 117.231 Section 117.231 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.231 Brandywine Creek. The draw of the...

7 CFR 1942.117 - General requirements.

Science.gov (United States)

2010-01-01

... § 1942.117 General requirements. (a) Reserve requirements. Loans under this subpart are subject to the... 7 Agriculture 13 2010-01-01 2009-01-01 true General requirements. 1942.117 Section 1942.117 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...

Indirubin Derivative 7-Bromoindirubin-3-Oxime (7Bio Attenuates Aβ Oligomer-Induced Cognitive Impairments in Mice

Directory of Open Access Journals (Sweden)

Liping Chen

2017-11-01

Full Text Available Indirubins are natural occurring alkaloids extracted from indigo dye-containing plants. Indirubins could inhibit various kinases, and might be used to treat chronic myelocytic leukemia, cancer and neurodegenerative disorders. 7-bromoindirubin-3-oxime (7Bio, an indirubin derivative derived from indirubin-3-oxime, possesses inhibitory effects against cyclin-dependent kinase-5 (CDK5 and glycogen synthase kinase-3β (GSK3β, two pharmacological targets of Alzheimer's disease (AD. In this study, we have discovered that 2.3–23.3 μg/kg 7Bio effectively prevented β-amyloid (Aβ oligomer-induced impairments of spatial cognition and recognition without affecting bodyweight and motor functions in mice. Moreover, 7Bio potently inhibited Aβ oligomer-induced expression of interleukin-6 (IL-6 and tumor necrosis factor-α (TNF-α. Furthermore, 7Bio significantly prevented the decreased expression of synapsin-1 and PSD-95, biomarkers of pre-synaptic and post-synaptic proteins in Aβ oligomer-treated mice. The mean optical density (OD with hyper-phosphorylated tau (pTau, glial fibrillary acidic protein (GFAP and CD45 positive staining in the hippocampus of 7Bio-treated mice were significantly decreased compared to those of Aβ oligomer-treated mice. In addition, Western blotting analysis showed that 7Bio attenuated Aβ oligomer-decreased expression of pSer9-GSK3β. Those results suggested that 7Bio could potently inhibit Aβ oligomer-induced neuroinflammation, synaptic impairments, tau hyper-phosphorylation, and activation of astrocytes and microglia, which may contribute to the neuroprotective effects of 7Bio. Based on these findings, we expected that 7Bio might be developed as a novel anti-AD lead compound.

33 CFR 117.309 - Nassau Sound.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nassau Sound. 117.309 Section 117.309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.309 Nassau Sound. The draw of the Fernandina Port...

33 CFR 117.331 - Snake Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake Creek. 117.331 Section 117.331 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.331 Snake Creek. The draw of the Snake Creek...

33 CFR 117.965 - Cow Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cow Bayou. 117.965 Section 117.965 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.965 Cow Bayou. The draws of the Orange County...

33 CFR 117.263 - Banana River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...

9 CFR 117.4 - Test animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Test animals. 117.4 Section 117.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS § 117.4...

33 CFR 117.861 - Blind Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blind Slough. 117.861 Section 117.861 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Oregon § 117.861 Blind Slough. The draws of the Portland and...

33 CFR 117.1087 - Fox River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Fox River. 117.1087 Section 117.1087 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1087 Fox River. (a) The draws of the Canadian...

33 CFR 117.987 - Taylor Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Bayou. 117.987 Section 117.987 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.987 Taylor Bayou. The draws of the Union Pacific...

33 CFR 117.543 - Bear Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bear Creek. 117.543 Section 117.543 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.543 Bear Creek. (a) The draws of the Baltimore...

33 CFR 117.177 - Mud Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mud Slough. 117.177 Section 117.177 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.177 Mud Slough. The draw of the Union Pacific...

33 CFR 117.1095 - Root River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main Street...

33 CFR 117.925 - Cooper River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.925 Section 117.925 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.925 Cooper River. The draw of the Seaboard...

33 CFR 117.713 - Cooper River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.713 Section 117.713 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.713 Cooper River. (a) The drawspans for the...

33 CFR 117.385 - Snake River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12 bridge...

14 CFR 415.117 - Ground safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 415.117 Section 415.117... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.117 Ground safety. (a) General. An applicant's safety review...

28 CFR 11.7 - Salary adjustments.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Salary adjustments. 11.7 Section 11.7 Judicial Administration DEPARTMENT OF JUSTICE DEBT COLLECTION Administration of Debt Collection § 11.7 Salary adjustments. The following debts shall not be subject to the salary offset procedures of § 11.8...

33 CFR 117.335 - Taylor Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Creek. 117.335 Section 117.335 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.335 Taylor Creek. The draw of US441 bridge, mile 0...

In Vitro Ability of Currently Available Oximes to Reactivate Organophosphate Pesticide-Inhibited Human Acetylcholinesterase and Butyrylcholinesterase

OpenAIRE

Kamil Musilek; Kamil Kuca; Daniel Jun; Lucie Musilova

2011-01-01

We have in vitro tested the ability of common, commercially available, cholinesterase reactivators (pralidoxime, obidoxime, methoxime, trimedoxime and HI-6) to reactivate human acetylcholinesterase (AChE), inhibited by five structurally different organophosphate pesticides and inhibitors (paraoxon, dichlorvos, DFP, leptophos-oxon and methamidophos). We also tested reactivation of human butyrylcholinesterase (BChE) with the aim of finding a potent oxime, suitable to serve as a “pseudocatalytic...

46 CFR 117.200 - Survival craft-general.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on a... craft they replace. (c) A summary of survival craft requirements is provided in Table 117.200(c). Table...

33 CFR 117.1058 - Snake River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.1058 Section 117... OPERATION REGULATIONS Specific Requirements Washington § 117.1058 Snake River. (a) The draw of the Burlington Northern Santa Fe railroad bridge across the Snake River at mile 1.5 between Pasco and Burbank is...

33 CFR 117.537 - Townsend Gut.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Townsend Gut. 117.537 Section 117... OPERATION REGULATIONS Specific Requirements Maine § 117.537 Townsend Gut. The draw of the Southport (SR27) Bridge, at mile 0.7, across Townsend Gut between Boothbay Harbor and Southport, Maine shall open on...

Cerebral uptake and retention of 99Tcsup(m)-hexamethylpropyleneamine oxime (99Tcsup(m)-HM-PAO)

International Nuclear Information System (INIS)

Holmes, R.A.; Chaplin, S.B.; Royston, K.G.; Missouri Univ., Columbia

1985-01-01

A new radiopharmaceutical, 99 Tcsup(m)-hexamethylpropyleneamine oxime ( 99 Tcsup(m)-HM-PAO) is described. This agent displays considerable promise for imaging cerebral blood flow. In studies in rats and one human volunteer, 99 Tcsup(m)-HM-PAO demonstrates good brain uptake, prolonged retention of activity in the brain, and slow regional redistribution. These properties suggest that this new radiopharmaceutical is ideal for single photon emission tomographic (SPECT) imaging of cerebral blood flow. (author)

42 CFR 435.117 - Newborn children.

Science.gov (United States)

2010-10-01

... 42 Public Health 4 2010-10-01 2010-10-01 false Newborn children. 435.117 Section 435.117 Public..., Children Under 8, and Newborn Children § 435.117 Newborn children. (a) The agency must provide Medicaid eligibility to a child born to a woman who has applied for, has been determined eligible and is receiving...

Can hydroxylamine be a more potent nucleophile for the reactivation of tabun-inhibited AChE than prototype oxime drugs? An answer derived from quantum chemical and steered molecular dynamics studies.

Science.gov (United States)

Lo, Rabindranath; Ganguly, Bishwajit

2014-07-29

Organophosphorus nerve agents are highly toxic compounds which strongly inhibit acetylcholinesterase (AChE) in the blood and in the central nervous system (CNS). Tabun is one of the highly toxic organophosphorus (OP) compounds and is resistant to many oxime drugs formulated for the reactivation of AChE. The reactivation mechanism of tabun-conjugated AChE with various drugs has been examined with density functional theory and ab initio quantum chemical calculations. The presence of a lone-pair located on the amidic group resists the nucleophilic attack at the phosphorus center of the tabun-conjugated AChE. We have shown that the newly designed drug candidate N-(pyridin-2-yl)hydroxylamine, at the MP2/6-31+G*//M05-2X/6-31G* level in the aqueous phase with the polarizable continuum solvation model (PCM), is more effective in reactivating the tabun-conjugated AChE than typical oxime drugs. The rate determining activation barrier with N-(pyridin-2-yl)hydroxylamine was found to be ∼1.7 kcal mol(-1), which is 7.2 kcal mol(-1) lower than the charged oxime trimedoxime (one of the most efficient reactivators in tabun poisonings). The greater nucleophilicity index (ω(-)) and higher CHelpG charge of pyridinylhydroxylamine compared to TMB4 support this observation. Furthermore, we have also examined the reactivation process of tabun-inhibited AChE with some other bis-quaternary oxime drug candidates such as methoxime (MMB4) and obidoxime. The docking analysis suggests that charged bis-quaternary pyridinium oximes have greater binding affinity inside the active-site gorge of AChE compared to the neutral pyridinylhydroxylamine. The peripheral ligand attached to the neutral pyridinylhydroxylamine enhanced the binding with the aromatic residues in the active-site gorge of AChE through effective π-π interactions. Steered molecular dynamics (SMD) simulations have also been performed with the charged oxime (TMB4) and the neutral hydroxylamine. From protein-drug interaction

Eesti köitekunst Oxfordis

Index Scriptorium Estoniae

2009-01-01

Köitekunstinäitus "Bound for Success" Oxfordi ülikooli Bodleiani raamatukogus 12. juunist 1. augustini. Näituse korraldas koostöös raamatukoguga köitekunstnike ühendus Designer Bookbinders. Näitusele valitud 117 tööst kümme (autorid loetletud) on Eestist

40 CFR 117.21 - Notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Notice. 117.21 Section 117.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS DETERMINATION OF... knowledge of any discharge of a designated hazardous substance from such vessel or facility in quantities...

33 CFR 117.225 - Yellow Mill Channel.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Yellow Mill Channel. 117.225 Section 117.225 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.225 Yellow Mill Channel. The...

High performance supercapacitor using N-doped graphene prepared via supercritical fluid processing with an oxime nitrogen source

International Nuclear Information System (INIS)

Balaji, S. Suresh; Elavarasan, A.; Sathish, M.

2016-01-01

Graphical abstract: N-doped graphene prepared via supercritical fluid processing with oxime nitrogen source (DMG) showed enhanced performance in electrochemical supercapacitor application. A maximum specific capacitance of 286 F g"−"1 at a current density of 0.5 A/g was achieved with a high specific capacity retention of 98% after 1000 cycles at 5 A/g. - Highlights: • N-functionalised graphene synthesized via supercritical fluid processing. • DMG, an oxime based nitrogen precursor. • Maximum specific capacitance of 286 F/g at 0.5 A/g in aqueous solution. • Pyridinic as well as quarternary nitrogen for enhanced capacitance. - Abstract: Heteroatom doped graphene has been proved for its promising applications in electrochemical energy storage systems. Here, nitrogen (N) doped graphene was prepared via two different techniques namely supercritical fluid assisted processing and hydrothermal heat treatment using dimethylglyoxime (DMG) as an oxime nitrogen precursor. The FT-IR and Raman spectra showed the N-containing functional group in the graphene. The XRD analysis revealed the complete reduction of graphene oxide during the supercritical fluid processing. The elemental analysis and X-ray photoelectron spectroscopy revealed the amount and nature of N-doping in the graphene, respectively. The surface morphology and physical nature of the samples were analyzed using scanning and transmission electron microscopic analysis. The electrochemical performance of prepared electrode materials was evaluated using cyclic voltammetry, galvanostatic charge-discharge analysis and electrochemical impedance spectroscopy. The N-doped graphene prepared via supercritical fluid assisted processing exhibit enhanced capacitive behaviour with a maximum specific capacitance of 286 F g"−"1 at a current density of 0.5 A/g. The cycling studies showed 98% specific capacity retention with 100% coulombic efficiency over 1000 cycles at 5 A/g. The enhanced specific capacitance of N

33 CFR 117.677 - Big Sunflower River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Big Sunflower River. 117.677 Section 117.677 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Mississippi § 117.677 Big Sunflower River. The draw of...

33 CFR 117.167 - Little Potato Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw of...

7 CFR 400.117 - Determination of delinquency.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Determination of delinquency. 400.117 Section 400.117 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION... Succeeding Crop Years § 400.117 Determination of delinquency. Prior to disclosing information about a debt to...

13 CFR 117.12 - Mediation.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Mediation. 117.12 Section 117.12... Mediation. (a) SBA shall, after ensuring that the complaint falls within the coverage of this Act and all... clearly within an exception, promptly refer the complaint to the Federal Mediation and Conciliation...

33 CFR 117.1001 - Cat Point Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cat Point Creek. 117.1001 Section 117.1001 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Virginia § 117.1001 Cat Point Creek. The draw of the...

33 CFR 117.705 - Beaver Dam Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Beaver Dam Creek. 117.705 Section 117.705 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.705 Beaver Dam Creek. The draw of the...

33 CFR 117.800 - Mill Neck Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mill Neck Creek. 117.800 Section 117.800 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.800 Mill Neck Creek. The draw of the...

33 CFR 117.769 - Black Rock Canal.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black Rock Canal. 117.769 Section 117.769 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.769 Black Rock Canal. The draws of the...

46 CFR 201.117 - Inclusion in record.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

1 CFR 11.7 - Federal Register Index.

Science.gov (United States)

2010-01-01

... 1 General Provisions 1 2010-01-01 2010-01-01 false Federal Register Index. 11.7 Section 11.7... REGISTER PUBLICATIONS SUBSCRIPTIONS § 11.7 Federal Register Index. The annual subscription price for the monthly Federal Register Index, purchased separately, in paper form, is $29. The price excludes postage...

46 CFR 117.175 - Survival craft equipment.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft equipment. 117.175 Section 117.175... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.175 Survival craft equipment. (a) General. Each item of survival craft equipment must be of good quality, and efficient for the purpose it...

Observation of pi K--(+) and pi K-+(-) Atoms

Czech Academy of Sciences Publication Activity Database

Adeva, B.; Benelli, A.; Čechák, T.; Doškářová, P.; Hons, Zdeněk; Klusoň, J.; Lednický, Richard; Martinčík, J.; Okada, K.; Průša, P.; Smolík, J.; Trojek, T.; Urban, T.; Vrba, T.

2016-01-01

Roč. 117, č. 11 (2016), s. 112001 ISSN 0031-9007 R&D Projects: GA MŠk(CZ) LG13031 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : Center of mass * Nickel foils * Standard deviation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 8.462, year: 2016

Dicty_cDB: SLA117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

Dicty_cDB: SFD117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

40 CFR 721.6660 - Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymer of alkanepolyol and poly-alkyl... Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime-blocked... substance identified generically as a polymer of alkane-polyol and polyalkylpolyisocyanatocarbomonocy- cle...

Extractive and spectrophotometric determination of U (VI) using 5-(3-phenolyl azo)-2-hydroxy-4-ethoxy propiophenone oxime (PHEPO)

International Nuclear Information System (INIS)

Subrahmanyam, P.; Krishnapriya, B.; Rekha, D.; Reddy Prasad, P.; Chiranjeevi, P.

2007-01-01

A simple spectrophotometric method for the determination of U (VI) using 5-(3-phenolyl azo)-2-hydroxy-4-ethoxy propiophenone oxime (PHEPO) is developed. The reagent PHEPO was synthesized and used for extraction of uranium. At pH 8.5-10.0 uranium forms a purple colored complex with PHEPO which was then quantitatively extracted in chloroform showing maximum absorbance at wavelength of 380nm. The proposed method obeys Beer's law in the range of 1.2-19.0ppm. molar absorptivity and Sandelson's sensitivity of extracted species were calculated to be 1.750 x 104 lmol-1 cm-1 and 8.5 x 10-5 mg cm-2 respectively. The method was applied for the determination of uranium in synthetic and plant samples. It was found that the newly developed method is competent to those of standard methods. (author)

47 CFR 25.117 - Modification of station license.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Modification of station license. 25.117 Section 25.117 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.117...

40 CFR 117.14 - Demonstration projects.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Demonstration projects. 117.14 Section... DETERMINATION OF REPORTABLE QUANTITIES FOR HAZARDOUS SUBSTANCES Applicability § 117.14 Demonstration projects... research or demonstration projects relating to the prevention, control, or abatement of hazardous substance...

Production of 57Co, 109Cd, 111In and 117mSn using CV-28 cyclotron at IPEN-CNEN/SP

International Nuclear Information System (INIS)

Osso, J.A. Jr.; Landini, L.; Lion, L.F.; Moraes, V.

2001-01-01

222MBq (6mCi) of 57 Co and impurity levels of 1.13 and 1.29% for 56 Co and 58 Co, respectively, at delivery time. In order to achieve these results, a chemical separation method was developed with a separation yield of 93% for 5 '7Co and a negligible loss of Ni. A composite target of Ni and Ag was prepared and a chemical separation method proposed to allow the separation between the targets and the products of interest, 57 Co and 109 Cd. The yields obtained in the irradiation of the composite target were: 947.94kBq/μA.h (25.62μCi/μA.h) of 57 Co - direct reaction, 259-00kBq/μA.h (7μCi/μA.h) of 57 Co - indirect reaction (11.31 days after EOB) and 71.41kBq/μA.h (1.93μCi/μA.h) of 109 Cd, which showed the efficiency of its use, as well as the chemical separation, with a yield of 80% for 57 Co and 109 Cd. 111 ln (t 1/2 =67.5 h) has appropriate characteristics for Diagnosis in Nuclear Medicine due to its decay mode (100% by electron capture) and its adequate half-life to slow biological studies, that makes it one of radioisotopes of interest of Brazilian Physicians. It can also be used in angular correlation studies in Nuclear Physics. 111 In was produced by the 112 Cd(p,2n) 111 ln reaction, that has the highest yield. The Cd targets were prepared by electroplating of CdSO 4 solution in copper and copper/nickel backings. After being irradiated, a chemical separation was performed by an acetic acid extraction method, with an overall recovery yield for 111 ln higher than 95%. The level of the chemical impurities of Cd, Ni and Cu were bellow than the permissible values. 117m Sn (t 1/2 =14 d) has suitable characteristics of decay to be used as a tracer of SnCl 2 in the labeling of organic molecules with 99m Tc and also in radiotherapeutical applications. It was prepared by the irradiation of natural tin through the nuclear reactions nat Sn(p,xn) 117 Sb→ 117m Sn. The production thick target yield of 117m Snnn was 784.4kBq/μA.h (21.20μCi/μA.h) and with the proper

33 CFR 117.751 - Shark River (South Channel).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shark River (South Channel). 117.751 Section 117.751 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.751 Shark River (South...

9 CFR 3.117 - Terminal facilities.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.117 Section 3... Marine Mammals Transportation Standards § 3.117 Terminal facilities. Carriers and intermediate handlers... facility of any carrier or intermediate handler where marine mammal shipments are maintained must be...

13 CFR 117.18 - Judicial review.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Judicial review. 117.18 Section 117.18 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FEDERALLY... reasonable attorney's fees, but that the complainant must demand these costs in the complaint; (iii) That...

9 CFR 117.2 - Animal facilities.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal facilities. 117.2 Section 117.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES... Animal facilities. Animal facilities shall comply with the requirements provided in part 108 of this...

33 CFR 117.803 - Niagara River.

Science.gov (United States)

2010-07-01

... Canadian National Railway bridge, mile 33.0 at Buffalo, need not be opened for the passage of vessels. ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River. 117.803 Section 117.803 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

33 CFR 117.825 - Newport River.

Science.gov (United States)

2010-07-01

... the Atlantic and East Carolina Railway bridge, mile 13.0 at Newport, need not be opened for the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newport River. 117.825 Section 117.825 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

48 CFR 1371.117 - Lay days.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1371.117 Section... REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.117 Lay days. Insert clause 1352.271-86, Lay Days, in all solicitations and contracts for ship repair. ...

41 CFR 102-117.200 - What is HAZMAT?

Science.gov (United States)

2010-07-01

... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...

Possible Deformed States in {sup 115}In and {sup 117}ln

Energy Technology Data Exchange (ETDEWEB)

Baecklin, A; Fogelberg, B [Inst. of Physics, Univ. of Uppsala (Sweden); Swedish Research Councils' Laboratory, Studsvik, Nykoeping (Sweden); Malmskog, S G [AB Atomenergi, Nykoeping (Sweden)

1967-01-15

Levels and transitions in {sup 115}In and {sup 117}In have been studied from the beta decay of 2.3-day {sup 115g}Cd and 2.5-h {sup 117g}Cd. Using a Ge(Li) detector and a double focussing beta spectrometer energies, intensities, conversion coefficients and multipolarities were obtained for the following transitions (energies in keV and multipolarities are given): {sup 115}In: 35.63 (97.0 % M1 + 3.0 % E2), 231.47 (E1), 260.80 (M1), 267, 336. 23 (M4 + < 5 % E5), 492. 4 (96 % El +4 % M2), 527.70 (E1). {sup 117}In: 71.0, 89.80 (E2 + < 20 % M1), 273.32 (M1, E2), 315.27 (M4 + < 7 % E2), 344.29 (E1), 434.12 (E1). Using the delayed coincidence technique, half lives were measured for 2 levels in {sup 115}In and for 3 levels in {sup 117}In. Energies, spins, parities and half lives are given for the following levels: In: 597.03, 3/2{sup -}; 828.39, 3/2{sup +}, 5.4 ns; 863.95, l/2{sup +} or 3/2{sup +}, 1.1 ns. {sup 117}In: 588.59, 3/2{sup -}; 0.20 ns; 659.56, 3/2{sup +}, 58.7 ns; 749.37, 1/2{sup +} or 3/2{sup +}, 4.3 ns. Reduced transition probabilities are given for several transitions in both nuclei. The E2 transition rates between the two excited positive parity states in both nuclei were found to be about 100 s. p. u. indicating a possible deformation of these states. The energy spacing and transition rates between these states can be well accounted for within the Nilsson model assuming the states to form a K = 1/2{sup +} rotational band. A deformation {delta} of about 0.20 is obtained for both nuclei.

33 CFR 117.923 - Congaree River.

Science.gov (United States)

2010-07-01

... the Southern Railway bridge, mile 4.3 at Moye's Station, shall open on signal if at least 24 hours... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Congaree River. 117.923 Section 117.923 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

49 CFR 214.117 - Eye and face protection.

Science.gov (United States)

2010-10-01

... corrective lenses, when required by this section to wear eye protection, shall be protected by goggles or... 49 Transportation 4 2010-10-01 2010-10-01 false Eye and face protection. 214.117 Section 214.117..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Bridge Worker Safety Standards § 214.117 Eye and face...

46 CFR 117.130 - Stowage of survival craft.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Stowage of survival craft. 117.130 Section 117.130... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.130 Stowage of survival craft. (a) Each survival craft must be: (1) Secured to the vessel by a painter with a float-free link permanently...

A neutral lipophilic complex of sup(99m)Tc with a multidentate amine oxime

International Nuclear Information System (INIS)

Troutner, D.E.; Volkert, W.A.; Hoffman, T.J.; Holmes, R.A.

1984-01-01

Propylene amine oxime, 3,3'-(1,3-propanediyldiimino)bis(3-methyl-2-butanone)dioxime, (PnAO) forms a neutral lipophilic complex with sup(99m)Tc in >95% yield at room temperature at pH 5-10. The complex can be prepared with generator produced sup(99m)Tc using 10 -5 M SnC 4 H 4 O 6 as the reducing agent at ligand concentrations as low as 3 x 10 -5 M. It is stable in saline solutions for as long as 24 h. [Sup(99m)Tc]PnAO may be useful as an imaging agent which passively diffuses across the blood brain barrier. (author)

33 CFR 117.423 - Atchafalaya River.

Science.gov (United States)

2010-07-01

... Kansas City Southern Railway bridge, mile 133.1 (mile 5.0 on N.O.S. Chart) above the mouth of the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Atchafalaya River. 117.423 Section 117.423 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

25 CFR 117.22 - Disbursements to legal guardians.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Disbursements to legal guardians. 117.22 Section 117.22... COMPETENCY § 117.22 Disbursements to legal guardians. Any disbursement authorized to be made to an Indian by... to the guardian. All expenditures by a guardian of the funds of his ward must be approved in writing...

Pyruvic Oxime Nitrification and Copper and Nickel Resistance by a Cupriavidus pauculus, an Active Heterotrophic Nitrifier-Denitrifier

OpenAIRE

Ramirez, Miguel; Obrzydowski, Jennifer; Ayers, Mary; Virparia, Sonia; Wang, Meijing; Stefan, Kurtis; Linchangco, Richard; Castignetti, Domenic

2014-01-01

Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2) and nitrous oxide (N2O) while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3–C(NOH)–COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a g...

Surface Modification of Zinc with an Oxime for Corrosion Protection in Chloride Medium

Directory of Open Access Journals (Sweden)

Ganesha Achary

2013-01-01

Full Text Available The surface treatment of zinc was done with different concentrations of an oxime (2E-2-(hydroxylamino-1,2-diphenylethanol molecule by the immersion method. The electrochemical corrosion studies of surface-treated zinc specimens were performed in aqueous sodium chloride solution (1 M, pH 5.0 at different temperatures in order to study the corrosion mechanism. The recorded electrochemical data indicated a basic modification of the cathodic corrosion behavior of the treated zinc resulting in a decrease of the electron transfer rate. The zinc samples treated by immersion in the inhibiting organic solution presented good corrosion resistance. Using scanning electron microscopy (SEM, it was found that a protective film was formed on the surface of zinc.

Detection of homing-in of stem cells labeled with technetium-99m hexamethylpropyleneamine oxime in infarcted myocardium after intracoronary injection

International Nuclear Information System (INIS)

Patel, Chetan D; Agarwal, Snehlata; Seth, Sandeep; Mohanty, Sujata; Aggarwal, Himesh; Gupta, Namit

2014-01-01

Bone marrow stem cells having myogenic potential are promising candidates for various cell-based therapies for myocardial disease. We present here images showing homing of technetium-99m (Tc-99m) hexamethylpropyleneamine oxime (HMPAO) labeled stem cells in the infarcted myocardium from a pilot study conducted to radio-label part of the stem cells in patients enrolled in a stem cell clinical trial for recent myocardial infarction

49 CFR 41.117 - Buildings built with Federal assistance.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Buildings built with Federal assistance. 41.117 Section 41.117 Transportation Office of the Secretary of Transportation SEISMIC SAFETY § 41.117 Buildings built with Federal assistance. (a) Each DOT Operating Administration assisting in the financing, through...

Construction of New Potential Reactivators of Phosphonylated Acetylcholinesterase. Substitution of F for H in the Nucleus of Pyridinecarboxaldehyde Oximes.

Science.gov (United States)

1983-11-01

essential to the content of the re- port and in all cases NMR data subjected to interpretation in this report have been entered in typography to...compared. In the Second Quarter reactions in the synthetic pathway to 3-F-2-PAM were scaled-up. Low yields were encountered for the specific nitration...oxime was synthetically achieved by way of the Markovac-Stevens-Ash-Hackley reaction , and the compound was characterized by its mass spectrum, NMR

41 CFR 102-117.5 - What is transportation management?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...

33 CFR 117.11 - Unnecessary opening of the draw.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Unnecessary opening of the draw. 117.11 Section 117.11 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.11 Unnecessary opening of the draw. No...

9 CFR 117.3 - Admittance of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Admittance of animals. 117.3 Section 117.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

9 CFR 117.5 - Segregation of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Segregation of animals. 117.5 Section 117.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

9 CFR 117.6 - Removal of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Removal of animals. 117.6 Section 117.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS...

The adsorption of 117Snm(IV)-EDTMP on collagen

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Pu Manfei; Bing Wenzeng; He Jiaheng; Wang Guanquan

2002-01-01

The adsorption and desorption characteristics of 117 Sn m (IV)-EDTMP on collage are studied, and compared with that on HA. The results show that the effects of pH and temperature on adsorption of 117 Sn m (IV)-EDTMP on collagen are similar to those on HA, and that the adsorption equilibrium and adsorption model of 117 Sn m (IV)-EDTMP on collagen are completely different from those on HA; 117 Sm m -EDTMP absorbed on collagen are extremely stable and almost could not be desorbed with normal saline or EDTMP

Nuclear spectroscopy study of the 117 Sn by the angular correlation technique

International Nuclear Information System (INIS)

Borges, Joao Baptista

1977-01-01

The directional correlation of gamma cascade (553-159) keV populated in 117 Sn through the β - decay of 117 In has been measured. An automatic gamma spectrometer utilizing Ge(Li) and NaI (Tl) detectors was used to measure the angular correlation. The results are analysed in terms of the multipole mixing ratio for the 159 keV transition in 117 Sn. The results are: A 22 = -0 064±0.005, A 44 = 0.005±0.007 with δ(E2/M1) 159keV = 0.036+0.021. The life time of the 159 keV state has also been determined by using the plastic scintillator detectors, and utilizing the delayed gamma-gamma coincidence method the resulting value of the life time is T 1/2 = 275±15 psec. Further measurements have been carried out to determine the nuclear g-factor of the 159 keV state utilizing the NaI(Tl) detectors and an external magnetic field of 25.5 k Gauss. The method of 'integral rotation with reverse field and constant angle' was utilized for the determination of the g-factor with the resulting value of g(159 keV) = +0.47±0.10. The experimental results are discussed in terms of single particle model and the pairing plus quadrupole model of Kisslinger and Sorensen. (author)

Increased rCBF in gray matter heterotopias detected by SPECT using 99mTc hexamethyl-propylenamine oxime

International Nuclear Information System (INIS)

Henkes, H.; Klinikum Rudolf Virchow, Berlin; Hosten, N.; Cordes, M.; Neumann, K.; Hansen, M.L.

1991-01-01

Imaging findings of morphology and regional cerebral blood flow in two patients suffering from epileptic seizures are presented. CT and MRI revealed heterotopic gray matter as a probable structural correlate, causing the seizure disorder. 99m Tc hexamethyl-propylenamine oxime (HM-PAO) SPECT demonstrated focally increased regional cerebral blood flow in both patients in the areas of their heterotopic lesions. Heterotopic and orthotopic gray matter seem to have similar features in terms of regional perfusion. A focally increased brain perfusion in interictal epileptic patients may indicate an underlying migration anomaly. (orig.)

Measurement of K-27, an oxime-type cholinesterase reactivator by high-performance liquid chromatography with electrochemical detection from different biological samples.

Science.gov (United States)

Gyenge, Melinda; Kalász, Huba; Petroianu, George A; Laufer, Rudolf; Kuca, Kamil; Tekes, Kornélia

2007-08-17

K-27 is a bisquaternary asymmetric pyridinium aldoxime-type cholinesterase reactivator of use in the treatment of poisoning with organophosphorous esterase inhibitors. A sensitive, simple and reliable reverse-phase high-performance liquid chromatographic method with electrochemical detection was developed for the measurement of K-27 concentrations in rat brain, cerebrospinal fluid, serum and urine samples. Male Wistar rats were treated intramuscularly with K-27 and the samples were collected 60 min later. Separation was carried out on an octadecyl silica stationary phase and a disodium phosphate solution (pH 3.7) containing citric acid, octane sulphonic acid and acetonitrile served as mobile phase. Measurements were carried out at 30 degrees C at E(ox) 0.65 V. The calibration curve was linear through the range of 10-250 ng/mL. Accuracy, precision and the limit of detection calculated were satisfactory according to internationally accepted criteria. Limit of quantitation was 10 ng/mL. The method developed is reliable and sensitive enough for monitoring K-27 levels from different biological samples including as little as 10 microL of cerebrospinal fluid. The method--with slight modification in the composition of the mobile phase--can be used to measure a wide range of other related pyridinium aldoxime-type cholinesterase reactivators.

CD117 expression on blast cells in acute myeloid leukemia

Directory of Open Access Journals (Sweden)

Goryainova N.V.

2015-09-01

Full Text Available The aim of the present work was to analyze the frequency of CD117 (c-KIT antigen expression on the blast cells in acute myeloid leukemia (AML, evaluation of the presence of the relationship between the expression of the c-KIT and leukemia according to the FAB classification and definition of co-expression of the antigen CD117, antigens CD33 and CD34. The data of 47 patients with AML were diagnosed. M0 AML variant was established in 3 (6% patients, M1 – in 2 (4%, M2 – in 9 (20%, M4 – in 22 (47% and M5 – in 11 (23%. For immunophenotypic stu¬dies monoclonal antibodies (mAb that detect antigens of anti-CD34, anti-CD33 and anti-CD117 (Becton Dickinson, USA were used. The presence of the antigen CD117 was detected in 39 people, accounting for 83% of all surveyed. Antigen c-KIT was present in 48.117.0% cells on average: in all 3 cases – AML M0, in2 cases of AML M1, in 6 cases – AML M2, 20 of 22 cases – AML M4 and in 8 of 11 AML M5 cases. Average levels of CD117 in investigated leukemia cases statistically differed significantly (p=0.0067. Among 39 CD117- positive patients in 25 (53% co-expression of CD117+/CD34+ was revealed. Expression of CD117+/CD34- was observed in 14 cases (30%, CD117-/CD34+ – in 4 cases (8,5%, CD117-/CD34- – in 4 cases (8.5%. CD34 had of 64% of cells of myeloid origin. A high positive cor¬relation between expression of CD117 and CD34 (r=+0,5169 was determined, being statistically significant (p0,0067.

25 CFR 117.33 - Signature of illiterates.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Signature of illiterates. 117.33 Section 117.33 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES DEPOSIT AND EXPENDITURE OF... Signature of illiterates. An Indian who cannot write shall be required to endorse checks payable to his...

27 CFR 479.117 - Action by Customs.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Action by Customs. 479.117... OTHER FIREARMS Importation and Exportation Exportation § 479.117 Action by Customs. Upon receipt of a... of Customs may order such inspection as deemed necessary prior to lading of the merchandise. If...

33 CFR 117.9 - Delaying opening of a draw.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Delaying opening of a draw. 117.9... DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.9 Delaying opening of a draw. No person shall unreasonably delay the opening of a draw after the signals required by § 117.15 have been given. Note: Trains...

Synthesis of the New Element with Z=117

International Nuclear Information System (INIS)

Hamilton, J H; Ramayya, A V; Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Lobanov, Yu V; Mezentsev, A N; Polyakov, A N; Bailey, P D; Benker, D; Ezold, J; Porter, C E; Riley, F; Roberto, J B; Bennett, M E; Henderson, R A; Moody, K J; Nelson, S L; Ryabinin, M A

2011-01-01

The synthesis of the new chemical element with atomic number Z=117 is presented. The isotopes 293 117 and 294 117were produced in fusion reactions between 48 Ca and 249 Bk. The 249 Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas Filled Recoil Separator. The measured decay properties show a strong rise of stability for super-heavy nuclei toward N=184.

The R117A variant of the Escherichia coli transacylase FabD synthesizes novel acyl-(acyl carrier proteins).

Science.gov (United States)

Marcella, Aaron M; Barb, Adam W

2017-12-01

The commercial impact of fermentation systems producing novel and biorenewable chemicals will flourish with the expansion of enzymes engineered to synthesize new molecules. Though a small degree of natural variability exists in fatty acid biosynthesis, the molecular space accessible through enzyme engineering is fundamentally limitless. Prokaryotic fatty acid biosynthesis enzymes build carbon chains on a functionalized acyl carrier protein (ACP) that provides solubility, stability, and a scaffold for interactions with the synthetic enzymes. Here, we identify the malonyl-coenzyme A (CoA)/holo-ACP transacylase (FabD) from Escherichia coli as a platform enzyme for engineering to diversify microbial fatty acid biosynthesis. The FabD R117A variant produced novel ACP-based primer and extender units for fatty acid biosynthesis. Unlike the wild-type enzyme that is highly specific for malonyl-CoA to produce malonyl-ACP, the R117A variant synthesized acetyl-ACP, succinyl-ACP, isobutyryl-ACP, 2-butenoyl-ACP, and β-hydroxybutyryl-ACP among others from holo-ACP and the corresponding acyl-CoAs with specific activities from 3.7 to 120 nmol min -1  mg -1 . FabD R117A maintained K M values for holo-ACP (~ 40 μM) and displayed small changes in K M for acetoacetyl-CoA (110 ± 30 μM) and acetyl-CoA (200 ± 70 μM) when compared to malonyl-CoA (80 ± 30 μM). FabD R117A represents a novel catalyst that synthesizes a broad range of acyl-acyl-ACPs.

Analysis of carbonyl compounds via headspace solid-phase microextraction with on-fiber derivatization and gas chromatographic-ion trap tandem mass spectrometric determination of their O-(2,3,4,5,6-pentafluorobenzyl)oxime derivatives

Energy Technology Data Exchange (ETDEWEB)

Schmarr, Hans-Georg [Dienstleistungszentrum Laendlicher Raum (DLR) Rheinpfalz, Breitenweg 71, D-67435 Neustadt an der Weinstrasse (Germany)], E-mail: hans-georg.schmarr@dlr.rlp.de; Potouridis, Theodoros; Ganss, Sebastian; Sang, Wei; Koepp, Benedikt; Bokuz, Ursula; Fischer, Ulrich [Dienstleistungszentrum Laendlicher Raum (DLR) Rheinpfalz, Breitenweg 71, D-67435 Neustadt an der Weinstrasse (Germany)

2008-06-09

An improved method for the analysis of carbonyls is described utilizing a headspace solid-phase microextraction (HS-SPME) step and on-fiber derivatization with O-(2,3,4,5,6-pentafluorobenzyl)hydroxylamine (PFBHA) hydrochloride. Thermal desorption of the oxime derivatives formed on the fiber is followed by gas chromatographic separation coupled to an ion trap tandem mass spectrometer (GC-ITMS). Selecting specific fragment ions within the electron ionization (EI{sup +}) mass spectra of these oxime derivatives as precursor ions for MS-MS fragmentation provides a suitable method for the target analysis of individual carbonyl classes, such as alkanals, (E)-2-alkenals, (E,E)-2,4-alkadienals, and others. Retention indices on polar as well as on apolar stationary phases along with EI{sup +} mass spectra patterns are presented for a large set of oxime derivatives, giving valuable information needed for unambiguous assignment of substances in complex sample matrices. The fast sample preparation and derivatization step via HS-SPME can be automated and is applicable to a variety of biological samples and foodstuffs, allowing rapid and sensitive screening analyses of important aldehydic biomarkers and aroma active compounds.

An LC-MS method for determination of milbemycin oxime in dog plasma.

Science.gov (United States)

Xu, Qianqian; Li, Jichang; Shen, Zhiqiang; Guo, Shijin; Wang, Yubo; Li, Feng

2014-10-01

An HPLC-MS method has been developed and validated for the quantitative determination of milbemycin oxime (MBO) in dog plasma. The developed method has been then applied in in vivo clinical studies to obtain pharmacokinetics of MBO in blood after its oral administration. Samples were extracted using solid-phase extraction (SPE). Sample proteins were precipitated with acetonitrile (ACN) and sodium chloride (NaCl) and then diluted with methanol and water. Calibration standards were prepared by using plasma matrix and following the same SPE procedure. Chromatographic separation was performed on a Waters C18 packed column (3.5 μm particles diameter; 3 × 100 mm) with a C18 guard column (3.5 μm particles diameter; 3 × 20 mm). The mobile phase was an 85:15 (v/v) mixed solution of ACN and 5 mM ammonium acetate. The calibration curve was linear over a concentration range of 2.0-500 ng/mL with a limit of quantitation of 2.0 ng/mL. The oral administration of a pellet of 2.5 mg MBO produced blood concentrations ranging from 6.10 ± 0.92 to 78.81 ± 4.38 ng/mL within 6 h, with a terminal half-time of 11.66 ± 0.93 h. This study determined the suitability of the herein proposed method to investigate the pharmacokinetics of MBO after oral administration. © The Author [2013]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

33 CFR 117.823 - Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Fear River. 117.823 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.823 Cape Fear River. The draw of the Cape Fear Memorial Bridge, mile 26.8, at Wilmington need not open for the passage of vessel from 8...

2-Hydro-4-n-But oxypropiophenone Oxime as a spectrophotometric reagent for Fe (III)

International Nuclear Information System (INIS)

Purohit, K.; Desai, K.K.

2006-01-01

2-Hydro-4-n-But oxypropiophenone Oxime [Hipbone] has been synthesized and used for the spectrophotometric determination of Fe (III). The reagent gives purple coloured complex with Fe (III) in 50% alcoholic medium in pH range of 2.5-4.5. Beer's law is obeyed up to 23.1 ppm of Fe (III). Molar absorptivity and sandell's sensitivity at 500 nm of complex were found to be 7.062x 10 power2 lit.mol.cm and 0.079 ug of Fe (III)/cm respectively. Composition and stability constant have been determined. The reagent is successfully used for determination of Fe (III) in dolomite and in pharmaceutical sample. It is also used for the indirect determination of fluoride in tap water sample. (author)

Contribution of direct actions of the oxime HI-6 in reversing soman-induced muscle weakness in the rat diaphragm

Energy Technology Data Exchange (ETDEWEB)

Alder, M.; Maxwell, D.M.; Filbert, M.G.; Deshpande, S.S.

1994-12-31

The actions of the bispyridinium oxime HI-6 ((4-AMINOCARBONYL) PYRIDINO-methoxymethyl- 2-(HYDROXYIMINO)METHYL- pyridinium dichloride) were investigated in vitro on rat phrenic nerve-hemidiaphragm preparations. Isometric twitch and tetanic tensions were elicited at 37 deg C with supramaximal nerve stimulation at frequencies of 20 and 50 Hz. To approximate normal respiration patterns, trials consisting of 30 successive 0.55 5 trains were alternated with 1.25 5 rest periods. Under control conditions, the above stimulation pattern generated tensions that were well maintained at both frequencies. In contrast, a marked depression of muscle tension was observed in diaphragms removed from rats administered 339 ug/kg soman (3 LD50) and tested in vitro. Addition of HI-6, 4 h after soman exposure, led to a nearly complete recovery of muscle tension at 20 Hz. At 50 Hz, muscle tensions still declined especially when trains were elicited at 1.25 and 3 5 intervals. The recovery by HI-6 observed in this study appears to be mediated by mechanisms unrelated to acetylcholinesterase reactivation since no increase of enzymatic activity was detected and the effect was reversed by a brief washout in oxime-free physiological solution. The results suggest that the direct action of HI-6 may play a role in restoring soman-induced diaphragmatic failure but this effect would be significant primarily under low use conditions.

43 CFR 4.117 - Service of papers.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Service of papers. 4.117 Section 4.117... Service of papers. A copy of all pleadings, briefs, motions, letters, or other papers filed with the Board, shall be served upon the other party at the time of filing. Service of papers may be made personally or...

24 CFR 1710.117 - Cost sheet, signature of Senior Executive Officer.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Cost sheet, signature of Senior... REGISTRATION Reporting Requirements § 1710.117 Cost sheet, signature of Senior Executive Officer. (a) Cost... description of our subdivision and development plans. Signature of Senior Executive Officer (2) Cost sheet...

33 CFR 117.829 - Northeast Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast Cape Fear River. 117... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.829 Northeast Cape... the Seaboard System Railroad Bridge across the Northeast Cape Fear River, mile 27.0, at Castle Hayne...

Síntesis y evaluación “in vitro” de la actividad antifúngica de oximas, éteres de oxima e isoxazoles

Directory of Open Access Journals (Sweden)

John Diaz-Velandia

2011-12-01

Full Text Available Synthesis and in vitro assessment of antifungal activity of oximes, oxime ethers and isoxazoles. Objective. To synthesize and carryout a preliminary evaluation of the in vitro antifungal activity of oximes, oxime ethers and isoxazoles. Materials and methods. Oximeswere synthesized from aldehydes or ketones with NH2OH.HCl and K2CO3. Oxime ethers were prepared by alkylation of oximes withpropargyl bromide or 2-bromobenzyl bromide, using NaOH as base and acetone as solvent. The isoxazoles were obtained by 1,3-dipolarcycloadditions using ceric ammonium nitrate (CAN, chloramine T (CAT and NaOCl. Products were identified or characterized usingnuclear magnetic resonance (NMR and mass spectrometry (MS. Radial growth inhibition assays against Aspergillus niger and Fusariumroseum were carried out. Results. Five oximes, seven oxime ethers, four of them new, and four new isoxazoles were obtained. Theassessed substances exhibited antifungal activity in amounts of 1,5 mg and 3,0 mg. Conclusions. Although 1,3-dipolar cycloadditionsallowed to obtain the desired isoxazoles, this methodology produced a wide variety of side products that reduced yields and made difficultthe purification of the target products. Four of the tested compounds showed inhibition percentages greater than 80%.

33 CFR 117.753 - Ship Channel, Great Egg Harbor Bay.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ship Channel, Great Egg Harbor Bay. 117.753 Section 117.753 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.753 Ship Channel, Great Egg Harbor Bay. The draw of the S52 (Ship...

33 CFR 117.734 - Navesink River (Swimming River).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navesink River (Swimming River). 117.734 Section 117.734 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Swimming River). The Oceanic Bridge, mile 4.5, shall open on signal; except that, from December 1 through...

33 CFR 117.927 - Coosaw River (Whale Branch).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosaw River (Whale Branch). 117.927 Section 117.927 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Whale Branch). The draw of the Seaboard System Railroad bridge, mile 5.3 at Seabrook, and the draw of...

46 CFR 117.150 - Survival craft embarkation arrangements.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft embarkation arrangements. 117.150 Section... EQUIPMENT AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.150 Survival craft embarkation... apparatus when either— (1) The embarkation station for the survival craft is on a deck more than 4.5 meters...

29 CFR 779.117 - Salesmen and sales clerks.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Salesmen and sales clerks. 779.117 Section 779.117 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... sales clerks. A salesman or a sales clerk who regularly and recurrently takes orders for, or sells, or...

Evaluation and Computational Characterization of the Faciliated Transport of Glc Carbon C-1 Oxime Reactivators Across a Blood Brain Barrier Model

Science.gov (United States)

2013-01-01

blood brain barrier (BBB) to reactivate inhibited brain acetylcholinesterase (AChE). We selected glucose (Glc) transporters (GLUT) for this purpose as...Eur. J. Pharm. 332 (1997) 43–52. [4] N.J. Abbott , L. Ronnback, E. Hansson, Astrocyte-endothelial interactions at the blood –brain barrier, Nat. Rev...5a. CONTRACT NUMBER oxime reactivators across a blood brain barrier model 5b. GRANT NUMBER 1.E005.08.WR 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S

Development of 10kW SOFC module

Energy Technology Data Exchange (ETDEWEB)

Hisatome, N.; Nagata, K. [Mitsubishi Heavy Industries, Ltd., Nagasaki (Japan); Kakigami, S. [Electric Power Development Co., Inc., Tokyo (Japan)] [and others

1996-12-31

Mitsubishi Heavy industries, Ltd. (MHI) has been developing tubular type Solid Oxide Fuel Cells (SOFC) since 1984. A 1 kW module of SOFC has been continuously operated for 3,000 hours with 2 scheduled thermal cycles at Electric Power Development Co., Inc. (EPDC) Wakamatsu Power Station in 1993. We have obtained of 34% (HHV as H{sub 2}) module efficiency and deterioration rate of 2% Per 1,000 hours in this field test. As for next step, we have developed 10 kW module in 1995. The 10 kW module has been operated for 5,000 hours continuously. This module does not need heating support to maintain the operation temperature, and the module efficiency was 34% (HHV as H{sub 2}). On the other hand, we have started developing the technology of pressurized SOFC. In 1996, pressurized MW module has been tested at MHI Nagasaki Shipyard & Machinery, Works. We are now planning the development of pressurized 10 kW module.

40 CFR 81.117 - Southeast Missouri Intrastate Air Quality Control Region.

Science.gov (United States)

2010-07-01

... Quality Control Region. 81.117 Section 81.117 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.117 Southeast Missouri Intrastate Air Quality Control Region. The Southeast Missouri Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

49 CFR 215.117 - Defective roller bearing adapter.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing adapter. 215.117 Section... Suspension System § 215.117 Defective roller bearing adapter. A railroad may not place or continue in service a car, if the car has a roller bearing adapter that is— (a) Cracked or broken; (b) Not in its design...

117 - 122 Omoniyi et al

African Journals Online (AJOL)

User

Bayero Journal of Pure and Applied Sciences, 8(2): 117 – 122. Received: ... FOLLOWING MILD EXPOSURE. Omoniyi ... People who work with materials containing mere traces .... obscured physical effect in the animal model (Omoniyi et al.

41 CFR 102-117.110 - What is satisfactory service?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...

Synthesis of a New Element with Atomic Number Z=117

International Nuclear Information System (INIS)

Oganessian, Yu. Ts.; Abdullin, F. Sh.; Dmitriev, S. N.; Itkis, M. G.; Lobanov, Yu. V.; Mezentsev, A. N.; Polyakov, A. N.; Sagaidak, R. N.; Shirokovsky, I. V.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu. S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.; Bailey, P. D.; Benker, D. E.; Ezold, J. G.; Porter, C. E.; Riley, F. D.

2010-01-01

The discovery of a new chemical element with atomic number Z=117 is reported. The isotopes 293 117 and 294 117 were produced in fusion reactions between 48 Ca and 249 Bk. Decay chains involving 11 new nuclei were identified by means of the Dubna gas-filled recoil separator. The measured decay properties show a strong rise of stability for heavier isotopes with Z≥111, validating the concept of the long sought island of enhanced stability for superheavy nuclei.

Searching for the universal reactivator for treatment of pesticide poisoning

International Nuclear Information System (INIS)

Kuca, K.; Musilek, K.; Pohanka, M.; Jun, D.; Karasova, J.; Novotny, L.

2009-01-01

According to the present knowledge, none of the currently available oximes (pralidoxime, obidoxime, trimedoxime, MMB-4 or HI-6) originally developed for the treatment of the nerve agent poisonings is able to treat organophosphorus pesticide poisoning. Among them, obidoxime seems to be the best candidate, however, its high toxicity disfavors its application in the high quantities. As byproduct of our searching for the new nerve agent reactivators, we found that oxime K027 seems to be very promising in the case of the treatment of organophosphorus pesticide poisonings. Its reactivation potency is similar or better than that of obidoxime, and moreover, its acute toxicity is lower. Thanks to these results, this oxime seems to be the best candidate for future use as universal reactivator for the treatment of poisonings caused by organophosphorus pesticides. This work was supported by the Czech Grant Agency - project No. 305/07/P162.(author)

28 CFR 0.117 - Office of Chief Immigration Judge.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Office of Chief Immigration Judge. 0.117... Executive Office for Immigration Review § 0.117 Office of Chief Immigration Judge. The Chief Immigration Judge shall provide general supervision to the Immigration Judges in performance of their duties in...

42 CFR 84.117 - Gas mask containers; minimum requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Gas mask containers; minimum requirements. 84.117... SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Gas Masks § 84.117 Gas mask containers; minimum requirements. (a) Gas masks shall be equipped with a substantial...

CD117 expression in operable oesophageal squamous cell carcinomas predicts worse clinical outcome

Science.gov (United States)

Fan, Huijie; Yuan, Yuan; Wang, Junsheng; Zhou, Fuyou; Zhang, Mingzhi; Giercksky, Karl-Erik; Nesland, Jahn M; Suo, Zhenhe

2013-01-01

Aims To investigate the aberrant expression of CD117 in oesophageal squamous cell carcinoma (SCC) and its prognostic significance. Methods and results Immunohistochemical staining for CD117 was performed on tissue microarray and routine tissue sections from 157 oesophageal SCC patients and 10 normal oesophageal epithelia adjacent to tumour. The positive rate of CD117 expression was 29.9% in oesophageal SCC tissues, whereas no CD117 expression was detected in the 10 normal oesophageal epithelia. CD117 expression was significantly associated with T stage (P < 0.001), distant metastasis (P = 0.015), lymph node metastasis (P = 0.019), and clinical stage (P = 0.021). Progression-free survival in the patients with CD117-positive tumours was shorter than that in the patients with CD117-negative tumours (P = 0.010). In univariate analyses, CD117 expression was the most significant factor for overall survival of oesophageal SCC patients (P < 0.001), followed by lymph node metastasis (P = 0.001), T stage (P = 0.002), clinical stage (P = 0.006), distant metastasis (P = 0.020), and histological grade (P = 0.027). Multivariate analyses verified that CD117 expression was an independent prognostic marker for oesophageal SCC patients (P = 0.002). In addition, CD117 expression predicted poorer survival in patients without distant metastases. Conclusions CD117 expression in operable oesophageal SCC may be a valuable prognostic marker, and detection of its expression in clinical samples may be useful in defining a subclass of oesophageal SCCs with extremely poor clinical outcome, which may require a specially targeted treatment modality. PMID:23570416

33 CFR 117.181 - Oakland Inner Harbor Tidal Canal.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oakland Inner Harbor Tidal Canal. 117.181 Section 117.181 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Tidal Canal. The draws of the Alameda County highway drawbridges at Park Street, mile 5.2; Fruitvale...

7 CFR 800.117 - Who shall perform original services.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Who shall perform original services. 800.117 Section... REGULATIONS Original Services § 800.117 Who shall perform original services. (a) General. Original services... official agency is not available on a regular basis to provide original services, and no official agency...

Evaluation of technetium 99m cyclobutylpropylene amine oxime as a potential brain perfusion imaging agent for SPET

International Nuclear Information System (INIS)

Bacciottini, L.; Pupi, A.; Formiconi, A.R.; De Cristofaro, M.T.R.; Petti, A.R.M.; Meldolesi, U.

1990-01-01

99m Tc-labelled d,l-cyclobutylpropylene amine oxime ( 99m Tc-CBPAO) has been developed as a brain imaging agent for single photon emission tomography (SPET). 99m Tc-CBPAO can be prepared using a simple labelling procedure suitable for routine clinical use. It has a high in vitro stability, as has been demonstrated by high-pressure liquid chromatography (HPCL) analysis. This shows that 3 h after labelling, less than 5% of the primary lipophilic complex which is capable of crossing the blood-brain barrier (BBB) converts to a secondary hydrophilic complex. Brain uptake (% dose/g wet tissue) of 99m Tc-CBPAO, determined at 5 and 30 min after injection in two groups of six adult male Sprague-Dawley rats, was found to be 0.74±0.06 and 0.73±0.13 (mean±SD), respectively. These values are not significantly different from those obtained repeating the experiment with 99m Tc-labelled hexamethylpropylene amine oxime ( 99m Tc-HMPAO) (0.72±0.15 at 5 min and 0.88±0.24 at 30 min after injection). Since the rat brain uptake of 99m Tc-CBPAO remained unchanged for a period of time suitable for tomographic study, the comparison of the two tracers was extended to two groups of ten patients. The latter were affected by neurological and psychiatric disorders and were studied with SPET. Human brain uptake (% dose/cc cortical grey matter) of 99m Tc-CBPAO and 99m Tc-HMPAO were 3.04±0.57 and 4.22±0.46 (mean x 10 -3 ±SD x 10 -3 ), respectively, with a 32% significant difference. In two other groups of five patients, the first transit time-activity curves of the two tracers were compared. From the analysis of these curves we suggest that 99m Tc-CBPAO has a higher binding effect on blood components and/or a higher degradation rate in blood than that of 99m Tc-HMPAO. This may account for the reduced human brain uptake. In conclusion, SPET images of 99m Tc-CBPAO reflect blood perfusion, and they have a good diagnostic quality. The main advantage of 99m Tc-CBPAO is its in vitro stability

/sup 13/C-/sup 13/C spin-spin coupling constants in structural investigations. I. New method of determining the configuration of oximes and their derivatives

Energy Technology Data Exchange (ETDEWEB)

Krivdin, L.B.; Shcherbakov, V.V.; Kalabin, G.A.

1986-07-10

It was shown that the direct /sup 13/C-/sup 13/C spin-spin coupling constants can be used for the unambiguous identification of the configurational isomers of oximes and their derivatives. The stereospecificity of the constants is explained by the additional contribution from the unshared electron pair of the nitrogen atom to the spin-spin coupling constant between the adjacent carbon nuclei in the cis position.

Application of oxime-diversification to optimize ligand interactions within a cryptic pocket of the polo-like kinase 1 polo-box domain | Center for Cancer Research

Science.gov (United States)

By a process involving initial screening of a set of 87 aldehydes using an oxime ligation-based strategy, we were able to achieve a several-fold affinity enhancement over one of the most potent previously known polo-like kinase 1 (Plk1) polo-box domain (PBD) binding inhibitors. This improved binding may result by accessing a newly identified auxiliary region proximal to a key

32 CFR 536.117 - Statutory authority for maritime claims.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Statutory authority for maritime claims. 536.117... ACCOUNTS CLAIMS AGAINST THE UNITED STATES Maritime Claims § 536.117 Statutory authority for maritime claims. The Army Maritime Claims Settlement Act (AMCSA) (10 U.S.C. 4801-04, 4806, as amended) authorizes the...

25 CFR 117.23 - Transactions between guardian and ward.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Transactions between guardian and ward. 117.23 Section... COMPETENCY § 117.23 Transactions between guardian and ward. Business dealings between the guardian and his ward involving the sale or purchase of any property, real or personal, by the guardian to or from the...

Bifidobacterium breve MCC-117 Induces Tolerance in Porcine Intestinal Epithelial Cells: Study of the Mechanisms Involved in the Immunoregulatory Effect

Science.gov (United States)

MURATA, Kozue; TOMOSADA, Yohsuke; VILLENA, Julio; CHIBA, Eriko; SHIMAZU, Tomoyuki; ASO, Hisashi; IWABUCHI, Noriyuki; XIAO, Jin-zhong; SAITO, Tadao; KITAZAWA, Haruki

2014-01-01

Bifidobacterium breve MCC-117 is able to significantly reduce the expression of inflammatory cytokines in porcine intestinal epithelial (PIE) cells and to improve IL-10 levels in CD4+CD25high Foxp3+ lymphocytes in response to heat-stable enterotoxigenic Escherichia coli (ETEC) pathogen-associated molecular patterns (PAMPs), while the immunoregulatory effect of B. adolescentis ATCC15705 was significantly lower than that observed for the MCC-117 strain. Considering the different capacities of the two bifidobacterium strains to activate toll-like receptor (TLR)-2 and their differential immunoregulatory activities in PIE and immune cells, we hypothesized that comparative studies with both strains could provide important information regarding the molecular mechanism(s) involved in the anti-inflammatory activity of bifidobacteria. In this work, we demonstrated that the anti-inflammatory effect of B. breve MCC-117 was achieved by a complex interaction of multiple negative regulators of TLRs as well as inhibition of multiple signaling pathways. We showed that B. breve MCC-117 reduced heat-stable ETEC PAMP-induced NF-κB, p38 MAPK and PI3 K activation and expression of pro-inflammatory cytokines in PIE cells. In addition, we demonstrated that B. breve MCC-117 may activate TLR2 synergistically and cooperatively with one or more other pattern recognition receptors (PRRs), and that interactions may result in a coordinated sum of signals that induce the upregulation of A20, Bcl-3, Tollip and SIGIRR. Upregulation of these negative regulators could have an important physiological impact on maintaining or reestablishing homeostatic TLR signals in PIE cells. Therefore, in the present study, we gained insight into the molecular mechanisms involved in the immunoregulatory effect of B. breve MCC-117. PMID:24936377

Application of oxime-diversification to optimize ligand interactions within a cryptic pocket of the polo-like kinase 1 polo-box domain.

Science.gov (United States)

Zhao, Xue Zhi; Hymel, David; Burke, Terrence R

2016-10-15

By a process involving initial screening of a set of 87 aldehydes using an oxime ligation-based strategy, we were able to achieve a several-fold affinity enhancement over one of the most potent previously known polo-like kinase 1 (Plk1) polo-box domain (PBD) binding inhibitors. This improved binding may result by accessing a newly identified auxiliary region proximal to a key hydrophobic cryptic pocket on the surface of the protein. Our findings could have general applicability to the design of PBD-binding antagonists. Published by Elsevier Ltd.

29 CFR 570.117 - General.

Science.gov (United States)

2010-07-01

... to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS CHILD LABOR REGULATIONS, ORDERS AND STATEMENTS OF INTERPRETATION General Statements of Interpretation of the Child Labor Provisions of the Fair Labor Standards Act of 1938, as Amended Oppressive Child Labor § 570.117 General. (a...

7 CFR 28.117 - Fee for new memorandum or certificate.

Science.gov (United States)

2010-01-01

... 28.117 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD... Standards Act Fees and Costs § 28.117 Fee for new memorandum or certificate. For each new memorandum or...

NPA4K development system using object-oriented methodology

International Nuclear Information System (INIS)

Jeong, Kwang Seong; Hahn, Do Hee

2000-11-01

NPA4K consists of module programs with several components for various functions. Software components have to be developed systematically by compartment criteria and design method. In this paper, the understandings of a typical Object-Oriented Methodology , UML(Unified Modeling Language), the procedure for NPA4K program development and the architecture for long-term development of NPA4K are introduced

NPA4K development system using object-oriented methodology

Energy Technology Data Exchange (ETDEWEB)

Jeong, Kwang Seong; Hahn, Do Hee

2000-11-01

NPA4K consists of module programs with several components for various functions. Software components have to be developed systematically by compartment criteria and design method. In this paper, the understandings of a typical Object-Oriented Methodology , UML(Unified Modeling Language), the procedure for NPA4K program development and the architecture for long-term development of NPA4K are introduced.

Synthesis of (19E)-3 beta,7 alpha-dihydroxy-17-oxoandrost-5-en-19-al 19-(O-carboxymethyl)oxime, a new hapten for 7 alpha-hydroxydehydroepiandrosterone (3 beta,7 alpha-dihydroxyandrost-5-en-17-one).

Science.gov (United States)

Pouzar, V; Slavíková, T; Cerńy, I

1998-09-01

The title compound was prepared in 11 steps from 17,17-ethylenedioxy-19-hydroxyandrost-5-en-3 beta-yl acetate. After tert-butyldimethylsilyl protection of the 19-hydroxyl group, a 7-oxo group was introduced by oxidation with 3,5-dimethylpyrazole-chromium trioxide complex, and then selectively reduced with L-Selectride to give a 7 alpha-hydroxy derivative. This partially protected triol was acetylated and desilylated to 3,7-diacetate. Subsequent oxidation with pyridine-chromium trioxide complex gave 19-aldehyde, which was transformed into the corresponding protected 19-(O-carboxymethyl)oxime. Successive ketal cleavage, deacetylation, and methyl ester splitting gave the final (19E)-3 beta,7 alpha-dihydroxy-17-oxoandrost-5-en-19-al 19-(O-carboxymethyl)oxime, designed as a hapten for 7 alpha-hydroxydehydroepiandrosterone immunoassays.

37 CFR 1.17 - Patent application and reexamination processing fees.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application and reexamination processing fees. 1.17 Section 1.17 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions Fees...

Diagnostic value of CD117 in differential diagnosis of acute leukemias.

Science.gov (United States)

Ahmadi, Abbas; Poorfathollah, Ali-Akbar; Aghaiipour, Mahnaz; Rezaei, Mansour; Nikoo-ghoftar, Mahin; Abdi, Mohammad; Gharib, Alireza; Amini, Amir

2014-07-01

C-kit receptor (CD117) and its ligand, stem cell factor, play a key role in normal hematopoiesis. It has been demonstrated that its expression extremely increases in leukemias with myeloid commitment. We analyzed findings on CD117 expression together with other myeloid related markers in 203 de novo acute leukemias, referred to Iranian immunophenotyping centers: Iranian Blood Transfusion Organization (IBTO) and Baghiatallah Hospital (BH). All cases were characterized based on the French American British cooperative group (FAB) and European Group for Immunological Classification of Leukemias (EGIL). The cases comprised of 111 acute myeloblastic leukemia (AML), 86 acute lymphoblastic leukemia (ALL), and 6 acute undifferentiated leukemia (AUL). CD117 was positive in 75 % of AML and 50 % of AUL, whereas none of the ALL cases was positive for this marker. Although CD117 was positive in 100 % of M5a cases, no M5b positive was found (p = 0.036). The calculated specificity for myeloid involvement was 100 % for CD117 and CD33, and 98 % for CD13 and CD15 (p acute leukemias.

Boiling points of the superheavy elements 117 and 118

International Nuclear Information System (INIS)

Takahashi, N.

2001-01-01

It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

33 CFR 117.458 - Inner Harbor Navigation Canal, New Orleans.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Inner Harbor Navigation Canal, New Orleans. 117.458 Section 117.458 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Harbor Navigation Canal, New Orleans. (a) The draws of the SR 46 (St. Claude Avenue) bridge, mile 0.5...

29 CFR 794.117 - Effect of franchises and other arrangements.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Effect of franchises and other arrangements. 794.117... âindependently Owned and Controlled Local Enterpriseâ § 794.117 Effect of franchises and other arrangements. Whether a franchise or other contractual arrangement affects the status of the enterprise as “an...

14 CFR 65.117 - Military riggers or former military riggers: Special certification rule.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Military riggers or former military riggers: Special certification rule. 65.117 Section 65.117 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... Riggers § 65.117 Military riggers or former military riggers: Special certification rule. In place of the...

26 CFR 521.117 - Claims in cases of double taxation.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Claims in cases of double taxation. 521.117...) REGULATIONS UNDER TAX CONVENTIONS DENMARK General Income Tax Taxation of Nonresident Aliens Who Are Residents of Denmark and of Danish Corporations § 521.117 Claims in cases of double taxation. Under Article XX...

Efficacy of fenbendazole and milbemycin oxime for treating baboons (Papio cynocephalus anubis) infected with Trichuris trichiura.

Science.gov (United States)

Reichard, Mason V; Wolf, Roman F; Carey, David W; Garrett, Jennifer Jane; Briscoe, Heather A

2007-03-01

We evaluated the efficacy of fenbendazole (FBZ) and milbemycin oxime (MO) in the treatment of baboons (Papio cynocephalus anubis) with naturally acquired Trichuris trichiura infection by comparing fecal egg count reduction (FECR) tests. We assigned 7 baboons, each singly housed and confirmed infected with T. trichiura, to treatment groups of FBZ (n=3) or MO (n=3), or as a control (n=1). All (100%) baboons that received FBZ stopped shedding T. trichiura eggs within 6 d of treatment, and fecal egg counts remained negative at 65 d after treatment. Although the number of T. trichiura eggs shed per gram of feces from 2 (67%) baboons decreased significantly after the second treatment with MO, this regimen never totally eliminated eggs of T. trichiura. The results of our study indicate that FBZ was more effective for treating baboons with T. trichiura than was MO.

33 CFR 117.921 - Broad River.

Science.gov (United States)

2010-07-01

... OPERATION REGULATIONS Specific Requirements South Carolina § 117.921 Broad River. (a) The draw of the S170 bridge, mile 14.0 near Beaufort, shall open on signal if at least 24 hours notice is given. (b) The draw...

Ciliopathy Protein Tmem107 Plays Multiple Roles in Craniofacial Development

Czech Academy of Sciences Publication Activity Database

Celá, Petra; Hampl, Marek; Shylo, N.; Christopher, K. J.; Kavková, M.; Landová, Marie; Zikmund, T.; Weatherbee, S. D.; Kaiser, J.; Buchtová, Marcela

2018-01-01

Roč. 97, č. 1 (2018), s. 108-117 ISSN 0022-0345 R&D Projects: GA ČR(CZ) GB14-37368G; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : craniofacial anomalies * growth/development * mineralized tissue/development * orofacial clefts * cell signaling Subject RIV: EA - Cell Biology Impact factor: 4.755, year: 2016

0+ analogue state in 118Sb from 117Sn(p,nγ) reaction

International Nuclear Information System (INIS)

Pal, J.; Dey, C.C.; Bose, S.; Sinha, B.K.; Chatterjee, M.B.; Mahapatra, D.P.

1996-01-01

The analogue of the 0 + ground state in 118 Sn has been observed in the compound nucleus 118 Sb through 117 Sn(p,nγ) 117 Sb reaction. The neutron decays of this analogue resonance have been studied from the deexciting γ-rays of the residual nucleus 117 Sb. From off resonance excitation functions, spin assignments have been made to states in 117 Sb, on the basis of Hauser-Feshbach formalism. The resonance parameters of the isobaric analogue resonance have been determined, including the total, proton and neutron decay widths. (orig.)

Reactions of Cp2MCl2 (M=Ti or Zr with Imine-Oxime Ligands. Formation of Metallacycles

Directory of Open Access Journals (Sweden)

C. Tripathi

2005-07-01

Full Text Available The reactions of bis(cyclopentadienyltitanium(IV/zirconium(IV dichloridewith a series of imine-oxime ligands (LH2, derived by condensing benzil-α-monoxime and2-phenylenediamine, 4-phenylenediamine, 4-methyl-2-phenylenediamine, 2,6-diamino-pyridine, have been studied in anhydrous tetrahydrofuran in the presence of base andmetallocycles of the [Cp2M(L] (M=Ti or Zr type have been isolated. Tentative structureshave been proposed for the products based on elemental analysis, electrical conductance andspectral (electronic, IR and 1H-NMR data. Proton NMR spectra indicate that on the NMRtime scale there is rapid rotation of the cyclopentadienyl ring around the metal-ring axis at25oC. Studies were conducted to assess the growth inhibiting potential of the complexessynthesized and the ligands against various bacterial strains.

33 CFR 25.117 - Proof of amount claimed for personal injury or death.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Proof of amount claimed for personal injury or death. 25.117 Section 25.117 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL CLAIMS General § 25.117 Proof of amount claimed for personal injury or death. The following evidence must be presented...

Probing the Carbonyl Functionality of a Petroleum Resin and Asphaltene through Oximation and Schiff Base Formation in Conjunction with N-15 NMR.

Directory of Open Access Journals (Sweden)

Kevin A Thorn

Full Text Available Despite recent advances in spectroscopic techniques, there is uncertainty regarding the nature of the carbonyl groups in the asphaltene and resin fractions of crude oil, information necessary for an understanding of the physical properties and environmental fate of these materials. Carbonyl and hydroxyl group functionalities are not observed in natural abundance 13C nuclear magnetic resonance (NMR spectra of asphaltenes and resins and therefore require spin labeling techniques for detection. In this study, the carbonyl functionalities of the resin and asphaltene fractions from a light aliphatic crude oil that is the source of groundwater contamination at the long term USGS study site near Bemidji, Minnesota, have been examined through reaction with 15N-labeled hydroxylamine and aniline in conjunction with analysis by solid and liquid state 15N NMR. Ketone groups were revealed through 15N NMR detection of their oxime and Schiff base derivatives, and esters through their hydroxamic acid derivatives. Anilinohydroquinone adducts provided evidence for quinones. Some possible configurations of the ketone groups in the resin and asphaltene fractions can be inferred from a consideration of the likely reactions that lead to heterocyclic condensation products with aniline and to the Beckmann reaction products from the initially formed oximes. These include aromatic ketones and ketones adjacent to quaternary carbon centers, β-hydroxyketones, β-diketones, and β-ketoesters. In a solid state cross polarization/magic angle spinning (CP/MAS 15N NMR spectrum recorded on the underivatized asphaltene as a control, carbazole and pyrrole-like nitrogens were the major naturally abundant nitrogens detected.

Probing the carbonyl functionality of a petroleum resin and asphaltene through oximation and schiff base formation in conjunction with N-15 NMR

Science.gov (United States)

Thorn, Kevin A.; Cox, Larry G.

2015-01-01

Despite recent advances in spectroscopic techniques, there is uncertainty regarding the nature of the carbonyl groups in the asphaltene and resin fractions of crude oil, information necessary for an understanding of the physical properties and environmental fate of these materials. Carbonyl and hydroxyl group functionalities are not observed in natural abundance 13C nuclear magnetic resonance (NMR) spectra of asphaltenes and resins and therefore require spin labeling techniques for detection. In this study, the carbonyl functionalities of the resin and asphaltene fractions from a light aliphatic crude oil that is the source of groundwater contamination at the long term USGS study site near Bemidji, Minnesota, have been examined through reaction with 15N-labeled hydroxylamine and aniline in conjunction with analysis by solid and liquid state 15N NMR. Ketone groups were revealed through 15N NMR detection of their oxime and Schiff base derivatives, and esters through their hydroxamic acid derivatives. Anilinohydroquinone adducts provided evidence for quinones. Some possible configurations of the ketone groups in the resin and asphaltene fractions can be inferred from a consideration of the likely reactions that lead to heterocyclic condensation products with aniline and to the Beckmann reaction products from the initially formed oximes. These include aromatic ketones and ketones adjacent to quaternary carbon centers, β-hydroxyketones, β-diketones, and β-ketoesters. In a solid state cross polarization/magic angle spinning (CP/MAS) 15N NMR spectrum recorded on the underivatized asphaltene as a control, carbazole and pyrrole-like nitrogens were the major naturally abundant nitrogens detected.

Method for palliation of pain in human bone cancer using therapeutic tin-117m compositions

International Nuclear Information System (INIS)

Srivastava, S.C.; Meinken, G.E.; Mausner, L.F.; Atkins, H.L.

1998-01-01

The invention provides a method for the palliation of bone pain due to cancer by the administration of a unique dosage of a tin-117m (Sn-117m) stannic chelate complex in a pharmaceutically acceptable composition. In addition, the invention provides a method for simultaneous palliation of bone pain and radiotherapy in cancer patients using compositions containing Sn-117m chelates. The invention also provides a method for palliating bone pain in cancer patients using Sn-117m-containing compositions and monitoring patient status by imaging the distribution of the Sn-117m in the patients. Also provided are pharmaceutically acceptable compositions containing Sn-117m chelate complexes for the palliation of bone pain in cancer patients. 5 figs

Radiation deterioration of ion-exchange Nafion N117CS membranes

International Nuclear Information System (INIS)

Iwai, Yasunori; Hiroki, Akihiro; Tamada, Masao; Isobe, Kanetsugu; Yamanishi, Toshihiko

2010-01-01

The cation-exchange Nafion N117 membranes swelling in electrolyte solution were irradiated with γ-rays or electron beams at various doses up to 1500 kGy in the temperature range from room temperature to 343 K to obtain detailed information on the effect of ion-exchange on the radiation deterioration in mechanical properties and ion-exchange capacity. Considerable deterioration in mechanical properties was observed when the Nafion membranes swelling in electrolyte solution were irradiated. A reason is the promotion of degradation with oxygen molecules produced by the irradiation of electrolyte solution. The concentration of electrolyte solution influenced strongly the radiation deterioration in mechanical properties. Keeping the concentration of metal ions to be negligible is important when electrolyzed highly radioactive solution in the light of the durability of polyperfluorosulfonic acid (PFSA) membrane. A sort of cation in electrolyte solution negligibly influenced radiation deterioration in mechanical properties. A sort of anion in electrolyte solution had negligible effect on radiation deterioration in mechanical properties and ion-exchange capacity. The discrepancy in the radiation deterioration in mechanical properties of Nafion membranes swelling in NaCl solution was observed between the specimens irradiated with γ-rays and electron beams. This discrepancy can be explained from the low diffusivity of oxygen from bulk into the membrane.

Contemporary developments in algebraic K-theory

International Nuclear Information System (INIS)

Karoubi, M.; Kuku, A.O.; Pedrini, C.

2003-01-01

The School and Conference on Algebraic K-theory which took place at ICTP July 8-26, 2002 was a follow-up to the earlier one in 1997, and like its predecessor, the 2002 meeting endeavoured to emphasise the multidisciplinary aspects of the subject. However, one special feature of the 2002 School and Conference is that the whole activity was dedicated to H. Bass, one of the founders of Algebraic K-theory, on the occasion of his seventieth birthday. The School during the first two weeks, July 8 to 19 was devoted to expository lectures meant to explore and highlight connections between K-theory and several other areas of mathematics - Algebraic Topology, Number theory, Algebraic Geometry, Representation theory, and Non-commutative Geometry. This volume, constituting the Proceedings of the School, is dedicated to H. Bass. The Proceedings of the Conference during the last week July 22 - 26, which will appear in Special issues of K-theory, is also dedicated to H. Bass. The opening contribution by M. Karoubi to this volume consists of a comprehensive survey of developments in K-theory in the last forty-five years, and covers a very broad spectrum of the subject, including Topological K-theory, Atiyah-Singer index theorem, K-theory of Banach algebras, Higher Algebraic K-theory, Cyclic Homology etc. J. Berrick's contribution on 'Algebraic K-theory and Algebraic Topology' treats the various topological constructions of Algebraic K-theory together with the underlying homotopy theory. Topics covered include the plus construction together with its various ramifications and applications, Topological Hochschild and Cyclic Homology as well as K-theory of the ring of integers. The contributions by M. Kolster titled 'K-theory and Arithmetics' includes such topics as values of zeta functions and relations to K-theory, K-theory of integers in number fields and associated conjectures, Etale cohomology, Iwasawa theory etc. A.O. Kuku's contributions on 'K-theory and Representation theory

Contemporary developments in algebraic K-theory

Energy Technology Data Exchange (ETDEWEB)

Karoubi, M [Univ. Paris (France); Kuku, A O [Abdus Salam International Centre for Theoretical Physics, Trieste (Italy); Pedrini, C [Univ. Genova (Italy)

2003-09-15

The School and Conference on Algebraic K-theory which took place at ICTP July 8-26, 2002 was a follow-up to the earlier one in 1997, and like its predecessor, the 2002 meeting endeavoured to emphasise the multidisciplinary aspects of the subject. However, one special feature of the 2002 School and Conference is that the whole activity was dedicated to H. Bass, one of the founders of Algebraic K-theory, on the occasion of his seventieth birthday. The School during the first two weeks, July 8 to 19 was devoted to expository lectures meant to explore and highlight connections between K-theory and several other areas of mathematics - Algebraic Topology, Number theory, Algebraic Geometry, Representation theory, and Non-commutative Geometry. This volume, constituting the Proceedings of the School, is dedicated to H. Bass. The Proceedings of the Conference during the last week July 22 - 26, which will appear in Special issues of K-theory, is also dedicated to H. Bass. The opening contribution by M. Karoubi to this volume consists of a comprehensive survey of developments in K-theory in the last forty-five years, and covers a very broad spectrum of the subject, including Topological K-theory, Atiyah-Singer index theorem, K-theory of Banach algebras, Higher Algebraic K-theory, Cyclic Homology etc. J. Berrick's contribution on 'Algebraic K-theory and Algebraic Topology' treats the various topological constructions of Algebraic K-theory together with the underlying homotopy theory. Topics covered include the plus construction together with its various ramifications and applications, Topological Hochschild and Cyclic Homology as well as K-theory of the ring of integers. The contributions by M. Kolster titled 'K-theory and Arithmetics' includes such topics as values of zeta functions and relations to K-theory, K-theory of integers in number fields and associated conjectures, Etale cohomology, Iwasawa theory etc. A.O. Kuku's contributions on 'K-theory and Representation theory

46 CFR 117.202 - Survival craft-vessels operating on oceans routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on oceans routes. 117... LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.202 Survival craft—vessels... number of overnight persons allowed, the survival craft requirements contained in paragraph (e) of this...

41 CFR 102-117.105 - What does best value mean when routing a shipment?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does best value mean when routing a shipment? 102-117.105 Section 102-117.105 Public Contracts and Property Management... 117-TRANSPORTATION MANAGEMENT Business Rules To Consider Before Shipping Freight or Household Goods...

Complexes of o-Vanillin oxime with La(III), Ce(III), Nd(III), Sm(III), Gd(III), Tb(III), Dy(III), Ho(III) and Yb(III)

International Nuclear Information System (INIS)

Dhar, M.L.; Gupta, V.K.; Singh, Onkar

1988-01-01

Ten complexes of lanthanides with o-vanillin oxime have been swynthesised and characterised. The composition of the complexes as determined by elemental and thermal analyses, infrared electronic spectral and magnetic moment studies is [Ln(C 8 H 8 NO 3 ) 3 .XH 2 O], where X=2 when Ln=La, Ce, Pr, Nd, Sm and X=3 when Ln=Gd, Dy, Tb, Ho, Yb; C 8 H 8 NO 3 - represents the anion of the ligand. (author). 16 refs., 2 figs., 2 tables

32 CFR 842.117 - Delegations of authority.

Science.gov (United States)

2010-07-01

... LITIGATION ADMINISTRATIVE CLAIMS Hospital Recovery Claims (42 U.S.C. 2651-2653) § 842.117 Delegations of... USAFE, and the SJAs of each Air Force base, station, or fixed installation have delegated authority to...

33 CFR 117.1049 - Lake Washington.

Science.gov (United States)

2010-07-01

... Evergreen Point Floating Bridge between Seattle and Bellevue shall operate as follows: (a) The draw shall open on signal if at least two hours notice is given. (b) Telephone requests for bridge opening may be... 117.1049 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

33 CFR 117.417 - Ohio River.

Science.gov (United States)

2010-07-01

....417 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.417 Ohio River. The draw of the Southern Railway railroad bridge, mile 607.4 at New Albany, Indiana, need not be opened for the passage of vessels. [CGD 82...

33 CFR 117.213 - New Haven Harbor, Quinnipiac and Mill Rivers.

Science.gov (United States)

2010-07-01

... Mill Rivers. 117.213 Section 117.213 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Haven Harbor, Quinnipiac and Mill Rivers. The draws of the Tomlinson bridge, mile 0.0, the Ferry Street... bridge, mile 0.4 across Mill River, shall operate as follows: (a) The draws shall open on signal; except...

46 CFR 117.208 - Survival craft-vessels operating on rivers routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on rivers routes. 117... LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.208 Survival craft—vessels... vessel certificated to operate on a rivers route in warm water is not required to carry survival craft...

CD117 immunoexpression in canine mast cell tumours: correlations with pathological variables and proliferation markers

Directory of Open Access Journals (Sweden)

Pires Maria A

2007-08-01

Full Text Available Abstract Background Cutaneous mast cell tumours are one of the most common neoplasms in dogs and show a highly variable biologic behaviour. Several prognosis tools have been proposed for canine mast cell tumours, including histological grading and cell proliferation markers. CD117 is a receptor tyrosine kinase thought to play a key role in human and canine mast cell neoplasms. Normal (membrane-associated and aberrant (cytoplasmic, focal or diffuse CD117 immunoexpression patterns have been identified in canine mast cell tumours. Cytoplasmic CD117 expression has been found to correlate with higher histological grade and with a worsened post-surgical prognosis. This study addresses the role of CD117 in canine mast cell tumours by studying the correlations between CD117 immunoexpression patterns, two proliferation markers (Ki67 and AgNORs histological grade, and several other pathological variables. Results Highly significant (p Conclusion These findings highlight the key role of CD117 in the biopathology of canine MCTs and confirm the relationship between aberrant CD117 expression and increased cell proliferation and higher histological grade. Further studies are needed to unravel the cellular mechanisms underlying focal and diffuse cytoplasmic CD117 staining patterns, and their respective biopathologic relevance.

Complete Genome Sequences of Isolates of Enterococcus faecium Sequence Type 117, a Globally Disseminated Multidrug-Resistant Clone

Science.gov (United States)

Tedim, Ana P.; Lanza, Val F.; Manrique, Marina; Pareja, Eduardo; Ruiz-Garbajosa, Patricia; Cantón, Rafael; Baquero, Fernando; Tobes, Raquel

2017-01-01

ABSTRACT The emergence of nosocomial infections by multidrug-resistant sequence type 117 (ST117) Enterococcus faecium has been reported in several European countries. ST117 has been detected in Spanish hospitals as one of the main causes of bloodstream infections. We analyzed genome variations of ST117 strains isolated in Madrid and describe the first ST117 closed genome sequences. PMID:28360174

33 CFR 117.833 - Pasquotank River.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.833 Pasquotank River. (a) The draw of the Albemarle & Chesapeake railroad bridge, mile 47.7, at Elizabeth City, North Carolina, shall... the train has cleared the bridge. (b) The draw of the US 158 Highway Bridge, mile 50.7, at Elizabeth...

FTIR study of the photoreaction of bovine rhodopsin in the presence of hydroxylamine.

Science.gov (United States)

Katayama, Kota; Furutani, Yuji; Kandori, Hideki

2010-07-15

In bovine rhodopsin, 11-cis-retinal forms a Schiff base linkage with Lys296. The Schiff base is not reactive to hydroxylamine in the dark, which is consistent with the well-protected retinal binding site. In contrast, under illumination it easily forms all-trans retinal oxime, resulting in the loss of color. This suggests that activation of rhodopsin creates a specific reaction channel for hydroxylamine or loosens the chromophore binding pocket. In the present study, to extract structural information on the Schiff base vicinity and to understand the changes upon activation of rhodopsin, we compared light-induced FTIR difference spectra of bovine rhodopsin in the presence and absence of hydroxylamine under physiological pH (approximately 7). Although the previous FTIR study did not observe the complex formation between rhodopsin and G-protein transducin in hydrated films, the present study clearly shows that hydrated films can be used for studies of the interaction between rhodopsin and hydroxylamine. Hydroxylamine does not react with the Schiff base of Meta-I intermediate trapped at 240 K, possibly because of decreased conformational motions under the frozen environment, while FTIR spectroscopy showed that hydroxylamine affects the hydrogen bonds of the Schiff base and water molecules in Meta-I. In contrast, formation of the retinal oxime was clearly observed at 280 K, the characteristic temperature of Meta-II accumulation in the absence of hydroxylamine, and time-dependent formation of retinal oxime was observed from Meta-II at 265 K as well. The obtained difference FTIR spectra of retinal oxime and opsin are different from that of Meta-II. It is likely that the antiparallel beta-sheet constituting a part of the retinal binding pocket at the extracellular surface is structurally disrupted in the presence of hydroxylamine, which allows the hydrolysis of the Schiff base into retinal oxime.

41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?

Science.gov (United States)

2010-07-01

...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...

Studies project development off U.K

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that capital spending on U.K. Continental Shelf (UKCS) oil and gas development in 1992-94 will reach about $36 billion, Arthur Andersen Petroleum Services (AAPS) predicts. Expenditures during the 3 year period would be about 55% more than capital spending for UKCS development in 1989-91 AAPS noted. Another industry forecast, by Grampian Regional Council, Aberdeen, estimates more than 90 new fields could be developed on the UKCS during the next 20 years

Extraction of uranium(VI) by emulsion liquid membrane containing 5,8-diethyl-7-hydroxy-6-dodecanone oxime

International Nuclear Information System (INIS)

Akiba, Kenichi; Takahashi, Toshihiko; Kanno, Takuji

1984-01-01

Extraction of uranium(VI) by a liquid surfactant membrane has been studied. The stability of water-in-oil (w/o) emulsion dispersed in the continuous aqueous phase increased with an increase in surfactant concentrations and in the fraction of the organic phase in emulsion globules. Uranium(VI) in dilute acid solutions was extracted into (w/o) emulsions containing 5,8-diethyl-7-hydroxy-6-dodecanone oxime (LIX 63) as a mobile carrier and its concentration decreased according to [U]sub(t)=[U]sub(o)exp(-ksub(obsd)t). The apparent rate constants (ksub(obsd)) increased with an increase in carrier concentrations and in external pH values, while they were slightly dependent on the stripping acid concentrations. Uranium was transported and concentrated into the internal aqueous droplets. The final concentration of uranium in the external aqueous phase dropped to about 10 -3 of its initial value. (author)

Development of 66 kV/6.9 kV 2 MV A prototype HTS power transformer

International Nuclear Information System (INIS)

Bohno, T.; Tomioka, A.; Imaizumi, M.; Sanuki, Y.; Yamamoto, T.; Yasukawa, Y.; Ono, H.; Yagi, Y.; Iwadate, K.

2005-01-01

We have developed the technology of the producing a HTS magnet for the power transformer. Three subjects have been mainly studied, high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies to establish the technology of 66 kV/6.9 kV 10 MV A class HTS power transformer. In order to verify the validity of elemental technologies, such as high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies, single-phase 2 MV A class 66 kV/6.9 kV prototype HTS transformer was manufactured and tested. In the load loss (AC loss) measurement, it was obtained that the measured value of 633 W was almost corresponding to the calculated value of 576 W at the rated operation of 2 MV A. Moreover, the breakdown was not found all voltage withstand test. These test results indicate that elemental technologies were established for the development of 66 kV/6.9 kV 10 MV A class HTS power transformer

Scopadulciol, an inhibitor of gastric H+, K(+)-ATPase from Scoparia dulcis, and its structure-activity relationships.

Science.gov (United States)

Hayashi, T; Asano, S; Mizutani, M; Takeguchi, N; Kojima, T; Okamura, K; Morita, N

1991-01-01

A new tetracyclic diterpenoid, scopadulciol [3], together with 6-methoxybenzoxazolinone, glutinol, and acacetin, was isolated from the 70% EtOH extract of Scoparia dulcis collected in Taiwan. Its structure was elucidated to be 6 beta-benzoyl-12-methyl-13-oxo-9(12)a,9(12)b-dihomo-18-podocarpanol on the basis of spectral data. It mildly inhibited hog gastric H+, K(+)-ATPase. Examination of the inhibitory activities of derivatives of scopadulcic acid B [2], including 3, revealed that methylation of the carboxyl group and introduction of an acetyl group or oxime at C-13 or C-18 markedly enhanced the inhibitory activity, while debenzoylation reduced the activity. Among the 30 compounds tested, compound 12, a methyl ester of scopadulcic acid B [2], showed the most potent activity.

33 CFR 117.824 - Neuse River.

Science.gov (United States)

2010-07-01

... OPERATION REGULATIONS Specific Requirements North Carolina § 117.824 Neuse River. (a) The draw of the U.S... for public vessels of the United States. (4) Shall open on signal at all other times. (b) The draw of the Atlantic and East Carolina Railway bridge, mile 80.0 at Kinston, shall open on signal if at least...

21 CFR 111.117 - What quality control operations are required for equipment, instruments, and controls?

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for equipment, instruments, and controls? 111.117 Section 111.117 Food and Drugs FOOD AND DRUG ADMINISTRATION... and Process Control System: Requirements for Quality Control § 111.117 What quality control operations...

Synthesis, Biological Evaluation, and Docking Studies of Novel Bisquaternary Aldoxime Reactivators on Acetylcholinesterase and Butyrylcholinesterase Inhibited by Paraoxon

Directory of Open Access Journals (Sweden)

Kamil Kuca

2018-05-01

Full Text Available Nerve agents and oxon forms of organophosphorus pesticides act as strong irreversible inhibitors of two cholinesterases in the human body: acetylcholinesterase (AChE; EC 3.1.1.7 and butyrylcholinesterase (BChE; EC 3.1.1.8, and are therefore highly toxic compounds. For the recovery of inhibited AChE, antidotes from the group of pyridinium or bispyridinium aldoxime reactivators (pralidoxime, obidoxime, HI-6 are used in combination with anticholinergics and anticonvulsives. Therapeutic efficacy of reactivators (called “oximes” depends on their chemical structure and also the type of organophosphorus inhibitor. Three novel oximes (K131, K142, K153 with an oxime group in position four of the pyridinium ring were designed and then tested for their potency to reactivate human (Homo sapiens sapiens AChE (HssACHE and BChE (HssBChE inhibited by the pesticide paraoxon (diethyl 4-nitrophenyl phosphate. According to the obtained results, none of the prepared oximes were able to satisfactorily reactivate paraoxon-inhibited cholinesterases. On the contrary, extraordinary activity of obidoxime in the case of paraoxon-inhibited HssAChE reactivation was confirmed. Additional docking studies pointed to possible explanations for these results.

Nitrogen Monitoring of West Hackberry 117 Cavern Wells

Energy Technology Data Exchange (ETDEWEB)

Bettin, Giorgia [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lord, David L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-02-01

U.S. Strategic Petroleum Reserve (SPR) oil storage cavern West Hackberry 117 was tested under extended nitrogen monitoring following a successful mechanical integrity test in order to validate a newly developed hydrostatic column model to be used to differentiate between normal "tight" well behavior and small-leak behavior under nitrogen. High resolution wireline pressure and temperature data were collected during the test period and used in conjunction with the hydrostatic column model to predict the nitrogen/oil interface and the pressure along the entire fluid column from the bradenhead flange nominally at ground surface to bottom of brine pool. Results here and for other SPR caverns have shown that wells under long term nitrogen monitoring do not necessarily pressurize with a relative rate (P N2 /P brine) of 1. The theoretical relative pressure rate depends on the well configuration, pressure and the location of the nitrogen-oil interface and varies from well to well. For the case of WH117 the predicted rates were 0.73 for well A and 0.92 for well B. The measured relative pressurization rate for well B was consistent with the model prediction, while well A rate was found to be between 0.58-0.68. A number of possible reasons for the discrepancy between the model and measured rates of well A are possible. These include modeling inaccuracy, measurement inaccuracy or the possibility of the presence of a very small leak (below the latest calculated minimum detectable leak rate).

Search for positive parity bands in 117Xe

International Nuclear Information System (INIS)

Liu, Z.; Sun, X.; Zhou, X.; Lei, X.; Zhang, Y.; Jin, H.; Pan, Q.; Guo, Y.; Chen, X.; Luo, Y.; Wen, S.; Yuan, G.; Yang, C.; Luo, W.; Chen, Y.S.; Xing, Z.; Chen, X.Q.

1995-01-01

Excited states of 117 Xe were populated via the reaction 28 Si+ 92 Mo at 100-120MeV. More than 40 new γ-transitions and three new positive parity bands have been observed by means of in-beam γ-ray spectroscopy. The previously known νh 11/2 bands were confirmed, and the νg 7/2 favored band was extended up to 47/2 + in which two bandcrossings have been observed at hω=0.33 and 0.44MeV, respectively. The band structures have been discussed by means of TRS and CSM calculations. A newly observed rotational band consisting of five γ-transitions has been considered as the πh 11/2 band of 117 Cs. ((orig.))

Production of Sn-117m in the BR2 high-flux reactor.

Science.gov (United States)

Ponsard, B; Srivastava, S C; Mausner, L F; Russ Knapp, F F; Garland, M A; Mirzadeh, S

2009-01-01

The BR2 reactor is a 100MW(th) high-flux 'materials testing reactor', which produces a wide range of radioisotopes for various applications in nuclear medicine and industry. Tin-117m ((117m)Sn), a promising radionuclide for therapeutic applications, and its production have been validated in the BR2 reactor. In contrast to therapeutic beta emitters, (117m)Sn decays via isomeric transition with the emission of monoenergetic conversion electrons which are effective for metastatic bone pain palliation and radiosynovectomy with lesser damage to the bone marrow and the healthy tissues. Furthermore, the emitted gamma photons are ideal for imaging and dosimetry.

CD117 expression in fibroblasts-like stromal cells indicates unfavorable clinical outcomes in ovarian carcinoma patients.

Directory of Open Access Journals (Sweden)

Ruixia Huang

Full Text Available The stem cell factor (SCF receptor CD117 (c-kit, is widely used for identification of hematopoietic stem cells and cancer stem cells. Moreover, CD117 expression in carcinoma cells indicates a poor prognosis in a variety of cancers. However the potential expression in tumor microenvironment and the biological and clinical impact are currently not reported. The expression of CD117 was immunohistochemically evaluated in a serial of 242 epithelial ovarian cancer (EOC cases. Thirty-eight out of 242 cases were CD117 positive in fibroblast-like stromal cells and 22 cases were positive in EOC cells. Four cases were both positive in fibroblast-like stromal cells and EOC cells for CD117. CD117 expression in fibroblast-like stromal cells in ovarian carcinoma was closely linked to advanced FIGO stage, poor differentiation grade and histological subtype (p<0.05, and it was significantly associated with poor overall survival (OS and progression free survival (PFS (Kaplan-Meier analysis; p<0.05, log-rank test. CD117 expression in ovarian carcinoma cells was not associated with these clinicopathological variables. The CD117 positive fibroblast-like stromal cells were all positive for mesenchymal stem/stromal cell (MSC marker CD73 but negative for fibroblast markers fibroblast activation protein (FAP and α smooth muscle actin (α-SMA, indicating that the CD117+/CD73+ fibroblast-like stromal cells are a subtype of mesenchymal stem cells in tumor stroma, although further characterization of these cells are needed. It is concluded herewith that the presence of CD117+/CD73+ fibroblast-like stromal cells in ovarian carcinoma is an unfavorable clinical outcome indication.

Up-regulation of K{sub ir}2.1 by ER stress facilitates cell death of brain capillary endothelial cells

Energy Technology Data Exchange (ETDEWEB)

Kito, Hiroaki [Department of Molecular and Cellular Pharmacology, Graduate School of Pharmaceutical Sciences, Nagoya City University, Nagoya (Japan); Yamazaki, Daiju [Department of Molecular and Cellular Pharmacology, Graduate School of Pharmaceutical Sciences, Nagoya City University, Nagoya (Japan); Department of Biological Chemistry, Kyoto University, Graduate School of Pharmaceutical Sciences, Kyoto (Japan); Department of Molecular Neurobiology, Graduate School of Medical Sciences, Nagoya City University, Nagoya (Japan); Ohya, Susumu; Yamamura, Hisao [Department of Molecular and Cellular Pharmacology, Graduate School of Pharmaceutical Sciences, Nagoya City University, Nagoya (Japan); Asai, Kiyofumi [Department of Molecular Neurobiology, Graduate School of Medical Sciences, Nagoya City University, Nagoya (Japan); Imaizumi, Yuji, E-mail: yimaizum@phar.nagoya-cu.ac.jp [Department of Molecular and Cellular Pharmacology, Graduate School of Pharmaceutical Sciences, Nagoya City University, Nagoya (Japan)

2011-07-29

Highlights: {yields} We found that application of endoplasmic reticulum (ER) stress with tunicamycin to brain capillary endothelial cells (BCECs) induced cell death. {yields} The ER stress facilitated the expression of inward rectifier K{sup +} channel (K{sub ir}2.1) and induced sustained membrane hyperpolarization. {yields} The membrane hyperpolarization induced sustained Ca{sup 2+} entry through voltage-independent nonspecific cation channels and consequently facilitated cell death. {yields} The K{sub ir}2.1 up-regulation by ER stress is, at least in part, responsible for cell death of BCECs under pathological conditions. -- Abstract: Brain capillary endothelial cells (BCECs) form blood brain barrier (BBB) to maintain brain homeostasis. Cell turnover of BCECs by the balance of cell proliferation and cell death is critical for maintaining the integrity of BBB. Here we found that stimuli with tunicamycin, endoplasmic reticulum (ER) stress inducer, up-regulated inward rectifier K{sup +} channel (K{sub ir}2.1) and facilitated cell death in t-BBEC117, a cell line derived from bovine BCECs. The activation of K{sub ir} channels contributed to the establishment of deeply negative resting membrane potential in t-BBEC117. The deep resting membrane potential increased the resting intracellular Ca{sup 2+} concentration due to Ca{sup 2+} influx through non-selective cation channels and thereby partly but significantly regulated cell death in t-BBEC117. The present results suggest that the up-regulation of K{sub ir}2.1 is, at least in part, responsible for cell death/cell turnover of BCECs induced by a variety of cellular stresses, particularly ER stress, under pathological conditions.

47 CFR 15.117 - TV broadcast receivers.

Science.gov (United States)

2010-10-01

... Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional Radiators § 15.117... approximately the same degree of tuning accuracy with approximately the same expenditure of time and effort... to simplify, expedite or perfect the reception of television signals (e.g., AFC, visual aids, remote...

33 CFR 117.822 - Beaufort Channel, NC.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

Reliability of low-frequency auditory stimulation studies associated with technetium-99m hexamethylpropylene amine oxime single-photon emission tomography

Energy Technology Data Exchange (ETDEWEB)

Le Saco, Y.; Turzo, A.; Guias, B.; Morin, P.P. (Centre Hospitalier Universitaire, 29 - Brest (France). Dept. of Nuclear Medicine); Jezequel, J. (Centre Hospitalier Universitaire, 29 - Brest (France). Dept. of Otorhinolaryngology); Robier, A. (Centre Hospitalier Universitaire, 37 - Tours (France). Dept. of Otorhinolaryngology); Baulieu, J.L. (Centre Hospitalier Universitaire, 37 - Tours (France). Dept. of Nuclear Medicine)

1993-05-01

Development of auditory stimulation tests associated with single-photon emission tomography (SPET) shows evidence of variations in perfusion related to the stimuli. Three brain SPET examinations with technetium-99m hexamethylpropylene amine oxime were performed on eight right-handed adults with normal hearing, the first one without stimulation and the other two associated with a 500-Hz/30-dB stimulation of the right ear. Temporal regions of interest covering auditory areas, as well as parietal ones (internal control), were drawn on three successive coronal slices. A cortico-cerebellar index R was calculated, and the variation in activity was defined for each subject using the ratio R[sub poststimulation] - R[sub prestimulation]/R[sub prest]u[sub mulation]. A significant increase in the temporal cortex count occurred in all subjects. This increase was bilateral, except for one subject in whom it was not significant on the right side. This result recurred during the second stimulation study. Overall the response of the left temporal cortex was stronger, although the asymmetry was not significant. The asymmetry repeated itself after each stimulation. The perfursion response is globally reliable in our study. We must ascertainhow sensitive this test is with regard to deaf adults and adults with normal hearing before extending its use to children. (orig.).

Reliability of low-frequency auditory stimulation studies associated with technetium-99m hexamethylpropylene amine oxime single-photon emission tomography

International Nuclear Information System (INIS)

Le Saco, Y.; Turzo, A.; Guias, B.; Morin, P.P.; Jezequel, J.; Robier, A.; Baulieu, J.L.

1993-01-01

Development of auditory stimulation tests associated with single-photon emission tomography (SPET) shows evidence of variations in perfusion related to the stimuli. Three brain SPET examinations with technetium-99m hexamethylpropylene amine oxime were performed on eight right-handed adults with normal hearing, the first one without stimulation and the other two associated with a 500-Hz/30-dB stimulation of the right ear. Temporal regions of interest covering auditory areas, as well as parietal ones (internal control), were drawn on three successive coronal slices. A cortico-cerebellar index R was calculated, and the variation in activity was defined for each subject using the ratio R poststimulation - R prestimulation /R prest u mulation . A significant increase in the temporal cortex count occurred in all subjects. This increase was bilateral, except for one subject in whom it was not significant on the right side. This result recurred during the second stimulation study. Overall the response of the left temporal cortex was stronger, although the asymmetry was not significant. The asymmetry repeated itself after each stimulation. The perfursion response is globally reliable in our study. We must ascertainhow sensitive this test is with regard to deaf adults and adults with normal hearing before extending its use to children. (orig.)

Radar tegi Moora küla kuulsaks / Aarne Mäe

Index Scriptorium Estoniae

Mäe, Aarne

2003-01-01

Kellavere mäel avati Eesti võimsaim õhuseireradar, USA päritolu Lockhead-Martini radar TPS-117. Laekvere vallavanem Aarne Laasi ja õhuseiredivisjoni ülem jaak Tarien'i kommentaarid. Foto: President Arnold Rüütel ja kaitseväe juhataja viitseadmiral Tarmo Kõuts tulevad koos teiste külalistega radari sisseõnnistamiselt, mis sai endale hellitusnimeks Piret

46 CFR 117.205 - Survival craft-vessels operating on limited coastwise routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on limited coastwise... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.205 Survival craft... the survival craft required by §§ 117.204 (a) through (d) of this part, as applicable. (b) Each vessel...

New 5 kW free-piston Stirling space convertor developments

Science.gov (United States)

Brandhorst, Henry W., Jr.; Chapman, Peter A., Jr.

2008-07-01

The NASA Vision for Exploration of the moon may someday require a nuclear reactor coupled with a free-piston Stirling convertor at a power level of 30-40 kW. In the 1990s, Mechanical Technology Inc.'s Stirling Engine Systems Division (some of whose Stirling personnel are now at Foster-Miller, Inc.) developed a 25 kW free-piston Stirling Space Power Demonstrator Engine under the SP-100 program. This system consisted of two 12.5 kW engines connected at their hot ends and mounted in tandem to cancel vibration. Recently, NASA and DoE have been developing dual 55 and 80 W Stirling convertor systems for potential use with radioisotope heat sources. Total test times of all convertors in this effort exceed 120,000 h. Recently, NASA began a new project with Auburn University to develop a 5 kW, single convertor for potential use in a lunar surface reactor power system. Goals of this development program include a specific power in excess of 140 W/kg at the convertor level, lifetime in excess of five years and a control system that will safely manage the convertors in case of an emergency. Auburn University awarded a subcontract to Foster-Miller, Inc. to undertake development of the 5 kW Stirling convertor assembly. The characteristics of the design along with progress in developing the system will be described.

Antigenic variation of TprK facilitates development of secondary syphilis.

Science.gov (United States)

Reid, Tara B; Molini, Barbara J; Fernandez, Mark C; Lukehart, Sheila A

2014-12-01

Although primary syphilis lesions heal spontaneously, the infection is chronic, with subsequent clinical stages. Healing of the primary chancre occurs as antibodies against outer membrane antigens facilitate opsonophagocytosis of the bacteria by activated macrophages. TprK is an outer membrane protein that undergoes antigenic variation at 7 variable regions, and variants are selected by immune pressure. We hypothesized that individual TprK variants escape immune clearance and seed new disseminated lesions to cause secondary syphilis. As in human syphilis, infected rabbits may develop disseminated secondary skin lesions. This study explores the nature of secondary syphilis, specifically, the contribution of antigenic variation to the development of secondary lesions. Our data from the rabbit model show that the odds of secondary lesions containing predominately TprK variant treponemes is 3.3 times higher than the odds of finding TprK variants in disseminated primary lesions (odds ratio [OR] = 3.3 [95% confidence interval {CI}, 0.98 to 11.0]; P = 0.055) and that 96% of TprK variant secondary lesions are likely seeded by single treponemes. Analysis of antibody responses demonstrates significantly higher antibody titers to tprK variable region sequences found in the inoculum compared to reactivity to tprK variant sequences found in newly arising secondary lesions. This suggests that tprK variants escape the initial immune response raised against the V regions expressed in the inoculum. These data further support a role for TprK in immune evasion and suggest that the ability of TprK variants to persist despite a robust immune response is instrumental in the development of later stages of syphilis. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

19 CFR 200.735-117 - Supplementary statements.

Science.gov (United States)

2010-04-01

... under this section, each employee shall at all times avoid acquiring a financial interest that could... CONDUCT Provisions Governing Statements of Employment and Financial Interests § 200.735-117 Supplementary... and financial interests shall be reported in a supplementary statement as of June 30 each year. If no...

33 CFR 117.801 - Newtown Creek, Dutch Kills, English Kills and their tributaries.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newtown Creek, Dutch Kills, English Kills and their tributaries. 117.801 Section 117.801 Navigation and Navigable Waters COAST GUARD....801 Newtown Creek, Dutch Kills, English Kills and their tributaries. (a) The following requirements...

The role of the oximes HI-6 and HS-6 inside human acetylcholinesterase inhibited with nerve agents: a computational study.

Science.gov (United States)

Cuya, Teobaldo; Gonçalves, Arlan da Silva; da Silva, Jorge Alberto Valle; Ramalho, Teodorico C; Kuca, Kamil; C C França, Tanos

2017-10-27

The oximes 4-carbamoyl-1-[({2-[(E)-(hydroxyimino) methyl] pyridinium-1-yl} methoxy) methyl] pyridinium (known as HI-6) and 3-carbamoyl-1-[({2-[(E)-(hydroxyimino) methyl] pyridinium-1-yl} methoxy) methyl] pyridinium (known as HS-6) are isomers differing from each other only by the position of the carbamoyl group on the pyridine ring. However, this slight difference was verified to be responsible for big differences in the percentual of reactivation of acetylcholinesterase (AChE) inhibited by the nerve agents tabun, sarin, cyclosarin, and VX. In order to try to find out the reason for this, a computational study involving molecular docking, molecular dynamics, and binding energies calculations, was performed on the binding modes of HI-6 and HS-6 on human AChE (HssAChE) inhibited by those nerve agents.

Recent development status of compact 2 K GM cryocoolers

Science.gov (United States)

Bao, Q.; Xu, M. Y.; Tsuchiya, A.; Li, R.

2015-12-01

To meet the growing demand for a compact cooling solution for superconducting electronic devices, we developed a two-stage 2 K GM cryocooler and a cryostat system, which can reach 46.3 K / 2.2 K on the first and second stages under no-load conditions. Nevertheless, with several innovative technologies applied, the total length of the expander cylinder is reduced to under 70% of the smallest conventional 4 K GM cryocooler. In this paper we will present the design method, including material selection and structure design with detailed explanation, which has been confirmed by both simulation and experiment.

Composite Nafion 117-TMSP membrane for Fe-Cr redox flow battery applications

Energy Technology Data Exchange (ETDEWEB)

Haryadi, E-mail: haryadi@polban.ac.id [Department of Chemical Engineering, PoliteknikNegeri Bandung Indonesia (Indonesia); Gunawan, Y. B.; Harjogi, D. [Department of Electronic Engineering, PoliteknikNegeri Bandung Indonesia (Indonesia); Mursid, S. P. [Department of Energy Engineering, PoliteknikNegeri Bandung. Jl. GegerkalongHilir, Ds, Ciwaruga, Bandung, West Java Indonesia (Indonesia)

2016-04-19

The modification of Nafion 117 - TMSP (trimethoxysylilprophanthiol) composite membrane has been conducted by in-situ sol-gel method followed by characterization of structural and properties of material using spectroscopic techniques. The performance of composite membrane has then been examined in the single stack module of Fe-Cr Redox Flow Battery. It was found that the introduction of silica from TMSP through sol-gel process within the Nafion 117 membrane produced composite membrane that has slightly higher proton conductivity values as compared to the pristine of Nafion 117 membrane observed by electrochemical impedance spectroscopy. The degree of swelling of water in the composite membrane demonstrated greatly reduced than a pristine Nafion 117 signifying low water cross over. The SEM-EDX measurements indicated that there was no phase separation occurred suggesting that silica nanoparticles are distributed homogeneously within the composite membrane. The composite membrane used as separator in the system of Fe-Cr Redox Flow Battery revealed no cross mixing (crossover) occurred between anolyte and catholyte in the system as observed from the total voltage measurements that closed to the theoretical value. The battery efficiency generally increased as the volume of the electrolytes enlarged.

Composite Nafion 117-TMSP membrane for Fe-Cr redox flow battery applications

International Nuclear Information System (INIS)

Haryadi; Gunawan, Y. B.; Harjogi, D.; Mursid, S. P.

2016-01-01

The modification of Nafion 117 - TMSP (trimethoxysylilprophanthiol) composite membrane has been conducted by in-situ sol-gel method followed by characterization of structural and properties of material using spectroscopic techniques. The performance of composite membrane has then been examined in the single stack module of Fe-Cr Redox Flow Battery. It was found that the introduction of silica from TMSP through sol-gel process within the Nafion 117 membrane produced composite membrane that has slightly higher proton conductivity values as compared to the pristine of Nafion 117 membrane observed by electrochemical impedance spectroscopy. The degree of swelling of water in the composite membrane demonstrated greatly reduced than a pristine Nafion 117 signifying low water cross over. The SEM-EDX measurements indicated that there was no phase separation occurred suggesting that silica nanoparticles are distributed homogeneously within the composite membrane. The composite membrane used as separator in the system of Fe-Cr Redox Flow Battery revealed no cross mixing (crossover) occurred between anolyte and catholyte in the system as observed from the total voltage measurements that closed to the theoretical value. The battery efficiency generally increased as the volume of the electrolytes enlarged.

Functional study of the novel multidrug resistance gene HA117 and its comparison to multidrug resistance gene 1

Directory of Open Access Journals (Sweden)

Chen Tingfu

2010-07-01

Full Text Available Abstract Background The novel gene HA117 is a multidrug resistance (MDR gene expressed by all-trans retinoic acid-resistant HL-60 cells. In the present study, we compared the multidrug resistance of the HA117 with that of the classical multidrug resistance gene 1 (MDR1 in breast cancer cell line 4T1. Methods Transduction of the breast cancer cell line 4T1 with adenoviral vectors encoding the HA117 gene and the green fluorescence protein gene (GFP (Ad-GFP-HA117, the MDR1 and GFP (Ad-GFP-MDR1 or GFP (Ad-GFP was respectively carried out. The transduction efficiency and the multiplicity of infection (MOI were detected by fluorescence microscope and flow cytometry. The transcription of HA117 gene and MDR1 gene were detected by reverse transcription polymerase chain reaction (RT-PCR. Western blotting analysis was used to detect the expression of P-glycoprotein (P-gp but the expression of HA117 could not be analyzed as it is a novel gene and its antibody has not yet been synthesized. The drug-excretion activity of HA117 and MDR1 were determined by daunorubicin (DNR efflux assay. The drug sensitivities of 4T1/HA117 and 4T1/MDR1 to chemotherapeutic agents were detected by Methyl-Thiazolyl-Tetrazolium (MTT assay. Results The transducted efficiency of Ad-GFP-HA117 and Ad-GFP-MDR1 were 75%-80% when MOI was equal to 50. The transduction of Ad-GFP-HA117 and Ad-GFP-MDR1 could increase the expression of HA117 and MDR1. The drug resistance index to Adriamycin (ADM, vincristine (VCR, paclitaxel (Taxol and bleomycin (BLM increased to19.8050, 9.0663, 9.7245, 3.5650 respectively for 4T1/HA117 and 24.2236, 11.0480, 11.3741, 0.9630 respectively for 4T1/MDR1 as compared to the control cells. There were no significant differences in drug sensitivity between 4T1/HA117 and 4T1/MDR1 for the P-gp substrates (ADM, VCR and Taxol (P Conclusions These results confirm that HA117 is a strong MDR gene in both HL-60 and 4T1 cells. Furthermore, our results indicate that the MDR

A comparative technetium 99m hexamethylpropylene amine oxime SPET study in different types of dementia

Energy Technology Data Exchange (ETDEWEB)

Habert, M O; Piketty, M L; Askienazy, S [Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Medecine Nucleaire; Spampinato, U; Mas, J L; Recondo, J de; Rondot, P [Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Neurologie; Bourdel, M C [Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Psychiatrie

1991-01-01

Regional cerebral perfusion was evaluated by single photon emission tomography (SPET) using technetium 99m hexamethylpropylene amine oxime ({sup 99m}Tc-HMPAO) as a tracer, in 13 control subjects and 44 age-matched patients suffering from dementia of the Alzheimer's type (DAT, n=19) presumed Pick's disease (n=5), idiopathic Parkinson's disease with dementia (DPD, n=15) and progressive supranuclear palsy (PSP, n=5), HMPAO uptake was measured in the superior frontal, inferior frontal, parietal, temporal and occipital cortices, and the perfusion values were expressed as cortical/cerebellar activity ratios. As compared with controls, tracer uptake ratios in the DAT group were signficantly reduced over all cortical regions, with the largest defects in the parieto-temporal and superior frontal cortices. A marked hypoperfusion affecting the superior and inferior frontal cortices was found in Pick's diesease, whereas a mild but significant hypoperfusion was observed only in the superior frontal cortex of patients with PSP. In the DPD group, HMPAO uptake was significantly reduced in the parietal, temporal and occipital cortices, but not in the frontal cortex. These results show that DAT and DPD share the opposite anteroposterior HMPAO uptake defect as compared with the Pick's and PSP groups. (orig.).

23 CFR 635.117 - Labor and employment.

Science.gov (United States)

2010-04-01

... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.117 Labor and employment. (a) No construction work shall... construction project from the time of award of the contract or the start of work on force account until final... outside the reservation. (f) The advertisement or call for bids on any contract for the construction of a...

Measurement of CP violation in the phase space of $B^{\\pm} \\rightarrow K^{+} K^{-} \\pi^{\\pm}$ and $B^{\\pm} \\rightarrow \\pi^{+} \\pi^{-} \\pi^{\\pm}$ decays

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Adrover, Cosme; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Mar-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; David, Pascal; David, Pieter; Davis, Adam; De Bonis, Isabelle; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Dogaru, Marius; Donleavy, Stephanie; Dordei, Francesca; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; van Eijk, Daan; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fitzpatrick, Conor; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garosi, Paola; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gorbounov, Petr; Gordon, Hamish; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hicks, Emma; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Huse, Torkjell; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Iakovenko, Viktor; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Kaballo, Michael; Kandybei, Sergii; Kanso, Wallaa; Karacson, Matthias; Karbach, Moritz; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Kochebina, Olga; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Li Gioi, Luigi; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lu, Haiting; Lucchesi, Donatella; Luisier, Johan; Luo, Haofei; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Maratas, Jan; Marconi, Umberto; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martins Tostes, Danielle; Martynov, Aleksandr; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Maurice, Emilie; Mazurov, Alexander; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Mountain, Raymond; Mous, Ivan; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muryn, Bogdan; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neubert, Sebastian; Neufeld, Niko; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Nomerotski, Andrey; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrick, Glenn; Patrignani, Claudia; Pavel-Nicorescu, Carmen; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Pérez-Calero Yzquierdo, Antonio; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Pessina, Gianluigi; Petridis, Konstantin; Petrolini, Alessandro; Phan, Anna; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Polok, Grzegorz; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redford, Sophie; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Straticiuc, Mihai; Straumann, Ulrich; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Teodorescu, Eliza; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Webber, Adam Dane; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiechczynski, Jaroslaw; Wiedner, Dirk; Wiggers, Leo; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-01-01

The charmless decays $B^{\\pm} \\rightarrow K^{+}K^{-}\\pi^{\\pm}$ and $B^{\\pm} \\rightarrow \\pi^{+}\\pi^{-}\\pi^{\\pm}$ are reconstructed in a data set, corresponding to an integrated luminosity of 1.0 fb$^{-1}$ of pp collisions at a center-of-mass energy of 7 TeV, collected by LHCb in 2011. The inclusive charge asymmetries of these modes are measured to be $A_{CP}(B^{\\pm} \\rightarrow K^{+}K^{-}\\pi^{\\pm}) =-0.141 \\pm 0.040 (stat) \\pm 0.018 (syst) \\pm 0.007 (J/\\psi K^{\\pm})$ and $A_{CP}(B^{\\pm} \\rightarrow \\pi^{+}\\pi^{-}\\pi^{\\pm}) = 0.117 \\pm 0.021 (stat) \\pm 0.009 (syst) \\pm 0.007 (J/\\psi K^{\\pm})$, where the third uncertainty is due to the CP asymmetry of the $B^{\\pm} \\rightarrow J/\\psi K^{\\pm}$ reference mode. In addition to the inclusive CP asymmetries, larger asymmetries are observed in localized regions of phase space.

Development of a Colloidal Gold-Based Immunochromatographic Strip for Rapid Detection of Klebsiella pneumoniae Serotypes K1 and K2.

Science.gov (United States)

Siu, L Kristopher; Tsai, Yu-Kuo; Lin, Jung-Chung; Chen, Te-Li; Fung, Chang-Phone; Chang, Feng-Yee

2016-12-01

In this study, a novel colloidal gold-based immunochromatographic strip (ICS) containing anti-Klebsiella pneumoniae capsular polysaccharide polyclonal antibodies was developed to specifically detect K. pneumoniae serotypes K1 and K2. Capsular polysaccharide K1 and K2 antigens were first used to produce polyclonal anti-K1 and anti-K2 antibodies. Reference strains with different serotypes, nontypeable K. pneumoniae strains, and other bacterial species were then used to assess the sensitivity and specificity of these test strips. The detection limit was found to be 10 5 CFU, and the ICSs were stable for 6 months when stored at room temperature. No false-positive or false-negative results were observed, and equivalent results were obtained compared to those of more conventional test methods, such as PCR or serum agglutination. In conclusion, the ICS developed here requires no technical expertise and allows for the specific, rapid, and simultaneous detection of K. pneumoniae serotypes K1 and K2. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

33 CFR 165.117 - Regulated Navigation Areas, Safety and Security Zones: Deepwater Ports, First Coast Guard District.

Science.gov (United States)

2010-07-01

..., Safety and Security Zones: Deepwater Ports, First Coast Guard District. 165.117 Section 165.117... Limited Access Areas First Coast Guard District § 165.117 Regulated Navigation Areas, Safety and Security... section are designated as regulated navigation areas. (2) Safety and security zones. All waters within a...

Cortical perfusion response to an electrical stimulation of the auditory nerve in profoundly deaf patients: Study with technetium-99m hexamethylpropylene amine oxime single photon emission tomography

International Nuclear Information System (INIS)

Le Scao, Y.; Robier, A.; Beuter, P.; Baulieu, J.L.; Pourcelot, L.

1992-01-01

Brain activation procedures associated with single photon emission tomography (SPET) have recently been developed in healthy controls and diseased patients in order to help in their diagnosis and treatment. We investigated the effects of a promontory test (PT) on the cerebral distribution of technetium-99m hexamethyl-propylene amine oxime ( 99m Tc-HMPAO) in 7 profoundly deaf patients, 6 PT+ and PT-. The count variation in the temporal lobe was calculated on 6 coronal slices using the ratio (R stimulation -R deprivation )/R deprivation where R=counts in the temporal lobe was observed in all patients and was higher in all patients with PT+ than in the patient with PT-. The problems of head positioning and resolution of the system were taken into account, and we considered that the maximal count increment was related to the auditory cortex response to the stimulus. Further clinical investigations with high-resolution systems have to be performed in order to validate this presurgery test in cochlear implant assessment. (orig.)

Cryogenic system for VECC K500 superconducting cyclotron

CERN Document Server

Pal, G; Bhattacharyya, T K; Bhandari, R K

2009-01-01

VEC Centre, Kolkata in India is at an advanced stage of commissioning a K500 superconducting cyclotron. The superconducting coil of the magnet for cyclotron is cooled by liquid helium. Three liquid helium cooled cryopanels, placed inside the Dees of the radiofrequency system, maintain the vacuum in the acceleration region of the superconducting cyclotron. The cryogenic system for magnet for cyclotron has been tested by cooling the coil and energizing the magnet. The cryogenic system for cryopanels has also been tested. Heater and temperature sensor were placed on the liquid helium cold head for cryopanel. The temperature of the cold head was observed to be below 20 K upto a heat load of 11.7 watt.

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153Sm(113,117Snm) complexes

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin

2004-01-01

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA

Comparison of the oxime-induced reactivation of rhesus monkey, swine and guinea pig erythrocyte acetylcholinesterase following inhibition by sarin or paraoxon, using a perfusion model for the real-time determination of membrane-bound acetylcholinesterase activity.

Science.gov (United States)

Herkert, Nadja M; Lallement, Guy; Clarençon, Didier; Thiermann, Horst; Worek, Franz

2009-04-28

Recently, a dynamically working in vitro model with real-time determination of membrane-bound human acetylcholinesterase (AChE) activity was shown to be a versatile model to investigate oxime-induced reactivation kinetics of organophosphate- (OP) inhibited enzyme. In this assay, AChE was immobilized on particle filters which were perfused with acetylthiocholine, Ellman's reagent and phosphate buffer. Subsequently, AChE activity was continuously analyzed in a flow-through detector. Now, it was an intriguing question whether this model could be used with erythrocyte AChE from other species in order to investigate kinetic interactions in the absence of annoying side reactions. Rhesus monkey, swine and guinea pig erythrocytes were a stable and highly reproducible enzyme source. Then, the model was applied to the reactivation of sarin- and paraoxon-inhibited AChE by obidoxime or HI 6 and it could be shown that the derived reactivation rate constants were in good agreement to previous results obtained from experiments with a static model. Hence, this dynamic model offers the possibility to investigate highly reproducible interactions between AChE, OP and oximes with human and animal AChE.

41 CFR 102-117.35 - What are the advantages and disadvantages of using GSA's tender of service?

Science.gov (United States)

2010-07-01

... and disadvantages of using GSA's tender of service? 102-117.35 Section 102-117.35 Public Contracts and...-117.35 What are the advantages and disadvantages of using GSA's tender of service? (a) It is an... damage claims. (b) It is a disadvantage to use GSA's tender of service when: (1) You want an agreement...

Two-dimensional T2 distribution mapping in rock core plugs with optimal k-space sampling.

Science.gov (United States)

Xiao, Dan; Balcom, Bruce J

2012-07-01

Spin-echo single point imaging has been employed for 1D T(2) distribution mapping, but a simple extension to 2D is challenging since the time increase is n fold, where n is the number of pixels in the second dimension. Nevertheless 2D T(2) mapping in fluid saturated rock core plugs is highly desirable because the bedding plane structure in rocks often results in different pore properties within the sample. The acquisition time can be improved by undersampling k-space. The cylindrical shape of rock core plugs yields well defined intensity distributions in k-space that may be efficiently determined by new k-space sampling patterns that are developed in this work. These patterns acquire 22.2% and 11.7% of the k-space data points. Companion density images may be employed, in a keyhole imaging sense, to improve image quality. T(2) weighted images are fit to extract T(2) distributions, pixel by pixel, employing an inverse Laplace transform. Images reconstructed with compressed sensing, with similar acceleration factors, are also presented. The results show that restricted k-space sampling, in this application, provides high quality results. Copyright © 2012 Elsevier Inc. All rights reserved.

Highly regio- and diastereoselective, acidic clay supported intramolecular nitrile oxide-alkene cycloaddition on D-ribose derived nitriles: an efficient synthetic route to isoxazoline fused five and six membered carbocycles.

Science.gov (United States)

Panda, Amarendra; Das, Sulagna; Pal, Shantanu

2014-10-29

An efficient synthetic route to isoxazoline fused carbocycles from carbohydrate scaffolds that comprise of free hydroxyl group(s) is described with high regio- and stereoselectivity. Montmorillonite K-10/chloramine T oxidation and in situ intramolecular nitrile oxide-alkene cycloaddition (INOC) of D-ribose derived oximes have been developed for the diversity oriented synthesis of isoxazoline fused five and six membered carbocycles. Copyright © 2014 Elsevier Ltd. All rights reserved.

38 CFR 1.17 - Evaluation of studies relating to health effects of radiation exposure.

Science.gov (United States)

2010-07-01

... relating to health effects of radiation exposure. 1.17 Section 1.17 Pensions, Bonuses, and Veterans' Relief... health effects of radiation exposure. (a) From time to time, the Secretary shall publish evaluations of scientific or medical studies relating to the adverse health effects of exposure to ionizing radiation in the...

Evaluation of medical countermeasures against organophosphorus compounds: the value of experimental data and computer simulations.

Science.gov (United States)

Worek, Franz; Aurbek, Nadine; Herkert, Nadja M; John, Harald; Eddleston, Michael; Eyer, Peter; Thiermann, Horst

2010-09-06

Despite extensive research for more than six decades on medical countermeasures against poisoning by organophosphorus compounds (OP) the treatment options are meagre. The presently established acetylcholinesterase (AChE) reactivators (oximes), e.g. obidoxime and pralidoxime, are insufficient against a number of nerve agents and there is ongoing debate on the benefit of oxime treatment in human OP pesticide poisoning. Up to now, the therapeutic efficacy of oximes was mostly evaluated in animal models but substantial species differences prevent direct extrapolation of animal data to humans. Hence, it was considered essential to establish relevant experimental in vitro models for the investigation of oximes as antidotes and to develop computer models for the simulation of oxime efficacy in different scenarios of OP poisoning. Kinetic studies on the various interactions between erythrocyte AChE from various species, structurally different OP and different oximes provided a basis for the initial assessment of the ability of oximes to reactivate inhibited AChE. In the present study, in vitro enzyme-kinetic and pharmacokinetic data from a minipig model of dimethoate poisoning and oxime treatment were used to calculate dynamic changes of AChE activities. It could be shown that there is a close agreement between calculated and in vivo AChE activities. Moreover, computer simulations provided insight into the potential and limitations of oxime treatment. In the end, such data may be a versatile tool for the ongoing discussion of the pros and cons of oxime treatment in human OP pesticide poisoning. Copyright (c) 2009 Elsevier Ireland Ltd. All rights reserved.

An in situ Raman spectroscopy system for long-term corrosion experiments in high temperature water up to 673 K

International Nuclear Information System (INIS)

Domae, Masafumi; Tani, Jun-ichi; Fujiwara, Kazutoshi; Katsumura, Yosuke

2006-01-01

A Raman spectroscopy system has been developed, in order to identify oxides formed on the surfaces of metals and steels in high temperature water up to 673 K. A supercritical water loop system including a Raman cell was installed. The design of the loop system is up to 673 K and 40 MPa. The Raman cell has a diamond window without window-to-metal packing. Raman spectrum of alumina plate was measured at room temperature, at 523 and at 673 K under pressure of 25 MPa. A long-term measurement was also performed at 523 K and 25 MPa for 117.5 h. In all cases intense Raman peaks attributed to alumina were observed. Raman spectrum of anatase particles in suspension was measured at 673 K and 25 MPa. The results show that the Raman spectroscopy system developed in the present study works well not only for plate sample but also for suspension. Raman spectra observed for titanium plate in high temperature water of 673 K and 25 MPa show growth of several Raman peaks with time up to 257 h. The peaks disappeared after cooled down to room temperature. The experimental results have demonstrated importance of in situ Raman spectroscopy. (author)

Evaluation of dysthymic disorder with technetium-99 m hexamethylpropylene amine oxime brain single-photon emission tomography

Energy Technology Data Exchange (ETDEWEB)

Sarikaya, A.; Cermik, T.F. [Department of Nuclear Medicine, Trakya University, Faculty of Medicine, Edirne (Turkey); Karasin, E.; Abay, E. [Department of Psychiatry, Trakya University, Faculty of Medicine, Edirne (Turkey); Berkarda, S.

1999-03-01

Dysthymic disorder is a chronic disorder characterised by the presence of a depressed mood and is classified as a distinct category in DSM-IV, separately from major depression. Although brain imaging studies have been performed in major depressive disease, there have to date been no reports of such studies in dysthymic disorder. In this study 36 patients with dysthymic disorder were compared with 16 normal subjects using technetium-99m hexamethylpropylene amine oxime brain single-photon emission tomography. A relative blood flow ratio was calculated for each region of interest using the average tissue activity in the region divided by activity in the cerebellum. There were significant differences in the bilateral inferior frontal, bilateral parietal, right superior frontal and left posterior temporal regions in the patients with dysthymic disorder compared with the healthy controls. These findings support the hypothesis that the biological bases for dysthymic disorder and major depression are similar. Recognition of these regional abnormalities may have clinical utility in both the diagnosis and the treatment of dysthymic disorder. Further studies are needed to confirm our results and to assess the influence of treatment in patients with dysthymic disorder. (orig.) With 1 fig., 1 tab., 26 refs.

Evaluation of dysthymic disorder with technetium-99 m hexamethylpropylene amine oxime brain single-photon emission tomography

International Nuclear Information System (INIS)

Sarikaya, A.; Cermik, T.F.; Karasin, E.; Abay, E.; Berkarda, S.

1999-01-01

Dysthymic disorder is a chronic disorder characterised by the presence of a depressed mood and is classified as a distinct category in DSM-IV, separately from major depression. Although brain imaging studies have been performed in major depressive disease, there have to date been no reports of such studies in dysthymic disorder. In this study 36 patients with dysthymic disorder were compared with 16 normal subjects using technetium-99m hexamethylpropylene amine oxime brain single-photon emission tomography. A relative blood flow ratio was calculated for each region of interest using the average tissue activity in the region divided by activity in the cerebellum. There were significant differences in the bilateral inferior frontal, bilateral parietal, right superior frontal and left posterior temporal regions in the patients with dysthymic disorder compared with the healthy controls. These findings support the hypothesis that the biological bases for dysthymic disorder and major depression are similar. Recognition of these regional abnormalities may have clinical utility in both the diagnosis and the treatment of dysthymic disorder. Further studies are needed to confirm our results and to assess the influence of treatment in patients with dysthymic disorder. (orig.)

Efficacy of a single dose of milbemycin oxime/praziquantel combination tablets, Milpro(®), against adult Echinococcus multilocularis in dogs and both adult and immature E. multilocularis in young cats.

Science.gov (United States)

Cvejic, Dejan; Schneider, Claudia; Fourie, Josephus; de Vos, Christa; Bonneau, Stephane; Bernachon, Natalia; Hellmann, Klaus

2016-03-01

Two single-site, laboratory, negatively controlled, masked, randomised dose confirmation studies were performed: one in dogs, the other in cats. After a period of acclimatisation, both the dogs and cats were orally infected with Echinococcus multilocularis protoscoleces. In the dog study, 10 dogs received a single dose of Milpro® tablets at a minimum dose of 0.5 mg/kg milbemycin oxime and 5 mg/kg praziquantel 18 days post-infection and 10 dogs received no treatment. In the cat study, 10 cats received a single dose of Milpro® tablets at a minimum dose of 2 mg/kg milbemycin oxime and 5 mg/kg praziquantel 7 days post-infection, 10 cats received a single dose of the treatment 18 days post-infection and 10 cats remained untreated. In both studies, intestinal worm counts were performed 23 days post-infection at necropsy. No worms were retrieved from any of the 30 treated animals. Nine of 10 control dogs had multiple worms (geometric mean 91, arithmetic mean 304) and all 10 control cats had multiple worms (geometric mean 216, arithmetic mean 481). The difference in worm counts between all three treated groups and their controls was highly significant (ANOVA p values of log transformed data dogs and cats as well as for elimination of immature E. multilocularis in cats as evidenced by the effectiveness of treatment 7 days post-infection. The treatments were well accepted and tolerated, and there were no adverse drug reactions observed.

A comparative technetium 99m hexamethylpropylene amine oxime SPET study in different types of dementia

Energy Technology Data Exchange (ETDEWEB)

Habert, M.O.; Piketty, M.L.; Askienazy, S. (Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Medecine Nucleaire); Spampinato, U.; Mas, J.L.; Recondo, J. de; Rondot, P. (Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Neurologie); Bourdel, M.C. (Centre Hospitalier Sainte-Anne, 75 - Paris (France). Dept. de Psychiatrie)

1991-01-01

Regional cerebral perfusion was evaluated by single photon emission tomography (SPET) using technetium 99m hexamethylpropylene amine oxime ({sup 99m}Tc-HMPAO) as a tracer, in 13 control subjects and 44 age-matched patients suffering from dementia of the Alzheimer's type (DAT, n=19) presumed Pick's disease (n=5), idiopathic Parkinson's disease with dementia (DPD, n=15) and progressive supranuclear palsy (PSP, n=5), HMPAO uptake was measured in the superior frontal, inferior frontal, parietal, temporal and occipital cortices, and the perfusion values were expressed as cortical/cerebellar activity ratios. As compared with controls, tracer uptake ratios in the DAT group were signficantly reduced over all cortical regions, with the largest defects in the parieto-temporal and superior frontal cortices. A marked hypoperfusion affecting the superior and inferior frontal cortices was found in Pick's diesease, whereas a mild but significant hypoperfusion was observed only in the superior frontal cortex of patients with PSP. In the DPD group, HMPAO uptake was significantly reduced in the parietal, temporal and occipital cortices, but not in the frontal cortex. These results show that DAT and DPD share the opposite anteroposterior HMPAO uptake defect as compared with the Pick's and PSP groups. (orig.).

Development of a 600 kJ HTS SMES

International Nuclear Information System (INIS)

Seong, K.C.; Kim, H.J.; Kim, S.H.; Sim, K.D.; Sohn, M.H.; Lee, E.Y.; Park, S.J.; Hahn, S.Y.; Park, M.W.

2008-01-01

This paper describes an overview of development on a 600 kJ high-temperature superconducting magnetic energy storage (HTS SMES). Our final goal will be the commercialization of MJ class HTS SMES system for the increase of power quality within 5 years. Hence, for this purpose, we have developed the research and development in 3 years. The purpose of this research is to develop a pilot system, which can protect the sensitivity loads from a momentary power interruption or a voltage sag

Activity of Bruton's tyrosine-kinase inhibitor ibrutinib in patients with CD117-positive acute myeloid leukaemia: a mechanistic study using patient-derived blast cells.

Science.gov (United States)

Rushworth, Stuart A; Pillinger, Genevra; Abdul-Aziz, Amina; Piddock, Rachel; Shafat, Manar S; Murray, Megan Y; Zaitseva, Lyubov; Lawes, Matthew J; MacEwan, David J; Bowles, Kristian M

2015-05-01

Roughly 80% of patients with acute myeloid leukaemia have high activity of Bruton's tyrosine-kinase (BTK) in their blast cells compared with normal haemopoietic cells, rendering the cells sensitive to the oral BTK inhibitor ibrutinib in vitro. We aimed to develop the biological understanding of the BTK pathway in acute myeloid leukaemia to identify clinically relevant diagnostic information that might define a subset of patients that should respond to ibrutinib treatment. We obtained acute myeloid leukaemia blast cells from unselected patients attending our UK hospital between Feb 19, 2010, and Jan 20, 2014. We isolated primary acute myeloid leukaemia blast cells from heparinised blood and human peripheral blood mononuclear cells to establish the activity of BTK in response to CD117 activation. Furthermore, we investigated the effects of ibrutinib on CD117-induced BTK activation, downstream signalling, adhesion to primary bone-marrow mesenchymal stromal cells, and proliferation of primary acute myeloid leukaemia blast cells. We used the Mann-Whitney U test to compare results between groups. We obtained acute myeloid leukaemia blast cells from 29 patients. Ibrutinib significantly inhibited CD117-mediated proliferation of primary acute myeloid leukaemia blast cells (p=0·028). CD117 activation increased BTK activity by inducing phosphorylated BTK in patients with CD117-positive acute myeloid leukaemia. Furthermore, ibrutinib inhibited CD117-induced activity of BTK and downstream kinases at a concentration of 100 nM or more. CD117-mediated adhesion of CD117-expressing blast cells to bone-marrow stromal cells was significantly inhibited by Ibrutinib at 500 nM (p=0·028) INTERPRETATION: As first-in-man clinical trials of ibrutinib in patients with acute myeloid leukaemia commence, the data suggest not all patients will respond. Our findings show that BTK has specific pro-tumoural biological actions downstream of surface CD117 activation, which are inhibited by ibrutinib

Development of 1 kW Stirling cryocooler using a linear compressor

International Nuclear Information System (INIS)

Ko, J; Kim, H; Hong, Y J; Yeom, H; In, S; Park, S J

2015-01-01

Cryogenic cooling systems for HTS electric power devices require a reliable and efficient high-capacity cryocooler. A Striling cryocooler with a linear compressor can be a good candidate. It has advantages of low vibration and long maintenance cycle compared with a kinematic-driven Stirling cryocooler. In this study, we developed a dual-opposed linear compressor of 12 kW electric input power with two 6 kW linear motors. Electrical performance of the fabricated linear compressor is verified by experimental measurement of thrust constant. The developed Stirling cryocooler has a gamma-type configuration. The piston and displacer are supported with a flexure spring. A slit-type heat exchanger is adopted for the cold and warm-end, and the generated heat is rejected by cooling water. In the cooling performance test, waveforms of voltage, current, displacement and pressure are obtained and their amplitude and phase difference are analysed. The developed cryocooler reaches 47.8 K within 23.4 min. with no-load. Heat load tests shows a cooling capacity of 440 W at 78.1 K with 6.45 kW of electric input power and 19.4 of % Carnot COP. (paper)

Measurement of CP violation in the phase space of B± → K+ K- π± and B± → π+ π- π± decays.

Science.gov (United States)

Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reichert, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

2014-01-10

The charmless decays B± → K+ K- π± and B± → π+ π- π± are reconstructed in a data set of pp collisions with an integrated luminosity of 1.0  fb(-1) and center-of-mass energy of 7 TeV, collected by LHCb in 2011. The inclusive charge asymmetries of these modes are measured to be A(CP)(B± → K+ K- π±) = -0.141±0.040  (stat)±0.018 (syst)±0.007(J/ψ K±) and A(CP)(B± → π+ π- π±) = 0.117±0.021 (stat)±0.009 (syst)±0.007(J/ψ K±), where the third uncertainty is due to the CP asymmetry of the B± → J/ψK± reference mode. In addition to the inclusive CP asymmetries, larger asymmetries are observed in localized regions of phase space.

submitter Development of a 100 kW, 12.5 kV, 22 kHz and 30 kV insulated medium frequency transformer for compact and reliable medium voltage power conversion

CERN Document Server

Isler, Stephane; Aguglia, Davide; Bonnin, Xavier Abel

2017-01-01

This paper presents the critical design aspects addressed during the development of a 100 kW, 12.5 kV, 22 kHz, and 30 kV insulated medium frequency transformer used in a power converter. The transformers are used in a resonant multilevel converter topology producing HV DC voltage from a three phase 400 V AC industrial grid. The power converter is used to supply radio frequency systems in particle accelerators. Considerations about material selection, dielectric, magnetic and thermal design are discussed and experimental results on the full scale transformer and power converter are presented.

Jaroslav Kolár. Vědec a přítel Zdeněk Horský

Czech Academy of Sciences Publication Activity Database

Hermann, Tomáš; Kolár, J.

2011-01-01

Roč. 44, č. 2 (2011), s. 117-122 ISSN 0300-4414 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : Zdeněk Horský * historiography of science * history of astronomy Subject RIV: AB - History

40 CFR 51.117 - Additional provisions for lead.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Additional provisions for lead. 51.117... Additional provisions for lead. In addition to other requirements in §§ 51.100 through 51.116 the following requirements apply to lead. To the extent they conflict, there requirements are controlling over those of the...

Development of Surface-Modified Polyacrylonitrile Fibers and Their Selective Sorption Behavior of Precious Metals

Directory of Open Access Journals (Sweden)

Areum Lim

2016-11-01

Full Text Available The purpose of this study was to design a powerful fibrous sorbent for recovering precious metals such as Pd(II and Pt(IV, and moreover for identifying its selectivity toward Pd(II or Pt(IV from a binary metal solution. For the development of the sorbent, polyacrylonitrile (PAN was selected as a model textile because its morphological property (i.e., thin fiber form is suitable for fast adsorption processes, and a high amount of PAN has been discharged from industrial textile factories. The PAN fiber was prepared by spinning a PAN–dimethylsulfoxide mixture into distilled water, and then its surface was activated through amidoximation so that the fiber surface could possess binding sites for Pd(II and Pt(IV. Afterwards, by Fourier-transform infrared (FT-IR and scanning electron microscopy (SEM analyses, it was confirmed that the amidoximation reaction successfully occurred. The surface-activated fiber, designated as PAN–oxime fiber, was used to adsorb and recover precious metals. In the experiment results, it was clearly observed that adsorption capacity of PAN–oxime fiber was significantly enhanced compared to the raw material form. Actually, the raw material does not have sorption capacity for the metals. In a comparison study with commercial sorbent (Amberjet™ 4200, it was found that adsorption capacity of PAN–oxime was rather lower than that of Amberjet™ 4200, however, in the aspects of sorption kinetics and metal selectivity, the new sorbent has much faster and better selectivity.

Preparation and surface active properties of oxypropylated diol monoesters of fatty acids with an amide oxime terminal group

Directory of Open Access Journals (Sweden)

Eissa, A. M.F.

1994-10-01

Full Text Available Locally produced non-edible oil, namely, rice bran oil (R.B.O. was utilized as starting materials for preparing new nonionic surfactant. Oxypropylated diol monoesters of linoleic and rice bran oil fatty acids were prepared. Also amide oxime derivatives were obtained. Surface active properties of these compounds were measured. Under neutral condition amide eximes served as nonionic surfactants and their properties were similar to other oxypropylated monoesters.

Se ha utilizado un aceite no comestible de producción local, denominado, aceite de salvado de arroz (R.B.O. como materia prima para la preparación de nuevos tensioactivos no iónicos. Se prepararon diol monoésteres oxipropilados de ácido linoleico y ácidos grasos de aceite de salvado de arroz. También se obtuvieron los derivados de amido oxima. Se midieron las propiedades de tensión superficial de estos compuestos. Bajo condiciones neutras las amido eximas sirvieron como tensioactivos no iónicos y sus propiedades fueron similares a los de otros monoésteres oxipropilados.

In vitro and in vivo genotoxicity assessment of HI-6 dimethanesulfonate/oxime.

Science.gov (United States)

Nakab, Lauren; Bardot, Isabelle; Bardot, Sébastien; Simar, Sophie; Marzin, Daniel; Nesslany, Fabrice

2014-03-01

Organophosphate compounds, which induce organophosphate poisoning, were originally used as pesticides. But this type of product has also been used as warfare nerve agent like sarin, soman, Russian VX, or tabun. HI-6-dimethanesulfonate is a salt of the oxime HI-6 used in the treatment of nerve-agent poisoning. It is known to be the best re-activator component of inactivated acetyl cholinesterase. HI-6-dimethanesulfonate has shown a higher level of solubility with similar potency to reactivate acetyl cholinesterase and a similar pharmacokinetics profile compared with HI-6 dichloride. HI-6 dimethanesulfonate was tested for its mutagenic and genotoxic potential by use of the standard ICH S2R (1) battery for the evaluation of pharmaceuticals. HI-6-dimethanesulfonate was mutagenic in the Ames test only in the presence of metabolic activation. In the mutation assay at the Tk locus in L5178Y mouse-lymphoma cells, HI-6-dimethanesulfonate showed mutagenic activity both with and without metabolic activation, with a significant increase in small colonies. The effects were in favour of a clastogenic activity. It was concluded that the compound was mutagenic and possibly clastogenic in vitro. In contrast, the in vivo micronucleus test in rat bone-marrow did not demonstrate any genotoxic activity and the Comet assay performed in rat liver did not show any statistically or biologically significant increases in DNA strand-breaks. The results of both in vivo studies performed on two different organs with two endpoints are sufficient to conclude the absence of a genotoxic hazard in vivo and to consider that there is no genotoxic concern in humans for HI-6-dimethanesulfonate. Copyright © 2014 Elsevier B.V. All rights reserved.

Cortical perfusion response to an electrical stimulation of the auditory nerve in profoundly deaf patients: Study with technetium-99m hexamethylpropylene amine oxime single photon emission tomography

Energy Technology Data Exchange (ETDEWEB)

Le Scao, Y.; Robier, A.; Beuter, P. (Centre Hospitalier Universitaire, 37 - Tours (France). Dept. of Otorhinolaryngology); Baulieu, J.L.; Pourcelot, L. (Centre Hospitalier Universitaire, 37 - Tours (France). Dept. of Nuclear Medicine)

1992-04-01

Brain activation procedures associated with single photon emission tomography (SPET) have recently been developed in healthy controls and diseased patients in order to help in their diagnosis and treatment. We investigated the effects of a promontory test (PT) on the cerebral distribution of technetium-99m hexamethyl-propylene amine oxime ({sup 99m}Tc-HMPAO) in 7 profoundly deaf patients, 6 PT+ and PT-. The count variation in the temporal lobe was calculated on 6 coronal slices using the ratio (R{sub stimulation}-R{sub deprivation})/R{sub deprivation} where R=counts in the temporal lobe was observed in all patients and was higher in all patients with PT+ than in the patient with PT-. The problems of head positioning and resolution of the system were taken into account, and we considered that the maximal count increment was related to the auditory cortex response to the stimulus. Further clinical investigations with high-resolution systems have to be performed in order to validate this presurgery test in cochlear implant assessment. (orig.).

Cortical perfusion response to an electrical stimulation of the auditory nerve in profoundly deaf patients: study with technetium-99m hexamethylpropylene amine oxime single photon emission tomography.

Science.gov (United States)

Le Scao, Y; Robier, A; Baulieu, J L; Beutter, P; Pourcelot, L

1992-01-01

Brain activation procedures associated with single photon emission tomography (SPET) have recently been developed in healthy controls and diseased patients in order to help in their diagnosis and treatment. We investigated the effects of a promontory test (PT) on the cerebral distribution of technetium-99m hexamethylpropylene amine oxime (99mTc-HMPAO) in 7 profoundly deaf patients, 6 PT+ and one PT-. The count variation in the temporal lobe was calculated on 6 coronal slices using the ratio (Rstimulation-Rdeprivation)/Rdeprivation where R = counts in the temporal lobe/whole-brain count. A count increase in the temporal lobe was observed in all patients and was higher in all patients with PT+ than in the patient with PT-. The problems of head positioning and resolution of the system were taken into account, and we considered that the maximal count increment was related to the auditory cortex response to the stimulus. Further clinical investigations with high-resolution systems have to be performed in order to validate this presurgery test in cochlear implant assessment.

Major Decisions Ahead: Implementing SFAA Nos. 116 and 117.

Science.gov (United States)

Williams, Kenneth; Turner, Robert

1994-01-01

Issues that colleges and universities must address in implementing the Financial Accounting Standards Board's Statements of Financial Accounting Standards 116 (concerning contributions received and made) and 117 (for nonprofit organizations) are outlined. The overall objective is to present a financial statement in a format that tells the…

25 CFR 117.28 - Payment of claims against estates.

Science.gov (United States)

2010-04-01

... COMPETENCY § 117.28 Payment of claims against estates. The superintendent may disburse to the executor or... the Indian. (b) Expenses incurred pending the qualifications of an executor or administrator under... executor or administrator, transcript fees and appraiser fees. (d) Living expenses incurred within 90 days...

33 CFR 117.591 - Charles River and its tributaries.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Charles River and its tributaries... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.591 Charles River and its tributaries. (a) The following requirements apply to all bridges across the Charles River and it's...

Development of a space-flight ADR providing continuous cooling at 50 mK with heat rejection at 10 K

Science.gov (United States)

Tuttle, James; Canavan, Edgar; DeLee, Hudson; DiPirro, Michael; Jahromi, Amir; James, Bryan; Kimball, Mark; Shirron, Peter; Sullivan, Dan; Switzer, Eric

2017-12-01

Future astronomical instruments will require sub-Kelvin detector temperatures to obtain high sensitivity. In many cases large arrays of detectors will be used, and the associated cooling systems will need performance surpassing the limits of present technologies. NASA is developing a compact cooling system that will lift heat continuously at temperatures below 50 mK and reject it at over 10 K. Based on adiabatic demagnetization refrigerators (ADRs), it will have high thermodynamic efficiency and vibration-free operation with no moving parts. It will provide more than 10 times the current flight ADR cooling power at 50 mK and will also continuously cool a 4 K stage for instruments and optics. In addition, it will include an advanced magnetic shield resulting in external field variations below 5 μT. We describe the cooling system here and report on the progress in its development.

Modelling copper solvent extraction from acidic sulphate solutions using MOC 45

Directory of Open Access Journals (Sweden)

Alguacil, F. J.

1998-05-01

Full Text Available A mathematical model to predict the extraction has been developed for the Cu-MOC 45 system. The model consists of sets of nonlinear mass action and mass balance equations where the dimerization of the oxime was also considered. The predictive model calculated the equilibrium concentrations from the total oxime concentration, total copper concentration, initial pH value and the O/A volume phase ratio. The model suggests that the extraction of copper can be defined by the existence of two species into the organic solution: CuR₂ (k^ext = 4.2 and Cu(HR₂₂ (k^ext = 10.000- The initial oxime concentration defines the predominancy in the organic solution of both species. The model can be used to predict copper extraction isotherm as well as copper stripping with sulphuric acid.

Se desarrolla un modelo matemático para predecir el proceso de extracción en el sistema Cu-MOC 45. El modelo consiste en un conjunto de ecuaciones en el que se considera la dimerización de la oxima. El modelo permite predecir la extracción a partir de las concentraciones totales de la oxima y del cobre, del pH inicial y de la relación de fases O/A. La extracción de cobre responde a la existencia de dos especies en la fase orgánica: CuR₂ (k^ext = 4,2 y Cu(HR₂₂ (k^ext = 10.000. La predominancia de una u otra especie en esta fase depende de la concentración inicial de la oxima. El modelo también puede predecir las isotermas de extracción y la reextracción de cobre mediante ácido sulfúrico.

1000kW on-site PAFC power plant development and demonstration

Energy Technology Data Exchange (ETDEWEB)

Satomi, Tomohide; Koike, Shunichi [Phosphoric Acid Fuel Cell Technology Research Association (PAFC-TRA), Osaka (Japan); Ishikawa, Ryou [New Energy and Industrial Technology Development Organization (NEDO), Tokyo (Japan)

1996-12-31

Phosphoric Acid Fuel Cell Technology Research Association (PAFC-TRA) and New Energy and Industrial Technology Development Organization (NEDO) have been conducting a joint project on development of a 5000kW urban energy center type PAFC power plant (pressurized) and a 1000kW on-site PAFC power plant (non-pressurized). The objective of the technical development of 1000kW on-site PAFC power plant is to realize a medium size power plant with an overall efficiency of over 70% and an electrical efficiency of over 36%, that could be installed in a large building as a cogeneration system. The components and system integration development work and the plant design were performed in 1991 and 1992. Manufacturing of the plant and installation at the test site were completed in 1994. PAC test was carried out in 1994, and generation test was started in January 1995. Demonstration test is scheduled for 1995 and 1996.

Development of K-Nearest Neighbour Regression Method in Forecasting River Stream Flow

Directory of Open Access Journals (Sweden)

Mohammad Azmi

2012-07-01

Full Text Available Different statistical, non-statistical and black-box methods have been used in forecasting processes. Among statistical methods, K-nearest neighbour non-parametric regression method (K-NN due to its natural simplicity and mathematical base is one of the recommended methods for forecasting processes. In this study, K-NN method is explained completely. Besides, development and improvement approaches such as best neighbour estimation, data transformation functions, distance functions and proposed extrapolation method are described. K-NN method in company with its development approaches is used in streamflow forecasting of Zayandeh-Rud Dam upper basin. Comparing between final results of classic K-NN method and modified K-NN (number of neighbour 5, transformation function of Range Scaling, distance function of Mahanalobis and proposed extrapolation method shows that modified K-NN in criteria of goodness of fit, root mean square error, percentage of volume of error and correlation has had performance improvement 45% , 59% and 17% respectively. These results approve necessity of applying mentioned approaches to derive more accurate forecasts.

49 CFR 1540.117 - Threat assessments regarding aliens holding or applying for FAA certificates, ratings, or...

Science.gov (United States)

2010-10-01

... applying for FAA certificates, ratings, or authorizations. 1540.117 Section 1540.117 Transportation Other... applying for FAA certificates, ratings, or authorizations. (a) Applicability. This section applies when TSA... applying for, an airman certificate, rating, or authorization issued by the FAA Administrator, poses a...

33 CFR 117.40 - Advance notice for drawbridge opening.

Science.gov (United States)

2010-07-01

... of the advanced notice for the drawbridge will be added to subpart B of this part. [USCG-2001-10881... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Advance notice for drawbridge... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.40 Advance notice for...

7 CFR 457.117 - Forage production crop insurance provisions.

Science.gov (United States)

2010-01-01

... INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.117 Forage..., or a mixture thereof, or other species as shown in the Actuarial Documents. Harvest—Removal of forage... different price elections by type, in which case you may select one price election for each forage type...

Crystal Structure and Hydrogen Bonding Study of (10E-2,2-Dimethyl-3,4-dihydro-2H-benzo[g]chromene-5,10-dione 10-Oxime Derived From a-Lapachone

Directory of Open Access Journals (Sweden)

Lorenzo C. Visentin

2011-01-01

Full Text Available The compound (10E-2,2-dimethyl-3,4-dihydro-2H-benzo[g]chromene-5,10-dione-10-oxime (1 was synthesized from a-lapachone and hydroxylamine chloride in alkaline medium. Single-crystals suitable for X-ray diffraction measurements were grown from an ethanol solution, and the crystal structure of the title molecule is reported for the first time. The title molecule was also characterized by 1H- and 13C-NMR in CDCl3 solution, FTIR and MS. The crystal structure of 1 shows an E stereochemistry and dimers formed through classical hydrogen bonds.

27 CFR 478.117 - Function outside a customs territory.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Function outside a customs... Importation § 478.117 Function outside a customs territory. In the insular possessions of the United States outside customs territory, the functions performed by U.S. Customs officers under this subpart within a...

Development of 750 keV/20kW DC accelerator

International Nuclear Information System (INIS)

Bapna, S.C.; Banwari, R.; Venkateswaran, S.V.; Tripathi, Alok; Kasliwal, Apollo; Pramod, R.; Kumar, Pankaj

2001-01-01

This paper discusses development of a DC accelerator at CAT for industrial applications. This accelerator is housed in two floors; first floor having the accelerator and the ground floor is an irradiation cell. It will operate in the voltage range of 300kV to 750kV and will give maximum beam power of 20kW. The electron gun, acceleration column, focusing coil, high voltage multiplier stack, filament power supply and the control unit are housed in a 1.5 m diameter 3.2 m high pressure vessel which will be pressurized to 5.5 bar of SF 6 gas

Recovery of sperm after epididymal refrigeration from domestic cats using ACP-117c and Tris extenders

Directory of Open Access Journals (Sweden)

D.B.C. Lima

2016-08-01

Full Text Available ABSTRACT We aimed to compare fresh sperm and sperm cooled to 4ºC that had been recovered from the epididymides of cats using powdered coconut water (ACP-117c and Tris extenders. Sixty epididymides were divided into 6 groups: 10 fresh epididymides were recovered using Tris (T0h; 10 were kept at 4°C/2h and recovered using Tris (T2h; 10 were kept at 4°C/4h and recovered using Tris (T4h; 10 fresh were recovered using ACP-117c (A0h; 10 were kept at 4°C/2h and recovered using ACP-117c (A2h, and 10 were kept at 4°C/4h and recovered using ACP-117c (A4h. The testis-epididymis complexes (TEC control were not cooled. The others were cooled at 4°C for 2 or 4h. The epididymis was separated and the sperm was recovered by the modified flotation method. Sperm kinetic parameters were evaluated by a computer-system analysis, and vigor, viability, concentration, membrane function and morphology of the sperm were assessed under a light microscope. The progressive motility with ACP-117c declined after 2h of cooling, but did not differ between fresh and 4h. The vigor and membrane function were higher in A4h than A0h. The vigor at T2h and T4h were decreased compared to T0h. T0h was higher than A0h for vigor and sperm membrane function. However, after 4h of cooling, ACP-117c maintained a higher percentage of living cells. Feline epididymal sperm quality can be maintained to the degree necessary for artificial breeding programs following cooling and ACP-117c may be successfully used to recover cat sperm that have been cooled for up to 4h.

Evidence that a glycolipid tail anchors antigen 117 to the plasma membrane of Dictyostelium discoideum cells

International Nuclear Information System (INIS)

Sadeghi, H.; Da Silva, A.M.; Klein, C.

1988-01-01

The authors describe the biochemical features of the putative cell cohesion molecule antigen 117, indicating that it is anchored to the plasma membrane by a glycolipid tail. Antigen 117 can be radiolabeled with [ 3 H]myristate, [ 3 H]palmitate, and [ 14 C]ethanolamine. The fatty acid label is removed by periodate oxidation and nitrous acid deamination, indicating that the fatty acid is attached to the protein by a structure containing carbohydrate and an unsubstituted glucosamine. As cells develop aggregation competence, the antigen is released from the cell surface in a soluble form that can still be radiolabeled with [ 14 C]ethanolamine but not with [ 3 H]myristate of [ 3 H]-palmitate. The molecular weight of the released antigen is similar to that found in the plasma membrane, but it preferentially partitions in Triton X-114 as a hydrophilic, as opposed to a hydrophobic, protein. Plasma membranes contain the enzyme activity responsible for the release of the antigen in a soluble form

76 FR 35104 - Safety Zone; Waterway Closure, Atchafalaya River From Mile Marker 117 (Morgan City Railroad...

Science.gov (United States)

2011-06-16

...-AA00 Safety Zone; Waterway Closure, Atchafalaya River From Mile Marker 117 (Morgan City Railroad Bridge... with rising flood water in the Atchafalaya River. Basis and Purpose Captain of the Port Morgan City... safety zone is located on the specified waters of the Atchafalaya River between MM 117 (Morgan City...

99mTc-Hexamethyl Propyleneamine Oxime Brain Perfusion Single Photon Emission Computed Tomography in Characterization of Dementia: An Initial Experience in Indian Clinical Practice

International Nuclear Information System (INIS)

Santra, Amburanjan; Sinha, Gaurav Kumar; Neogi, Rajarshi; Thukral, Ramesh Kumar

2014-01-01

There is a growing health burden in developing countries due to recent trends of increasing incidence of neurodegenerative diseases. To reduce the healthcare cost and effective management of dementia illness, early diagnosis, accurate differentiation and their progression assessment is becoming crucially important. We are utilizing 99m Tc-d, l-hexamethyl propyleneamine oxime (HMPAO) brain perfusion single photon emission computed tomography (SPECT) to characterize dementia on the basis of perfusion patterns and observed significant improvement in their management. Eleven patients (median age of 60 years range of 53-83 years) with clinical suspicion of dementia underwent 99m Tc-HMPAO brain perfusion SPECT. SPECT-computed tomography acquisition done, data are reconstructed, reviewed in three view and further processed in “neurogam” to get voxel based analysis and the comparison with age based normal database and surface mapping. Final diagnosis was done with clinical correlation. Four patients are diagnosed as Alzheimer's disease, two as frontotemporal dementia, one as dementia of Lewy bodies, two as vascular dementia and two as pseudodementia. All imaging findings are well-correlated with clinical background. Brain perfusion SPECT with HMPAO was very helpful to us in characterizing the patients of dementia by its perfusion pattern

Focus on the therapeutic efficacy of 3BNC117 against HIV-1: In vitro studies, in vivo studies, clinical trials and challenges.

Science.gov (United States)

Liu, Zhi-Jun; Bai, Jing; Liu, Feng-Li; Zhang, Xiang-Yang; Wang, Jing-Zhang

2017-11-01

3BNC117, which was discovered in 2011, is a broadly neutralizing antibody (bNAb) and specifically neutralizes the human immunodeficiency virus type-1 (HIV-1) by targeting the CD4-binding site. This is the first comprehensive review that focuses on the role of 3BNC117 in the prevention of HIV-1 and acquired immune deficiency syndrome (AIDS). Briefly, 3BNC117 neutralizes many HIV/SHIV strains in vitro, blocks HIV-1 acquisition in animal models via a pre-exposure prophylaxis, alleviates HIV-1-associated viremia via a post-exposure therapeutic effect, prevents the establishment of latent HIV-1 reservoirs, and induces both humoral and cellular anti-HIV immune responses in vivo. The outcomes of Phase I and Phase IIa clinical trials in 2015 and 2016 showed the safety, tolerability, and therapeutic efficacy of 3BNC117 in HIV-1-infected human individuals. Nevertheless, anti-3BNC117 antibodies and HIV-1 strains resistant to 3BNC117 pose clinical challenges to immunotherapy with 3BNC117, so potential strategies for optimizing the potency of 3BNC117 are suggested here. Predictably, HIV-1 prevention and AIDS treatment will benefit from combinational immunotherapies with 3BNC117 and other pharmaceuticals (bNAbs, antiretroviral medicines, viral inducers, etc.) in the near future. Copyright © 2017 Elsevier B.V. All rights reserved.

41 CFR 102-117.50 - What are the advantages and disadvantages of contracting directly with a TSP under the FAR?

Science.gov (United States)

2010-07-01

... and disadvantages of contracting directly with a TSP under the FAR? 102-117.50 Section 102-117.50... Related Services § 102-117.50 What are the advantages and disadvantages of contracting directly with a TSP... office is able to handle the requirement. (b) The FAR may be a disadvantage when you: (1) Cannot prepare...

Brain single-photon emission tomography with technetium-99m hexamethylpropylene amine oxime in adolscents with intial-stage schizophrenia

International Nuclear Information System (INIS)

Batista, J.F.; Galiano, M.C.; Torres, L.A.; Hernandez, M.C.; Sosa, F.; Perera, A.; Perez, M.

1995-01-01

The objective of this study was to search for regional cerebral blood flow (rCBF) abnormalities in adolescents with initial-stage schizophrenia by means of brain single-photon emission tomography (SPET) using technetium-99m hexamethylpropylene amine oxime (HMPAO). SPET studies were performed on a homogeneous sample of 15 carefully selected adolescents with a recent diagnosis of schizophrenia, and without previous electroconvulsive or antipsychotic drug treatment. Computed tomography (CT) and electro-encephalographic (EEG) studies were performed in all patients. Qualitative and semiquantitative analysis of 99m Tc-HMPAO SPET studies showed an impaired rCBF in 12 patients (80%). The most common pattern was a decreased uptake of 99m Tc-HMPAO in the frontal lobes, usually in the left hemisphere. Conventional and quantitative EEG was positive in 12 (80%) and 15 (100%) patients, respectively. CT findings were positive in two patients (13%). There was a high level of concordance between SPET and EEG results and between SPET and clinical features (P > 0.05). This study suggests that previously untreated patients in the first stages of schizophrenia present functional abnormalities that are revealed by brain SPET. (orig.)

14 CFR 382.117 - Must carriers permit passengers with a disability to travel with service animals?

Science.gov (United States)

2010-01-01

... necessary to legally transport service animals on flights from the U.S. into the United Kingdom is found in... disability to travel with service animals? 382.117 Section 382.117 Aeronautics and Space OFFICE OF THE... disability to travel with service animals? (a) As a carrier, you must permit a service animal to accompany a...

41 CFR 102-117.55 - What are the advantages and disadvantages of using a rate tender?

Science.gov (United States)

2010-07-01

... and disadvantages of using a rate tender? 102-117.55 Section 102-117.55 Public Contracts and Property... the advantages and disadvantages of using a rate tender? (a) Using a rate tender is an advantage when... volume to obtain favorable rates. (b) Using a rate tender may be a disadvantage when: (1) You have...

41 CFR 102-117.285 - What are my choices if a TSP's performance is not satisfactory?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are my choices if a TSP's performance is not satisfactory? 102-117.285 Section 102-117.285 Public Contracts and Property... are my choices if a TSP's performance is not satisfactory? You may choose to place a TSP in temporary...

Kimberlite Wall Rock Fragmentation: Venetia K08 Pipe Development

Science.gov (United States)

Barnett, W.; Kurszlaukis, S.; Tait, M.; Dirks, P.

2009-05-01

Volcanic systems impose powerful disrupting forces on the country rock into which they intrude. The nature of the induced brittle deformation or fragmentation can be characteristic of the volcanic processes ongoing within the volcanic system, but are most typically partially removed or obscured by repeated, overprinting volcanic activity in mature pipes. Incompletely evolved pipes may therefore provide important evidence for the types and stages of wall rock fragmentation, and mechanical processes responsible for the fragmentation. Evidence for preserved stages of fragmentation is presented from a detailed study of the K08 pipe within the Cambrian Venetia kimberlite cluster, South Africa. This paper investigates the growth history of the K08 pipe and the mechanics of pipe development based on observations in the pit, drill core and thin sections, from geochemical analyses, particle size distribution analyses, and 3D modeling. Present open pit exposures of the K08 pipe comprise greater than 90% mega-breccia of country rock clasts (gneiss and schist) with Drill core shows that below about 225 m the CRB includes increasing quantities of kimberlite. The breccia clasts are angular, clast-supported with void or carbonate cement between the clasts. Average clast sizes define sub-horizontal layers tens of metres thick across the pipe. Structural and textural observations indicate the presence of zones of re-fragmentation or zones of brittle shearing. Breccia textural studies and fractal statistics on particle size distributions (PSD) is used to quantify sheared and non- sheared breccia zones. The calculated energy required to form the non-sheared breccia PSD implies an explosive early stage of fragmentation that pre-conditions the rock mass. The pre-conditioning would have been caused by explosions that are either phreatic or phreatomagmatic in nature. The explosions are likely to have been centered on a dyke, or pulses of preceding volatile-fluid phases, which have

A rat model of nerve agent exposure applicable to the pediatric population: The anticonvulsant efficacies of atropine and GluK1 antagonists.

Science.gov (United States)

Miller, Steven L; Aroniadou-Anderjaska, Vassiliki; Figueiredo, Taiza H; Prager, Eric M; Almeida-Suhett, Camila P; Apland, James P; Braga, Maria F M

2015-04-15

Inhibition of acetylcholinesterase (AChE) after nerve agent exposure induces status epilepticus (SE), which causes brain damage or death. The development of countermeasures appropriate for the pediatric population requires testing of anticonvulsant treatments in immature animals. In the present study, exposure of 21-day-old (P21) rats to different doses of soman, followed by probit analysis, produced an LD50 of 62μg/kg. The onset of behaviorally-observed SE was accompanied by a dramatic decrease in brain AChE activity; rats who did not develop SE had significantly less reduction of AChE activity in the basolateral amygdala than rats who developed SE. Atropine sulfate (ATS) at 2mg/kg, administered 20 min after soman exposure (1.2×LD50), terminated seizures. ATS at 0.5mg/kg, given along with an oxime within 1 min after exposure, allowed testing of anticonvulsants at delayed time-points. The AMPA/GluK1 receptor antagonist LY293558, or the specific GluK1 antagonist UBP302, administered 1h post-exposure, terminated SE. There were no degenerating neurons in soman-exposed P21 rats, but both the amygdala and the hippocampus were smaller than in control rats at 30 and 90days post-exposure; this pathology was not present in rats treated with LY293558. Behavioral deficits present at 30 days post-exposure, were also prevented by LY293558 treatment. Thus, in immature animals, a single injection of atropine is sufficient to halt nerve agent-induced seizures, if administered timely. Testing anticonvulsants at delayed time-points requires early administration of ATS at a low dose, sufficient to counteract only peripheral toxicity. LY293558 administered 1h post-exposure, prevents brain pathology and behavioral deficits. Published by Elsevier Inc.

Development of a thermally switched superconducting rectifier for 100 kA

NARCIS (Netherlands)

Mulder, G.B.J.; Mulder, G.B.J.; ten Kate, Herman H.J.; Krooshoop, Hendrikus J.G.; van de Klundert, L.J.M.; van de Klundert, L.J.M.

1991-01-01

A full-wave superconducting rectifier for 100 kA has been developed. Typical design values of this device are: a secondary current of 100 kA, a primary amplitude of 20 A, an operating frequency of 0.5 Hz, and an average power on the order of 100 W. The rectification is achieved by means of thermally

Pyruvic oxime nitrification and copper and nickel resistance by a Cupriavidus pauculus, an active heterotrophic nitrifier-denitrifier.

Science.gov (United States)

Ramirez, Miguel; Obrzydowski, Jennifer; Ayers, Mary; Virparia, Sonia; Wang, Meijing; Stefan, Kurtis; Linchangco, Richard; Castignetti, Domenic

2014-01-01

Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2) and nitrous oxide (N2O) while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3-C(NOH)-COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a genus (Cupriavidus) known for its resistance to metals and its metabolism of xenobiotics. The microbe (a Cupriavidus pauculus designated as C. pauculus strain UM1) was examined for its ability to perform heterotrophic nitrification in the presence of Cu(2+) and Ni(2+) and to metabolize the xenobiotic phenol. The bacterium heterotrophically nitrified well when either 1 mM Cu(2+) or 0.5 mM Ni(2+) was present in either enriched or minimal medium. The organism also used phenol as a sole carbon source in either the presence or absence of 1 mM Cu(2+) or 0.5 mM Ni(2+). The ability of this isolate to perform a number of different metabolisms, its noteworthy resistance to copper and nickel, and its potential use as a bioremediation agent are discussed.

Eleven new heaviest isotopes of elements Z=105 to Z=117 identified among the products of 249Bk+48Ca reactions

International Nuclear Information System (INIS)

Oganessian, Yu. Ts.; Abdullin, F. Sh.; Dmitriev, S. N.; Itkis, M. G.; Lobanov, Yu. V.; Mezentsev, A. N.; Polyakov, A. N.; Sagaidak, R. N.; Shirokovsky, I. V.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu. S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.; Bailey, P. D.; Benker, D. E.; Ezold, J. G.; Porter, C. E.; Riley, F. D.

2011-01-01

The heaviest isotopes of elements Z=117 to Z=105, 294 117, 293 117, 290 115, 289 115, 286 113, 285 113, 282 Rg, 281 Rg, 278 Mt, 274 Bh, and 270 Db, were identified by means of the Dubna gas-filled recoil separator among the products of the 249 Bk + 48 Ca reaction. The details of the observed six decay chains, indicating the production and decay of isotopes 293 117 and 294 117, are presented and discussed. The decay energies and resulting half-lives of these new nuclei show a strong rise of stability with increasing neutron number, validating the concept of the island of enhanced stability for superheavy nuclei [Oganessian et al., Phys. Rev. Lett. 104, 142502 (2010)].

Development of the Korean version of Alzheimer's Disease Assessment Scale (ADAS-K).

Science.gov (United States)

Youn, J C; Lee, D Y; Kim, K W; Lee, J H; Jhoo, J H; Lee, K U; Ha, J; Woo, J I

2002-09-01

The purpose of this study was the development of the Korean Version of Alzheimer's Disease Assessment Scale (ADAS-K). ADAS-K was administrated to 84 AD patients as well as 105 non-demented control subjects. Three aspects of reliability were tested. To evaluate the validity of ADAS-K, discriminant validity and concurrent validity were tested. To evaluate the sensitivity of ADAS-K to disease severity, all subjects, AD patients and control subjects, were grouped by CDR scale and their mean scores on ADAS-K were compared. ADAS-K demonstrated high levels of reliability. Mean ADAS-K scores for AD patients were significantly different from the control group (p ADAS-K exhibited significant correlations with other tests and scales (range 0.45-0.85, p ADAS-K displayed high diagnostic efficacy and the optimal cut-off point was selected between 18/19. ADAS-K was able to discriminate the degree of AD severity according to CDR classification. Our results suggested that ADAS-K-cog was sensitive to very mild AD. We demonstrated that ADAS-K is a reliable and valid instrument not only for AD diagnosis but also for evaluation of its severity. Copyright 2002 John Wiley & Sons, Ltd.

Scintigraphic evaluation of brain death with 99mTc-d,l-hexamethyl-propyleneamine oxime (HMPAO)

International Nuclear Information System (INIS)

Takehara, Yasuo; Isoda, Haruo; Sakai, Tsuneo; Tanaka, Tokutaro; Sato, Haruhiko; Yamamoto, Takamichi; Takahashi, Motoichiro; Kaneko, Masao.

1989-01-01

Lately, the criteria of brain death is being discussed. Cerebral scintigram, especially scintigraphic evaluation of brain death by dynamic study, has been previously reported. Cerebral imaging using radiolabeled amines such as 123 I-IMP N-isopropyl-p-iodoamphetamin (IMP) or 99m Tc d, l-hexamethyl-propyleneamine oxime (HMPAO) offers a significant information of brain death by the finding of 'non visualized brain'. However, the dynamic scintigram acquired during the bolus injection of 99m Tc-HMPAO provides an additional information of brain death by classical 'hot nose sign'. 99m Tc-HMPAO is able to be administered relatively in a large amount of dose. This cerebral perfusion tracer is lipophilic and remains in the central nervous system, which characterize its role as a reliable indicator of cerebral blood flow. As a result, this compound became suitable for the non-invasive study of brain circulation when the diagnosis of brain death is uncertain. We report a case of brain death in which diagnosis was made by the classical 'hot nose sign' in dynamic scintigraphy performed when 99 mTc-HMPAO was injected as well as the SPECT which showed a lack of cerebral visualization at the equilibrium state. As far as we are informed, this additional procedure used in the diagnosis of brain death has not reported before. The importance of performing a dynamic scintigram at the administration of 99m Tc-HMPAO is also discussed in this report. (author)

SiO2@FeSO4 nano composite: A recoverable nano-catalyst for eco-friendly synthesis oximes of carbonyl compounds

Directory of Open Access Journals (Sweden)

Mostafa Karimkoshteh

2016-01-01

Full Text Available Various aldoximes and ketoximes synthesis of corresponding aldehydes and ketones in the presence of SiO2@FeSO4 nano composite as recoverable nano catalyst and NH2OH·HCl. The SiO2@FeSO4 nano composite system was carried out between 10 to 15 min in oil bath (70-80 °C under solvent-free condition in excellent yields in addition this protocol can be used for industrial scales. This method offers some advantages in term of clean reaction conditions, easy work-up procedure, short reaction time, applied to convert α-diketones to α-diketoximes (as longer than other carbonyl compounds, α,β-unsaturated aldehydes and ketones to corresponding oximes and suppression of any side product. So we think that NH2OH•HCl/SiO2@FeSO4 nano composite system could be considered a new and useful addition to the present methodologies in this area. Structure of products and nano composite elucidation was carried out by 1H NMR, 13C NMR, FT-IR, scanning electron microscopy (SEM.

SPECT with [99mTc]-d,l-hexamethyl-propylene amine oxime (HM-PAO) compared with regional cerebral blood flow measured by PET

DEFF Research Database (Denmark)

Yonekura, Y; Nishizawa, S; Mukai, Thomas Søgaard

1988-01-01

In order to validate the use of technetium-99m-d,l-hexamethylpropyleneamine oxime (HM-PAO) as a flow tracer, a total of 21 cases were studied with single photon emission computerized tomography (SPECT), and compared to regional cerebral blood flow (rCBF) measured by position emission tomography...... (PET) using the oxygen-15 CO2 inhalation technique. Although HM-PAO SPECT and rCBF PET images showed a similar distribution pattern the HM-PAO SPECT image showed less contrast between high and low activity flow regions than the rCBF image and a nonlinear relationship between HM-PAO activity and r......CBF was shown. Based on the assumption of flow-dependent backdiffusion of HM-PAO from the brain, we applied a "linearization algorithm" to correct the HM-PAO SPECT images. The corrected HM-PAO SPECT images revealed a good linear correlation with rCBF (r = 0.901, p less than 0.001). The results indicated HM-PAO...

A unique corundum and refractory metal-nugget bearing micrometeorite P117

Digital Repository Service at National Institute of Oceanography (India)

Rudraswami, N.G.; Reshma, K.; ShyamPrasad, M.

Micrometeorites provide a large range of samples sourced from a wide variety of planetary materials, thereby providing a scope for expanding the known inventory of solar system materials. Here we report the micrometeorite AAS62-34-P117 having...

The development of a 200 kV monochromated field emission electron source

Energy Technology Data Exchange (ETDEWEB)

Mukai, Masaki, E-mail: mmukai@jeol.co.jp [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Kim, Judy S. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom); Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom)

2014-05-01

We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination.

The development of a 200 kV monochromated field emission electron source

International Nuclear Information System (INIS)

Mukai, Masaki; Kim, Judy S.; Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu; Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I.

2014-01-01

We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination

32 CFR 701.117 - Changes to PA systems of records.

Science.gov (United States)

2010-07-01

... DEPARTMENT OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.117 Changes to PA systems of... consider the sensitivity and use of the records; present and projected threats and vulnerabilities; and... who records are maintained. For example, a decision to expand a system of records that originally...

33 CFR 117.669 - St. Louis River (Duluth Superior Harbor).

Science.gov (United States)

2010-07-01

... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Minnesota § 117.669 St. Louis River (Duluth Superior Harbor). (a) The draws of the Burlington Northern railroad bridge, mile 5.7, shall open... Missabe and Iron Range Railway bridge, mile 16.3, need not be opened for the passage of vessels. The owner...

33 CFR 117.1083 - Duluth-Superior Harbor (St. Louis River).

Science.gov (United States)

2010-07-01

... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1083 Duluth-Superior Harbor (St. Louis River). (a) The draws of the Burlington Northern railroad bridge, mile 5.7 at... blasts. (c) The draw of the Duluth, Missabe and Iron Range Railway bridge, mile 16.3 at Duluth, need not...

41 CFR 102-117.255 - What actions may I take if the TSP's performance is not satisfactory?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What actions may I take if the TSP's performance is not satisfactory? 102-117.255 Section 102-117.255 Public Contracts and... may I take if the TSP's performance is not satisfactory? If the TSP's performance is not satisfactory...

Infrared Astronomy Professional Development for K-12 Educators: WISE Telescope

Science.gov (United States)

Borders, Kareen; Mendez, B. M.

2010-01-01

K-12 educators need effective and relevant astronomy professional development. WISE Telescope (Wide-Field Infrared Survey Explorer) and Spitzer Space Telescope Education programs provided an immersive teacher professional development workshop at Arecibo Observatory in Puerto Rico during the summer of 2009. As many common misconceptions involve scale and distance, teachers worked with Moon/Earth scale, solar system scale, and distance of objects in the universe. Teachers built and used basic telescopes, learned about the history of telescopes, explored ground and satellite based telescopes, and explored and worked on models of WISE Telescope. An in-depth explanation of WISE and Spitzer telescopes gave participants background knowledge for infrared astronomy observations. We taught the electromagnetic spectrum through interactive stations. The stations included an overview via lecture and power point, the use of ultraviolet beads to determine ultraviolet exposure, the study of WISE lenticulars and diagramming of infrared data, listening to light by using speakers hooked up to photoreceptor cells, looking at visible light through diffraction glasses and diagramming the data, protocols for using astronomy based research in the classroom, and infrared thermometers to compare environmental conditions around the observatory. An overview of LIDAR physics was followed up by a simulated LIDAR mapping of the topography of Mars. We will outline specific steps for K-12 infrared astronomy professional development, provide data demonstrating the impact of the above professional development on educator understanding and classroom use, and detail future plans for additional K-12 professional development. Funding was provided by WISE Telescope, Spitzer Space Telescope, Starbucks, Arecibo Observatory, the American Institute of Aeronautics and Astronautics, and the Washington Space Grant Consortium.

Study on keV-neutron capture cross sections and capture γ-ray spectra of 117,119Sn

International Nuclear Information System (INIS)

Nishiyama, J.; Igashira, M.; Ohsaki, T.; Kim, G.N.; Chung, W.C.; Ro, T.I.

2006-01-01

The capture cross sections and capture γ-ray spectra of 117,119 Sn were measured in an incident neutron energy region from 10 to 100 keV and at 570 keV, using a 1.5-ns pulsed neutron source by the 7 Li(p,n) 7 Be reaction and a large anti-Compton NaI(Tl) γ-ray spectrometer. A pulse-height weighting technique was applied to observed capture γ-ray pulse-height spectra to derive capture yields. The capture cross sections of 117,119 Sn were obtained with the error of about 5% by using the standard capture cross sections of 197 Au. The present cross sections were compared with previous experimental data and the evaluated values in JENDL-3.3 and ENDF/B-VI. The capture γ-ray spectra of 117,119 Sn were derived by unfolding the observed capture γ-ray pulse-height spectra. The calculations of capture cross sections and capture γ-ray spectra of 117,119 Sn were performed with the EMPIRE-II code. The calculated results were compared with the present experimental ones. (author)

Development of a 15 K hydrogen-based sorption cooler

NARCIS (Netherlands)

Burger, Johannes Faas; Holland, Herman J.; Meijer, R.J.; Linder, M.; ter Brake, Hermanus J.M.

2010-01-01

At the University of Twente, a 15 K hydrogen-based sorption cooler is under development, which has no moving parts and, therefore, is essentially vibration-free. Moreover, it has the potential of a very long life. Although the cooler may operate standalone, it is designed to precool a helium-based

Morphology Effect on Proton Dynamics in Nafion® 117 and Sulfonated Polyether Ether Ketone

Science.gov (United States)

Leong, Jun Xing; Diño, Wilson Agerico; Ahmad, Azizan; Daud, Wan Ramli Wan; Kasai, Hideaki

2016-09-01

We report results of our experimental and theoretical studies on the dynamics of proton conductivity in Nafion® 117 and self-fabricated sulfonated polyether ether ketone (SPEEK) membranes. Knowing that the presence of water molecules in the diffusion process results in a lower energy barrier, we determined the diffusion barriers and corresponding tunneling probabilities of Nafion® 117 and SPEEK system using a simple theoretical model that excludes the medium (water molecules) in the initial calculations. We then propose an equation that relates the membrane conductivity to the tunneling probability. We recover the effect of the medium by introducing a correction term into the proposed equation, which takes into account the effect of the proton diffusion distance and the hydration level. We have also experimentally verified that the proposed equation correctly explain the difference in conductivity between Nafion® 117 and SPEEK. We found that membranes that are to be operated in low hydration environments (high temperatures) need to be designed with short diffusion distances to enhance and maintain high conductivity.

Structure and magnetic properties of Gd2Co17-xCr x (1.17 ≤ x ≤ 3.0) compounds

International Nuclear Information System (INIS)

Fuquan, B.; Tegus, O.; Dagula, W.; Brueck, E.; Klaasse, J.C.P.; Buschow, K.H.J.

2007-01-01

The structure and magnetic properties of Gd 2 Co 17-x Cr x (1.17 ≤ x ≤ 3.0) compounds have been investigated by means of X-ray diffraction (XRD) and magnetization measurements. The powder X-ray diffraction patterns show that all samples crystallize as a single phase with the rhombohedral Th 2 Zn 17 -type structure. The lattice parameters a and the unit cell volume V increases slightly with increasing Cr content, but the c parameter varies in a less simple way with increasing Cr content. The X-ray diffraction patterns of the magnetically aligned samples show that all compounds investigated have uniaxial anisotropy. Spin reorientation phenomena occur in all of the compounds. The Curie temperature T C , the spin reorientation temperature T sr , the spontaneous magnetization M 0 and the saturation magnetization M s decrease with the increasing Cr content. The anisotropy constant K 1 and the anisotropy field B a of the compounds at room temperature reach a maximum for x = 1.76. The M 0 and M s increase with increasing temperature from 5 K to 300 K. The easy-axis anisotropy of all compounds changes to easy-plane anisotropy at low temperatures and the spin reorientation phenomena are more pronounced for low Cr concentration

21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.

Science.gov (United States)

2010-04-01

... HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.117 Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (a... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa with dioctyl sodium sulfosuccinate for...

Ab initio determination of the nuclear quadrupole moments of 114In, 115In, and 117In

International Nuclear Information System (INIS)

Errico, Leonardo A.; Renteria, Mario

2006-01-01

We present here ab initio determinations of the nuclear-quadrupole moment Q of hyperfine-probe-nuclear states of three different In isotopes: the 5 + 192 keV excited state of 114 In (probe for nuclear quadrupole alignment spectroscopy), the 9/2 + ground state of 115 In (nuclear magnetic and nuclear quadrupole resonance probe), and the 3/2 + 659 keV excited state of 117 In (perturbed angular correlations probe). These nuclear-quadrupole moments were determined by comparing experimental nuclear-quadrupole frequencies to the electric field gradient tensor calculated with high accuracy at In sites in metallic indium within the density functional theory. These ab initio calculations were performed with the full-potential linearized augmented plane wave method. The results obtained for the quadrupole moments of 114 In [Q( 114 In)=-0.14(1) b] are in clear discrepancy with those reported in the literature [Q( 114 In)=+0.16(6) b and +0.739(12) b]. For 115 In and 117 In our results are in excellent agreement with the literature and in the last case Q( 117 In) is determined with more precision. In the case of Q( 117 In), its sign cannot be determined because standard γ-γ perturbed angular correlations experiments are not sensitive to the sign of the nuclear-quadrupole frequency

Plavnoite, a new K-Mn member of the zippeite group from Jachymov, Czech Republic

Czech Academy of Sciences Publication Activity Database

Plášil, Jakub; Škácha, P.; Sejkora, J.; Kampf, A.R.; Škoda, R.; Čejka, J.; Hloušek, J.; Kasatkin, A.V.; Pavlíček, R.; Babka, K.

2017-01-01

Roč. 29, č. 1 (2017), s. 117-128 ISSN 0935-1221 R&D Projects: GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : plavnoite * uranyl sulfate hydrate * new mineral * zippeite group * crystal structure * chemical composition Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.362, year: 2016

Pyruvic Oxime Nitrification and Copper and Nickel Resistance by a Cupriavidus pauculus, an Active Heterotrophic Nitrifier-Denitrifier

Directory of Open Access Journals (Sweden)

Miguel Ramirez

2014-01-01

Full Text Available Heterotrophic nitrifiers synthesize nitrogenous gasses when nitrifying ammonium ion. A Cupriavidus pauculus, previously thought an Alcaligenes sp. and noted as an active heterotrophic nitrifier-denitrifier, was examined for its ability to produce nitrogen gas (N2 and nitrous oxide (N2O while heterotrophically nitrifying the organic substrate pyruvic oxime [CH3–C(NOH–COOH]. Neither N2 nor N2O were produced. Nucleotide and phylogenetic analyses indicated that the organism is a member of a genus (Cupriavidus known for its resistance to metals and its metabolism of xenobiotics. The microbe (a Cupriavidus pauculus designated as C. pauculus strain UM1 was examined for its ability to perform heterotrophic nitrification in the presence of Cu2+ and Ni2+ and to metabolize the xenobiotic phenol. The bacterium heterotrophically nitrified well when either 1 mM Cu2+ or 0.5 mM Ni2+ was present in either enriched or minimal medium. The organism also used phenol as a sole carbon source in either the presence or absence of 1 mM Cu2+ or 0.5 mM Ni2+. The ability of this isolate to perform a number of different metabolisms, its noteworthy resistance to copper and nickel, and its potential use as a bioremediation agent are discussed.

Development of the Advanced Energy Design Guide for K-12 Schools -- 50% Energy Savings

Energy Technology Data Exchange (ETDEWEB)

Bonnema, E.; Leach, M.; Pless, S.; Torcellini, P.

2013-02-01

This Technical Support Document (TSD) describes the process and methodology for the development of the Advanced Energy Design Guide for K-12 School Buildings: Achieving 50% Energy Savings Toward a Net Zero Energy Building (AEDG-K12) (ASHRAE et al. 2011a). The AEDG-K12 provides recommendations for achieving 50% whole-building energy savings in K-12 schools over levels achieved by following ANSI/ASHRAE/IESNA Standard 90.1-2004, Energy Standard for Buildings Except Low-Rise Residential Buildings (Standard 90.1-2004) (ASHRAE 2004b). The AEDG-K12 was developed in collaboration with the American Society of Heating, Refrigerating and Air-Conditioning Engineers (ASHRAE), the American Institute of Architects (AIA), the Illuminating Engineering Society of North America (IES), the U.S. Green Building Council (USGBC), and the U.S. Department of Energy (DOE).

Structural, spectroscopic (FT-IR, NMR, UV-visible), nonlinear optical (NLO), cytotoxic and molecular docking studies of 4-nitro-isonitrosoacetophenone (ninapH) by DFT method

Science.gov (United States)

Kucuk, Ilhan; Kaya, Yunus; Kaya, A. Asli

2017-07-01

(4-Nitro-phenyl)-oxo-acetaldehyde oxime (ninapH) is a type of oxime, which has a oxime and α-carbonyl groups. This molecule has been synthesized from literature procedure. The structural properties and conformational behaviors were examined using the density functional theory (DFT) with the B3LYP method combined with the 6-311++G(d,p) basis set. As a result of the conformational studies, the most stable conformer was determined, and then this molecule was optimized with the same basis set. Comprehensive theoretical and experimental structural studies on the molecule have been carried out by FT-IR, NMR and UV-vis spectrometry. The calculated HOMO and LUMO energies show that charge transfer within the molecule. The first order hyperpolarizability and molecular electrostatic potential (MEP) were also performed. The thermodynamic properties (heat capacity, entropy, and enthalpy) of the ninapH have been calculated at different temperatures, 100-1000 K. In addition, the molecular docking studies have been performed with DNA and protein structures (downloaded from Protein Data Bank).

Fertirrigação da bananeira cv. Prata-Anã com N e K em um argissolo vermelho-amarelo Fertigation of banana cv Prata Anã with N and K in an ultisol

Directory of Open Access Journals (Sweden)

Valbério Paolilo dos Santos

2009-06-01

Full Text Available O Nordeste brasileiro é a principal região produtora de banana, responsável por cerca de 35,80% da produção nacional. Apesar das condições favoráveis ao seu cultivo, a produtividade tem sido muito abaixo do seu potencial. Geralmente, isso se deve a problemas de suprimento hídrico e nutricional. Dentre os nutrientes, o nitrogênio (N e o potássio (K são requeridos em maiores quantidades pela bananeira. Com o objetivo de estudar o efeito de quatro doses de N (0; 117; 235 e 352 kg ha-1 de N e de K (0; 157; 313 e 470 kg ha-1 de K2O, aplicados via fertirrigação, avaliaram-se características produtivas de um 2º ciclo de cultivo da banana cv. Prata-Anã, em um Argissolo Vermelho-Amarelo dos tabuleiros costeiros do Nordeste brasileiro. O N não influenciou na produção de banana, enquanto a resposta ao K foi linear. O nível crítico de K pelo Mehlich-1, na profundidade de 0,20- 0,40 m, foi 0,71 mmol c kg-1.The Brazilian Northeast is the main producing area, being responsible for about 35,80% of banana's national production. In spite of the favorable conditions to its cultivation, the average national yield has been a lot below its potential, due mainly to water and nutrients supply. Among all nutrients, nitrogen (N and potassium (K are the ones required in larger amounts by the banana. With the objective of studying the effect of four rates of N (0, 117, 235 and 352 kg ha-1 of N, and of four rates K (0, 157, 313 and 470 kg ha-1 of K2O applied by fertirrigation in the 2º cycle of cultivation of the cv. Prata Anã, data was collected in an factorial experiment in randomized blocks, in an Ultisol of the coastal tableland, of the northeast of Brazil. There was not response to N but a linear one was observed for K. Soil K by Mehlich-1 critical level at 0,20- 0,40 m was 0,71 mmol c kg-1.

46 CFR 117.204 - Survival craft-vessels operating on coastwise routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on coastwise routes... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.204 Survival craft... allowed, the following survival craft requirements apply when not engaged in an overnight voyage: (1...

Quaternary and tertiary aldoxime antidotes for organophosphate exposure in a zebrafish model system

Energy Technology Data Exchange (ETDEWEB)

Schmidt, Hayden R. [Department of Biology, Whittier College, Whittier, CA 90608 (United States); Radić, Zoran; Taylor, Palmer [Department of Pharmacology, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California at San Diego, La Jolla, CA 92093-0650 (United States); Fradinger, Erica A., E-mail: efrading@whittier.edu [Department of Biology, Whittier College, Whittier, CA 90608 (United States)

2015-04-15

The zebrafish is rapidly becoming an important model system for screening of new therapeutics. Here we evaluated the zebrafish as a potential pharmacological model for screening novel oxime antidotes to organophosphate (OP)-inhibited acetylcholinesterase (AChE). The k{sub i} values determined for chlorpyrifos oxon (CPO) and dichlorvos (DDVP) showed that CPO was a more potent inhibitor of both human and zebrafish AChE, but overall zebrafish AChE was less sensitive to OP inhibition. In contrast, aldoxime antidotes, the quaternary ammonium 2-PAM and tertiary amine RS-194B, showed generally similar overall reactivation kinetics, k{sub r}, in both zebrafish and human AChE. However, differences between the K{sub ox} and k{sub 2} constants suggest that zebrafish AChE associates more tightly with oximes, but has a slower maximal reactivation rate than human AChE. Homology modeling suggests that these kinetic differences result from divergences in the amino acids lining the entrance to the active site gorge. Although 2-PAM had the more favorable in vitro reactivation kinetics, RS-194B was more effective antidote in vivo. In intact zebrafish embryos, antidotal treatment with RS-194B rescued embryos from OP toxicity, whereas 2-PAM had no effect. Dechorionation of the embryos prior to antidotal treatment allowed both 2-PAM and RS-194B to rescue zebrafish embryos from OP toxicity. Interestingly, RS-194B and 2-PAM alone increased cholinergic motor activity in dechorionated embryos possibly due to the reversible inhibition kinetics, K{sub i} and αK{sub i}, of the oximes. Together these results demonstrate that the zebrafish at various developmental stages provides an excellent model for investigating membrane penetrant antidotes to OP exposure. - Highlights: • Zebrafish AChE shares significant structural similarities with human AChE. • OP-inhibited zebrafish and human AChE exhibit similar reactivation kinetics. • The zebrafish chorion is permeable to BBB penetrant and not

A Molecular Dynamic Simulation of Hydrated Proton Transfer in Perfluorosulfonate Ionomer Membranes (Nafion 117

Directory of Open Access Journals (Sweden)

Hong Sun

2015-01-01

Full Text Available A molecular dynamic model based on Lennard-Jones Potential, the interaction force between two particles, molecular diffusion, and radial distribution function (RDF is presented. The diffusion of the hydrated ion, triggered by both Grotthuss and vehicle mechanisms, is used to study the proton transfer in Nafion 117. The hydrated ion transfer mechanisms and the effects of the temperature, the water content in the membrane, and the electric field on the diffusion of the hydrated ion are analyzed. The molecular dynamic simulation results are in good agreement with those reported in the literature. The modeling results show that when the water content in Nafion 117 is low, H3O+ is the main transfer ion among the different hydrated ions. However, at higher water content, the hydrated ion in the form of H+(H2O2 is the main transfer ion. It is also found that the negatively charged sulfonic acid group as the fortified point facilitates the proton transfer in Nafion 117 better than the free water molecule. The diffusion of the hydrated ion can be improved by increasing the cell temperature, the water content in Nafion, and the electric field intensity.

Development of a 200kW multi-fuel type PAFC power plant

Energy Technology Data Exchange (ETDEWEB)

Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)

1996-12-31

Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.

Search Results | Page 117 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Smoking: Africa fights back ... The work of activist and lawyer Nighat Dad embodies the digital rights dichotomy facing Pakistan and many other developing ... Could affordable daycare be the key to unlocking women's earning power in Africa?

Involving Practicing Scientists in K-12 Science Teacher Professional Development

Science.gov (United States)

Bertram, K. B.

2011-12-01

The Science Teacher Education Program (STEP) offered a unique framework for creating professional development courses focused on Arctic research from 2006-2009. Under the STEP framework, science, technology, engineering, and math (STEM) training was delivered by teams of practicing Arctic researchers in partnership with master teachers with 20+ years experience teaching STEM content in K-12 classrooms. Courses based on the framework were offered to educators across Alaska. STEP offered in-person summer-intensive institutes and follow-on audio-conferenced field-test courses during the academic year, supplemented by online scientist mentorship for teachers. During STEP courses, teams of scientists offered in-depth STEM content instruction at the graduate level for teachers of all grade levels. STEP graduate-level training culminated in the translation of information and data learned from Arctic scientists into standard-aligned lessons designed for immediate use in K-12 classrooms. This presentation will focus on research that explored the question: To what degree was scientist involvement beneficial to teacher training and to what degree was STEP scientist involvement beneficial to scientist instructors? Data sources reveal consistently high levels of ongoing (4 year) scientist and teacher participation; high STEM content learning outcomes for teachers; high STEM content learning outcomes for students; high ratings of STEP courses by scientists and teachers; and a discussion of the reasons scientists indicate they benefited from STEP involvement. Analyses of open-ended comments by teachers and scientists support and clarify these findings. A grounded theory approach was used to analyze teacher and scientist qualitative feedback. Comments were coded and patterns analyzed in three databases. The vast majority of teacher open-ended comments indicate that STEP involvement improved K-12 STEM classroom instruction, and the vast majority of scientist open-ended comments

Resistance to organophosphorus agent toxicity in transgenic mice expressing the G117H mutant of human butyrylcholinesterase

International Nuclear Information System (INIS)

Wang Yuxia; Ticu Boeck, Andreea; Duysen, Ellen G.; Van Keuren, Margaret; Saunders, Thomas L.; Lockridge, Oksana

2004-01-01

Organophosphorus toxicants (OP) include chemical nerve agents and pesticides. The goal of this work was to find out whether an animal could be made resistant to OP toxicity by genetic engineering. The human butyrylcholinesterase (BChE) mutant G117H was chosen for study because it has the unusual ability to hydrolyze OP as well as acetylcholine, and it is resistant to inhibition by OP. Human G117H BChE, under the control of the ROSA26 promoter, was expressed in all tissues of transgenic mice. A stable transgenic mouse line expressed 0.5 μg/ml of human G117H BChE in plasma as well as 2 μg/ml of wild-type mouse BChE. Intestine, kidneys, stomach, lungs, heart, spleen, liver, brain, and muscle expressed 0.6-0.15 μg/g of G117H BChE. Transgenic mice were normal in behavior and fertility. The LD50 dose of echothiophate for wild-type mice was 0.1 mg/kg sc. This dose caused severe cholinergic signs of toxicity and lethality in wild-type mice, but caused no deaths and only mild toxicity in transgenic animals. The mechanism of protection was investigated by measuring acetylcholinesterase (AChE) and BChE activity. It was found that AChE and endogenous BChE were inhibited to the same extent in echothiophate-treated wild type and transgenic mice. This led to the hypothesis that protection against echothiophate toxicity was not explained by hydrolysis of echothiophate. In conclusion, the transgenic G117H BChE mouse demonstrates the factors required to achieve protection from OP toxicity in a vertebrate animal

41 CFR 102-117.345 - Is there a requirement for me to report to GSA on my transportation activities?

Science.gov (United States)

2010-07-01

... for me to report to GSA on my transportation activities? 102-117.345 Section 102-117.345 Public... requirement for me to report to GSA on my transportation activities? (a) Currently, there is no requirement for reporting to GSA on your transportation activities. However, GSA will work with your agency and...

Development of a 400 kV 80 mA Cockcroft-Walton power supply and 12 kW isolation transformer systems for neutron generators

Science.gov (United States)

Lu, X.; Chen, S.; Zhang, Y.; Huang, Z.; Ma, Z.; Yao, Z.

2017-06-01

A 400 kV 80 mA Cockcroft-Walton power supply driven by 2.5 kHz frequency, and 12 kW isolation transformer systems are developed for an intense DD/DT neutron generator. The design, construction, and testing of the high voltage (HV) power supply and isolation transformer systems are detailed reported. The structure of step-up transformers can make the potential distribution uniform, and auxiliary coils of the isolation transformers can improve the power transmission efficiency significantly. The testing results show that the HV power supply can reach 400 kV, and the isolation transformer systems can withstand 400 kV voltages and its power transmission efficiency is about 98.1%.

Development Status of Diffusion Code RAST-K 2.0 at UNIST

Energy Technology Data Exchange (ETDEWEB)

Park, Minyong; Zheng, Youqi; Choe, Jiwon; Zhang, Peng; Lee, Deokjung [UNIST, Ulsan (Korea, Republic of); Lee, Eunki; Shin, Hocheol [KHNP Central Research Institute, Daejeon (Korea, Republic of)

2016-10-15

The non-linear scheme was used based on the 2-group CMFD and a three dimensional multi -group unified nodal method (UNM). To consider the history effects, the main heavy isotopes were tracked by micro-depletion module using CRAM. The simplified 1-D single channel thermal hydraulic solver from nTACER is implemented. The θ method was adopted in the transient calculation. To get detailed pin-wise power and burnup distribution, Pin power reconstruction module was implemented. Also automatic control logic to calculate MTC, FTC, control rod worth was implemented. To perform multicycle analysis, restart and shuffling/rotation module has been implemented. To link between CASMO-4E and RAST-K 2.0, CATORA (CASMO TO RAST-K 2.0) code was developed. Unlike the other diffusion codes, RAST-K 2.0 depletion module uses CRAM and extended depletion chain for fission products. Most lattice codes give cumulative fission yield of Pm-149 without considering Pm-148 and Pm-149 capture reaction which will lead to the increase of Sm-149 number density. This paper reports the status of RAST-K 2.0 code development at UNIST. The new code applies a new kernel based on the two-node UNM with CMFD, and θ method for kinetic calculation. Also, the microdepletion calculation is used to consider the history effects. And other modules and functions also implemented such as pin power reconstruction, branch calculation, restart, multi-cycle, and 1-D single channel T/H solver.

Triaxiality in the odd-A nuclei 109−117I studied through a microscopic rotationparticle coupling

Directory of Open Access Journals (Sweden)

Modi Swati

2018-01-01

Full Text Available A systematic study of ground state spectrum with the triaxial deformation γ for odd-A Iodine isotopes 109−117I is carried out with the nonadiabatic quasiparticle approach. The rotation-particle coupling is accomplished microscopically such that the matrix elements of a particle-plus-rotor system are written in terms of the rotor energies. The 5/2+ state is confirmed as ground state for odd-A 111−117I and also coming out as lowest in energy for 109I.

Excited states of 117Sb populated in the reaction (α, 2nγ)

International Nuclear Information System (INIS)

Lobach, Y.N.; Trishin, V.V.

1995-01-01

The structure of 117 Sb levels populated in the reaction 115 In(α, 2nγ) at E α = 27.2 MeV is investigated. Data on γγ coincidences and the angular distributions of γ rays are used to construct the energy-level diagram and to determine the multipole orders of various transitions and the quantum numbers of levels. The positive-parity band based on the 9/2 + level is observed up to I = 23/2. A new band is revealed that is probably based on one of the isomer states. The levels of 117 Sb are interpreted in terms of the coupling of a proton to vibrations of the core or to three-quasiparticle excitations. Identical bands in the neighboring isotopes of Sb are discussed. 26 refs., 7 figs., 3 tabs

Development of 1000kW-class MCFC pilot plant

Energy Technology Data Exchange (ETDEWEB)

Ooue, M.; Yasue, H. [MCFC Research Association, Mie (Japan); Takasu, K.; Tsuchitori, T.

1996-12-31

This pilot plant is a part of the New Sunshine Program which has proceeded by the Agency of Industrial Science and Technology of the Ministry of International Trade and Industry. MCFC Research Association is entrusted with the development of the pilot plant, and constructing it at Kawagoe site. Following items will be verified by this pilot plant operation. (a) Development of 250kW class stack and confirmation of stack performance and decay rate. (b) System verification such as basic process, control system and operation characteristics, toward commercialization. (c) To get design data for demonstration plant.

Study of the properties of the superheavy nuclei Z=117 produced in the 249Bk + 48Ca reaction

International Nuclear Information System (INIS)

Oganessian, Y.T.; Abdullin, F.S.; Dmitriev, S.N.; Itkis, M.G.; Polyakov, A.N.; Sagaidak, R.N.; Shirokovsky, I.V.; Shumeiko, M.V.; Subbotin, V.G.; Sukhov, A.M.; Tsyganov, Y.S.; Utyonkov, V.K.; Voinov, A.A.; Vostokin, G.K.; Alexander, C.; Binder, J.; Boll, R.A.; Ezold, J.; Felker, K.; Miernik, K.; Roberto, J.B.; Rykaczewski, K.P.; Gostic, J.M.; Henderson, R.A.; Moody, K.J.; Shaughnessy, D.H.; Stoyer, M.A.; Stoyer, N.J.; Grzywacz, R.K.; Miller, D.; Hamilton, J.H.; Ramayya, A.V.; Ryabinin, M.A.

2014-01-01

The reaction of 249 Bk with 48 Ca have been reinvestigated to provide new evidence for the discovery of element 117 on a larger number of events. The experiments were performed at five projectile energies and with a total beam dose of 48 Ca of about 4.6*10 19 . Two isotopes 293,294 117 were synthesized in the 249 Bk+ 48 Ca reaction, providing excitation functions and α-decay spectra of the produced isotopes that establishes these nuclei to be the products of the 4n- and 3n-evaporation channels, respectively. Decay properties of 293,294 117 and of all the daughter products agree with the data of the experiment in which these nuclei were synthesized for the first time in 2010. The new 289 115 events, populated by a decay of 293 117, demonstrate the same decay properties as those observed for 289 115 produced in the 243 Am( 48 Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294 118 was observed from the reaction with 249 Cf - a result of the in-growth of 249 Cf in the 249 Bk target. (authors)

Survival and compound nucleus probability of super heavy element Z = 117

Energy Technology Data Exchange (ETDEWEB)

Manjunatha, H.C. [Government College for Women, Department of Physics, Kolar, Karnataka (India); Sridhar, K.N. [Government First grade College, Department of Physics, Kolar, Karnataka (India)

2017-05-15

As a part of a systematic study for predicting the most suitable projectile-target combinations for heavy-ion fusion experiments in the synthesis of {sup 289-297}Ts, we have calculated the transmission probability (T{sub l}), compound nucleus formation probabilities (P{sub CN}) and survival probability (P{sub sur}) of possible projectile-target combinations. We have also studied the fusion cross section, survival cross section and fission cross sections for different projectile-target combination of {sup 289-297}Ts. These theoretical parameters are required before the synthesis of the super heavy element. The calculated probabilities and cross sections show that the production of isotopes of the super heavy element with Z = 117 is strongly dependent on the reaction systems. The most probable reactions to synthetize the super heavy nuclei {sup 289-297}Ts are worked out and listed explicitly. We have also studied the variation of P{sub CN} and P{sub sur} with the mass number of projectile and target nuclei. This work is useful in the synthesis of the super heavy element Z = 117. (orig.)

Development of a 20kA current feedthrough using YBCO bulk conductors

International Nuclear Information System (INIS)

Maehata, Keisuke; Ishibashi, Kenji; Shintomi, Takakazu; Iwamoto, Akifumi; Maekawa, Ryuji; Mito, Toshiyuki

2004-01-01

In the phase II experiment of the Large Helical Device (LHD) of the National Institute for Fusion Science (NIFS), it is planned to operate the helical coils at 1.8 K by employing pressurized superfluid cooling to raise the magnetic field to 4 T with 17.3 kA. It is important to develop a 20kA-class current feedthrough into the 1.8 K region, but it must have a high current capacity and low heat leakage in the maximum magnetic leakage field of 1 T. Rectangle-shaped YBCO bulk conductors measuring 20 mm wide, 140 mm long and 10 mm thick were manufactured from square-pillar-shaped YBCO bulk materials for a 20 kA current. To check the quality of the bulk conductors, internal defects or cracks were detected by carrying out a precise survey of trapped magnetic flux. An assembled 20 kA current feedthrough was mounted in the λ-plate of a pressurized superfluid cooling cryostat. Experiments of current feeding into the 1.8 K region were carried out by operating the 20 kA current feedthrough. In the experiments, the transport current was kept at 20 kA for longer than 1,200 s. During the 20 kA operation, the current transport section of the YBCO bulk conductors remained in the superconducting state and the voltage drop between the YBCO bulk conductors and the copper electrode was observed to be constant. A contact resistance and the Joule heat generation in the joint region between the YBCO bulk conductors and the copper electrode were obtained as 1.45 nΩ and 0.72 W, respectively in the 20 kA operation. We have demonstrated the feasibility of using a 20 kA current feedthrough for the phase II experiment of the LHD. (author)

Development of new measurement and analytical method to trace 41K for long-term

International Nuclear Information System (INIS)

Yuita, Koichi; Miyagawa, Saburo

1999-01-01

To establish a control technique of fertilizer application for resource-saving and environmental conservation, non-radiative 41 K tracer method in the field has been developed. In this paper, potassium silicate fertilizer, one of slow-release fertilizer, was synthesized and marked by 41 K. Potassium silicate fertilizer with natural abundance of 41 K/ 39 K was prepared by mixing 76.2 g fly ash, 23.4 g potassium carbonate and 7.2 g magnesium hydroxide and colicinating the mixture for 47 min at 850degC. The product was satisfied the conditions of potasium silicate fertilizer. Then, the potassium silicate fertilizer marked with 41 K was synthesized by calicinating the mixture 1.85 KCl (6.77% 41 K and 93.23% 39 K) and 11.45 g 41 KCl under the above conditions. 41 K excess% of product fertilizer was about -2.00%, which is possible to trace 41 K of crop plant of soil culture pot test during the growing process. (S.Y.)

40 CFR 92.117 - Gas meter or flow instrumentation calibration, particulate measurement.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Gas meter or flow instrumentation... ENGINES Test Procedures § 92.117 Gas meter or flow instrumentation calibration, particulate measurement. (a) Sampling for particulate emissions requires the use of gas meters or flow instrumentation to...

The preparation and intramolecular radical cyclisation reactions of chiral oxyme ethers

International Nuclear Information System (INIS)

Booth, Susan E.; Jenkins, Paul R.

1998-01-01

Chiral oxime ether 2 and Oxime ester 4 have been prepared by alkylation and esterification of the oxime 1. Racemic hydroxylamine 6 and chiral hydroxylamine 10 have been synthesised from N-hydroxysuccinimide and the corresponding alcohol in the presence of diethyl azo dicarboxylate, the two product were converted into the oxime ethers 7 and 11 respectively. The intramolecular radical cyclisation reactions of these oxime ethers and esters has been studied, successful reaction was observed to produce alkyl hydroxylamines 3,8 and 12. (author)

Increased numbers of P63-positive/CD117-positive cells in advanced adenoid cystic carcinoma give a poorer prognosis

Directory of Open Access Journals (Sweden)

Zhou Quan

2012-09-01

Full Text Available Abstract Objectives This study consisted of two parts. One part was to analyze the survival rates of adenoid cystic carcinoma (ACC in Chinese and explain the difference between our data and the literature. The other was to analyze the relationship between the expression of CD117 and the histological grade and the prognosis. Methods A retrospective study of 80 ACC patients was performed. Clinical data were collected, and p63, CD117 were detected by immunohistochemical staining. Results Eighty patients received follow-ups 3 to 216 months after initial diagnosis. ACC occurred in the lacrimal gland (26.3%, n = 21, nasal cavity and parasinus (33.8%, n = 27 and other sites (40.0%, n = 33. The 5-year and 10-year survival rates were 66.41% and 10.16%, respectively. Over expression of CD117 was detected in p63-negative cells in 94.3% of cases and in p63-positive cells in 45.8%. The expression of CD117 in p63-positive cells was significantly associated with the histological grade (P Conclusions ACC had a good 5-year survival but poor 10-year survival in Chinese, which differed from the occidental data. More p63+/CD117+ cells were associated with a higher histological grade and poorer outcome. Virtual slides The virtual slide(s for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/1701457278762097

OleA Glu117 is key to condensation of two fatty-acyl coenzyme A substrates in long-chain olefin biosynthesis

Energy Technology Data Exchange (ETDEWEB)

Jensen, Matthew R.; Goblirsch, Brandon R.; Christenson, James K.; Esler, Morgan A.; Mohamed, Fatuma A.; Wackett, Lawrence P.; Wilmot, Carrie M. (UMM)

2017-10-12

In the interest of decreasing dependence on fossil fuels, microbial hydrocarbon biosynthesis pathways are being studied for renewable, tailored production of specialty chemicals and biofuels. One candidate is long-chain olefin biosynthesis, a widespread bacterial pathway that produces waxy hydrocarbons. Found in three- and four-gene clusters, oleABCD encodes the enzymes necessary to produce cis-olefins that differ by alkyl chain length, degree of unsaturation, and alkyl chain branching. The first enzyme in the pathway, OleA, catalyzes the Claisen condensation of two fatty acyl-coenzyme A (CoA) molecules to form a β-keto acid. In this report, the mechanistic role of Xanthomonas campestris OleA Glu117 is investigated through mutant enzymes. Crystal structures were determined for each mutant as well as their complex with the inhibitor cerulenin. Complemented by substrate modeling, these structures suggest that Glu117 aids in substrate positioning for productive carbon–carbon bond formation. Analysis of acyl-CoA substrate hydrolysis shows diminished activity in all mutants. When the active site lacks an acidic residue in the 117 position, OleA cannot form condensed product, demonstrating that Glu117 has a critical role upstream of the essential condensation reaction. Profiling of pH dependence shows that the apparent pKa for Glu117 is affected by mutagenesis. Taken together, we propose that Glu117 is the general base needed to prime condensation via deprotonation of the second, non-covalently bound substrate during turnover. This is the first example of a member of the thiolase superfamily of condensing enzymes to contain an active site base originating from the second monomer of the dimer.

The use of technetium-99m hexamethylpropylene amine oxime labelled granulocytes with single-photon emission tomography imaging in the detection and follow-up of recurrence of infective endocarditis complicating transvenous endocardial pacemaker

International Nuclear Information System (INIS)

Ramackers, J.M.; Kotzki, P.O.; Couret, I.; Messner-Pellenc, P.; Davy, J.M.; Rossi, M.

1995-01-01

In this case report we present a patient with a recurrence of subacute bacterial infectious endocarditis (IE) complicating a transvenous endocardial pacemaker. Technetium-99m hexamethylpropylene amine oxime ( 99m Tc-HMPAO) labelled granulocytes were used for diagnosis and follow-up under medical treatment only, since surgical removal of the pacemaker lead was ruled out because of the general condition of the patient. Single-photon emission tomography (SPET) imaging displayed the active lesion previously suspected on echography. At the end of antibiotic therapy, SPET indicated a favourable disease outcome whereas echocardiographic abnormalities remained nearly unchanged. The medical treatment had eradicated the IE, and the patient did well for more than 1 year thereafter. (orig.)

The use of technetium-99m hexamethylpropylene amine oxime labelled granulocytes with single-photon emission tomography imaging in the detection and follow-up of recurrence of infective endocarditis complicating transvenous endocardial pacemaker

Energy Technology Data Exchange (ETDEWEB)

Ramackers, J M [Department of Nuclear Medicine, CHU E. Herriot, Lyon (France); Kotzki, P O [Department of Nuclear Medicine, CHU Lapeyronie et A. de Villeneuve, Montpellier (France); Couret, I [Department of Nuclear Medicine, CHU Lapeyronie et A. de Villeneuve, Montpellier (France); Messner-Pellenc, P [Department of Cardiology, CHU Lapeyronie et A. Villeneuve, Montpellier (France); Davy, J M [Department of Cardiology, CHU Lapeyronie et A. Villeneuve, Montpellier (France); Rossi, M [Department of Nuclear Medicine, CHU Lapeyronie et A. de Villeneuve, Montpellier (France)

1995-11-01

In this case report we present a patient with a recurrence of subacute bacterial infectious endocarditis (IE) complicating a transvenous endocardial pacemaker. Technetium-99m hexamethylpropylene amine oxime ({sup 99m}Tc-HMPAO) labelled granulocytes were used for diagnosis and follow-up under medical treatment only, since surgical removal of the pacemaker lead was ruled out because of the general condition of the patient. Single-photon emission tomography (SPET) imaging displayed the active lesion previously suspected on echography. At the end of antibiotic therapy, SPET indicated a favourable disease outcome whereas echocardiographic abnormalities remained nearly unchanged. The medical treatment had eradicated the IE, and the patient did well for more than 1 year thereafter. (orig.)

Spectroscopic study of the Lambda hypernuclei by the (e,e'K⁺) reaction

Energy Technology Data Exchange (ETDEWEB)

Miyoshi, Toshinobu [Tohoku Univ., Sendai (Japan)

2002-01-01

Hypernuclear spectroscopy study via the (e,e'K⁺) reaction has been carried out for the first time, establishing a new technique to study Lambda hypernuclei. The high quality electron beam at Jefferson Lab made it possible to measure Lambda hypernuclear spectra with an energy resolution better than 1 MeV (FWHM). The present experiment was designed to make full use of the virtual photon flux, which peaks at very forward angles, by detecting scattered electrons at 0 degrees. Scattered positive kaons were also detected near 0 degrees, where the cross section of the kaon photo-production is maximized. This unique kinematical configuration was realized with the HyperNuclear Spectrometer System (HNSS), which consisted of the Short-Orbit Spectrometer, the Enge Split-Pole Spectrometer, and the splitter magnet. The $12\\atop{Λ}$B mass spectrum was measured in the ¹²C(e,e'K⁺)$12\\atop{Λ}$ reaction with 0.9 MeV (FWHM) energy resolution. The averaged binding energy of the $12\\atop{Λ}$B ground state doublet was obtained to be 11.7 ± 0.1 (statistical) ± 0.3 (systematic) MeV, which is consistent with emulsion data. The general spectral structure of the ¹²C(e,e'K⁺) $12\\atop{Λ}$B reaction was found to be similar to that of the ¹²C(Λ⁺,K⁺)$12\\atop{Λ}$C reaction, showing characteristic peaks corresponding to sLambda and pLambda orbits, as well as a few core-excited states. The cross section of the $12\\atop{Λ}$B ground state doublet was derived to be 117 ± 13 (statistical) ± 14 (systematic) nb/sr. The theoretical prediction of the cross section was consistent with the present result, validating DWIA calculation for hypernuclear yields. The present study proved the effectiveness of the (e,e'K⁺) reaction for future Lambda hypernuclear spectroscopy studies.

Opening of small and intermediate calcium-activated potassium channels induces relaxation mainly mediated by nitric-oxide release in large arteries and endothelium-derived hyperpolarizing factor in small arteries from rat

DEFF Research Database (Denmark)

Stankevicius, Edgaras; Dalsgaard, Thomas; Kroigaard, Christel

2011-01-01

This study was designed to investigate whether calcium-activated potassium channels of small (SK(Ca) or K(Ca)2) and intermediate (IK(Ca) or K(Ca)3.1) conductance activated by 6,7-dichloro-1H-indole-2,3-dione 3-oxime (NS309) are involved in both nitric oxide (NO) and endothelium-derived hyperpolar......This study was designed to investigate whether calcium-activated potassium channels of small (SK(Ca) or K(Ca)2) and intermediate (IK(Ca) or K(Ca)3.1) conductance activated by 6,7-dichloro-1H-indole-2,3-dione 3-oxime (NS309) are involved in both nitric oxide (NO) and endothelium...... in human umbilical vein endothelial cells (HUVECs), and calcium concentrations were investigated in both HUVECs and mesenteric arterial endothelial cells. In both superior (∼1093 μm) and small mesenteric (∼300 μm) arteries, NS309 evoked endothelium- and concentration-dependent relaxations. In superior....... In small mesenteric arteries, NS309 relaxations were reduced slightly by ADMA, whereas apamin plus an IK(Ca) channel blocker almost abolished relaxation. Iberiotoxin did not change NS309 relaxation. HUVECs expressed mRNA for SK(Ca) and IK(Ca) channels, and NS309 induced increases in calcium, outward...

Development of a measurement and control system for a 10 kW@20 K refrigerator based on Siemens PLC S7-300

Science.gov (United States)

Li, J.; Liu, L. Q.; Liu, T.; Xu, X. D.; Dong, B.; Lu, W. H.; Pan, W.; Wu, J. H.; Xiong, L. Y.

2017-02-01

A 10 kW@20 K refrigerator has been established by the Technical Institute of Physics and Chemistry, Chinese Academy of Sciences. A measurement and control system based on Siemens PLC S7-300 for this 10 kW@20 K refrigerator is developed. According to the detailed measurement requirements, proper sensors and transmitters are adopted. Siemens S7-300 PLC CPU315-2 PN/DP operates as a master station. Two sets of ET200M DP remote expand I/O, one power meter, two compressors and one vacuum gauge operate as slave stations. Profibus-DP field communication and Modbus communication are used between the master station and the slave stations in this control system. The upper computer HMI (Human Machine Interface) is compiled using Siemens configuration software WinCC V7.0. The upper computer communicates with PLC by means of industrial Ethernet. After commissioning, this refrigerator has been operating with a 10 kW of cooling power at 20 K for more than 72 hours.

Development of an Occupational Orientation Program for Grades K-6. Final Report.

Science.gov (United States)

Kesler, Ray M.; Brown, Sandra

This report presents the development, methodology, and findings of an Occupational Orientation Program for Grades K-6 in Monongalia County, West Virginia. The objectives of the program were to develop a curriculum for an elementary school that would give students the assistance needed to make realistic, attainable career choices, to assist…

46 CFR 117.206 - Survival craft-vessels operating on Great Lakes routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on Great Lakes routes... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.206 Survival craft... vessel certificated to operate on a Great Lakes route must be provided with the survival craft required...

A Dynamic Model of the Initial Spares Support List Development Process

Science.gov (United States)

1979-06-01

S117Z1NOTE NREI -NOT READI END ITERS IIT7INOTE GPEI -QUANTITY OF PARTS M. END ITER 11775NOTE FUSERF -PARTS USE RATE FACTOR U8WOTE OP U -OTHER PARTS USE...FAILURES ’I 1675R PtJER.L=(NREI.K) (QPEI) (PUSERF.K)+OPUR II7HNOTE PUSER -PARTS USE RATE II7t5NOTE NREI -NOT READY END ITEMS II756NOTE GPEI -QUANTITY

Survival and compound nucleus probability of super heavy element Z = 117

International Nuclear Information System (INIS)

Manjunatha, H.C.; Sridhar, K.N.

2017-01-01

As a part of a systematic study for predicting the most suitable projectile-target combinations for heavy-ion fusion experiments in the synthesis of "2"8"9"-"2"9"7Ts, we have calculated the transmission probability (T_l), compound nucleus formation probabilities (P_C_N) and survival probability (P_s_u_r) of possible projectile-target combinations. We have also studied the fusion cross section, survival cross section and fission cross sections for different projectile-target combination of "2"8"9"-"2"9"7Ts. These theoretical parameters are required before the synthesis of the super heavy element. The calculated probabilities and cross sections show that the production of isotopes of the super heavy element with Z = 117 is strongly dependent on the reaction systems. The most probable reactions to synthetize the super heavy nuclei "2"8"9"-"2"9"7Ts are worked out and listed explicitly. We have also studied the variation of P_C_N and P_s_u_r with the mass number of projectile and target nuclei. This work is useful in the synthesis of the super heavy element Z = 117. (orig.)

All projects related to | Page 117 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Properly managing and gaining maximum benefit from the extractive sectors in developing countries relies on skilled human resources. Topic: DEVELOPING COUNTRIES, URUGUAY, Poverty alleviation, ECONOMIC GROWTH, SUSTAINABLE DEVELOPMENT, CANADA. Region: Uruguay, Canada. Total Funding: CA$ ...

Flight physiology training experiences and perspectives: survey of 117 pilots.

Science.gov (United States)

Patrão, Luís; Zorro, Sara; Silva, Jorge; Castelo-Branco, Miguel; Ribeiro, João

2013-06-01

Human factors and awareness of flight physiology play a crucial role in flight safety. Even so, international legislation is vague relative to training requirements in hypoxia and altitude physiology. Based on a previously developed survey, an adapted questionnaire was formulated and released online for Portuguese pilots. Specific questions regarding the need for pilot attention monitoring systems were added to the original survey. There were 117 pilots, 2 of whom were women, who completed the survey. Most of the pilots had a light aviation license and flew in unpressurized cabins at a maximum ceiling of 10,000 ft (3048 m). The majority of the respondents never experienced hypoxic symptoms. In general, most of the individuals agreed with the importance of an introductory hypoxia course without altitude chamber training (ACT) for all pilot populations, and with a pilot monitoring system in order to increase flight safety. Generally, most of the pilots felt that hypoxia education and training for unpressurized aircraft is not extensive enough. However, almost all the respondents were willing to use a flight physiology monitoring system in order to improve flight safety.

Sub-minute method for simultaneous determination of aspartame, cyclamate, acesulfame-K and saccharin in food and pharmaceutical samples by capillary zone electrophoresis.

Science.gov (United States)

Vistuba, Jacqueline Pereira; Dolzan, Maressa Danielli; Vitali, Luciano; de Oliveira, Marcone Augusto Leal; Micke, Gustavo Amadeu

2015-05-29

This paper reports the development of a sub-minute separation method by capillary zone electrophoresis for the determination of aspartame, cyclamate, acesulfame-K and saccharin in food products and pharmaceutical samples. Separations were performed in a fused uncoated silica capillary with UV detection at 220nm. Samples and standards were injected hydrodynamically using the short-end injection procedure. The electrophoretic system was operated under constant voltage of -30kV. The background electrolyte was composed of 45mmolL(-1) 2-amino-2-(hydroxymethyl)-1,3-propanediol and 15mmolL(-1) benzoic acid at pH 8.4. The separation time for all analytes was less than 1min. Evaluation of analytical parameters of the method showed good linearity (r(2)>0.9972), limit of detection of 3.3-6.4mgL(-1), intermediate precision better than 9.75% (peak area of sample) and recovery in the range of 91-117%. Copyright © 2015 Elsevier B.V. All rights reserved.

Technetium-99m hexamethylpropylene amine oxime single photon emission tomography of the brain in early Parkinson's disease: correlation with dementia and lateralization

International Nuclear Information System (INIS)

Wang Shuujiun; Lin Kerneng; Shan Dinge; Liao Kwankum; Fuh Jongling; Lee Liangshong; Liu Renshyan; Liu Hsiuchih

1993-01-01

Regional cerebral blood flow was assessed in 19 patients with early idiopathic Parkinson's disease (PD) and 12 control subjects of similar age by single-photon emission tomography using technetium-99m hexamethylpropylene amine oxime (HMPAO). Of the patients with PD, seven were mildly demented and 15 presented with hemiparkinsonism. Mean HMPAO cortical or basal ganglia/cerebellum activity ratios were calculated. Mean cortical and regional uptake ratios in non-demented PD patients were not significantly different from values in the controls. In contrast, besides generalized cortical hypoperfusion, demented PD patients had significantly lower HMPAO uptake in the frontal and basal ganglia regions than non-demented patients. These observations support the hypothesis of impaired neuronal activity in both cortical and subcortical regions of the brain in demented PD patients. In hemiparkinsonian patients, the only asymmetrical finding was a relative hypoperfusion in the contralateral parietal region. This may be due to deafferentation of the thalamoparietal pathways. The lack of asymmetrical uptake in basal ganglia in our PD patients may be explained by their staging at the time of the investigation (stage I and II, Hoehn and Yahr scale). (orig.)

Technetium-99m hexamethylpropylene amine oxime single photon emission tomography of the brain in early Parkinson's disease: correlation with dementia and lateralization

Energy Technology Data Exchange (ETDEWEB)

Shuujiun, Wang; Kerneng, Lin; Dinge, Shan; Kwankum, Liao; Jongling, Fuh; Liangshong, Lee [National Yang-Ming Medical Coll., Taipei (Taiwan); Renshyan, Liu [Veterans General Hospital, Taipei (Taiwan). Dept. of Nuclear Medicine; Hsiuchih, Liu [Veterans General Hospital, Taipei (Taiwan). Neurological Inst.

1993-04-01

Regional cerebral blood flow was assessed in 19 patients with early idiopathic Parkinson's disease (PD) and 12 control subjects of similar age by single-photon emission tomography using technetium-99m hexamethylpropylene amine oxime (HMPAO). Of the patients with PD, seven were mildly demented and 15 presented with hemiparkinsonism. Mean HMPAO cortical or basal ganglia/cerebellum activity ratios were calculated. Mean cortical and regional uptake ratios in non-demented PD patients were not significantly different from values in the controls. In contrast, besides generalized cortical hypoperfusion, demented PD patients had significantly lower HMPAO uptake in the frontal and basal ganglia regions than non-demented patients. These observations support the hypothesis of impaired neuronal activity in both cortical and subcortical regions of the brain in demented PD patients. In hemiparkinsonian patients, the only asymmetrical finding was a relative hypoperfusion in the contralateral parietal region. This may be due to deafferentation of the thalamoparietal pathways. The lack of asymmetrical uptake in basal ganglia in our PD patients may be explained by their staging at the time of the investigation (stage I and II, Hoehn and Yahr scale). (orig.).

Development of a Wood Powder Fuelled 35 kW Stirling CHP Unit

DEFF Research Database (Denmark)

Pålsson, M.; Carlsen, Henrik

2003-01-01

For biomass fuelled CHP in sizes below 100 kW, Stirling engines are the only feasible alternative today. Using wood powder as fuel, the Stirling engine can be heated directly by the flame like when using a gaseous or liquid fuel burner. However, the combustion chamber will have to be much larger...... recirculation (CGR) a smaller air preheater can be used, while system efficiency will increase compared with using excess air for flame cooling. In a three-year project, a wood powder fuelled Stirling engine CHP unit will be developed and run in field test. The project will use the double-acting four......-cylinder Stirling engine SM3D with an electric output of 35 kW. This engine is a further development of the engine SM3B that has been developed at the Technical University of Denmark. The engine heater is being adapted for use with wood powder as fuel. During a two-year period a combustion system for this engine...

Effects of Cheap Antidotes; Sodium Bicarbonate and Magnesium Sulfate in Organophosphorous Poisoning

International Nuclear Information System (INIS)

Balali-Mood, M.; Afshari, R.

2007-01-01

Organophosphorous (OP) compounds have been used as pesticides and chemical warfare nerve agents. Despite administration of well known antidotes (atropine and oximes), morbidity and mortality of OP poisoning were still high. Besides, oximes are very expensive and not available in most developing countries. It was thus aimed to study the effects of cheap available antidotes; sodium bicarbonate and magnesium sulfate in OP poisoning. In addition to the standard antidotal treatment, out of 117 patients (63M, 47F) aged 25.2 ± 9.5 years with moderate to severe acute OP pesticide poisoning 59 were given sodium bicarbonate 5 mEq/kg in 60 min. followed by 5-6 mEq/kg/day to obtain arterial blood pH of 7.45 to 7.55. Arterial blood pH increased significantly (p less than 0.01) to 7.48 ± 0.05 compared to the controls (7.32 ± 0.06). Morbidity based on hospitalization days reduced significantly (p less than 0.05) from 5.62 ± 3.4 in the controls to 3.1 ± 2.6 days in the sodium bicarbonate group. Total atropine dose was also significantly (p less than 0.05) lower in the test group. Mortality was lower, but not significantly due to the low numbers (5 and 2 of the controls and test group, respectively). Sodium bicarbonate appeared to be effective and could be added to the treatment regime of OP poisoning. Magnesium sulfate was administered four gram intravenously only for the first 24 hr of hospitalization day for the patients with moderate to severe OP poisoning in a pilot study. The results were promising and thus further investigations are continued.(author)

’n Ondersoek na die teologiese boodskap en prediking van Psalm 117

Directory of Open Access Journals (Sweden)

S.D. Snyman

2011-06-01

Full Text Available An investigation into the theological message and preaching of Psalm 117 Psalm 117 is at the same a well-known and an unknown psalm. It is well-known as the shortest psalm in the Psalter, but there actually is remarkable little theological reflection on the psalm. To answer the question about the theological message of the psalm, it is subjected to an exegetical investigation giving attention to matters such as the extent of the psalm, text-critical questions, structural features, literary genre, “Sitz im Leben”, dating, the use of traditional material, et cetera. The exegetical details lead to a theological conclusion where it was found that the steadfast love and faithfulness of Yahweh experienced by his people in history serve as the reason why foreign nations are called upon to praise Him. The psalm probably originated in an exilic situation, reflects on the past and motivates people towards a future where Yahweh’s love and faithfulness will once again be experienced by his people.

Development of a linear compressor for compact 2 K Gifford- McMahon cryocoolers

International Nuclear Information System (INIS)

Hiratsuka, Y

2015-01-01

Recently, a new, compact Gifford-McMahon (GM) cryocooler for cooling superconducting single photon detectors (SSPD) has been developed at Sumitomo Heavy Industries, Ltd. (SHI) [1, 2]. The objective is to reduce the total height of the expander by 33% relative to the existing RDK-101 GM expander and to reduce the total volume of the compressor unit by 50% relative to the existing CNA-11 compressor. In addition, considering the targeted cooling application, we set the design temperature targets of the first and the second stages to 1 W and 20 mW of heat load at 60 K and 2.3 K, respectively. Although optimization of the internal components is one way to miniaturize the volume of the compressor unit, major design changes are required because the volume of the adsorber and the oil separator is almost the same as the volume of the compressor capsule. Thus, one approach is to develop a non-lubricated compressor, such as a valved linear compressor. An experimental unit of a valved linear compressor was designed and built, and preliminary experiments were conducted. Under no-load condition, a low temperature of 2.19 K has been achieved. With 1 W and 14 mW heat load, the temperature is 48 K at the first stage and 2.3 K at the second stage, with an input power of about 1.2 KW. The detailed experimental results will be discussed in this paper. (paper)

Development of a 10 kW PEM fuel cell for stationary applications

Energy Technology Data Exchange (ETDEWEB)

Barthels, H.; Mergel, J.; Oetjen, H.F. [Institute fuer Energieverfahrenstechnik (IEV), Juelich (Germany)] [and others

1996-12-31

A 10 kW Proton Exchange Membrane Fuel Cell (PEMFC) is being developed as part of a long-term energy storage path for electricity in the photovoltaic demonstration plant called PHOEBUS at the Forschungszentrum Julich.

Observation of high spin states in 117Xe

International Nuclear Information System (INIS)

Liu, Z.; Yuan, G.J.; Li, G.S.; Yang, C.X.; Luo, W.D.; Chen, Y.S.

1995-01-01

High spin states of 117 Xe have been investigated by means of in-beam γ-ray spectroscopy using the reaction 92 Mo( 28 Si, 2pn) at beam energies of 100 to 120 MeV. The previously known νh 11/2 bands are confirmed and the νg 7/2 favored-signature band is extended up to 47/2 + , in which two band crossings are observed at hω=0.33 and 0.44 MeV, respectively. Two new positive-parity bands have been established, one of which is most likely the νg 7/2 unfavored-signature band. A new transition cascade with irregular level spacings is also observed. (orig.)

Access to bifunctionalized biomolecular platforms using oxime ligation

Czech Academy of Sciences Publication Activity Database

Křenek, Karel; Gažák, Radek; Daskhan, G. Ch.; Garcia, J.; Fiore, M.; Dumy, P.; Šulc, Miroslav; Křen, Vladimír; Renaudet, O.

2014-01-01

Roč. 393, JUL 2014 (2014), s. 9-14 ISSN 0008-6215 R&D Projects: GA MŠk(CZ) LD13042 Institutional support: RVO:61388971 Keywords : Chemoselective ligation * Glycocluster * Cyclopeptide Subject RIV: CC - Organic Chemistry Impact factor: 1.929, year: 2014

Development and use of 60 kV, and 150 kV floating deck modulators for high voltage protection of multi-megawatt ion beam accelerators

International Nuclear Information System (INIS)

Barber, G.C.; Ponte, N.S.; Schilling, G.

1977-01-01

Extraction currents of 60 A at 40 kV have been produced by utilizing a 60 kV floating deck modulator interfaced to a high voltage power supply. The modulator is operated in a series mode to repetitively pulse power to the ion beam accelerator. Current monitoring and other protective circuits provide interrupt commands to the series switch tube when faults occur. The constant current characteristics of the water cooled tetrode and the rapid response of the protective circuits effectively limit the fault energy to the ion source. Three of the 60 kV decks have been modified and stacked in a series configuration to supply 150 kV, 50 A pulses. This system supplies power for development of higher-energy multi-grid sources. In this system attention has been focused on forced voltage sharing of the three decks and on protective circuits for fault conditions. All control signal processing and conditioning is performed at ground level. Fiber optic links are used to interface with the high potential associated with the floating decks. A shunt modulator incorporated with this system provides regulation of the voltage to the ion source gradient grid. Future modulator development includes a system to deliver 100 A at 80 kV

[Cytogenetic Abnormalities and Outcomes of 117 Patients with Multiple Myeloma Detected by FISH].

Science.gov (United States)

Zhai, Bing; Zou, Dan-Dan; Yan, Jian-Jun; Wang, Nan; Wang, Li-Li; Zhu, Hong-Li; Huang, Wen-Rong; Yu, Li

2016-02-01

To analyze the cytogenetic abnormalities and prognostic outcomes of patients with multiple myeloma (MM) detected by fluorescence in situ hybridization (FISH). The clinical record of 117 newly-diagnosed patients with MM treated in department of hematology and geriatric hematology of our hospital for 7 years were collected, and their molecular cytogenetic abnormalities detected by FISH and the clinical outcome were analyzed retrospectively. The detected rate of cytogenetic abnormality was 76.9%(90/117), the most common abnormality deteted by FISH was 1q21+ (71.1%), followed by 13q- (56.6%). The cross comparison method showed that 13q- and 17p13-, t(11;14) and t(4;14) were related respectively. All the patients with cytogenetic abnormalities showed no significant difference in the overall survival from cytogenetic normal patients. The positive rate of molecular cytogenetic abnormalities detected by FISH in MM patients is high, but data from larger and longer studies are needed to evaluate the prognostic outcomes.

Development of a perturbation code, PERT-K, for hexagonal core geometry

Energy Technology Data Exchange (ETDEWEB)

Kim, Taek Kyum; Kim, Sang Ji; Song, Hoon; Kim, Young Il; Kim, Young Jin [Korea Atomic Energy Research Institute, Taejon (Korea)

1999-01-01

A perturbation code for hexagonal core geometry has been developed based on Nodal Expansion Method. By using relevant output files of DIF3D code, it can calculate the reactivity changes caused by perturbation in composition or/and neutron cross section libraries. The accuracy of PERT-K code has been validated by calculating the reactivity changes due to fuel composition change, the sodium void coefficients, and the sample reactivity worths of BFS-73-1 critical experiments. In the case of 10% reduction in all fuel isotopics at a assembly located in the outer core, PERT-K computation agrees with the direct computation by DIF3D within 60 pcm. The sample reactivity worths of BFS-73-1 critical experiments are predicted with PERT-K code within the experimental error bounds. For 100% sodium void occurrence at the inner core, the maximum difference of reactivity changes between PERT-K and direct DIF3D computations is less than 40 pcm. On the other hand, the same sodium void condition at the outer core leads to a difference of reactivity change greater than 400 pcm. However, as sodium voiding becomes near zero value, the difference becomes less and rapidly falls within the acceptable bound, i.e. 40 pcm. (author). 11 refs., 9 figs., 6 tabs.

Developing DNA barcoding (matK) primers for marama bean ...

African Journals Online (AJOL)

The homology found with Tylosema fassoglensis (trnK gene) and Pisum sativum (matK gene) suggests that an identical region was amplified for Tylosema esculentum. A phylogenetic tree was constructed based on the matK sequences and the results suggest that the matK region can also be used in determining levels of ...

Synthesis of 14C-labeled 3-{[1-ethoxycarbonyl-3-phenyl-(1S)-propyl]amino}-2,3,4,5-tetrahydro-2-oxo -1H-1-(3S)-benzazepine-1-acetic acid hydrochloride ([14C]CGS 14824A)

International Nuclear Information System (INIS)

Chaudhuri, N.K.; Patera, R.; Markus, B.; Mingsang Sung

1987-01-01

The title compound, CGS 14824A, was synthesized with a 14 C-label in the azepine ring in 14 steps starting with 1-bromo-3-phenylpropane (1) and K 14 CN in an overall yield of 1.31%. The reaction of 1 with K 14 CN yielded the nitrile 2 which upon hydrolysis followed by ring closure gave α-tetralone-1- 14 C (4). Bromination of 4 followed by oxime formation gave the bromo oxime 5, which upon Beckmann rearrangement by acid treatment yielded the ring expansion product 6. The bromine atom of 6 was then replaced by an azido group, and an acetic ester side chain was introduced at the nitrogen atom. Catalytic reduction of the azido compound 8 gave a mixture of epimeric amino esters which was resolved by salt formation with L-tartaric acid. The negatively rotating isomer was then reacted with 4-phenyl-2-oxo-butanoate in presence of sodium cyanoborohydride to give a mixture of diastereoisomers which were separated as their benzyl esters by chromatography. The major isomer was then converted to labeled CGS 14824A. (author)

Enhanced radiative strength in the quasicontinuum of 117Sn.

Science.gov (United States)

Agvaanluvsan, U; Larsen, A C; Chankova, R; Guttormsen, M; Mitchell, G E; Schiller, A; Siem, S; Voinov, A

2009-04-24

The radiative strength function of 117Sn has been measured up to the neutron separation energy using the (3He, 3He' gamma) reaction. An increase in the slope of the strength function around E gamma=4.5 MeV indicates the onset of a resonancelike structure, giving a significant enhancement of the radiative strength function compared to standard models in the energy region 4.5

Development of radiographic technique for examining k-type butt weld

International Nuclear Information System (INIS)

Barui, K.L.; Bhattacharyya, B.

1983-01-01

An attempt is made to develop a radiographic technique for examining K-type full penetration butt joints in heavy duty crane girders. The existing standard techniques of radiographic examination is found to be unsuitable to assess the internal defects properly. The examination technique reported here is successful in detecting not only the nature of the internal defects but also their degree of severities - from which clues for avoiding the most probable defects can be found out. The results of radiographic examination applied on the K-type butt joints of heavy duty crane girders have been discussed and it is specified that the acceptable limit of the defects must lie between 'blue' and 'green' according to the IIW colour code. Much work is yet to be done before standard specifications regarding the acceptibility of the defects in the actual job can be formulated. (author)

Mutated PET117 causes complex IV deficiency and is associated with neurodevelopmental regression and medulla oblongata lesions.

Science.gov (United States)

Renkema, G H; Visser, G; Baertling, F; Wintjes, L T; Wolters, V M; van Montfrans, J; de Kort, G A P; Nikkels, P G J; van Hasselt, P M; van der Crabben, S N; Rodenburg, R J T

2017-06-01

The genetic basis of the many progressive, multi systemic, mitochondrial diseases that cause a lack of cellular ATP production is heterogeneous, with defects found both in the mitochondrial genome as well as in the nuclear genome. Many different mutations have been found in the genes encoding subunits of the enzyme complexes of the oxidative phosphorylation system. In addition, mutations in genes encoding proteins involved in the assembly of these complexes are known to cause mitochondrial disorders. Here we describe two sisters with a mitochondrial disease characterized by lesions in the medulla oblongata, as demonstrated by brain magnetic resonance imaging, and an isolated complex IV deficiency and reduced levels of individual complex IV subunits. Whole exome sequencing revealed a homozygous nonsense mutation resulting in a premature stop codon in the gene encoding Pet117, a small protein that has previously been predicted to be a complex IV assembly factor. PET117 has not been identified as a mitochondrial disease gene before. Lentiviral complementation of patient fibroblasts with wild-type PET117 restored the complex IV deficiency, proving that the gene defect is responsible for the complex IV deficiency in the patients, and indicating a pivotal role of this protein in the proper functioning of complex IV. Although previous studies had suggested a possible role of this protein in the insertion of copper into complex IV, studies in patient fibroblasts could not confirm this. This case presentation thus implicates mutations in PET117 as a novel cause of mitochondrial disease.

Working women worldwide. Age effects in female labor force participation in 117 countries

NARCIS (Netherlands)

Besamusca, J.; Tijdens, K.; Keune, M.; Steinmetz, S.

2015-01-01

In this article, we investigate the effects of economic conditions, families, education, and gender ideologies on the labor force participation rates of women in eleven age groups in 117 countries. We find that participation rates of young and older women are partly explained by sector sizes and the

Lin- CD34hi CD117int/hi FcεRI+ cells in human blood constitute a rare population of mast cell progenitors.

Science.gov (United States)

Dahlin, Joakim S; Malinovschi, Andrei; Öhrvik, Helena; Sandelin, Martin; Janson, Christer; Alving, Kjell; Hallgren, Jenny

2016-01-28

Mast cells are rare tissue-resident immune cells that are involved in allergic reactions, and their numbers are increased in the lungs of asthmatics. Murine lung mast cells arise from committed bone marrow-derived progenitors that enter the blood circulation, migrate through the pulmonary endothelium, and mature in the tissue. In humans, mast cells can be cultured from multipotent CD34(+) progenitor cells. However, a population of distinct precursor cells that give rise to mast cells has remained undiscovered. To our knowledge, this is the first report of human lineage-negative (Lin(-)) CD34(hi) CD117(int/hi) FcεRI(+) progenitor cells, which represented only 0.0053% of the isolated blood cells in healthy individuals. These cells expressed integrin β7 and developed a mast cell-like phenotype, although with a slow cell division capacity in vitro. Isolated Lin(-) CD34(hi) CD117(int/hi) FcεRI(+) blood cells had an immature mast cell-like appearance and expressed high levels of many mast cell-related genes as compared with human blood basophils in whole-transcriptome microarray analyses. Furthermore, serglycin, tryptase, and carboxypeptidase A messenger RNA transcripts were detected by quantitative reverse transcription-polymerase chain reaction. Altogether, we propose that the Lin(-) CD34(hi) CD117(int/hi) FcεRI(+) blood cells are closely related to human tissue mast cells and likely constitute an immediate precursor population, which can give rise to predominantly mast cells. Furthermore, asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) FcεRI(+) blood mast cell progenitors than asthmatics with normal lung function. © 2016 by The American Society of Hematology.

Development of an Innovative 2.5 kW Water-Silica Gel Adsorption Chiller

Energy Technology Data Exchange (ETDEWEB)

Bakker, E.J.; De Boer, R.; Smeding, S.F.; Sijpheer, N.C.; Van der Pal, M.

2013-10-15

Besides (better) utilization of available solar heat or waste heat, and thereby reduction of fossil fuel consumption, sorption cooling offers several other advantages compared to conventional compression cooling. Such as reduction of summer peaks in the electricity grid, use of natural refrigerants, and low noise and maintenance. Sorption cooling in itself is not a new development. However, the development of small scale sorption chillers (2-20 kW) is new. This development allows sorption cooling to enter the markets for individual homes, small collective systems and small commercial applications. A second trend is gradual reduction of the driving temperatures of the sorption cycles allowing more solar and waste heat to be used. This article describes the design and performance of a new, innovative 2.5 kW adsorption chiller, developed by ECN. This system was built and tests have been performed in a laboratory and in one of ECN's full-scale research houses.

K-Ras(V14I) -induced Noonan syndrome predisposes to tumour development in mice.

Science.gov (United States)

Hernández-Porras, Isabel; Schuhmacher, Alberto J; Garcia-Medina, Raquel; Jiménez, Beatriz; Cañamero, Marta; de Martino, Alba; Guerra, Carmen

2016-06-01

The Noonan syndrome (NS) is an autosomal dominant genetic disorder characterized by short stature, craniofacial dysmorphism, and congenital heart defects. A significant proportion of NS patients may also develop myeloproliferative disorders (MPDs), including juvenile myelomonocytic leukaemia (JMML). Surprisingly, scarce information is available in relation to other tumour types in these patients. We have previously developed and characterized a knock-in mouse model that carries one of the most frequent KRAS-NS-related mutations, the K-Ras(V14I) substitution, which recapitulates most of the alterations described in NS patients, including MPDs. The K-Ras(V14I) mutation is a mild activating K-Ras protein; thus, we have used this model to study tumour susceptibility in comparison with mice expressing the classical K-Ras(G12V) oncogene. Interestingly, our studies have shown that these mice display a generalized tumour predisposition and not just MPDs. In fact, we have observed that the K-Ras(V14I) mutation is capable of cooperating with the p16Ink4a/p19Arf and Trp53 tumour suppressors, as well as with other risk factors such as pancreatitis, thereby leading to a higher cancer incidence. In conclusion, our results illustrate that the K-Ras(V14I) activating protein is able to induce cancer, although at a much lower level than the classical K-Ras(G12V) oncogene, and that it can be significantly modulated by both genetic and non-genetic events. Copyright © 2016 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd. Copyright © 2016 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd.

Development status of the integrated tokamak simulator for K-DEMO

Energy Technology Data Exchange (ETDEWEB)

Kang, J. S.; Wang, J.; Hwang, Y. S. [Seoul National University, Seoul (Korea, Republic of); Jung, L. [National Fusion Research Institute, Daejeon (Korea, Republic of)

2016-10-15

Korean fusion demonstration reactor (K-DEMO) study has been conducted to investigate the feasibility of an electricity generation, self-sustained tritium cycle, and component test facility. To estimate its capability, the integrated fusion operation simulator called INFRA has been developed by organizing relevant computational codes with standard data models and framework. The different modules of the integrated simulator are chosen among well-validated codes. Standard data models are directly linked with KSTAR experimental data so that the integrated simulator can be used for interpretative simulations but also for predictive simulations. In this study, the current status of code development and some examples of KSTAR interpretative simulations are reported. ITER integrated modelling and analysis suite is imported to K-DEMO data model to take over ITER experience and to accelerate collaboration with international IMAS community. Standardized rules and guideline have been developed by ITER team for many years. Based on strict policy, this data model has been established and updated. This data model is used for experimental and simulation results. The INFRA system has been utilized to be an alpha version of a KDEMO simulator. Database, framework, and module integration are conducted. A test equilibrium run for KSTAR is done by filling the database with experiment results. More modules will be incorporated in a near future. Validation with KSTAR data and benchmarking previous modelling activity is also planned in order to confirm the feasibility of this system.

Experimental and statistical requirements for developing a well-defined K/sub IR/ curve. Final report

International Nuclear Information System (INIS)

Server, W.L.; Oldfield, W.; Wullaert, R.A.

1977-05-01

Further development of a statistically well-defined reference fracture toughness curve to verify and compliment the K/sub IR/ curve presently specified in Appendix G, Section III of the ASME Code was accomplished by performing critical experiments in small specimen fracture mechanics and improving techniques for statistical analysis of the data. Except for cleavage-initiated fracture, crack initiation was observed to occur prior to maximum load for all of the materials investigated. Initiation fracture toughness values (K/sub Jc/) based on R-curve heat-tinting studies were up to 50 percent less than the previously reported equivalent energy values (K*/sub d/). At upper shelf temperatures, the initiation fracture toughness (K/sub Jc/) generally increased with stress intensification rate. Both K/sub Jc/--Charpy V-notch and K/sub Ic/--specimen strength ratio correlations are promising methods for predicting thick-section behavior from small specimens. The previously developed tanh curve fitting procedure was improved to permit estimates of the variances and covariances of the regression coefficients to be computed. The distribution of the fracture toughness data was determined as a function of temperature. Instrumented precracked Charpy results were used to normalize the larger specimen fracture toughness data. The transformed large specimen fracture toughness data are used to generate statistically based lower-bound fracture toughness curves for either static or dynamic test results. A comparison of these lower bound curves with the K/sub IR/ curve shows that the K/sub IR/ curve is more conservative over most of its range. 143 figures, 26 tables

Development of a 0.1 kW thermoelectric power generator for military applications

International Nuclear Information System (INIS)

Menchen, W.R.

1986-01-01

A man-portable thermoelectric power source is being developed for the U.S. Army. Initially used as a dedicated power supply for the XM-21 Chemical Agent Alarm System, the set can also meet a variety of general purpose user requirements. Development of a thermoelectric power conversion device is being undertaken by the U.S. Army LABCOM Electronics Technology and Devices Laboratory to fill a need for a generator that is silent, lightweight, multi-fueled and reliable. The 0.1 kW Power Generator is rectangular in configuration and consists of a power module, electronic control assembly and fuel delivery system housed within a tubular structural frame. The generator operates on military fuels ranging from kerosene to diesel oil. Multi-fuel capability is achieved using an ultrasonic atomizer and regenerative burner developed specifically for this application. This paper provides the first public presentation of results achieved during the Advanced Development Phase of the 0.1 kW Power Generator. The development process is briefly traced with emphasis on a description of the system and test results obtained to date

41 CFR 301-10.117 - May I keep compensation an airline gives me for voluntarily vacating my seat on my scheduled...

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false May I keep compensation an airline gives me for voluntarily vacating my seat on my scheduled airline flight when the airline asks for volunteers? 301-10.117 Section 301-10.117 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY)...

Immunohistochemistry of a choroidal melanoma: nestin, CD34 and CD117÷c-kit labeling.

Science.gov (United States)

Vrapciu, Alexandra Diana; Rusu, Mugurel Constantin; Voinea, Liliana Mary

2014-01-01

In a case of choroidal melanoma (CM) in a 70-year-old male patient, was firstly aimed at studying the processes of angiogenesis by use of nestin and CD34 antibodies. Anti-CD117÷c-kit antibodies were further considered for their progenitor cells specificity. Choroidal melanoma was histopathologically confirmed. Nestin-positive endothelia were found in the CM and the adjacent retina, but not in endothelia elsewhere in that eye. Nestin-positive non-pigmentary cells were found within the CM. Filopodia-projecting endothelial tip cells (ETCs), nestin- and CD34-positive were found in the CM. CD34-positive ETCs were also found in the iridial stroma. There were found two different immune patterns of the retinal Müller cells (MCs). They were nestin-positive in the retina adjacent to the tumor, but negative in any other part of retina. On the other hand, CD117÷c-kit antibodies labeled MCs as follows: (a) discontinuously, or continuously, in the retina adjacent to the CM; (b) only the inner segments of the MCs were labeled in the retina unrelated to the CM. While nestin could be a reliable marker for retinal damage, the CD117÷c-kit phenotype of MCs still needs further investigations. Antiangiogenic therapy appears as a good choice for tumor therapy.

25 CFR 117.26 - Expenses incurred pending qualification of an executor or administrator.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Expenses incurred pending qualification of an executor or... HAVE CERTIFICATES OF COMPETENCY § 117.26 Expenses incurred pending qualification of an executor or administrator. Pending the qualification of the executor or administrator of the estate of a deceased Indian of...

Development of 6.6 kV/600 A superconducting fault current limiter using coated conductors

Energy Technology Data Exchange (ETDEWEB)

Yazawa, T., E-mail: takashi.yazawa@toshiba.co.j [Toshiba Corporation, Power Systems Company (Japan); Koyanagi, K.; Takahashi, M.; Toba, K.; Takigami, H.; Urata, M. [Toshiba Corporation, Power Systems Company (Japan); Iijima, Y.; Saitoh, T. [Fujikura Ltd. (Japan); Amemiya, N. [Superconductivity Research Laboratory, ISTEC (Japan); Shiohara, Y. [Department of Electrical Engineering, Kyoto University (Japan); Ito, T. [Tokyo Gas Co., Ltd. (Japan)

2009-10-15

As one of the programs in the Ministry of Economy, Trade and Industry (METI) project regarding R and D on superconducting coated conductor, three-phase superconducting fault current limiter (SFCL) for 6.6 kV application was developed and successfully tested. The developed SFCL was mainly comprised three-phase set of current limiting coils installed in a sub-cooled nitrogen cryostat with a GM cryocooler, circuit breakers and a sequence circuit. The whole system was installed in a cubicle. Two tapes of coated conductor were wound in parallel in each coil to obtain the rated current of 72 A rms. After developing the whole SFCL system, short circuit experiments were implemented with a short circuit generator. In a three-line ground fault test, the SFCL successfully restricted the prospected short circuit current over 1.6 kA to about 800 A by the applied voltage of 6.6 kV. The SFCL was installed in a user field and connected with a gas engine generator, followed by a consecutive operation. In this program, 600 A class FCL coil, with which four coated conductor tapes were wound, was also developed. The coil showed sufficiently low AC loss at the rated current. With these results, the program attained the planned target of the fundamentals for the 6.6 kV/600 A SFCL.

California-Oregon 500-kV transmission line development of design criteria

International Nuclear Information System (INIS)

Simpson, K.D.

1990-01-01

The California-Oregon Transmission Project (COTP) encompassed the design and construction of a third 500-kV ac intertie between California and the Pacific Northwest Transmission system. Sargent ampersand Lundy's (S ampersand L) scope of work in the COTP includes the design of approximately 150 miles of new single-circuit, 500-kV transmission line from southern Oregon to the vicinity of Redding, California. This paper presents the development of the design criteria for this segment of the project, which crosses diverse topographic and climatic regions. This project is an example of the increasing utilization of computers in transmission line engineering. Almost all aspects of design involved the use of the computer. Also, the development of the design criteria for this project coincided with an early release of the TLWorkstation software package by EPRI. TLWorkstation is an engineering workstation containing a family of programs for various aspects of transmission line design. This engineering software allows for increasing refinement in the design and economic optimization of transmission lines and is becoming an important design tool for transmission engineers

Development of measurement and analysis method for long-term monitoring of {sup 41}-K

Energy Technology Data Exchange (ETDEWEB)

Yuita, Koichi; Miyagawa, Saburo [National Inst. of Agro-Environmental Sciences, Tsukuba, Ibaraki (Japan)

2000-02-01

This study aimed to develop a double labeling method with {sup 41}K and {sup 15}N for animal feed and excreta. Guinea pig was used as the subjects for the preliminary experiment. Animal feces and urine were separately collected once a day and the feces were dried at 70degC and urine was lyophilized. Those samples were submitted to analysis after mixing. Then, {sup 41}KCl solution and {sup 15}NH{sub 4}SO{sub 4} solution were absorbed to the conventional guinea pig feed and 1.0 g of the feed was given once a day. The amount of {sup 41}K in feces was determined using flame photometric detector and {sup 15}N was determined by ANCA-SL Mass spectrometer. The isotope abundances of {sup 41}K and {sup 15}N in the feed were 6.11% and 0.829%, respectively and the excess % was -0.062 % and 0.46 % for {sup 41}K and {sup 15}N, respectively. The present results showed that 15-N labeling for feces was fairly succeeded, but {sup 41}K labeling was insufficient. Therefore, it is thought necessary to use K tracer of a larger excess % (-0.3% or more) and raise the accuracy of analysis for total K and {sup 41}K. (M.N.)

Role of the Na+/K+-ATPase ion pump in male reproduction and embryo development.

Science.gov (United States)

Câmara, D R; Kastelic, J P; Thundathil, J C

2017-08-01

Na + /K + -ATPase was one of the first ion pumps studied because of its importance in maintaining osmotic and ionic balances between intracellular and extracellular environments, through the exchange of three Na + ions out and two K + ions into a cell. This enzyme, which comprises two main subunits (α and β), with or without an auxiliary polypeptide (γ), can have specific biochemical properties depending on the expression of associated isoforms (α1β1 and/or α2β1) in the cell. In addition to the importance of Na + /K + -ATPase in ensuring the function of many tissues (e.g. brain, heart and kidney), in the reproductive tract this protein is essential for embryo development because of its roles in blastocoel formation and embryo hatching. In the context of male reproduction, the discovery of a very specific subunit (α4), apparently restricted to male germ cells, only expressed after puberty and able to influence sperm function (e.g. motility and capacitation), opened a remarkable field for further investigations regarding sperm biology. Therefore, the present review focuses on the importance of Na + /K + -ATPase on male reproduction and embryo development.

India | Page 117 | IDRC - International Development Research Centre

International Development Research Centre (IDRC) Digital Library (Canada)

Profile of IDRC's Social and Economic Policy (SEP) program area. The current era of economic globalization has brought high expectations — but also some profound disappointments — to people in the developing world. Read more about New policy challenges on a changing economic landscape. Language English.

Development program for a 200 kW, CW, 28 GHz gyroklystron. Final report, April 1976-September 1980

International Nuclear Information System (INIS)

Shively, J.; Conner, C.; Evans, S.

1980-01-01

The objective of this program was to develop a microwave amplifier or oscillator capable of producing 200 kW, CW power output at 28 GHz. The use of the gyrotron or cyclotron resonance interaction was pursued. A room temperature hollow core solenoid magnet with an iron case was designed to produce the magnetic field required for electron cyclotron resonance. Three pulsed gyroklystron amplifiers were built providing increasing stable output powers of 6, 65 and 76 kW. A back-up pulsed gyrotron oscillator produced 248 kW. A ceramic cone broadband water load was developed. Tests are described for the various tubes that were developed

States in 118Sn from 117Sn(d,p) 118Sn at 12 MeV

International Nuclear Information System (INIS)

Frota-Pessoa, E.

1983-01-01

118 Sn energy levels up to = 5.2 MeV excitation energy are studied in the reaction 117 Sn (d,p) 118 Sn. Deuterons had a bombarding energy of 12 MeV. The protons were analized by a magnetic spectrograph. The detector was nuclear emulsion and the resolution in energy about 10 KeV. The distorted-wave analysis was used to determine l values and spectroscopic strengths. Centers of gravity and the sums of reduced spectroscopic factors are presented for the levels when it was possible to determine the S' value. 66 levels of excitation energy were found which did not appear in previous 117 Sn (d,p) reactions. 40 levels were not found previously in any reaction giving 118 Sn. The results are compared with the known ones. (Author) [pt

Vitamin K2 biosynthetic enzyme, UBIAD1 is essential for embryonic development of mice.

Science.gov (United States)

Nakagawa, Kimie; Sawada, Natsumi; Hirota, Yoshihisa; Uchino, Yuri; Suhara, Yoshitomo; Hasegawa, Tomoka; Amizuka, Norio; Okamoto, Tadashi; Tsugawa, Naoko; Kamao, Maya; Funahashi, Nobuaki; Okano, Toshio

2014-01-01

UbiA prenyltransferase domain containing 1 (UBIAD1) is a novel vitamin K2 biosynthetic enzyme screened and identified from the human genome database. UBIAD1 has recently been shown to catalyse the biosynthesis of Coenzyme Q10 (CoQ10) in zebrafish and human cells. To investigate the function of UBIAD1 in vivo, we attempted to generate mice lacking Ubiad1, a homolog of human UBIAD1, by gene targeting. Ubiad1-deficient (Ubiad1(-/-)) mouse embryos failed to survive beyond embryonic day 7.5, exhibiting small-sized body and gastrulation arrest. Ubiad1(-/-) embryonic stem (ES) cells failed to synthesize vitamin K2 but were able to synthesize CoQ9, similar to wild-type ES cells. Ubiad1(+/-) mice developed normally, exhibiting normal growth and fertility. Vitamin K2 tissue levels and synthesis activity were approximately half of those in the wild-type, whereas CoQ9 tissue levels and synthesis activity were similar to those in the wild-type. Similarly, UBIAD1 expression and vitamin K2 synthesis activity of mouse embryonic fibroblasts prepared from Ubiad1(+/-) E15.5 embryos were approximately half of those in the wild-type, whereas CoQ9 levels and synthesis activity were similar to those in the wild-type. Ubiad1(-/-) mouse embryos failed to be rescued, but their embryonic lifespans were extended to term by oral administration of MK-4 or CoQ10 to pregnant Ubiad1(+/-) mice. These results suggest that UBIAD1 is responsible for vitamin K2 synthesis but may not be responsible for CoQ9 synthesis in mice. We propose that UBIAD1 plays a pivotal role in embryonic development by synthesizing vitamin K2, but may have additional functions beyond the biosynthesis of vitamin K2.

Nuclear spectroscopic study of the 117In and 77Se using angular correlation technique

International Nuclear Information System (INIS)

Zamboni, C.B.

1981-01-01

The integral pertubed angular correlation technique has been used to measure the g-factor of the 587 KeV(3/2 - ) state in 117 In. The measurements were made in an external magnetic field of 26 Kg. The 1303-273 KeV gamma cascade in 117 In populated from the beta decay of 117 Cd was utilized for the measurement. The result is g(587 KeV) = -0.233+-0.057. The present result shows the 587 KeV state may not be a simple P 3/2 proton hole state but rather a complex admixture of different configurations. The g-factor of the 249 KeV state in 77 Se has also been measured by the time differential pertubed angular correlation (TDPAC) method in an external magnetic field of 25 Kg. The 755-249 KeV gamma cascade in 77 Se populated from the electron capture decay of 57h 77 Br utilized for the measurement. The g-factor is determined to be g(249 KeV) = 0.486 +- 0.009. In addition the half life of the 249 KeV state in 77 Se has also been measured by the delayed gamma-gamma coincidence method utilizing the gamma cascades 572-249 KeV and 750-249 KeV in 77 Se. The resulting value of the half life is T 1/2 (249 KeV) = (9.56 +- 0.10)ns. The experimental results are discussed in terms of nuclear models applicable for nuclei in this mass region. (author) [pt

In-vivo behavior of tin-117m(2+ and 4+)-labeled DTPA and MDP. Preparation, tissue distribution in mice, and imaging in dogs

International Nuclear Information System (INIS)

Srivastava, S.C.; Richards, P.; Meinken, G.E.; Som, P.; Knapp, F.F. Jr.; Butler, T.A.

1982-01-01

Tissue distribution in mice of stannous chloride (pH 2), and of stannous as well as stannic chelates of MDP and DTPA is described. The bone-to-tissue ratios of these compounds are evaluated. High bone uptake of all these compounds point out the high affinity of tin for bone despite the chemically diverse ligands. Whole body autoradiographs of mice injected with tin-117m(IV)-DTPA demonstrate the almost exclusive localization of tin-117m activity in bone. Clarity of bone images in a dog, obtained up to 15 days following the injection of tin-117m(IV)-DTPA is demonstrated

Parallel k-means++

Energy Technology Data Exchange (ETDEWEB)

2017-04-04

A parallelization of the k-means++ seed selection algorithm on three distinct hardware platforms: GPU, multicore CPU, and multithreaded architecture. K-means++ was developed by David Arthur and Sergei Vassilvitskii in 2007 as an extension of the k-means data clustering technique. These algorithms allow people to cluster multidimensional data, by attempting to minimize the mean distance of data points within a cluster. K-means++ improved upon traditional k-means by using a more intelligent approach to selecting the initial seeds for the clustering process. While k-means++ has become a popular alternative to traditional k-means clustering, little work has been done to parallelize this technique. We have developed original C++ code for parallelizing the algorithm on three unique hardware architectures: GPU using NVidia's CUDA/Thrust framework, multicore CPU using OpenMP, and the Cray XMT multithreaded architecture. By parallelizing the process for these platforms, we are able to perform k-means++ clustering much more quickly than it could be done before.

Inherited prion disease A117V is not simply a proteinopathy but produces prions transmissible to transgenic mice expressing homologous prion protein.

Science.gov (United States)

Asante, Emmanuel A; Linehan, Jacqueline M; Smidak, Michelle; Tomlinson, Andrew; Grimshaw, Andrew; Jeelani, Asif; Jakubcova, Tatiana; Hamdan, Shyma; Powell, Caroline; Brandner, Sebastian; Wadsworth, Jonathan D F; Collinge, John

2013-01-01

Prions are infectious agents causing fatal neurodegenerative diseases of humans and animals. In humans, these have sporadic, acquired and inherited aetiologies. The inherited prion diseases are caused by one of over 30 coding mutations in the human prion protein (PrP) gene (PRNP) and many of these generate infectious prions as evidenced by their experimental transmissibility by inoculation to laboratory animals. However, some, and in particular an extensively studied type of Gerstmann-Sträussler-Scheinker syndrome (GSS) caused by a PRNP A117V mutation, are thought not to generate infectious prions and instead constitute prion proteinopathies with a quite distinct pathogenetic mechanism. Multiple attempts to transmit A117V GSS have been unsuccessful and typical protease-resistant PrP (PrP(Sc)), pathognomonic of prion disease, is not detected in brain. Pathogenesis is instead attributed to production of an aberrant topological form of PrP, C-terminal transmembrane PrP ((Ctm)PrP). Barriers to transmission of prion strains from one species to another appear to relate to structural compatibility of PrP in host and inoculum and we have therefore produced transgenic mice expressing human 117V PrP. We found that brain tissue from GSS A117V patients did transmit disease to these mice and both the neuropathological features of prion disease and presence of PrP(Sc) was demonstrated in the brains of recipient transgenic mice. This PrP(Sc) rapidly degraded during laboratory analysis, suggesting that the difficulty in its detection in patients with GSS A117V could relate to post-mortem proteolysis. We conclude that GSS A117V is indeed a prion disease although the relative contributions of (Ctm)PrP and prion propagation in neurodegeneration and their pathogenetic interaction remains to be established.

Inherited prion disease A117V is not simply a proteinopathy but produces prions transmissible to transgenic mice expressing homologous prion protein.

Directory of Open Access Journals (Sweden)

Emmanuel A Asante

Full Text Available Prions are infectious agents causing fatal neurodegenerative diseases of humans and animals. In humans, these have sporadic, acquired and inherited aetiologies. The inherited prion diseases are caused by one of over 30 coding mutations in the human prion protein (PrP gene (PRNP and many of these generate infectious prions as evidenced by their experimental transmissibility by inoculation to laboratory animals. However, some, and in particular an extensively studied type of Gerstmann-Sträussler-Scheinker syndrome (GSS caused by a PRNP A117V mutation, are thought not to generate infectious prions and instead constitute prion proteinopathies with a quite distinct pathogenetic mechanism. Multiple attempts to transmit A117V GSS have been unsuccessful and typical protease-resistant PrP (PrP(Sc, pathognomonic of prion disease, is not detected in brain. Pathogenesis is instead attributed to production of an aberrant topological form of PrP, C-terminal transmembrane PrP ((CtmPrP. Barriers to transmission of prion strains from one species to another appear to relate to structural compatibility of PrP in host and inoculum and we have therefore produced transgenic mice expressing human 117V PrP. We found that brain tissue from GSS A117V patients did transmit disease to these mice and both the neuropathological features of prion disease and presence of PrP(Sc was demonstrated in the brains of recipient transgenic mice. This PrP(Sc rapidly degraded during laboratory analysis, suggesting that the difficulty in its detection in patients with GSS A117V could relate to post-mortem proteolysis. We conclude that GSS A117V is indeed a prion disease although the relative contributions of (CtmPrP and prion propagation in neurodegeneration and their pathogenetic interaction remains to be established.

Overview of Air Liquide refrigeration systems between 1.8 K and 200 K

Science.gov (United States)

Gondrand, C.; Durand, F.; Delcayre, F.; Crispel, S.; Baguer, G. M. Gistau

2014-01-01

Cryogenic refrigeration systems are necessary for numerous applications. Gas purification and distillation require temperatures between 15 K and 200 K depending on the application, space simulation chambers down to 15 K, superconductivity between 1.8 K and up to 75 K (magnets, cavities or HTS devices like cables, FCL, SMES, etc), Cold Neutron Sources between 15 and 20 K, etc. Air Liquide Advanced Technologies is designing and manufacturing refrigerators since 60 years to satisfy those needs. The step by step developments achieved have led to machines with higher efficiency and reliability. In 1965, reciprocating compressors and Joule Thomson expansion valves were used. In 1969, centripetal expanders began to be used. In 1980, oil lubricated screw compressors took the place of reciprocating compressors and a standard range of Claude cycle refrigerators was developed: the HELIAL series. 1980 was also the time for cryogenic centrifugal compressor development. In 2011, driven by the need for lower operational cost (high efficiency and low maintenance), cycle oil free centrifugal compressors on magnetic bearings were introduced instead of screw compressors. The power extracted by centripetal expanders was recovered. Based on this technology, a range of Turbo-Brayton refrigerators has been designed for temperatures between 40 K and 150 K. On-going development will enable widening the range of Turbo-Brayton refrigerators to cryogenic temperatures down to 15 K.. Cryogenic centrifugal circulators have been developed in order to answer to an increasing demand of 4 K refrigerators able to distribute cold power.

Overview of Air Liquide refrigeration systems between 1.8 K and 200 K

International Nuclear Information System (INIS)

Gondrand, C.; Durand, F.; Delcayre, F.; Crispel, S.; Baguer, G. M. Gistau

2014-01-01

Cryogenic refrigeration systems are necessary for numerous applications. Gas purification and distillation require temperatures between 15 K and 200 K depending on the application, space simulation chambers down to 15 K, superconductivity between 1.8 K and up to 75 K (magnets, cavities or HTS devices like cables, FCL, SMES, etc), Cold Neutron Sources between 15 and 20 K, etc. Air Liquide Advanced Technologies is designing and manufacturing refrigerators since 60 years to satisfy those needs. The step by step developments achieved have led to machines with higher efficiency and reliability. In 1965, reciprocating compressors and Joule Thomson expansion valves were used. In 1969, centripetal expanders began to be used. In 1980, oil lubricated screw compressors took the place of reciprocating compressors and a standard range of Claude cycle refrigerators was developed: the HELIAL series. 1980 was also the time for cryogenic centrifugal compressor development. In 2011, driven by the need for lower operational cost (high efficiency and low maintenance), cycle oil free centrifugal compressors on magnetic bearings were introduced instead of screw compressors. The power extracted by centripetal expanders was recovered. Based on this technology, a range of Turbo-Brayton refrigerators has been designed for temperatures between 40 K and 150 K. On-going development will enable widening the range of Turbo-Brayton refrigerators to cryogenic temperatures down to 15 K.. Cryogenic centrifugal circulators have been developed in order to answer to an increasing demand of 4 K refrigerators able to distribute cold power

Overview of Air Liquide refrigeration systems between 1.8 K and 200 K

Energy Technology Data Exchange (ETDEWEB)

Gondrand, C.; Durand, F.; Delcayre, F.; Crispel, S. [AL-AT, 2 rue de Clémencières, 38360 Sassenage (France); Baguer, G. M. Gistau [CRYOGUY, 44, chemin de la Buisse, 38330 Biviers (France)

2014-01-29

Cryogenic refrigeration systems are necessary for numerous applications. Gas purification and distillation require temperatures between 15 K and 200 K depending on the application, space simulation chambers down to 15 K, superconductivity between 1.8 K and up to 75 K (magnets, cavities or HTS devices like cables, FCL, SMES, etc), Cold Neutron Sources between 15 and 20 K, etc. Air Liquide Advanced Technologies is designing and manufacturing refrigerators since 60 years to satisfy those needs. The step by step developments achieved have led to machines with higher efficiency and reliability. In 1965, reciprocating compressors and Joule Thomson expansion valves were used. In 1969, centripetal expanders began to be used. In 1980, oil lubricated screw compressors took the place of reciprocating compressors and a standard range of Claude cycle refrigerators was developed: the HELIAL series. 1980 was also the time for cryogenic centrifugal compressor development. In 2011, driven by the need for lower operational cost (high efficiency and low maintenance), cycle oil free centrifugal compressors on magnetic bearings were introduced instead of screw compressors. The power extracted by centripetal expanders was recovered. Based on this technology, a range of Turbo-Brayton refrigerators has been designed for temperatures between 40 K and 150 K. On-going development will enable widening the range of Turbo-Brayton refrigerators to cryogenic temperatures down to 15 K.. Cryogenic centrifugal circulators have been developed in order to answer to an increasing demand of 4 K refrigerators able to distribute cold power.

117th Annual Meeting, Medical Library Association, Inc., Seattle, WA, May 26–31, 2017

Directory of Open Access Journals (Sweden)

Nicole Mitchell

2018-01-01

Full Text Available The Medical Library Association (MLA held its 117th annual meeting in Seattle, Washington, May 26–31, 2017, at the Washington State Convention Center. The meeting theme was “Dream, Dare, Do.”

A case of Z/E-isomers elution order inversion caused by cosolvent percentage change in supercritical fluid chromatography.

Science.gov (United States)

Pokrovskiy, Oleg I; Ustinovich, Konstantin B; Usovich, Oleg I; Parenago, Olga O; Lunin, Valeriy V; Ovchinnikov, Denis V; Kosyakov, Dmitry S

2017-01-06

A case of elution order inversion caused by cosolvent percentage change in supercritical fluid chromatography was observed and investigated in some detail. Z- and E-isomers of phenylisobutylketone oxime experience an elution order reversal on most columns if the mobile phase consists of CO 2 and alcohol. At lower percentages of alcohol Z-oxime is retained less, somewhere at 2-5% coelution occurs and at larger cosolvent volume elution order reverses - Z-oxime is eluted later than E-oxime. We suppose inversion with CO 2 -ROH phases happens due to a shift in balance between two main interactions governing retention. At low ROH percentages stationary phase surface is only slightly covered by ROH molecules so oximes primarily interact with adsorption sites via hydrogen bond formation. Due to intramolecular sterical hindrance Z-oxime is less able to form hydrogen bonds and consequently is eluted first. At higher percentages alcohols occupy most of strong hydrogen bonding sites on silica surface thus leaving non-specific electrostatic interactions predominantly responsible for Z/E selectivity. Z-oxime has a much larger dipole moment than E-oxime and at these conditions it is eluted later. Additional experimental data with CO 2 -CH 3 CN, hexane-iPrOH and CHF 3 -ROH mobile phases supporting this explanation are presented. Copyright © 2016 Elsevier B.V. All rights reserved.

Expression and prognostic value of putative cancer stem cell markers CD117 and CD15 in choroidal and ciliary body melanoma.

Science.gov (United States)

Lukenda, Adrian; Dotlic, Snjezana; Vukojevic, Nenad; Saric, Borna; Vranic, Semir; Zarkovic, Kamelija

2016-03-01

The aim of the present study was to immunohistochemically investigate the expression and prognostic significance of putative cancer stem cell markers CD117 (c-kit), CD34, CD20 and CD15 in a cohort of patients with primary choroidal and ciliary body melanoma. The immunohistochemical expression of these markers was evaluated using 3,3'-diaminobenzidine tetrahydrochloride (DAB) and 3-amino-9-ethylcarbazole (AEC) chromogens on paraffin-embedded tissue samples from 40 patients who underwent enucleation in the period from 1985 through 2000. Thirty-one patients had adequate tissue specimens for the analysis. CD117 overexpression was observed in 12 of the 31 samples (39%) when AEC chromogen was used and in 14 of 26 (54%) samples when DAB was used. CD15 positivity was seen in three out of 30 (10%) samples with AEC and in six out of 26 (23%) samples with DAB. CD20 and CD34 exhibited no positivity in the tested samples. During the average follow-up time of 8.7 years (range 0.5-22 years), 17 patients (55%) died due to metastatic disease. The Kaplan-Meier plots showed a significantly shorter overall and disease-free survival in CD117-positive patients when the AEC chromogen was used. CD15 expression was not associated with patients' survival. In multivariate analysis, patients expressing the CD117 AEC had 4.13 times higher risk of lethal outcome in comparison with CD117 AEC negative patients. Our retrospective cohort study has for the first time demonstrated a small proportion of CD15-positive uveal melanomas. CD117 AEC overexpression was associated with a worse outcome in patients with choroidal and ciliary body melanoma. Further studies should confirm the validity of these observations and their potential for targeted treatment modalities. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

Development of an Attitude Scale to Assess K-12 Teachers' Attitudes toward Nanotechnology

Science.gov (United States)

Lan, Yu-Ling

2012-05-01

To maximize the contributions of nanotechnology to this society, at least 60 countries have put efforts into this field. In Taiwan, a government-funded K-12 Nanotechnology Programme was established to train K-12 teachers with adequate nanotechnology literacy to foster the next generation of Taiwanese people with sufficient knowledge in nanotechnology. In the present study, the Nanotechnology Attitude Scale for K-12 teachers (NAS-T) was developed to assess K-12 teachers' attitudes toward nanotechnology. The NAS-T included 23 Likert-scale items that can be grouped into three components: importance of nanotechnology, affective tendencies in science teaching, and behavioural tendencies to teach nanotechnology. A sample of 233 K-12 teachers who have participated in the K-12 Nanotechnology Programme was included in the present study to investigate the psychometric properties of the NAS-T. The exploratory factor analysis of this teacher sample suggested that the NAS-T was a three-factor model that explained 64.11% of the total variances. This model was also confirmed by the confirmatory factor analysis to validate the factor structure of the NAS-T. The Cronbach's alpha values of three NAS-T subscales ranged from 0.89 to 0.95. Moderate to strong correlations among teachers' NAS-T domain scores, self-perception of own nanoscience knowledge, and their science-teaching efficacy demonstrated good convergent validity of the NAS-T. As a whole, psychometric properties of the NAS-T indicated that this instrument is an effective instrument for assessing K-12 teachers' attitudes toward nanotechnology. The NAS-T will serve as a valuable tool to evaluate teachers' attitude changes after participating in the K-12 Nanotechnology Programme.

Yield of 117Sb, 118mSb, 120mSb, 122Sb, 124Sb in reactions Sn (p, xn)

International Nuclear Information System (INIS)

Dmitriev, P.P.; Konstantinov, I.O.

1993-01-01

Yield of 117 Sb, 118m Sb, 120m Sb, 122 Sb, 124 Sb from thick target depending on proton energy is measured. The maximum proton energy is 21.7±0.2 MeV. Antimony isotopes yield in separate reactions when irradiating of tin isotopes with 100% enrichment is determined using the method published earlier. The methods for production of 117 Sb, 118m Sb, 120m Sb, 122 Sb, 124 Sb with high radioisotope purity are shown. 13 refs., 1 fig., 3 tabs

Development and performance test results of 50 kA vapor-cooled current lead for ITER

International Nuclear Information System (INIS)

Sugimoto, Makoto; Isono, Takaaki; Hamada, Kazuya

1998-01-01

JAERI has developed 50 kA current leads for the International Thermonuclear Experimental Reactor (ITER). The Center Solenoid (CS) Model Coil program is under way by means of international collaboration in ITER-EDA. The CS model coil is being developed for ITER CS coil and is for demonstration for ITER construction. The performance test of the CS model coil will be carried out at the JAERI ITER common test facility (CTF). The current lead consists of the vertical lead and the connection lead. The vertical lead is a vapor-cooled type and has a cable-in-conduit geometry. The vertical lead was designed with a heat leak of 1.2 W/kA at a helium flow rate of 0.06 g/(s·kA). The measured heat leak satisfied the designed value. The connection lead was made from copper pipe soldered with NbTi superconducting wires. The pipe was stabilized by the superconducting wires and a cooling channel. The current lead was operated up to 60 kA. The design and the performance test results of 50 kA current leads are reported. The results meet the specifications for the CS model coil test and for the ITER real machine. (author)

Work in the U.K. on filamentary A15 conductor development

International Nuclear Information System (INIS)

Lee, J.A.; Scott, C.A.

1980-07-01

Work on Nb 3 Sn conductor development work began at Harwell in 1967 with work on stable filamentary Nb 3 Sn composites starting in 1969. This lead to a series of small magnets built at the Rutherford laboratory, using conductors incorporating high purity copper regions protected by diffusion barriers of both tantalum and phosphorus poisoned niobium, and the Wind-react technique for magnet construction was established. A magnet development programme lead to the construction of a 450mmx50mm hexapole magnet. IMI's parallel conductor programme developed tantalum diffusion barriers and used a hot extrusion first stage. The present position on conductor development is the result of a unification in 1979 of technical and commercial interests including university programmes. This current position is reported. (U.K.)

HER-2/neu and CD117 (c-kit overexpression in patients with pesticide exposure and extensive stage small cell lung carcinoma (ESSCLC

Directory of Open Access Journals (Sweden)

Potti Anil

2005-06-01

Full Text Available Abstract Background The rate of detection of HER-2/neu and CD117 (c-kit overexpression in small cell lung cancer (SCLC has varied widely; between 5–35% and 21–70% respectively. Methods To evaluate the relationship between pesticide exposure and HER-2/neu and CD117 overexpression in extensive stage SCLC (ESSCLC, we identified patients with ESSCLC and assessed pesticide exposure using a predetermined questionnaire. An exposure index (hours/day × days/year × years ≥ 2400 hours was considered as 'exposed.' HER-2/neu overexpression was evaluated on archival tissue using the DAKO Hercep test, and CD117 testing was performed using immunohistochemistry (A4052 polyclonal antibody. Results 193 ESSCLC patients were identified. Pesticide exposure data could be obtained on 174 patients (84 females and 109 males with a mean age of 68.5 years. 53/174 (30.4% revealed HER-2/neu overexpression. 54/174 (31.03% specimens showed CD117 overexpression by IHC. On multivariate analysis, HER-2/neu overexpression was associated with diminished survival (p neu overexpression and 47/121 (38.8% patients without overexpression had exposure to pesticides (odds ratio: 5.38; p Conclusion Pesticide exposure affects HER-2/neu but not CD117 overexpression. Future studies are needed to determine specific pesticide(s/pesticide components that are responsible for HER-2/neu overexpression in ESSCLC, and to validate our findings in other solid tumors that overexpress HER-2/neu.

Cyanide binding to hexacoordinate cyanobacterial hemoglobins: hydrogen-bonding network and heme pocket rearrangement in ferric H117A Synechocystis hemoglobin.

Science.gov (United States)

Vu, B Christie; Nothnagel, Henry J; Vuletich, David A; Falzone, Christopher J; Lecomte, Juliette T J

2004-10-05

The truncated hemoglobin (Hb) from the cyanobacterium Synechocystis sp. PCC 6803 is a bis-histidyl hexacoordinate complex in the absence of exogenous ligands. This protein can form a covalent cross-link between His117 in the H-helix and the heme 2-vinyl group. Cross-linking, the physiological importance of which has not been established, is avoided with the His117Ala substitution. In the present work, H117A Hb was used to explore exogenous ligand binding to the heme group. NMR and thermal denaturation data showed that the replacement was of little consequence to the structural and thermodynamic properties of ferric Synechocystis Hb. It did, however, decelerate the association of cyanide ions with the heme iron. Full complexation required hours, instead of minutes, of incubation at optical and NMR concentrations. At neutral pH and in the presence of excess cyanide, binding occurred with a first-order dependence on cyanide concentration, eliminating distal histidine decoordination as the rate-limiting step. The cyanide complex of the H117A variant was characterized for the conformational changes occurring as the histidine on the distal side, His46 (E10), was displaced. Extensive rearrangement allowed Tyr22 (B10) to insert in the heme pocket and Gln43 (E7) and Gln47 (E11) to come in contact with it. H-bond formation to the bound cyanide was identified in solution with the use of (1)H(2)O/(2)H(2)O mixtures. Cyanide binding also resulted in a change in the ratio of heme orientational isomers, in a likely manifestation of heme environment reshaping. Similar observations were made with the related Synechococcus sp. PCC 7002 H117A Hb, except that cyanide binding was rapid in this protein. In both cases, the (15)N chemical shift of bound cyanide was reminiscent of that in peroxidases and the orientation of the proximal histidine was as in other truncated Hbs. The ensemble of the data provided insight into the structural cooperativity of the heme pocket scaffold and pointed

46 CFR 117.207 - Survival craft-vessels operating on lakes, bays, and sounds routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on lakes, bays, and... 49 PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.207 Survival craft—vessels operating on lakes, bays, and sounds routes. (a) Each vessel with overnight...

Technetium-99m hexamethylpropylene amine oxime single photon emission tomography of the brain in early Parkinson's disease: correlation with dementia and lateralization

Energy Technology Data Exchange (ETDEWEB)

Wang Shuujiun; Lin Kerneng; Shan Dinge; Liao Kwankum; Fuh Jongling; Lee Liangshong (National Yang-Ming Medical Coll., Taipei (Taiwan)); Liu Renshyan (Veterans General Hospital, Taipei (Taiwan). Dept. of Nuclear Medicine); Liu Hsiuchih (Veterans General Hospital, Taipei (Taiwan). Neurological Inst.)

1993-04-01

Regional cerebral blood flow was assessed in 19 patients with early idiopathic Parkinson's disease (PD) and 12 control subjects of similar age by single-photon emission tomography using technetium-99m hexamethylpropylene amine oxime (HMPAO). Of the patients with PD, seven were mildly demented and 15 presented with hemiparkinsonism. Mean HMPAO cortical or basal ganglia/cerebellum activity ratios were calculated. Mean cortical and regional uptake ratios in non-demented PD patients were not significantly different from values in the controls. In contrast, besides generalized cortical hypoperfusion, demented PD patients had significantly lower HMPAO uptake in the frontal and basal ganglia regions than non-demented patients. These observations support the hypothesis of impaired neuronal activity in both cortical and subcortical regions of the brain in demented PD patients. In hemiparkinsonian patients, the only asymmetrical finding was a relative hypoperfusion in the contralateral parietal region. This may be due to deafferentation of the thalamoparietal pathways. The lack of asymmetrical uptake in basal ganglia in our PD patients may be explained by their staging at the time of the investigation (stage I and II, Hoehn and Yahr scale). (orig.).

Preparation of Nafion 117™-SnO₂ Composite Membranes using an Ion-Exchange Method

DEFF Research Database (Denmark)

Nørgaard, Casper Frydendal; Nielsen, Ulla Gro; Skou, Eivind Morten

2012-01-01

Nafion 117™-SnO2 composite membranes were prepared by in-situ particle formation using an ion-exchange method. SnO2 was incorporated into Nafion 117ä membranes by ion-exchange in solutions of SnCl2 ∙2 H2O in methanol, followed by oxidation to SnO2 in air. By adjustment of the concentration of SnCl2...... ∙ 2 H2O used in the ion-exchange step, compositions ranging from 2 to 8 wt% SnO2 with SnO2 homogeneously distributed as nanoparticles were obtained. The prepared nanocomposite membranes were characterized by powder XRD, 119Sn MAS NMR spectroscopy, electrochemical impedance spectroscopy, water uptake...

Vitamin K

Science.gov (United States)

Vitamins are substances that your body needs to grow and develop normally. Vitamin K helps your body by making proteins for ... blood clotting. If you don't have enough vitamin K, you may bleed too much. Newborns have ...

K C Mittal

Indian Academy of Sciences (India)

K C Mittal. Articles written in Sadhana. Volume 30 Issue 6 December 2005 pp 757-764. Development of a 300-kV Marx generator and its application to drive a relativistic electron beam · Y Choyal Lalit Gupta Preeti Vyas Prasad Deshpande Anamika Chaturvedi K C Mittal K P Maheshwari · More Details Abstract Fulltext PDF.

A rat model of nerve agent exposure applicable to the pediatric population: The anticonvulsant efficacies of atropine and GluK1 antagonists

Energy Technology Data Exchange (ETDEWEB)

Miller, Steven L., E-mail: stevenmiller17@gmail.com [Department of Anatomy, Physiology, and Genetics, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Program in Neuroscience, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Aroniadou-Anderjaska, Vassiliki, E-mail: vanderjaska@usuhs.edu [Department of Anatomy, Physiology, and Genetics, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Department of Psychiatry, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Program in Neuroscience, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Figueiredo, Taiza H., E-mail: taiza.figueiredo.ctr@usuhs.edu [Department of Anatomy, Physiology, and Genetics, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Prager, Eric M., E-mail: eric.prager683@gmail.com [Department of Anatomy, Physiology, and Genetics, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Program in Neuroscience, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Almeida-Suhett, Camila P., E-mail: camilapalmeida@gmail.com [Department of Anatomy, Physiology, and Genetics, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Program in Neuroscience, Uniformed Services University of the Health Sciences, 4301 Jones Bridge Road, Bethesda, MD 20814 (United States); Apland, James P., E-mail: james.p.apland.civ@mail.mil [Neurotoxicology Branch, U.S. Army Medical Research Institute of Chemical Defense, Aberdeen Proving Ground, MD 21010 (United States); and others

2015-04-15

Inhibition of acetylcholinesterase (AChE) after nerve agent exposure induces status epilepticus (SE), which causes brain damage or death. The development of countermeasures appropriate for the pediatric population requires testing of anticonvulsant treatments in immature animals. In the present study, exposure of 21-day-old (P21) rats to different doses of soman, followed by probit analysis, produced an LD{sub 50} of 62 μg/kg. The onset of behaviorally-observed SE was accompanied by a dramatic decrease in brain AChE activity; rats who did not develop SE had significantly less reduction of AChE activity in the basolateral amygdala than rats who developed SE. Atropine sulfate (ATS) at 2 mg/kg, administered 20 min after soman exposure (1.2 × LD{sub 50}), terminated seizures. ATS at 0.5 mg/kg, given along with an oxime within 1 min after exposure, allowed testing of anticonvulsants at delayed time-points. The AMPA/GluK1 receptor antagonist LY293558, or the specific GluK1 antagonist UBP302, administered 1 h post-exposure, terminated SE. There were no degenerating neurons in soman-exposed P21 rats, but both the amygdala and the hippocampus were smaller than in control rats at 30 and 90 days post-exposure; this pathology was not present in rats treated with LY293558. Behavioral deficits present at 30 days post-exposure, were also prevented by LY293558 treatment. Thus, in immature animals, a single injection of atropine is sufficient to halt nerve agent-induced seizures, if administered timely. Testing anticonvulsants at delayed time-points requires early administration of ATS at a low dose, sufficient to counteract only peripheral toxicity. LY293558 administered 1 h post-exposure, prevents brain pathology and behavioral deficits. - Highlights: • The LD{sub 50} of soman was determined in postnatal-day-21 rats. • Rats with no seizures after 1.2XLD{sub 50} soman had less reduction of AChE in the amygdala. • Atropine sulfate (ATS) at 2 mg/kg, given at 20 min after

A rat model of nerve agent exposure applicable to the pediatric population: The anticonvulsant efficacies of atropine and GluK1 antagonists

International Nuclear Information System (INIS)

Miller, Steven L.; Aroniadou-Anderjaska, Vassiliki; Figueiredo, Taiza H.; Prager, Eric M.; Almeida-Suhett, Camila P.; Apland, James P.

2015-01-01

Inhibition of acetylcholinesterase (AChE) after nerve agent exposure induces status epilepticus (SE), which causes brain damage or death. The development of countermeasures appropriate for the pediatric population requires testing of anticonvulsant treatments in immature animals. In the present study, exposure of 21-day-old (P21) rats to different doses of soman, followed by probit analysis, produced an LD 50 of 62 μg/kg. The onset of behaviorally-observed SE was accompanied by a dramatic decrease in brain AChE activity; rats who did not develop SE had significantly less reduction of AChE activity in the basolateral amygdala than rats who developed SE. Atropine sulfate (ATS) at 2 mg/kg, administered 20 min after soman exposure (1.2 × LD 50 ), terminated seizures. ATS at 0.5 mg/kg, given along with an oxime within 1 min after exposure, allowed testing of anticonvulsants at delayed time-points. The AMPA/GluK1 receptor antagonist LY293558, or the specific GluK1 antagonist UBP302, administered 1 h post-exposure, terminated SE. There were no degenerating neurons in soman-exposed P21 rats, but both the amygdala and the hippocampus were smaller than in control rats at 30 and 90 days post-exposure; this pathology was not present in rats treated with LY293558. Behavioral deficits present at 30 days post-exposure, were also prevented by LY293558 treatment. Thus, in immature animals, a single injection of atropine is sufficient to halt nerve agent-induced seizures, if administered timely. Testing anticonvulsants at delayed time-points requires early administration of ATS at a low dose, sufficient to counteract only peripheral toxicity. LY293558 administered 1 h post-exposure, prevents brain pathology and behavioral deficits. - Highlights: • The LD 50 of soman was determined in postnatal-day-21 rats. • Rats with no seizures after 1.2XLD 50 soman had less reduction of AChE in the amygdala. • Atropine sulfate (ATS) at 2 mg/kg, given at 20 min after soman, blocked

Development and Evaluation of a Barley 50k iSelect SNP Array

Directory of Open Access Journals (Sweden)

Micha M. Bayer

2017-10-01

Full Text Available High-throughput genotyping arrays continue to be an attractive, cost-effective alternative to sequencing based approaches. We have developed a new 50k Illumina Infinium iSelect genotyping array for barley, a cereal crop species of major international importance. The majority of SNPs on the array have been extracted from variants called in exome capture data of a wide range of European barley germplasm. We used the recently published barley pseudomolecule assembly to map the exome capture data, which allowed us to generate markers with accurate physical positions and detailed gene annotation. Markers from an existing and widely used barley 9k Infinium iSelect array were carried over onto the 50k chip for backward compatibility. The array design featured 49,267 SNP markers that converted into 44,040 working assays, of which 43,461 were scorable in GenomeStudio. Of the working assays, 6,251 are from the 9k iSelect platform. We validated the SNPs by comparing the genotype calls from the new array to legacy datasets. Rates of agreement averaged 98.1 and 93.9% respectively for the legacy 9k iSelect SNP set (Comadran et al., 2012 and the exome capture SNPs. To test the utility of the 50k chip for genetic mapping, we genotyped a segregating population derived from a Golden Promise × Morex cross (Liu et al., 2014 and mapped over 14,000 SNPs to genetic positions which showed a near exact correspondence to their known physical positions. Manual adjustment of the cluster files used by the interpreting software for genotype scoring improved results substantially, but migration of cluster files between sites led to a deterioration of results, suggesting that local adjustment of cluster files is required on a site-per-site basis. Information relating to the markers on the chip is available online at https://ics.hutton.ac.uk/50k.

Ferromagnetic Coupling between Copper(II) Centers through the Diamagnetic Zinc(II) Ion: Crystal Structure and Magnetic Properties of [Cu(2)Zn(Hdmg)(2)(dmg)(2)(H(2)O)].0.5H(2)dmg.H(2)O (H(2)dmg = Dimethylglyoxime).

Science.gov (United States)

Ruiz, Rafael; Julve, Miguel; Faus, Juan; Lloret, Francesc; Muñoz, M. Carmen; Journaux, Yves; Bois, Claudette

1997-07-30

A new heterotrinuclear complex of formula [Cu(2)Zn(Hdmg)(2)(dmg)(2)(H(2)O)].0.5H(2)dmg.H(2)O (C(18)H(34)Cu(2)N(9)O(11)Zn, 1) (H(2)dmg = dimethylglyoxime) has been synthesized and its crystal structure determined by single-crystal X-ray diffraction. It crystallizes in the triclinic system, space group P&onemacr;, with a = 11.414(1) Å, b = 11.992(3) Å, c =12.567(10) Å, alpha = 91.27(6) degrees, beta = 111.46(2) degrees, gamma = 112.24(2) degrees, and Z = 2. The structure consists of a chain of neutral [Cu(2)Zn(Hdmg)(2)(dmg)(2)(H(2)O)] trinuclear units and noncoordinated H(2)dmg and water molecules. The configuration around the zinc atom is distorted trigonal bipyramidal with four oximate oxygens from two [Cu(Hdmg)(dmg)](-) fragments (each one acting as a bidentate ligand through its deprotonated oximate oxygens in cis positions) occupying one axial and the three equatorial positions and an additional oximate oxygen from a symmetry-related [Cu(Hdmg)(dmg)](-) fragment filling the remaining axial position. The environment around Cu(1) and Cu(2) is distorted square pyramidal with four oximate nitrogen atoms building the equatorial plane. An oxygen atom [O(9)] from a water molecule and an oximate oxygen from a symmetry-related [Cu(Hdmg)(dmg)](-) fragment occupy the apical position of the square pyramids around Cu(1) and Cu(2), respectively. The trinuclear units are repeated through inversion centers standing at the middle of the Zn(1).Zn(1)(i) and Cu(2).Cu(2)(ii) vectors leading to a chain which runs parallel to the diagonal of the ac-plane. The Cu(1).Cu(2), Zn(1).Zn(1)(i), and Cu(2).Cu(2)(ii) separations are 5.506(2), 3.390(2), and 3.930(2) Å, respectively. 1 exhibits a characteristic ferromagnetic behavior with a continuous increase of the chi(M)T product as the temperature is lowered from 300 to 2.0 K. The field dependence of the magnetization at 2.0 K is consistent with a low-lying quintet state. The only efficient exchange pathways responsible for the overall

Anesthesia and Duchenne or Becker muscular dystrophy: review of 117 anesthetic exposures.

Science.gov (United States)

Segura, Leal G; Lorenz, Jessica D; Weingarten, Toby N; Scavonetto, Federica; Bojanić, Katarina; Selcen, Duygu; Sprung, Juraj

2013-09-01

Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) are associated with life-threatening perioperative complications, including rhabdomyolysis, hyperkalemia, and hyperthermia. Current recommendations contraindicate use of succinylcholine and volatile anesthetics; however, the latter recommendation remains controversial. To review the perioperative outcomes of patients with DMD and BMD. We reviewed records of patients with DMD or BMD who underwent anesthetic management at our institution from January 1990 through December 2011. We identified 47 patients (DMD, 37; BMD, 10) who underwent 117 anesthetic exposures (DMD, 101; BMD, 16). Volatile anesthetic agents were used 66 times (DMD, 59; BMD, 7). One patient with undiagnosed BMD received succinylcholine and developed acute rhabdomyolysis and hyperkalemic cardiac arrest. All other major complications were attributed to the procedure (i.e., large bleeding), to preexisting comorbidities (i.e., respiratory failure, cardiac disease), or to both. Use of succinylcholine in children with dystrophinopathy is contraindicated. These patients have significant comorbidities and are frequently undergoing extensive operations; complications related to these factors can develop, as evidenced by our series. These complications may occur with use of volatile and nonvolatile anesthetics. However, because most of our patients were older than 8 years at the time of surgery, our observation cannot be generalized to younger dystrophin-deficient children. © 2013 John Wiley & Sons Ltd.

Tin-117m(4+)-DTPA for palliation of pain from osseous metastases: A pilot study

International Nuclear Information System (INIS)

Atkins, H.L.; Mausner, L.F.; Srivastava, S.C.

1995-01-01

The physical and biological attributes of 117m Sn(4+)-DTPA indicate that it should be an effective agent for palliative therapy of painful bony metastatic disease. The aim of this study was to evaluate whether or not this agent could effectively reduce pain while sparing the hemopoietic marrow from adverse effects. Fifteen patients (10 males and 5 females) with painful bony metastases from various primary cancers were included in the study. Seven patients received 1.22 to 3.11 MBq/kg of 117m Sn intravenously (Group 1) and eight patients received 4.85 to 5.77 MBq/kg (Group 2). All but one were treated as outpatients and followed for a minimum of 2 mo. In the first group, pain relief was nonassessable in four patients because of death or additional treatment of soft-tissue disease by another modality. One patient had no relief of pain, one had complete relief of pain and one had transient relief of pain. No myelotoxicity was observed. For Group 2, three patients achieved complete relief of pain, two good relief, two partial relief and one began to experience pain relief when he suffered a pathological fracture 2 mo most-treatment. None of these patients had myelotoxicity. Tin-117m(4+)-DTPA can reduce pain from metastatic disease to bone without inducing adverse reactions related to bone marrow. Further studies are needed to assess tolerance levels for the bone marrow and to evaluate response rates and duration of effect. 6 refs., 4 figs., 4 tabs

Characterization of the cardiac Na+/K+ pump by development of a comprehensive and mechanistic model.

Science.gov (United States)

Oka, Chiaki; Cha, Chae Young; Noma, Akinori

2010-07-07

A large amount of experimental data on the characteristics of the cardiac Na(+)/K(+) pump have been accumulated, but it remains difficult to predict the quantitative contribution of the pump in an intact cell because most measurements have been made under non-physiological conditions. To extrapolate the experimental findings to intact cells, we have developed a comprehensive Na(+)/K(+) pump model based on the thermodynamic framework (Smith and Crampin, 2004) of the Post-Albers reaction cycle combined with access channel mechanisms. The new model explains a variety of experimental results for the Na(+)/K(+) pump current (I(NaK)), including the dependency on the concentrations of Na(+) and K(+), the membrane potential and the free energy of ATP hydrolysis. The model demonstrates that both the apparent affinity and the slope of the substrate-I(NaK) relationship measured experimentally are affected by the composition of ions in the extra- and intracellular solutions, indirectly through alteration in the probability distribution of individual enzyme intermediates. By considering the voltage dependence in the Na(+)- and K(+)-binding steps, the experimental voltage-I(NaK) relationship could be reconstructed with application of experimental ionic compositions in the model, and the view of voltage-dependent K(+) binding was supported. Re-evaluation of charge movements accompanying Na(+) and K(+) translocations gave a reasonable number for the site density of the Na(+)/K(+) pump on the membrane. The new model is relevant for simulation of cellular functions under various interventions, such as depression of energy metabolism. (c) 2010 Elsevier Ltd. All rights reserved.

Exemplar: A Model for Social Studies Curriculum Development in Delaware, K-12.

Science.gov (United States)

Delaware State Dept. of Public Instruction, Dover.

GRADES OR AGES: Grades K-12. SUBJECT MATTER: Social studies. ORGANIZATION AND PHYSICAL APPEARANCE: The subject matter is divided into the following five themes: 1) Man develops within his physical and cultural environment. 2) Man functions within an interdependent society. 3) Man seeks justice and order. 4) Man experiences conflict and change. 5)…

On Developments of k-τ and k-ω Models for Near-Wall Turbulence of Engineering Duct Flows

DEFF Research Database (Denmark)

Rokni, Masoud; Sundén, Bengt

2009-01-01

-epsilon model namely, the lack of natural boundary conditions. Based on idea of Kolmogorov time-scale a boundary condition at the wall is also proposed. A bounded k-omega model for near wall turbulence is also presented and comparison with other well established two-equation models (k-epsilon model and Wilcox k...

Development of a Virtual Technology Coach to Support Technology Integration for K-12 Educators

Science.gov (United States)

Sugar, William; van Tryon, Patricia J. Slagter

2014-01-01

In an effort to develop a virtual technology coach for K-12 educators, this article analyzed survey results from sixty teachers with regards to specific resources that a technology coach could provide within a virtual environment. A virtual technology coach was proposed as a possible solution to provide continual professional development for…

"Flipping" educational technology professional development for K-12 educators

Science.gov (United States)

Spencer, Daniel

As the demand for more effective professional development increases in K-12 schools, trainers must adjust their training methods to meet the needs of their teacher learners. Just as lecture-heavy, teacher-centered instruction only meet the learning needs of a small minority of students, "sit and get" professional development rarely results in the teachers gaining the skills and confidence necessary to use technology effectively in their instruction. To resolve the frustrations of teachers related to ineffective professional development, a "Flipped PD" training model was developed based on the learning needs of adult learners, the integration of technological, pedagogical, and content knowledge (TPACK), learning activities, and the Flipped Classroom concept. Under this model, training shifts from a passive, trainer-centered format, to an active, learner-centered format where teachers learn to use technology in their classrooms by first focusing on pedagogical issues, then choosing the options that work best for addressing those issues in their unique situation, and completing "learn-by-doing" projects. Those who participate in "Flipped PD" style trainings tend to have more confidence upon completion that they can use the tools they were trained on in their teaching, as well as believe that the PD was engaging and a good use of their time.

p53, erbB-2 and K-ras gene alterations are rare in spontaneous and plutonium-239-induced canine lung neoplasia

International Nuclear Information System (INIS)

Tierney, L.A.; Hahn, F.F.; Lechner, J.F.

1996-01-01

Inhalation of high-linear energy transfer radiation in the form of radon progeny is a suspected cause of human lung cancer. To gain insight into the types of genetic derangements caused by this type of radiation, lung tumors from beagle dogs exposed to 239 PuO 2 and those arising in animals with no known carcinogen exposure were examined for evidence of aberrations in genes known to be altered in lung tumors. Altered expression of the p53 tumor suppressor gene and proto-oncogene erbB-2 proteins (p185 erbB2 ) was evaluated by immunohistochemical analysis of 117 tumors representing different histological types in exposed (n = 80) and unexposed (n = 37) animals. Twenty-eight tumors were analyzed for K-ras proto-oncogene mutations by polymerase chain reaction amplification and direct sequencing. Fourteen percent (16/116) of all lung neoplasms showed elevated nuclear accumulation of p53 protein. Regardless of exposure history, adenosquamous and squamous cell cancers comprised 94% of all tumors with p53 abnormalities. Eighteen percent (21/117) of all tumors had evidence of erbB-2 protein overexpression. K-ras mutations were not detected in codons 12, 13 or 61 of tumors from unexposed (n = 9) or plutonium-exposed dogs (n = 19). These data indicate that p53 and K-ras gene abnormalities as a result of missense mutation are infrequent events in spontaneous and 239 PuO 2 -induced lung neoplasia in this colony of beagle dogs. Alternative mechanisms of gene alteration may be involved in canine pulmonary carcinogenesis. 45 refs., 3 figs., 2 tabs

Development of a 2kWe LPG fuel processor for PEFC

International Nuclear Information System (INIS)

Cipiti, F.; Pino, L.; Vita, A.; Cordaro, M.; Lagana, M.; Recupero, V.

2004-01-01

The successful development of Polymer Electrolyte Fuel Cells (PEFC's) for stationary and/or transportation purposes is strictly dependent on the choice of a proper fuel processor. This paper covers the in progress activities performed at CNR-ITAE on the development of a 2 kWequivalent hydrogen generator unit, (under testing) feed by LPG (propane). The main issues that should be satisfied by the hydrogen generator will be high fuel conversion, stable performance for repeated start-up and shut-down cycles, capability to process different hydrocarbons, etc. The actual unit, is constituted by an autothermal reactor (ATR) with a proprietary CNR/ITAE catalyst, an intermediate water gas shift (ITS) and a CO preferential oxidation (PROX) reactors containing commercial catalysts; the system includes heat exchangers, manual and automatic valves, pressure regulators and transducers, flow meters and ancillaries. External heating is supplied only during the start-up; on regime operations the global heat balance is smoothly exothermic. The main objectives of the experimental tests are: evaluation of reactors and system performance (in steady state and in transient response), identification of main operating limits of the reactors, to validate heat and mass balance. Preliminary results, for the 2 kW prototype, are presented. (author)

Minor abnormalities of testis development in mice lacking the gene encoding the MAPK signalling component, MAP3K1.

Directory of Open Access Journals (Sweden)

Nick Warr

2011-05-01

Full Text Available In mammals, the Y chromosome is a dominant male determinant, causing the bipotential gonad to develop as a testis. Recently, cases of familial and spontaneous 46,XY disorders of sex development (DSD have been attributed to mutations in the human gene encoding mitogen-activated protein kinase kinase kinase 1, MAP3K1, a component of the mitogen-activated protein kinase (MAPK signal transduction pathway. In individuals harbouring heterozygous mutations in MAP3K1, dysregulation of MAPK signalling was observed in lymphoblastoid cell lines, suggesting a causal role for these mutations in disrupting XY sexual development. Mice lacking the cognate gene, Map3k1, are viable and exhibit the eyes open at birth (EOB phenotype on a mixed genetic background, but on the C57BL/6J genetic background most mice die at around 14.5 dpc due to a failure of erythropoiesis in the fetal liver. However, no systematic examination of sexual development in Map3k1-deficient mice has been described, an omission that is especially relevant in the case of C57BL/6J, a genetic background that is sensitized to disruptions to testis determination. Here, we report that on a mixed genetic background mice lacking Map3k1 are fertile and exhibit no overt abnormalities of testis development. On C57BL/6J, significant non-viability is observed with very few animals surviving to adulthood. However, an examination of development in Map3k1-deficient XY embryos on this genetic background revealed no significant defects in testis determination, although minor abnormalities were observed, including an increase in gonadal length. Based on these observations, we conclude that MAP3K1 is not required for mouse testis determination. We discuss the significance of these data for the functional interpretation of sex-reversing MAP3K1 mutations in humans.

Na-K pump site density and ouabain binding affinity in cultured chick heart cells

International Nuclear Information System (INIS)

Lobaugh, L.A.; Lieberman, M.

1987-01-01

The possible existence of multiple [ 3 H]ouabain binding sites and the relationship between ouabain binding and Na-K pump inhibition in cardiac muscle were studied using cultured embryonic chick heart cells. [ 3 H]ouabain bound to a single class of sites in 0.5 mM K (0.5 Ko) with an association rate constant (k+1) of 3.4 X 10(4) M-1.s-1 and a dissociation rate constant (k-1) of 0.0095 s. Maximal specific [ 3 H]ouabain binding RT to myocyte-enriched cultures is 11.7 pmol/mg protein and Kd is 0.43 microM in 0.5 Ko, whereas Kd,apparent is 6.6 microM in 5.4 Ko. The number of binding sites per myocyte was calculated by correcting for the contribution of fibroblasts in myocyte-enriched cultures using data from homogeneous fibroblast cultures (RT = 3.3 pmol/mg protein; Kd = 0.19 microM in 0.5 Ko). Equivalence of [ 3 H]ouabain binding sites and Na-K pumps was implied by agreement between maximal specific binding of [ 3 H]ouabain and 125 I-labeled monoclonal antibody directed against Na+-K+-ATPase (approximately 2 X 10(6) sites/cell). However, [ 3 H]ouabain binding occurred at lower concentrations than inhibition of ouabain-sensitive 42 K uptake in 0.5 Ko. Further studies in both 0.5 K and 5.4 Ko showed that ouabain caused cell Na content Nai to increase over the same range of concentrations that binding occurred, implying that increased Nai may stimulate unbound Na-K pumps and prevent a proportional decrease in 42 K uptake rate. The results show that Na-K pump inhibition occurs as a functional consequence of specific ouabain binding and indicate that the Na-K pump is the cardiac glycoside receptor in cultured heart cells

Time-Resolved K-shell Photoabsorption Edge Measurement in a Strongly Coupled Matter Driven by Laser-converted Radiation

Science.gov (United States)

Zhao, Yang; Yang, Jia-Min; Zhang, Ji-Yan; Yang, Guo-Hong; Xiong, Gang; Wei, Min-Xi; Song, Tian-Ming; Zhang, Zhi-Yu

2013-06-01

A time-resolved K edge absorption measurement of warm dense KCl was performed on Shenguang II laser facility. The x-ray radiation driven shocks were adopted to take colliding shocks compression. By using Dog bone hohlraum the CH/KCl/CH sample was shielded from the laser hitting point to suppress the M band preheating and enhance the compressibility. Thus, an unexplored and extreme region of the plasma state with the maximum 5 times solid density and temperature lower than 3 eV (with coupling constant Γii around 100) was first obtained. The photoabsorption spectra of chlorine near the K-shell edge have been measured with a crystal spectrometer using a short x-ray backlighter. The K edge red shift up to 11.7 eV and broadening of 15.2 eV were obtained for the maximum compression. The electron temperature, inferred by Fermi-Dirac fit of the measured K-edge broadening, was consistent with the hydrodynamic predictions. The comparison of the K edge shift with a plasma model, in which the ionization effect, continuum lowering and partial degeneracy are considered, shows that more improvements are desired to describe in details the variation of K edge shift. This work might extend future study of WDM in extreme conditions of high compression.

Bright x-ray stainless steel K-shell source development at the National Ignition Facility

Energy Technology Data Exchange (ETDEWEB)

May, M. J.; Fournier, K. B.; Colvin, J. D.; Barrios, M. A.; Dewald, E. L.; Moody, J.; Patterson, J. R.; Schneider, M.; Widmann, K. [Lawrence Livermore National Laboratory, P.O. Box 808 L170, Livermore, California 94551 (United States); Hohenberger, M.; Regan, S. P. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)

2015-06-15

High x-ray conversion efficiency (XRCE) K-shell sources are being developed for high energy density experiments for use as backlighters and for the testing of materials exposed to high x-ray fluxes and fluences. Recently, sources with high XRCE in the K-shell x-ray energy range of iron and nickel were investigated at the National Ignition Facility (NIF). The x-ray conversion efficiency in the 5–9 keV spectral range was determined to be 6.8% ± 0.3%. These targets were 4.1 mm diameter, 4 mm tall hollow epoxy tubes having a 50 μm thick wall supporting a tube of 3 to 3.5 μm thick stainless steel. The NIF laser deposited ∼460 kJ of 3ω light into the target in a 140 TW, 3.3 ns square pulse. The absolute x-ray emission of the source was measured by two calibrated Dante x-ray spectrometers. Time resolved images filtered for the Fe K-shell were recorded to follow the heating of the target. Time integrated high-resolution spectra were recorded in the K-shell range.