A proposal to rename the hyperthermophile Pyrococcus woesei as Pyrococcus furiosus subsp. woesei.
Kanoksilapatham, Wirojne; González, Juan M; Maeder, Dennis L; DiRuggiero, Jocelyne; Robb, Frank T
2004-10-01
Pyrococcus species are hyperthermophilic members of the order Thermococcales, with optimal growth temperatures approaching 100 degrees C. All species grow heterotrophically and produce H2 or, in the presence of elemental sulfur (S(o)), H2S. Pyrococcus woesei and P. furiosus were isolated from marine sediments at the same Vulcano Island beach site and share many morphological and physiological characteristics. We report here that the rDNA operons of these strains have identical sequences, including their intergenic spacer regions and part of the 23S rRNA. Both species grow rapidly and produce H2 in the presence of 0.1% maltose and 10-100 microM sodium tungstate in S(o)-free medium. However, P. woesei shows more extensive autolysis than P. furiosus in the stationary phase. Pyrococcus furiosus and P. woesei share three closely related families of insertion sequences (ISs). A Southern blot performed with IS probes showed extensive colinearity between the genomes of P. woesei and P. furiosus. Cloning and sequencing of ISs that were in different contexts in P. woesei and P. furiosus revealed that the napA gene in P. woesei is disrupted by a type III IS element, whereas in P. furiosus, this gene is intact. A type I IS element, closely linked to the napA gene, was observed in the same context in both P. furiosus and P. woesei genomes. Our results suggest that the IS elements are implicated in genomic rearrangements and reshuffling in these closely related strains. We propose to rename P. woesei a subspecies of P. furiosus based on their identical rDNA operon sequences, many common IS elements that are shared genomic markers, and the observation that all P. woesei nucleotide sequences deposited in GenBank to date are > 99% identical to P. furiosus sequences.
A proposal to rename the hyperthermophile Pyrococcus woesei as Pyrococcus furiosus subsp. woesei
Directory of Open Access Journals (Sweden)
Wirojne Kanoksilapatham
2004-01-01
Full Text Available Pyrococcus species are hyperthermophilic members of the order Thermococcales, with optimal growth temperatures approaching 100 °C. All species grow heterotrophically and produce H2 or, in the presence of elemental sulfur (S°, H2S. Pyrococcus woesei and P. furiosus were isolated from marine sediments at the same Vulcano Island beach site and share many morphological and physiological characteristics. We report here that the rDNA operons of these strains have identical sequences, including their intergenic spacer regions and part of the 23S rRNA. Both species grow rapidly and produce H2 in the presence of 0.1% maltose and 10–100 µM sodium tungstate in S°-free medium. However,P. woesei shows more extensive autolysis than P. furiosus in the stationary phase. Pyrococcusfuriosus and P. woesei share three closely related families of insertion sequences (ISs. A Southern blot performed with IS probes showed extensive colinearity between the genomes of P. woesei and P. furiosus. Cloning and sequencing of ISs that were in different contexts in P. woesei and P. furiosus revealed that the napA gene in P. woesei is disrupted by a type III IS element, whereas in P. furiosus, this gene is intact. A type I IS element, closely linked to the napA gene, was observed in the same context in both P. furiosus and P. woesei genomes. Our results suggest that the IS elements are implicated in genomic rearrangements and reshuffling in these closely related strains. We propose to rename P. woesei a subspecies of P. furiosus based on their identical rDNA operon sequences, many common IS elements that are shared genomic markers, and the observation that all P. woesei nucleotide sequences deposited in GenBank to date are > 99% identical to P. furiosus sequences.
Enhanced production of subtilisin of Pyrococcus furiosus expressed ...
African Journals Online (AJOL)
A subtilisin gene identified in the reported genome sequence of Pyrococcus furiosus was amplified and inserted in pET-22b(+) vector to produce the recombinant plasmid pET-SB. Escherichia coli BL-21 (DE3) CodonPlus was transformed with this plasmid and the enzyme was expressed up to 30% of the total cell protein on ...
Bruins, M.E.; Strubel, M.; Lieshout, van J.F.T.; Janssen, A.E.M.; Boom, R.M.
2003-01-01
Oligosaccharides can be synthesised from monosaccharides or disaccharides, using glycosidases as a catalyst. To investigate the potential of this synthesis with beta-glycosidase from Pyrococcus furiosus we determined kinetic parameters for substrate conversion and product formation from cellobiose,
Sevcenco, Ana-Maria; Paravidino, Monica; Vrouwenvelder, Johannes S.; Wolterbeek, Hubert Th.; van Loosdrecht, Mark C.M.; Hagen, Wilfred R.
2015-01-01
Oxo-anion binding properties of the thermostable enzyme ferritin from Pyrococcus furiosus were characterized with radiography. Radioisotopes 32P and 76As present as oxoanions were used to measure the extent and the rate of their absorption
Berrisford, J.M.; Akerboom, A.P.; Turnbull, A.P.; Geus, de D.; Sedelnikova, S.E.; Staton, I.; McLeod, C.W.; Verhees, C.H.; Oost, van der J.; Rice, D.W.; Baker, P.J.
2003-01-01
Phosphoglucose isomerase (PGI) catalyzes the reversible isomerization between D-fructose 6-phosphate and D-glucose 6-phosphate as part of the glycolytic pathway. PGI from the Archaea Pyrococcus furiosus (Pfu) was crystallized, and its structure was determined by x-ray diffraction to a 2-Angstrom
Crystallization of [Fe4S3]-ferredoxin from the hyperthermophile archaeon pyrococcus furiosus
DEFF Research Database (Denmark)
Nielsen, Michael Ericsson Skovbo; Harris, Pernille; Christensen, Hans Erik Mølager
2003-01-01
Recombinant Pyrococcus furiosus ferredoxin with a [Fe3S4]-cluster was crystallized through steps of optimization and X-ray diffraction data were collected from several crystal forms. Flat plate-like crystals were grown by hanging-drop vapour diffusion. The precipitant used was 30% PEG 400; the p...
Hanson, T.; Kaper, T.; Oost, van der J.; Vos, de W.M.
2001-01-01
Enzymatic transglycosylation of lactose into oligosaccharides was studied using wild-type -glucosidase (CelB) and active site mutants thereof (M424K, F426Y, M424K/F426Y) and wild-type -mannosidase (BmnA) of the hyperthermophilic Pyrococcus furiosus. The effects of the mutations on kinetics, enzyme
Akerboom, A.P.; Turnbull, A.P.; Hargreaves, D.; Fischer, M.; Geus, de D.; Sedelnikova, S.E.; Berrisford, J.M.; Baker, P.J.; Verhees, C.H.; Oost, van der J.; Rice, D.W.
2003-01-01
The glycolytic enzyme phosphoglucose isomerase catalyses the reversible isomerization of glucose 6-phosphate to fructose 6-phosphate. The phosphoglucose isomerase from the hyperthermophilic archaeon Pyrococcus furiosus, which shows no sequence similarity to any known bacterial or eukaryotic
Ban, van den E.C.D.
2001-01-01
This Ph.D. project started in 1997 and its main goal was to obtain insight in the reductive capacity of the hyperthermophilic archaeon Pyrococcus furiosus . The research was focused on the biocatalytic reduction of carboxylic
Sedelnikova, S.E.; Smits, S.H.J.; Leonard, P.M.; Brinkman, A.B.; Oost, van der J.; Rafferty, J.B.
2001-01-01
The LrpA transcriptional regulator from Pyrococcus furiosus, a member of the leucine-responsive regulatory protein (Lrp) family, has been crystallized by the hanging-drop method of vapour diffusion using ammonium sulfate as the precipitant. The crystals belong to the tetragonal system and are in
Intermolecular ion pairs maintain the toroidal structure of Pyrococcus furiosus PCNA
Matsumiya, Shigeki; Ishino, Sonoko; Ishino, Yoshizumi; Morikawa, Kosuke
2003-01-01
Two mutant proliferating cell nuclear antigens from the hyperthermophilic archaeon Pyrococcus furiosus, PfuPCNA(D143A) and PfuPCNA(D143A/D147A), were prepared by site-specific mutagenesis. The results from gel filtration showed that mutations at D143 and D147 drastically affect the stability of the trimeric structure of PfuPCNA. The PfuPCNA(D143A) still retained the activity to stimulate the DNA polymerase reaction, but PfuPCNA(D143A/D147A) lost the activity. Crystal structures of the mutant ...
Expression, Purification, and Characterisation of Dehydroquinate Synthase from Pyrococcus furiosus
Directory of Open Access Journals (Sweden)
Leonardo Negron
2011-01-01
Full Text Available Dehydroquinate synthase (DHQS catalyses the second step of the shikimate pathway to aromatic compounds. DHQS from the archaeal hyperthermophile Pyrococcus furiosus was insoluble when expressed in Escherichia coli but was partially solubilised when KCl was included in the cell lysis buffer. A purification procedure was developed, involving lysis by sonication at 30∘C followed by a heat treatment at 70∘C and anion exchange chromatography. Purified recombinant P. furiosus DHQS is a dimer with a subunit Mr of 37,397 (determined by electrospray ionisation mass spectrometry and is active over broad pH and temperature ranges. The kinetic parameters are KM (3-deoxy-D-arabino-heptulosonate 7-phosphate 3.7 μM and kcat 3.0 sec-1 at 60∘C and pH 6.8. EDTA inactivates the enzyme, and enzyme activity is restored by several divalent metal ions including (in order of decreasing effectiveness Cd2+, Co2+, Zn2+, and Mn2+. High activity of a DHQS in the presence of Cd2+ has not been reported for enzymes from other sources, and may be related to the bioavailability of Cd2+ for P. furiosus. This study is the first biochemical characterisation of a DHQS from a thermophilic source. Furthermore, the characterisation of this hyperthermophilic enzyme was carried out at elevated temperatures using an enzyme-coupled assay.
Directory of Open Access Journals (Sweden)
Gerrit Jan Schut
2016-01-01
Full Text Available Carbon monoxide (CO is an important intermediate in anaerobic carbon fixation pathways in acetogenesis and methanogenesis. In addition, some anaerobes can utilize CO as an energy source. In the hyperthermophilic archaeon Thermococcus onnurineus, which grows optimally at 80°C, CO oxidation and energy conservation is accomplished by a respiratory complex encoded by a 16-gene cluster containing a carbon monoxide dehydrogenase, a membrane-bound [NiFe]-hydrogenase and a Na+/H+ antiporter module. This complex oxidizes CO, evolves CO2 and H2, and generates a Na+ motive force that is used to conserve energy by a Na+-dependent ATP synthase. Herein we used a bacterial artificial chromosome to insert the 13.2 kb gene cluster encoding the CO-oxidizing respiratory complex of T. onnurineus into the genome of the heterotrophic archaeon, Pyrococcus furiosus, which grows optimally at 100°C. P. furiosus is normally unable to utilize CO, however, the recombinant strain readily oxidized CO and generated H2 at 80°C. Moreover, CO also served as an energy source and allowed the P. furiosus strain to grow with a limiting concentration of sugar or with peptides as the carbon source. Moreover, CO oxidation by P. furiosus was also coupled to the re-utilization, presumably for biosynthesis, of acetate generated by fermentation. The functional transfer of CO utilization between Thermococcus and Pyrococcus species demonstrated herein is representative of the horizontal gene transfer of an environmentally-relevant metabolic capability. The transfer of CO utilizing, hydrogen-producing genetic modules also has applications for biohydrogen production and a CO-based industrial platform for various thermophilic organisms.
2012-04-26
organophosphorus acid anhydrase from a halophilic bacterial isolate. J Bacteriol, 173, 1938-1943. Du, X., Tove, S., Kast -Hutcheson, K. & Grunden, A. M...1938-1943. Du, X., Tove, S., Kast -Hutcheson, K. & Grunden, A. M. 2005. Characterization of the dinuclear metal center of Pyrococcus furiosus
DEFF Research Database (Denmark)
Kepp, Kasper Planeta; Ooi, Bee Lean; Christensen, Hans Erik Mølager
2007-01-01
This work describes the computation and accurate reproduction of subtle shifts in reduction potentials for two mutants of the iron-sulfur protein Pyrococcus furiosus ferredoxin. The computational models involved only first-sphere ligands and differed with respect to one ligand, either acetate (as...
Kiyonari, Shinichi; Tahara, Saki; Shirai, Tsuyoshi; Iwai, Shigenori; Ishino, Sonoko; Ishino, Yoshizumi
2009-01-01
Apurinic/apyrimidinic (AP) sites are the most frequently found mutagenic lesions in DNA, and they arise mainly from spontaneous base loss or modified base removal by damage-specific DNA glycosylases. AP sites are cleaved by AP endonucleases, and the resultant gaps in the DNA are repaired by DNA polymerase/DNA ligase reactions. We identified the gene product that is responsible for the AP endonuclease activity in the hyperthermophilic euryarchaeon, Pyrococcus furiosus. Furthermore, we detected...
Sevcenco, Ana-Maria
2015-03-13
Oxo-anion binding properties of the thermostable enzyme ferritin from Pyrococcus furiosus were characterized with radiography. Radioisotopes 32P and 76As present as oxoanions were used to measure the extent and the rate of their absorption by the ferritin. Thermostable ferritin proved to be an excellent system for rapid phosphate and arsenate removal from aqueous solutions down to residual concentrations at the picomolar level. These very low concentrations make thermostable ferritin a potential tool to considerably mitigate industrial biofouling by phosphate limitation or to remove arsenate from drinking water.
Guschinskaya, Natalia; Brunel, Romain; Tourte, Maxime; Lipscomb, Gina L; Adams, Michael W W; Oger, Philippe; Charpentier, Xavier
2016-11-08
Transposition mutagenesis is a powerful tool to identify the function of genes, reveal essential genes and generally to unravel the genetic basis of living organisms. However, transposon-mediated mutagenesis has only been successfully applied to a limited number of archaeal species and has never been reported in Thermococcales. Here, we report random insertion mutagenesis in the hyperthermophilic archaeon Pyrococcus furiosus. The strategy takes advantage of the natural transformability of derivatives of the P. furiosus COM1 strain and of in vitro Mariner-based transposition. A transposon bearing a genetic marker is randomly transposed in vitro in genomic DNA that is then used for natural transformation of P. furiosus. A small-scale transposition reaction routinely generates several hundred and up to two thousands transformants. Southern analysis and sequencing showed that the obtained mutants contain a single and random genomic insertion. Polyploidy has been reported in Thermococcales and P. furiosus is suspected of being polyploid. Yet, about half of the mutants obtained on the first selection are homozygous for the transposon insertion. Two rounds of isolation on selective medium were sufficient to obtain gene conversion in initially heterozygous mutants. This transposition mutagenesis strategy will greatly facilitate functional exploration of the Thermococcales genomes.
Chiaraluce, R.; Gianese, G.; Angelaccio, S.; Florio, R.; Lieshout, van J.F.T.; Oost, van der J.; Consalvi, V.
2005-01-01
The family 16 endo-b-1,3 glucanase from the extremophilic archaeon Pyrococcus furiosus is a laminarinase, which in 7.9 M GdmCl (guanidinium chloride) maintains a significant amount of tertiary structure without any change of secondary structure. The addition of calcium to the enzyme in 7.9 M GdmCl
Wong, Catherine C L; Cociorva, Daniel; Miller, Christine A; Schmidt, Alexander; Monell, Craig; Aebersold, Ruedi; Yates, John R
2013-02-01
Pyrococcus furiosus (Pfu) is an excellent organism to generate reference samples for proteomics laboratories because of its moderately sized genome and very little sequence duplication within the genome. We demonstrated a stable and consistent method to prepare proteins in bulk that eliminates growth and preparation as a source of uncertainty in the standard. We performed several proteomic studies in different laboratories using each laboratory's specific workflow as well as separate and integrated data analysis. This study demonstrated that a Pfu whole cell lysate provides suitable protein sample complexity to not only validate proteomic methods, work flows, and benchmark new instruments but also to facilitate comparison of experimental data generated over time and across instruments or laboratories.
Chiaraluce, R.; Florio, R.; Angelaccio, S.; Gianese, G.; Lieshout, van J.F.T.; Oost, van der J.; Consalvi, V.
2007-01-01
The thermodynamic stability of family 16 endo-ß-1,3-glucanase (EC 3.2.1.39) from the hyperthermophilic archaeon Pyrococcus furiosus is decreased upon single (D287A, E53A) and double (E53A/D287A) mutation of Asp287 and Glu53. In accordance with the homology model prediction, both carboxylic acids are
Thorgersen, Michael P; Lipscomb, Gina L; Schut, Gerrit J; Kelly, Robert M; Adams, Michael W W
2014-03-01
The heterotrophic, hyperthermophilic archaeon Pyrococcus furiosus is a new addition to the growing list of genetically-tractable microorganisms suitable for metabolic engineering to produce liquid fuels and industrial chemicals. P. furiosus was recently engineered to generate 3-hydroxypropionate (3-HP) from CO₂ and acetyl-CoA by the heterologous-expression of three enzymes from the CO₂ fixation cycle of the thermoacidophilic archaeon Metallosphaera sedula using a thermally-triggered induction system. The acetyl-CoA for this pathway is generated from glucose catabolism that in wild-type P. furiosus is converted to acetate with concurrent ATP production by the heterotetrameric (α₂β₂) acetyl-CoA synthetase (ACS). Hence ACS in the engineered 3-HP production strain (MW56) competes with the heterologous pathway for acetyl-CoA. Herein we show that strains of MW56 lacking the α-subunit of either of the two ACSs previously characterized from P. furiosus (ACSI and ACSII) exhibit a three-fold increase in specific 3-HP production. The ΔACSIα strain displayed only a minor defect in growth on either maltose or peptides, while no growth defect on these substrates was observed with the ΔACSIIα strain. Deletion of individual and multiple ACS subunits was also shown to decrease CoA release activity for several different CoA ester substrates in addition to acetyl-CoA, information that will be extremely useful for future metabolic engineering endeavors in P. furiosus. Copyright © 2014 International Metabolic Engineering Society. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Meagher, Martin; Enemark, Eric J.
2016-06-22
The crystal structure of the N-terminal domain of the
Zhu, Hong; Reynolds, L Bruce; Menassa, Rima
2017-06-19
Alpha amylase hydrolyzes α-bonds of polysaccharides such as starch and produces malto-oligosaccharides. Its starch saccharification applications make it an essential enzyme in the textile, food and brewing industries. Commercially available α-amylase is mostly produced from Bacillus or Aspergillus. A hyper-thermostable and Ca 2++ independent α-amylase from Pyrococcus furiosus (PFA) expressed in E.coli forms insoluble inclusion bodies and thus is not feasible for industrial applications. We expressed PFA in Nicotiana tabacum and found that plant-produced PFA forms functional aggregates with an accumulation level up to 3.4 g/kg FW (fresh weight) in field conditions. The aggregates are functional without requiring refolding and therefore have potential to be applied as homogenized plant tissue without extraction or purification. PFA can also be extracted from plant tissue upon dissolution in a mild reducing buffer containing SDS. Like the enzyme produced in P. furiosus and in E. coli, plant produced PFA preserves hyper-thermophilicity and hyper-thermostability and has a long shelf life when stored in lyophilized leaf tissue. With tobacco's large biomass and high yield, hyper-thermostable α-amylase was produced at a scale of 42 kg per hectare. Tobacco may be a suitable bioreactor for industrial production of active hyperthermostable alpha amylase.
Crystal structure of Pfu, the high fidelity DNA polymerase from Pyrococcus furiosus.
Kim, Suhng Wook; Kim, Dong-Uk; Kim, Jin Kwang; Kang, Lin-Woo; Cho, Hyun-Soo
2008-05-01
We have determined a 2.6A resolution crystal structure of Pfu DNA polymerase, the most commonly used high fidelity PCR enzyme, from Pyrococcus furiosus. Although the structures of Pfu and KOD1 are highly similar, the structure of Pfu elucidates the electron density of the interface between the exonuclease and thumb domains, which has not been previously observed in the KOD1 structure. The interaction of these two domains is known to coordinate the proofreading and polymerization activity of DNA polymerases, especially via H147 that is present within the loop (residues 144-158) of the exonuclease domain. In our structure of Pfu, however, E148 rather than H147 is located at better position to interact with the thumb domain. In addition, the structural analysis of Pfu and KOD1 shows that both the Y-GG/A and beta-hairpin motifs of Pfu are found to differ with that of KOD1, and may explain differences in processivity. This information enables us to better understand the mechanisms of polymerization and proofreading of DNA polymerases.
Collart, F R; Osipiuk, J; Trent, J; Olsen, G J; Huberman, E
1996-10-03
We have cloned and characterized the gene encoding inosine monophosphate dehydrogenase (IMPDH) from Pyrococcus furiosus (Pf), a hyperthermophillic archeon. Sequence analysis of the Pf gene indicated an open reading frame specifying a protein of 485 amino acids (aa) with a calculated M(r) of 52900. Canonical Archaea promoter elements, Box A and Box B, are located -49 and -17 nucleotides (nt), respectively, upstream of the putative start codon. The sequence of the putative active-site region conforms to the IMPDH signature motif and contains a putative active-site cysteine. Phylogenetic relationships derived by using all available IMPDH sequences are consistent with trees developed for other molecules; they do not precisely resolve the history of Pf IMPDH but indicate a close similarity to bacterial IMPDH proteins. The phylogenetic analysis indicates that a gene duplication occurred prior to the division between rodents and humans, accounting for the Type I and II isoforms identified in mice and humans.
Komori, K; Ichiyanagi, K; Morikawa, K; Ishino, Y
1999-01-01
PI- Pfu I and PI- Pfu II from Pyrococcus furiosus are homing endonucleases, as shown in the accompanying paper. These two endonucleases are produced by protein splicing from the precursor protein including ribonucleotide reductase (RNR). We show here that both enzymes specifically interact with their substrate DNA and distort the DNA strands by 73 degrees and 67 degrees, respectively. They have two copies of the amino acid sequence motif LAGLIDADG, which is present in the majority of homing e...
Nguyen, Diep M N; Schut, Gerrit J; Zadvornyy, Oleg A; Tokmina-Lukaszewska, Monika; Poudel, Saroj; Lipscomb, Gina L; Adams, Leslie A; Dinsmore, Jessica T; Nixon, William J; Boyd, Eric S; Bothner, Brian; Peters, John W; Adams, Michael W W
2017-09-01
Electron bifurcation has recently gained acceptance as the third mechanism of energy conservation in which energy is conserved through the coupling of exergonic and endergonic reactions. A structure-based mechanism of bifurcation has been elucidated recently for the flavin-based enzyme NADH-dependent ferredoxin NADP + oxidoreductase I (NfnI) from the hyperthermophillic archaeon Pyrococcus furiosus. NfnI is thought to be involved in maintaining the cellular redox balance, producing NADPH for biosynthesis by recycling the two other primary redox carriers, NADH and ferredoxin. The P. furiosus genome encodes an NfnI paralog termed NfnII, and the two are differentially expressed, depending on the growth conditions. In this study, we show that deletion of the genes encoding either NfnI or NfnII affects the cellular concentrations of NAD(P)H and particularly NADPH. This results in a moderate to severe growth phenotype in deletion mutants, demonstrating a key role for each enzyme in maintaining redox homeostasis. Despite their similarity in primary sequence and cofactor content, crystallographic, kinetic, and mass spectrometry analyses reveal that there are fundamental structural differences between the two enzymes, and NfnII does not catalyze the NfnI bifurcating reaction. Instead, it exhibits non-bifurcating ferredoxin NADP oxidoreductase-type activity. NfnII is therefore proposed to be a bifunctional enzyme and also to catalyze a bifurcating reaction, although its third substrate, in addition to ferredoxin and NADP(H), is as yet unknown. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
2011-01-01
affinity for metal, and increased thermostability compared to P. furiosus prolidase, Pf prol (PF1343). To obtain a better enzyme for OP nerve agent...decontamination and to investigate the structural factors that may influence protein thermostability and thermoactivity, randomly mutated Ph1prol enzymes ...Introduction Pyrococcus horikoshii and Pyrococcus furiosus are both hyper- thermophilic archaea, growing optimally at 98 –100◦C that were isolated from a
Garg, Dushyant K; Tomar, Rachana; Dhoke, Reema R; Srivastava, Ankit; Kundu, Bishwajit
2015-05-01
Here, we report the folding and assembly of a Pyrococcus furiosus-derived protein, L-asparaginase (PfA). PfA functions as a homodimer, with each monomer made of distinct N- and C-terminal domains. The purified individual domains as well as single Trp mutant of each domain were subjected to chemical denaturation/renaturation and probed by combination of spectroscopic, chromatographic, quenching and scattering techniques. We found that the N-domain acts like a folding scaffold and assists the folding of remaining polypeptide. The domains displayed sequential folding with the N-domain having higher thermodynamic stability. We report that the extreme thermal stability of PfA is due to the presence of high intersubunit associative forces supported by extensive H-bonding and ionic interactions network. Our results proved that folding cooperativity in a thermophilic, multisubunit protein is dictated by concomitant folding and association of constituent domains directly into a native quaternary structure. This report gives an account of the factors responsible for folding and stability of a therapeutically and industrially important protein.
DEFF Research Database (Denmark)
Løvgreen, Monika Nøhr; Martic, Maja; Windahl, Michael S.
2011-01-01
The structure of the all-cysteinyl-coordinated D14C variant of [4Fe–4S] ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus has been determined to 1.7 Å resolution from a crystal belonging to space group C2221 with two types of molecules, A and B, in the asymmetric unit. A and B...... molecules have different crystal packing and intramolecular disulfide bond conformation. The crystal packing reveals a β-sheet interaction between A molecules in adjacent asymmetric units, whereas B molecules are packed as monomers in a less rigid position next to the A–A extended β-sheet dimers...... and purification are carried out at pH 5.8, only the monomer is obtained. The crystal structure of D14C [3Fe–4S] P. furiosus ferredoxin monomer was determined to 2.8 Å resolution from a crystal belonging to space group P212121 with two molecules in the asymmetric unit. The molecules resemble molecule A of D14C [4...
DEFF Research Database (Denmark)
Zhang, Jingdong; Christensen, Hans Erik Mølager; Ooi, Bee Lean
2004-01-01
We have addressed here electron transfer (ET) of Pyrococcus furiosus ferredoxin (PfFd, 7.5 kDa) in both homogeneous solution using edge plane graphite (EPG) electrodes and in the adsorbed state by electrochemistry on surface-modified single-crystal Au(111) electrodes, This has been supported...... by surface microscopic structures of PfFd monolayers, as revealed by scanning tunneling microscopy under potential control (in situ STM). Direct ET between PfFd in phosphate buffer solution, pH 7.9, and EPG electrodes is observed in the presence of promoters. Neomycin gives rise to a pair of redox peaks...... with a formal potential of ca -430 mV (vs SCE), corresponding to [3Fe-4S](1+/0). The presence of an additional promoter, which can be propionic acid, alanine, or cysteine, induces a second pair of redox peaks at similar to-900 mV (vs SCE) arising from [3Fe-4S](0/1-). A robust neomycin-PfFd complex was detected...
Lian, Hong; Zeldes, Benjamin M; Lipscomb, Gina L; Hawkins, Aaron B; Han, Yejun; Loder, Andrew J; Nishiyama, Declan; Adams, Michael W W; Kelly, Robert M
2016-12-01
Acetyl-Coenzyme A carboxylase (ACC), malonyl-CoA reductase (MCR), and malonic semialdehyde reductase (MRS) convert HCO 3 - and acetyl-CoA into 3-hydroxypropionate (3HP) in the 3-hydroxypropionate/4-hydroxybutyrate carbon fixation cycle resident in the extremely thermoacidophilic archaeon Metallosphaera sedula. These three enzymes, when introduced into the hyperthermophilic archaeon Pyrococcus furiosus, enable production of 3HP from maltose and CO 2 . Sub-optimal function of ACC was hypothesized to be limiting for production of 3HP, so accessory enzymes carbonic anhydrase (CA) and biotin protein ligase (BPL) from M. sedula were produced recombinantly in Escherichia coli to assess their function. P. furiosus lacks a native, functional CA, while the M. sedula CA (Msed_0390) has a specific activity comparable to other microbial versions of this enzyme. M. sedula BPL (Msed_2010) was shown to biotinylate the β-subunit (biotin carboxyl carrier protein) of the ACC in vitro. Since the native BPLs in E. coli and P. furiosus may not adequately biotinylate the M. sedula ACC, the carboxylase was produced in P. furiosus by co-expression with the M. sedula BPL. The baseline production strain, containing only the ACC, MCR, and MSR, grown in a CO 2 -sparged bioreactor reached titers of approximately 40 mg/L 3HP. Strains in which either the CA or BPL accessory enzyme from M. sedula was added to the pathway resulted in improved titers, 120 or 370 mg/L, respectively. The addition of both M. sedula CA and BPL, however, yielded intermediate titers of 3HP (240 mg/L), indicating that the effects of CA and BPL on the engineered 3HP pathway were not additive, possible reasons for which are discussed. While further efforts to improve 3HP production by regulating gene dosage, improving carbon flux and optimizing bioreactor operation are needed, these results illustrate the ancillary benefits of accessory enzymes for incorporating CO 2 into 3HP production in metabolically engineered P
Staples, Christopher R.; Dhawan, Ish K.; Finnegan, Michael G.; Dwinell, Derek A.; Zhou, Zhi Hao; Huang, Heshu; Verhagen, Marc F. J. M.; Adams, Michael W. W.; Johnson, Michael K.
1997-12-03
The ground- and excited-state properties of heterometallic [CuFe(3)S(4)](2+,+), [CdFe(3)S(4)](2+,+), and [CrFe(3)S(4)](2+,+) cubane clusters assembled in Pyrococcus furiosus ferredoxin have been investigated by the combination of EPR and variable-temperature/variable-field magnetic circular dichroism (MCD) studies. The results indicate Cd(2+) incorporation into [Fe(3)S(4)](0,-) cluster fragments to yield S = 2 [CdFe(3)S(4)](2+) and S = (5)/(2) [CdFe(3)S(4)](+) clusters and Cu(+) incorporation into [Fe(3)S(4)](+,0) cluster fragments to yield S = (1)/(2) [CuFe(3)S(4)](2+) and S = 2 [CuFe(3)S(4)](+) clusters. This is the first report of the preparation of cubane type [CrFe(3)S(4)](2+,+) clusters, and the combination of EPR and MCD results indicates S = 0 and S = (3)/(2) ground states for the oxidized and reduced forms, respectively. Midpoint potentials for the [CdFe(3)S(4)](2+,+), [CrFe(3)S(4)](2+,+), and [CuFe(3)S(4)](2+,+) couples, E(m) = -470 +/- 15, -440 +/- 10, and +190 +/- 10 mV (vs NHE), respectively, were determined by EPR-monitored redox titrations or direct electrochemistry at a glassy carbon electrode. The trends in redox potential, ground-state spin, and electron delocalization of [MFe(3)S(4)](2+,+) clusters in P. furiosus ferredoxin are discussed as a function of heterometal (M = Cr, Mn, Fe, Co, Ni, Cu, Zn, Cd, and Tl).
DNA targeting by the type I-G and type I-A CRISPR–Cas systems of Pyrococcus furiosus
Elmore, Joshua; Deighan, Trace; Westpheling, Jan; Terns, Rebecca M.; Terns, Michael P.
2015-01-01
CRISPR–Cas systems silence plasmids and viruses in prokaryotes. CRISPR–Cas effector complexes contain CRISPR RNAs (crRNAs) that include sequences captured from invaders and direct CRISPR-associated (Cas) proteins to destroy corresponding invader nucleic acids. Pyrococcus furiosus (Pfu) harbors three CRISPR–Cas immune systems: a Cst (Type I-G) system with an associated Cmr (Type III-B) module at one locus, and a partial Csa (Type I-A) module (lacking known invader sequence acquisition and crRNA processing genes) at another locus. The Pfu Cmr complex cleaves complementary target RNAs, and Csa systems have been shown to target DNA, while the mechanism by which Cst complexes silence invaders is unknown. In this study, we investigated the function of the Cst as well as Csa system in Pfu strains harboring a single CRISPR–Cas system. Plasmid transformation assays revealed that the Cst and Csa systems both function by DNA silencing and utilize similar flanking sequence information (PAMs) to identify invader DNA. Silencing by each system specifically requires its associated Cas3 nuclease. crRNAs from the 7 shared CRISPR loci in Pfu are processed for use by all 3 effector complexes, and Northern analysis revealed that individual effector complexes dictate the profile of mature crRNA species that is generated. PMID:26519471
Energy Technology Data Exchange (ETDEWEB)
Blumentals, I.I.; Robinson, A.S.; Kelly, R.M. (Johns Hopkins Univ., Baltimore, MD (USA))
1990-07-01
Cell extracts from Pyrococcus furiosus were found to contain five proteases, two of which (S66 and S102) are resistant to sodium dodecyl sulfate (SDS) denaturation. Cell extracts incubated at 98{degree}C in the presence of 1% SDS for 24 h exhibited substantial cellular proteolysis such that only four proteins could be visualized by amido black-Coomassie brilliant blue staining of SDS-polyacrylamide gels. The SDS-treated extract retained 19% of the initial proteolytic activity as represented by two proteases, S66 (66 kilodaltons (kDa)) and S102 (102 kDa). Immunoblot analysis with guinea pig sera containing antibodies against protease S66 indicated that S66 is related neither to S102 nor to the other proteases. The results of this analysis also suggest that S66 might be the hydrolysis product of a 200-kDa precursor which does not have proteolytic activity. The 24-h SDS-treated extract showed unusually thermostable proteolytic activity; the measured half-life at 98{degree}C was found to be 33 h. Proteases S66 and S102 were also resistant to denaturation by 8 M urea, 80 mM dithiothreitol, and 5% {beta}-mercaptoethanol. Purified protease S66 was inhibited by phenylmethylsulfonyl fluoride and diisopropyl fluorophosphate but not by EDTA, ethylene glycol-bis({beta}-aminoethyl ether)-N,N,N{prime},N{prime}-tetraacetic acid, or iodoacetic acid. These results indicate that S66 is a serine protease. Amino acid ester hydrolysis studies showed that protease S66 was hydrolytically active towards N-benzoyl-L-arginine ethyl ester.
2013-01-01
Background Lactose intolerance is a common health concern causing gastrointestinal symptoms and avoidance of dairy products by afflicted individuals. Since milk is a primary source of calcium and vitamin D, lactose intolerant individuals often obtain insufficient amounts of these nutrients which may lead to adverse health outcomes. Production of lactose-free milk can provide a solution to this problem, although it requires use of lactase from microbial sources and increases potential for contamination. Use of thermostable lactase enzymes can overcome this issue by functioning under pasteurization conditions. Results A thermostable β-glucosidase gene from Pyrococcus furiosus was cloned in frame with the Saccharomyces cerecisiae a-factor secretory signal and expressed in Pichia pastoris strain X-33. The recombinant enzyme was purified by a one-step method of weak anion exchange chromatography. The optimum temperature and pH for this β-glucosidase activity was 100°C and pH 6.0, respectively. The enzyme activity was not significantly inhibited by Ca2+. We tested the additive amount, hydrolysis time, and the influence of glucose on the enzyme during pasteurization and found that the enzyme possessed a high level of lactose hydrolysis in milk that was not obviously influenced by glucose. Conclusions The thermostablity of this recombinant β-glucosidase, combined with its neutral pH activity and favorable temperature activity optima, suggest that this enzyme is an ideal candidate for the hydrolysis of lactose in milk, and it would be suitable for application in low-lactose milk production during pasteurization. PMID:24053641
Directory of Open Access Journals (Sweden)
Roberta V. Branco
2015-01-01
Full Text Available A recombinant thermostable lipase (Pf2001Δ60 from the hyperthermophilic Archaeon Pyrococcus furiosus (PFUL was immobilized by hydrophobic interaction on octyl-agarose (octyl PFUL and by covalent bond on aldehyde activated-agarose in the presence of DTT at pH = 7.0 (one-point covalent attachment (glyoxyl-DTT PFUL and on glyoxyl-agarose at pH 10.2 (multipoint covalent attachment (glyoxyl PFUL. The enzyme’s properties, such as optimal temperature and pH, thermostability, and selectivity, were improved by covalent immobilization. The highest enzyme stability at 70°C for 48 h incubation was achieved for glyoxyl PFUL (around 82% of residual activity, whereas glyoxyl-DTT PFUL maintained around 69% activity, followed by octyl PFUL (27% remaining activity. Immobilization on glyoxyl-agarose improved the optimal temperature to 90°C, while the optimal temperature of octyl PFUL was 70°C. Also, very significant changes in activity with different substrates were found. In general, the covalent bond derivatives were more active than octyl PFUL. The E value also depended substantially on the derivative and the conditions used. It was observed that the reaction of glyoxyl-DTT PFUL using methyl mandelate as a substrate at pH 7 presented the best results for enantioselectivity E=22 and enantiomeric excess (ee (% = 91.
Energy Technology Data Exchange (ETDEWEB)
Adams, Michael W. [University of Georgia; W. W. Adams, Michael
2014-01-07
Virtualy all cellular processes are carried out by dynamic molecular assemblies or multiprotein complexes (PCs), the composition of which is largely unknown. Structural genomics efforts have demonstrated that less than 25% of the genes in a given prokaryotic genome will yield stable, soluble proteins when expressed using a one-ORF-at-a-time approach. We proposed that much of the remaining 75% of the genes encode proteins that are part of multiprotein complexes or are modified post-translationally, for example, with metals. The problem is that PCs and metalloproteins (MPs) cannot be accurately predicted on a genome-wide scale. The only solution to this dilemma is to experimentally determine PCs and MPs in biomass of a model organism and to develop analytical tools that can then be applied to the biomass of any other organism. In other words, organisms themselves must be analyzed to identify their PCs and MPs: “native proteomes” must be determined. This information can then be utilized to design multiple ORF expression systems to produce recombinant forms of PCs and MPs. Moreover, the information and utility of this approach can be enhanced by using a hyperthermophile, one that grows optimally at 100°C, as a model organism. By analyzing the native proteome at close to 100 °C below the optimum growth temperature, we will trap reversible and dynamic complexes, thereby enabling their identification, purification, and subsequent characterization. The model organism for the current study is Pyrococcus furiosus, a hyperthermophilic archaeon that grows optimally at 100°C. It is grown up to 600-liter scale and kg quantities of biomass are available. In this project we identified native PCs and MPs using P. furiosus biomass (with MS/MS analyses to identify proteins by component 4). In addition, we provided samples of abundant native PCs and MPs for structural characterization (using SAXS by component 5). We also designed and evaluated generic bioinformatics and
Directory of Open Access Journals (Sweden)
Nastassia Havarushka
Full Text Available Molybdenum and tungsten cofactors share a similar pterin-based scaffold, which hosts an ene-dithiolate function being essential for the coordination of either molybdenum or tungsten. The biosynthesis of both cofactors involves a multistep pathway, which ends with the activation of the metal binding pterin (MPT by adenylylation before the respective metal is incorporated. In the hyperthermophilic organism Pyrococcus furiosus, the hexameric protein MoaB (PfuMoaB has been shown to catalyse MPT-adenylylation. Here we determined the crystal structure of PfuMoaB at 2.5 Å resolution and identified key residues of α3-helix mediating hexamer formation. Given that PfuMoaB homologues from mesophilic organisms form trimers, we investigated the impact on PfuMoaB hexamerization on thermal stability and activity. Using structure-guided mutagenesis, we successfully disrupted the hexamer interface in PfuMoaB. The resulting PfuMoaB-H3 variant formed monomers, dimers and trimers as determined by size exclusion chromatography. Circular dichroism spectroscopy as well as chemical cross-linking coupled to mass spectrometry confirmed a wild-type-like fold of the protomers as well as inter-subunits contacts. The melting temperature of PfuMoaB-H3 was found to be reduced by more than 15 °C as determined by differential scanning calorimetry, thus demonstrating hexamerization as key determinant for PfuMoaB thermal stability. Remarkably, while a loss of activity at temperatures higher than 50 °C was observed in the PfuMoaB-H3 variant, at lower temperatures, we determined a significantly increased catalytic activity. The latter suggests a gain in conformational flexibility caused by the disruption of the hexamerization interface.
The L7Ae protein binds to two kink-turns in the Pyrococcus furiosus RNase P RNA
Lai, Stella M.; Lai, Lien B.; Foster, Mark P.; Gopalan, Venkat
2014-01-01
The RNA-binding protein L7Ae, known for its role in translation (as part of ribosomes) and RNA modification (as part of sn/oRNPs), has also been identified as a subunit of archaeal RNase P, a ribonucleoprotein complex that employs an RNA catalyst for the Mg2+-dependent 5′ maturation of tRNAs. To better understand the assembly and catalysis of archaeal RNase P, we used a site-specific hydroxyl radical-mediated footprinting strategy to pinpoint the binding sites of Pyrococcus furiosus (Pfu) L7Ae on its cognate RNase P RNA (RPR). L7Ae derivatives with single-Cys substitutions at residues in the predicted RNA-binding interface (K42C/C71V, R46C/C71V, V95C/C71V) were modified with an iron complex of EDTA-2-aminoethyl 2-pyridyl disulfide. Upon addition of hydrogen peroxide and ascorbate, these L7Ae-tethered nucleases were expected to cleave the RPR at nucleotides proximal to the EDTA-Fe–modified residues. Indeed, footprinting experiments with an enzyme assembled with the Pfu RPR and five protein cofactors (POP5, RPP21, RPP29, RPP30 and L7Ae–EDTA-Fe) revealed specific RNA cleavages, localizing the binding sites of L7Ae to the RPR's catalytic and specificity domains. These results support the presence of two kink-turns, the structural motifs recognized by L7Ae, in distinct functional domains of the RPR and suggest testable mechanisms by which L7Ae contributes to RNase P catalysis. PMID:25361963
Bevers, Loes E; Hagedoorn, Peter-Leon; Krijger, Gerard C; Hagen, Wilfred R
2006-09-01
A novel tungstate and molybdate binding protein has been discovered from the hyperthermophilic archaeon Pyrococcus furiosus. This tungstate transport protein A (WtpA) is part of a new ABC transporter system selective for tungstate and molybdate. WtpA has very low sequence similarity with the earlier-characterized transport proteins ModA for molybdate and TupA for tungstate. Its structural gene is present in the genome of numerous archaea and some bacteria. The identification of this new tungstate and molybdate binding protein clarifies the mechanism of tungstate and molybdate transport in organisms that lack the known uptake systems associated with the ModA and TupA proteins, like many archaea. The periplasmic protein of this ABC transporter, WtpA (PF0080), was cloned and expressed in Escherichia coli. Using isothermal titration calorimetry, WtpA was observed to bind tungstate (dissociation constant [K(D)] of 17 +/- 7 pM) and molybdate (K(D) of 11 +/- 5 nM) with a stoichiometry of 1.0 mol oxoanion per mole of protein. These low K(D) values indicate that WtpA has a higher affinity for tungstate than do ModA and TupA and an affinity for molybdate similar to that of ModA. A displacement titration of molybdate-saturated WtpA with tungstate showed that the tungstate effectively replaced the molybdate in the binding site of the protein.
ORF Alignment: NC_003413 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ure Analysis Of Pyrococcus Furiosus Cell ... Division Atpase Mind pdb|1G3Q|A Chain A, Crystal ... ... ... Structure Analysis Of Pyrococcus Furiosus Cell Division ... Atpase Mind ... Length = 231 ...
Directory of Open Access Journals (Sweden)
Melissa G. eCastillo-Lizardo
2014-08-01
Full Text Available Replication slippage or slipped-strand mispairing involves the misalignment of DNA strands during the replication of repeated DNA sequences, and can lead to genetic rearrangements such as microsatellite instability. Here, we show that PolB and PolD replicative DNA polymerases from the archaeal model Pyrococcus abyssi (Pab slip in vitro during replication of a single-stranded DNA template carrying a hairpin structure and short direct repeats. We find that this occurs in both their wild-type (exo+ and exonuclease deficient (exo- forms. The slippage behavior of PabPolB and PabPolD, probably due to limited strand displacement activity, resembles that observed for the high fidelity Pyrococcus furiosus (Pfu DNA polymerase. The presence of PabPCNA inhibited PabPolB and PabPolD slippage. We propose a model whereby PabPCNA stimulates strand displacement activity and polymerase progression through the hairpin, thus permitting the error-free replication of repetitive sequences.
Elshawadfy, Ashraf M; Keith, Brian J; Ee Ooi, H'Ng; Kinsman, Thomas; Heslop, Pauline; Connolly, Bernard A
2014-01-01
The polymerase chain reaction (PCR) is widely applied across the biosciences, with archaeal Family-B DNA polymerases being preferred, due to their high thermostability and fidelity. The enzyme from Pyrococcus furiosus (Pfu-Pol) is more frequently used than the similar protein from Thermococcus kodakarensis (Tkod-Pol), despite the latter having better PCR performance. Here the two polymerases have been comprehensively compared, confirming that Tkod-Pol: (1) extends primer-templates more rapidly; (2) has higher processivity; (3) demonstrates superior performance in normal and real time PCR. However, Tkod-Pol is less thermostable than Pfu-Pol and both enzymes have equal fidelities. To understand the favorable properties of Tkod-Pol, hybrid proteins have been prepared. Single, double and triple mutations were used to site arginines, present at the "forked-point" (the junction of the exonuclease and polymerase channels) of Tkod-Pol, at the corresponding locations in Pfu-Pol, slightly improving PCR performance. The Pfu-Pol thumb domain, responsible for double-stranded DNA binding, has been entirely replaced with that from Tkod-Pol, again giving better PCR properties. Combining the "forked-point" and thumb swap mutations resulted in a marked increase in PCR capability, maintenance of high fidelity and retention of the superior thermostability associated with Pfu-Pol. However, even the arginine/thumb swap mutant falls short of Tkod-Pol in PCR, suggesting further improvement within the Pfu-Pol framework is attainable. The significance of this work is the observation that improvements in PCR performance are easily attainable by blending elements from closely related archaeal polymerases, an approach that may, in future, be extended by using more polymerases from these organisms.
Ilari, A.; Fiorillo, A.; Angelaccio, S.; Florio, R.; Chiaraluce, R.; Oost, van der J.; Consalvi, V.
2009-01-01
Bacterial and archaeal endo-beta-1,3-glucanases that belong to glycoside hydrolase family 16 share a beta-jelly-roll fold, but differ significantly in sequence and in substrate specificity. The crystal structure of the laminarinase (EC 3.2.1.39) from the hyperthermophilic archaeon Pyrococcus
Directory of Open Access Journals (Sweden)
Afonnikov Dmitry A
2009-12-01
Full Text Available Abstract Background Prokaryotic microorganisms are able to survive and proliferate in severe environmental conditions. The increasing number of complete sequences of prokaryotic genomes has provided the basis for studying the molecular mechanisms of their adaptation at the genomic level. We apply here a computer-based approach to compare the genomes and proteomes from P. furiosus, P. horikoshii, and P. abyssi to identify features of their molecular evolution related to adaptation strategy to diverse environmental conditions. Results Phylogenetic analysis of rRNA genes from 26 Pyrococcus strains suggested that the divergence of P. furiosus, P. horikoshii and P. abyssi might have occurred from ancestral deep-sea organisms. It was demonstrated that the function of genes that have been subject to positive Darwinian selection is closely related to abiotic and biotic conditions to which archaea managed to become adapted. Divergence of the P. furiosus archaea might have been due to loss of some genes involved in cell motility or signal transduction, and/or to evolution under positive selection of the genes for translation machinery. In the course of P. horikoshii divergence, positive selection was found to operate mainly on the transcription machinery; divergence of P. abyssi was related with positive selection for the genes mainly involved in inorganic ion transport. Analysis of radical amino acid replacement rate in evolving P. furiosus, P. horikoshii and P. abyssi showed that the fixation rate was higher for radical substitutions relative to the volume of amino acid side-chain. Conclusions The current results give due credit to the important role of hydrostatic pressure as a cause of variability in the P. furiosus, P. horikoshii and P. abyssi genomes evolving in different habitats. Nevertheless, adaptation to pressure does not appear to be the sole factor ensuring adaptation to environment. For example, at the stage of the divergence of P
International Nuclear Information System (INIS)
Matias, Pedro M.; Tatur, Jana; Carrondo, Maria Arménia; Hagen, Wilfred R.
2005-01-01
Ferritin from P. furiosus crystallizes in space group C222 1 , with unit-cell parameters a = 258.1, b = 340.1, c = 266.5 Å and 36 monomers in the asymmetric unit, corresponding to one and a half 24-mers. Crystals of the title protein have been produced and preliminary structural analysis has been carried out. The crystals belong to the orthorhombic space group C222 1 , with unit-cell parameters a = 258.1, b = 340.1, c = 266.5 Å. The protein forms a 24-mer of 20 kDa subunits, which assemble with 432 non-crystallographic symmetry. A total of 36 monomers are found in the asymmetric unit, corresponding to one and a half 24-mers
Directory of Open Access Journals (Sweden)
Pascal F Egea
Full Text Available In all organisms the Signal Recognition Particle (SRP, binds to signal sequences of proteins destined for secretion or membrane insertion as they emerge from translating ribosomes. In Archaea and Eucarya, the conserved ribonucleoproteic core is composed of two proteins, the accessory protein SRP19, the essential GTPase SRP54, and an evolutionarily conserved and essential SRP RNA. Through the GTP-dependent interaction between the SRP and its cognate receptor SR, ribosomes harboring nascent polypeptidic chains destined for secretion are dynamically transferred to the protein translocation apparatus at the membrane. We present here high-resolution X-ray structures of SRP54 and SRP19, the two RNA binding components forming the core of the signal recognition particle from the hyper-thermophilic archaeon Pyrococcus furiosus (Pfu. The 2.5 A resolution structure of free Pfu-SRP54 is the first showing the complete domain organization of a GDP bound full-length SRP54 subunit. In its ras-like GTPase domain, GDP is found tightly associated with the protein. The flexible linker that separates the GTPase core from the hydrophobic signal sequence binding M domain, adopts a purely alpha-helical structure and acts as an articulated arm allowing the M domain to explore multiple regions as it scans for signal peptides as they emerge from the ribosomal tunnel. This linker is structurally coupled to the GTPase catalytic site and likely to propagate conformational changes occurring in the M domain through the SRP RNA upon signal sequence binding. Two different 1.8 A resolution crystal structures of free Pfu-SRP19 reveal a compact, rigid and well-folded protein even in absence of its obligate SRP RNA partner. Comparison with other SRP19*SRP RNA structures suggests the rearrangement of a disordered loop upon binding with the RNA through a reciprocal induced-fit mechanism and supports the idea that SRP19 acts as a molecular scaffold and a chaperone, assisting the SRP
ORF Alignment: NC_003413 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein ... [Pyrococcus furiosus DSM 3638] ... Length = 233 ... Query: 63 ... LMKISDLYPGMDPHEVNIVGRIL...KKYPPREYTKKDGSIGRVASLVIYDDTGRARVVLWDS 122 ... LMKISDLYPGMDPHEVNIVGRILKKYPP...REYTKKDGSIGRVASLVIYDDTGRARVVLWDS Sbjct: 1 ... LMKISDLYPGMDPHEVNIVGRILKKYPPREYTKKDGSIGRVASLVIYDDTGRARVVLWDS 60
Bruins, M.E.; Hellemond, van E.W.; Janssen, A.E.M.; Boom, R.M.
2003-01-01
The thermostable Pyrococcus furiosus beta-glycosidase was used for oligosaccharide production from lactose in a kinetically controlled reaction. Our experiments showed that higher temperatures are beneficial for the absolute as well as relative oligosaccharide yield. However, at reaction
Stabilization of enzymes against thermal stress and freeze-drying by mannosylglycerate
Ramos, A.; Raven, N.; Sharp, R.J.; Bartolucci, S.; Rossi, M.; Cannio, R.; Lebbink, J.; Oost, van der J.; Vos, de W.M.; Santos, H.
1997-01-01
2-O-(beta)-Mannosylglycerate, a solute that accumulates in some (hyper)thermophilic organisms, was purified from Pyrococcus furiosus cells, and its effect on enzyme stabilization in vitro was assessed. Enzymes from hyperthermophilic, thermophilic, and mesophilic sources were examined. The
Machielsen, M.P.; Uria, A.R.; Kengen, S.W.M.; Oost, van der J.
2006-01-01
The gene encoding a novel alcohol dehydrogenase that belongs to the aldo-keto reductase superfamily has been identified in the hyperthermophilic archaeon Pyrococcus furiosus. The gene, referred to as adhD, was functionally expressed in Escherichia coli and subsequently purified to homogeneity. The
RNAi: prokaryotes get in on the act
Oost, van der J.; Brouns, S.J.J.
2009-01-01
The small CRISPR-derived RNAs of bacteria and archaea provide adaptive immunity by targeting the DNA of invading viruses and plasmids. Hale et al. (2009) now report on a new variant CRISPR/Cas complex in the archaeon Pyrococcus furiosus that uses guide RNAs to specifically target and cleave RNA not
Molecular characterization of glycolysis in Pyrococcus furiosus
Verhees, C.H.
2002-01-01
In the last few decades microorganisms have been isolated from rather unknown and hostile locations, such as those with high salt concentrations, an extreme pH, or low or high temperatures. Microorganisms isolated from these environments are referred to as extremophiles (1). The most
Domain motions of Argonaute, the catalytic engine of RNA interference
Directory of Open Access Journals (Sweden)
Wall Michael E
2007-11-01
Full Text Available Abstract Background The Argonaute protein is the core component of the RNA-induced silencing complex, playing the central role of cleaving the mRNA target. Visual inspection of static crystal structures already has enabled researchers to suggest conformational changes of Argonaute that might occur during RNA interference. We have taken the next step by performing an all-atom normal mode analysis of the Pyrococcus furiosus and Aquifex aeolicus Argonaute crystal structures, allowing us to quantitatively assess the feasibility of these conformational changes. To perform the analysis, we begin with the energy-minimized X-ray structures. Normal modes are then calculated using an all-atom molecular mechanics force field. Results The analysis reveals low-frequency vibrations that facilitate the accommodation of RNA duplexes – an essential step in target recognition. The Pyrococcus furiosus and Aquifex aeolicus Argonaute proteins both exhibit low-frequency torsion and hinge motions; however, differences in the overall architecture of the proteins cause the detailed dynamics to be significantly different. Conclusion Overall, low-frequency vibrations of Argonaute are consistent with mechanisms within the current reaction cycle model for RNA interference.
2015-12-23
Molecular Recognition Element For Use in Sensor Applications Report Title The overall goal of the project was to evolve a highly thermostable enzyme ( alcohol ...SECURITY CLASSIFICATION OF: The overall goal of the project was to evolve a highly thermostable enzyme ( alcohol dehydrogenase D (AdhD) from Pyrococcus...furiosus) to bind an explosive molecule, RDX. The enzyme naturally catalyzes the nicotinamide cofactor-dependent oxidation or reduction of alcohols
Oxidative desulfurization of tire pyrolysis oil
Directory of Open Access Journals (Sweden)
Ahmad Shahzad
2016-01-01
Full Text Available This paper presents a low cost method for the purification of oils obtained from the pyrolysis of used tires. Oxidative desulfurization is a promising route for purification of tire pyrolysis oils as hydro-desulfurization may not be affordable for small scale industries. Different additives and acids have been employed for the enhancement of properties of pyrolytic oils. The experimental conditions were kept identical throughout, i.e. atmospheric pressure and 50°C temperature for comparison of performance of various additives. The use of hydrogen peroxide-acetic acid mixture (10 wt.% was found more economical and effective in desulfurization and improvement of fuel properties of sample oils. The contribution of sulfuric acid in desulfurization and decreasing viscosity was also satisfactory but due to high price of concentrated sulfuric acid its use may not be economical. Calcium oxide and Fuller’s earth was not found to be effective in desulfurization. Results indicate that oxidative desulfurization could render tire pyrolysis oils suitable for blending as heating fuel.
Rare earth oxides in gaseous desulfurization
International Nuclear Information System (INIS)
Kay, D.A.R.; Wilson, W.G.
1988-01-01
Phase stability diagrams are used to predict the abilities of lanthanum and cerium oxides to desulfurize coal gasification products in the temperature range 800-1000 C. Results of desulfurization studies in laboratory fixed bed reactors illustrate the effects of sorbent preparation, input gas quality and temperature, on the desulfurization reaction: 2CeO( 2 - x )(s) + H 2 S(g) + (1-2x)H 2 = Ce 2 O 2 S(s) + 2(1 - x)H 2 O(g). The results of desulfurization/oxidation regeneration cycles are also reported
Cell architecture and flagella of hyperthermophilic Archaea
Bellack, Annett
2011-01-01
Earlier studies indicated that flagella might play a crucial role in motility, adhesion, and cell-cell contacts of Archaea. Thus, the ultrastructural and functional characterization of flagella and their anchoring in the cell are crucial for understanding the archaeal cell organization in general. To address this topic, Pyrococcus furiosus was chosen as a suitable model organism. However, in the course of this study, morphological changes of this strain, cultured continuously for several y...
White, James R; Escobar-Paramo, Patricia; Mongodin, Emmanuel F; Nelson, Karen E; DiRuggiero, Jocelyne
2008-10-01
The extent of chromosome rearrangements in Pyrococcus isolates from marine hydrothermal vents in Vulcano Island, Italy, was evaluated by high-throughput genomic methods. The results illustrate the dynamic nature of the genomes of the genus Pyrococcus and raise the possibility of a connection between rapidly changing environmental conditions and adaptive genomic properties.
Enhanced production of subtilisin of Pyrococcus furiosus expressed ...
African Journals Online (AJOL)
PRECIOUS
2009-11-02
Nov 2, 2009 ... on SDS-PAGE as compared to theoretical molecular mass of 17.6 kDa. This aberrant electrophoresis mobility could be .... analyze protein expression by 12% SDS-PAGE (Laemmli, 1970). To analyze the expression of .... pellet washed with buffer containing Triton X; lane 4, refolded subtilisin. subjected to ...
Identification of a mismatch-specific endonuclease in hyperthermophilic Archaea
Ishino, Sonoko; Nishi, Yuki; Oda, Soichiro; Uemori, Takashi; Sagara, Takehiro; Takatsu, Nariaki; Yamagami, Takeshi; Shirai, Tsuyoshi; Ishino, Yoshizumi
2016-01-01
The common mismatch repair system processed by MutS and MutL and their homologs was identified in Bacteria and Eukarya. However, no evidence of a functional MutS/L homolog has been reported for archaeal organisms, and it is not known whether the mismatch repair system is conserved in Archaea. Here, we describe an endonuclease that cleaves double-stranded DNA containing a mismatched base pair, from the hyperthermophilic archaeon Pyrococcus furiosus. The corresponding gene revealed that the act...
The catalytic potency of ß-glucosidase from Pyroccus furiosus in the direct glucosylation reaction
Roode, de B.M.; Meer, van der T.D.; Kaper, T.; Franssen, M.C.R.; Padt, van der A.; Oost, van der J.; Boom, R.M.
2001-01-01
Enzymes from extremophiles operate at conditions that are different from their `normal' counterparts, and are therefore a useful extension of the enzyme toolbox. In this paper, the direct glucosylation reaction mediated by a hyperthermophilic -glucosidase from Pyrocuccus furiosus was investigated.
High hydrostatic pressure adaptive strategies in an obligate piezophile Pyrococcus yayanosii
Michoud, Gregoire; Jebbar, Mohamed
2016-01-01
Pyrococcus yayanosii CH1, as the first and only obligate piezophilic hyperthermophilic microorganism discovered to date, extends the physical and chemical limits of life on Earth. It was isolated from the Ashadze hydrothermal vent at 4,100 m depth. Multi-omics analyses were performed to study the mechanisms used by the cell to cope with high hydrostatic pressure variations. In silico analyses showed that the P. yayanosii genome is highly adapted to its harsh environment, with a loss of aromatic amino acid biosynthesis pathways and the high constitutive expression of the energy metabolism compared with other non-obligate piezophilic Pyrococcus species. Differential proteomics and transcriptomics analyses identified key hydrostatic pressure-responsive genes involved in translation, chemotaxis, energy metabolism (hydrogenases and formate metabolism) and Clustered Regularly Interspaced Short Palindromic Repeats sequences associated with Cellular apoptosis susceptibility proteins.
High hydrostatic pressure adaptive strategies in an obligate piezophile Pyrococcus yayanosii
Michoud, Gregoire
2016-06-02
Pyrococcus yayanosii CH1, as the first and only obligate piezophilic hyperthermophilic microorganism discovered to date, extends the physical and chemical limits of life on Earth. It was isolated from the Ashadze hydrothermal vent at 4,100 m depth. Multi-omics analyses were performed to study the mechanisms used by the cell to cope with high hydrostatic pressure variations. In silico analyses showed that the P. yayanosii genome is highly adapted to its harsh environment, with a loss of aromatic amino acid biosynthesis pathways and the high constitutive expression of the energy metabolism compared with other non-obligate piezophilic Pyrococcus species. Differential proteomics and transcriptomics analyses identified key hydrostatic pressure-responsive genes involved in translation, chemotaxis, energy metabolism (hydrogenases and formate metabolism) and Clustered Regularly Interspaced Short Palindromic Repeats sequences associated with Cellular apoptosis susceptibility proteins.
High hydrostatic pressure adaptive strategies in an obligate piezophile Pyrococcus yayanosii
Michoud, Grégoire; Jebbar, Mohamed
2016-01-01
Pyrococcus yayanosii CH1, as the first and only obligate piezophilic hyperthermophilic microorganism discovered to date, extends the physical and chemical limits of life on Earth. It was isolated from the Ashadze hydrothermal vent at 4,100 m depth. Multi-omics analyses were performed to study the mechanisms used by the cell to cope with high hydrostatic pressure variations. In silico analyses showed that the P. yayanosii genome is highly adapted to its harsh environment, with a loss of aromatic amino acid biosynthesis pathways and the high constitutive expression of the energy metabolism compared with other non-obligate piezophilic Pyrococcus species. Differential proteomics and transcriptomics analyses identified key hydrostatic pressure-responsive genes involved in translation, chemotaxis, energy metabolism (hydrogenases and formate metabolism) and Clustered Regularly Interspaced Short Palindromic Repeats sequences associated with Cellular apoptosis susceptibility proteins. PMID:27250364
White, James R.; Escobar-Paramo, Patricia; Mongodin, Emmanuel F.; Nelson, Karen E.; DiRuggiero, Jocelyne
2008-01-01
The extent of chromosome rearrangements in Pyrococcus isolates from marine hydrothermal vents in Vulcano Island, Italy, was evaluated by high-throughput genomic methods. The results illustrate the dynamic nature of the genomes of the genus Pyrococcus and raise the possibility of a connection between rapidly changing environmental conditions and adaptive genomic properties. PMID:18723649
Novel Methods for Desulfurization of Fuel Oils
H. Hosseini
2012-01-01
Because of the requirement for low sulfur content of fuel oils, it is necessary to develop alternative methods for desulfurization of heavy fuel oil. Due to the disadvantages of HDS technologies such as costs, safety and green environment, new methods have been developed. Among these methods is ultrasoundassisted oxidative desulfurization. Using ultrasound-assisted oxidative desulfurization, compounds such as benzothiophene and dibenzothiophene can be oxidized. As an alterna...
Desulfurization of Jordanian oil shale
International Nuclear Information System (INIS)
Abu-Jdayil, B. M.
1990-01-01
Oxy desulfurization process and caustic treatment were applied in this work to remove sulfur from Jordanian oil shale. The oxy desulfurization process has been studied in a batch process using a high pressure autoclave, with constant stirring speed, and oxygen and water were used as desulfurizing reagents. Temperature, oxygen pressure, batch time, and particle size were found to be important process variables, while solid/liquid ratio was found to have no significant effect on the desulfurization process. The response of different types of oil shale to this process varied, and the effect of the process variables on the removal of total sulfur, pyritic sulfur, organic sulfur, total carbon, and organic carbon were studied. An optimum condition for oxy desulfurization of El-Lajjun oil shale, which gave maximum sulfur removal with low loss of carbon, was determined from the results of this work. The continuous reaction model was found to be valid, and the rate of oxidation for El-Lajjun oil shale was of the first order with respect to total sulfur, organic sulfur, total carbon, and organic carbon. For pyritic sulfur oxidation, the shrinking core model was found to hold and the rate of reaction controlled by diffusion through product ash layer. An activation energy of total sulfur, organic sulfur, pyritic sulfur, total carbon, and organic carbon oxidation was calculated for the temperature range of 130 -190 degrees celsius. In caustic treatment process, aqueous sodium hydroxide at 160 degrees celsius was used to remove the sulfur from El-Lajjun oil shale. The variables tested (sodium hydroxide concentration and treatment time) were found to have a significant effect. The carbon losses in this process were less than in the oxy desulfurization process. 51 refs., 64 figs., 121 tabs. (A.M.H.)
Magnesite base desulfurizer of metallurgical physical chemistry research
Directory of Open Access Journals (Sweden)
G. D. Liu
2017-01-01
Full Text Available This topic put carbon thermal vacuum method in combination with magnesium based desulfurization technology with magnesite reduction of magnesium vapor directly on hot metal desulphurization. This is a new type of desulfurization technology, the retrieval related literature at home and abroad was not reported in the recent ten years, according to the relationship between heat of desulfurizer preparation MgO style content can reach 50 %.It was found that the desulfurizer sample with 50 % MgO content was in accordance with the requirements, without adding flux, but its viscosity did not meet the requirements; adding 1 % flux (CaF2, the sample viscosity was significantly reduced, and about 1 400 °C sample viscosity suitable for hot metal pretreatment desulfurization.
Biocatalytic desulfurization of petroleum and middle distillates
International Nuclear Information System (INIS)
Monticello, D.J.
1993-01-01
Biocatalytic Desulfurization (BDS) represents an alternative approach to the reduction of sulfur in fossil fuels. The objective is to use bacteria to selectively remove sulfur from petroleum and middle distillate fractions, without the concomitant release of carbon. Recently, bacteria have been developed which have the ability to desulfurize dibenzothiophene (DBT) and other organosulfur molecules. These bacteria are being developed for use in a biocatalyst-based desulfurization process. Analysis of preliminary conceptual engineering designs has shown that this process has the potential to complement conventional technology as a method to temper the sulfur levels in crude oil, or remove the recalcitrant sulfur in middle distillates to achieve the deep desulfurization mandated by State and Federal regulations. This paper describes the results of initial feasibility studies, sensitivity analyses and conceptual design work. Feasibility studies with various crude oils and middle distillates achieved unoptimized desulfurization levels of 40-80%. Sensitivity analyses indicate that total desulfurization costs of about $3.00 per barrel for crude oil and less than $2.00 per barrel for diesel are possible. Key criteria for commercial success of the process include the cost and half-life of the biocatalyst, residence time in the reactor, oil/water ratios required to extract the sulfur and the disposition of the separated sulfur products. 9 refs., 3 figs
Desulfurization performance of azole-based ionic liquids
Directory of Open Access Journals (Sweden)
Liubei CHENG
2017-10-01
Full Text Available In order to study the addition of functional groups in ionic liquid anion and cation to achieve better absorbing of SO2, the 1,1,3,3-tetramethylguanidine triazole ( is synthesized using 1,1,3,3-tetramethylguanidine and triazole as raw materials. The desulfurization performance of the synthesized is systematically studied. The desulfurization performance and desulfurization mechanism of the are discussed. The results show that the has good performance of desulfurization and regeneration. At the atmospheric pressure, 1 mol of the absorbs 2.964 mol of SO2 at 20 ℃. With the increase of temperature, the desulfurization capacity of the decreases gradually. The molar absorption ratio increases with the increase of SO2 partial pressure, and under the conditions of 130 ℃, the desorption rate of the ionic liquid after saturated adsorption reaches over 95%. The mechanism investigation results show that the interaction of SO2 and is the combination of chemical absorption and physical absorption. The results have a certain reference value to improve the efficiency of flue gas treatment.
Method of treating final products from flue gas desulfurization
International Nuclear Information System (INIS)
Bloss, W.; Mohn, U.
1984-01-01
A method of treating final products from a flue gas desulfurization. The flue gas desulfurization is carried out by the absorption of sulfur oxide in a spray dryer with a suspension which contains lime, or in a reactor with a dry, fine-grained, absorbent which contains lime. Prior to desulfurization, the fly ash carried along by the flue gas which is to be desulfurized is separated entirely, partially, or not at all from the flue gas, and the final products from the flue gas desulfurization, prior to any further treatment thereof, amount to 1-99% by weight, preferably 1-70% by weight, of fly ash, and 1-99% by weight, preferably 30-99% by weight, of the sum of the desulfurization products, preferably calcium sulfite hemihydrate, and/or calcium sulfite, and/or calcium sulfate dyhydrate, and/or calcium sulfate hemihydrate, and/or calcium sulfate, as well as residue of the absorbent. The reduction of the amount of calcium sulfite is implemented by a dry oxidation with air
Review of desulfurization process for biogas purification
Xiao, Cong; Ma, Yunqian; Ji, Dandan; Zang, Lihua
2017-12-01
Hydrogen sulfide (H2S) is a toxic and odorous compound present in biogas produced by the anaerobic digestion of biosolids and other organic materials. Elimination of H2S is necessary as it is extremely hazardous to human health, poisonous to process catalysts and corrosive to equipment. The desulfurization technology is an important part for efficient utilization of biogas. In this paper, the traditional wet and dry desulfurization technology for biogas was reviewed, and the new research progress of biological desulfurization technologies are also introduced.
In vitro hydrogen production by glucose dehydrogenase and hydrogenase
Energy Technology Data Exchange (ETDEWEB)
Woodward, J. [Oak Ridge National Lab., TN (United States)
1996-10-01
A new in vitro enzymatic pathway for the generation of molecular hydrogen from glucose has been demonstrated. The reaction is based upon the oxidation of glucose by Thermoplasma acidophilum glucose dehydrogenase with the concomitant oxidation of NADPH by Pyrococcus furiosus hydrogenase. Stoichiometric yields of hydrogen were produced from glucose with continuous cofactor recycle. This simple system may provide a method for the biological production of hydrogen from renewable sources. In addition, the other product of this reaction, gluconic acid, is a high-value commodity chemical.
Boosting the IGCLC process efficiency by optimizing the desulfurization step
International Nuclear Information System (INIS)
Hamers, H.P.; Romano, M.C.; Spallina, V.; Chiesa, P.; Gallucci, F.; Sint Annaland, M. van
2015-01-01
Highlights: • Pre-CLC hot gas desulfurization and post-CLC desulfurization are assessed. • Process efficiency increases by 0.5–1% points with alternative desulfurization methods. • Alternative desulfurization methods are more beneficial for CFB configurations. - Abstract: In this paper the influence of the desulfurization method on the process efficiency of an integrated gasification chemical-looping combustion (IGCLC) systems is investigated for both packed beds and circulating fluidized bed CLC systems. Both reactor types have been integrated in an IGCLC power plant, in which three desulfurization methods have been compared: conventional cold gas desulfurization with Selexol (CGD), hot gas desulfurization with ZnO (HGD) and flue gas desulfurization after the CLC reactors (post-CLC). For CLC with packed bed reactors, the efficiency gain of the alternative desulfurization methods is about 0.5–0.7% points. This is relatively small, because of the relatively large amount of steam that has to be mixed with the fuel to avoid carbon deposition on the oxygen carrier. The HGD and post-CLC configurations do not contain a saturator and therefore more steam has to be mixed with a negative influence on the process efficiency. Carbon deposition is not an issue for circulating fluidized bed systems and therefore a somewhat higher efficiency gain of 0.8–1.0% point can be reached for this reactor system, assuming that complete fuel conversion can be reached and no sulfur species are formed on the solid, which is however thermodynamically possible for iron and manganese based oxygen carriers. From this study, it can be concluded that the adaptation of the desulfurization method results in higher process efficiencies, especially for the circulating fluidized bed system, while the number of operating units is reduced.
Oxidative desulfurization of fuel oil by pyridinium-based ionic liquids.
Zhao, Dishun; Wang, Yanan; Duan, Erhong
2009-10-28
In this work, an N-butyl-pyridinium-based ionic liquid [BPy]BF(4) was prepared. The effect of extraction desulfurization on model oil with thiophene and dibenzothiophene (DBT) was investigated. Ionic liquids and hydrogen peroxide (30%) were tested in extraction-oxidation desulfurization of model oil. The results show that the ionic liquid [BPy]BF(4) has a better desulfurization effect. The best technological conditions are: V(IL)/V(Oil) /V(H(2)O(2)) = 1:1:0.4, temperature 55 degrees C, the time 30 min. The ratio of desulfurization to thiophene and DBT reached 78.5% and 84.3% respectively, which is much higher than extraction desulfurization with simple ionic liquids. Under these conditions, the effect of desulfurization on gasoline was also investigated. The used ionic liquids can be recycled up to four times after regeneration.
Oxidative Desulfurization of Fuel Oil by Pyridinium-Based Ionic Liquids
Directory of Open Access Journals (Sweden)
Erhong Duan
2009-10-01
Full Text Available In this work, an N-butyl-pyridinium-based ionic liquid [BPy]BF4 was prepared. The effect of extraction desulfurization on model oil with thiophene and dibenzothiophene (DBT was investigated. Ionic liquids and hydrogen peroxide (30% were tested in extraction-oxidation desulfurization of model oil. The results show that the ionic liquid [BPy]BF4 has a better desulfurization effect. The best technological conditions are: V(IL/V(Oil /V(H2O2 = 1:1:0.4, temperature 55 °C, the time 30 min. The ratio of desulfurization to thiophene and DBT reached 78.5% and 84.3% respectively, which is much higher than extraction desulfurization with simple ionic liquids. Under these conditions, the effect of desulfurization on gasoline was also investigated. The used ionic liquids can be recycled up to four times after regeneration.
Desulfurization of AL-Ahdab Crude Oil using Oxidative Processes
Directory of Open Access Journals (Sweden)
Neran Khalel Ibrahim
2015-07-01
Full Text Available Two different oxidative desulfurization strategies based on oxidation/adsorption or oxidation/extraction were evaluated for the desulfurization of AL-Ahdab (AHD sour crude oil (3.9wt% sulfur content. In the oxidation process, a homogenous oxidizing agent comprising of hydrogen peroxide and formic acid was used. Activated carbons were used as sorbent/catalyst in the oxidation/adsorption process while acetonitrile was used as an extraction solvent in the oxidation/extraction process. For the oxidation/adsorption scheme, the experimental results indicated that the oxidation desulfurization efficiency was enhanced on using activated carbon as catalyst/sorbent. The effects of the operating conditions (contact time, temperature, mixing speed and sorbent dose on the desulfurization efficiency were examined. The desulfurization efficiency measured at the best operating conditions(optimum conditions: 60 , 500rpm, 60min contact time and sorbent dose of 0.7g AC/100 ml AHD crude, was 32.8% corresponding to a sulfur content of 2.6 wt%. Applying the same optimum operating conditions and at 3:1 solvent/oil ratio, the oxidation/extraction method gave comparable desulfurization efficiency of 31.5%.
Oxidative desulfurization of tire pyrolysis oil
Ahmad Shahzad; Ahmad Muhammad Imran; Naeem Khawar; Humayun Muhammad; Sebt-E-Zaeem; Faheem Farrukh
2016-01-01
This paper presents a low cost method for the purification of oils obtained from the pyrolysis of used tires. Oxidative desulfurization is a promising route for purification of tire pyrolysis oils as hydro-desulfurization may not be affordable for small scale industries. Different additives and acids have been employed for the enhancement of properties of pyrolytic oils. The experimental conditions were kept identical throughout, i.e. atmospheric pressure a...
Ultrasound-Assisted Oxidative Desulfurization of Diesel
Niran K. Ibrahim; Walla A. Noori; Jaffar M. Khasbag
2016-01-01
Due to the dramatic environmental impact of sulfur emissions associated with the exhaust of diesel engines, last environmental regulations for ultra-low-sulfur diesel require a very deep desulfurization (up to 15 ppm), which cannot be met by the conventional hydrodesulfurization units alone. The proposed method involves a batch ultrasound-assisted oxidative desulfurization (UAODS) of a previously hydrotreated diesel (containing 480 ppm sulfur) so as to convert the residual sulfur-bearing comp...
Structure of PIN-domain protein PH0500 from Pyrococcus horikoshii
International Nuclear Information System (INIS)
Jeyakanthan, Jeyaraman; Inagaki, Eiji; Kuroishi, Chizu; Tahirov, Tahir H.
2005-01-01
The structure of P. horikoshii OT3 protein PH0500 was determined by the multiple anomalous dispersion method and refined in two crystal forms. The protein is a dimer and has a PIN-domain fold. The Pyrococcus horikoshii OT3 protein PH0500 is highly conserved within the Pyrococcus genus of hyperthermophilic archaea and shows low amino-acid sequence similarity with a family of PIN-domain proteins. The protein has been expressed, purified and crystallized in two crystal forms: PH0500-I and PH0500-II. The structure was determined at 2.0 Å by the multiple anomalous dispersion method using a selenomethionyl derivative of crystal form PH0500-I (PH0500-I-Se). The structure of PH0500-I has been refined at 1.75 Å resolution to an R factor of 20.9% and the structure of PH0500-II has been refined at 2.0 Å resolution to an R factor of 23.4%. In both crystal forms as well as in solution the molecule appears to be a dimer. Searches of the databases for protein-fold similarities confirmed that the PH0500 protein is a PIN-domain protein with possible exonuclease activity and involvement in DNA or RNA editing
Liquefaction and desulfurization of coal using synthesis gas
Fu, Yuan C.
1977-03-08
A process for desulfurizing and liquefying coal by heating said coal at a temperature of 375.degree.-475.degree. C in the presence of a slurry liquid, hydrogen, carbon monoxide, steam, and a catalyst comprising a desulfurization catalyst and an alkali metal salt.
International Nuclear Information System (INIS)
Sun, Zhongwei; Wang, Shengwei; Zhou, Qulan; Hui, Shi'en
2010-01-01
This paper presents a new liquid-screen gas-liquid two-phase flow pattern with discarded carbide slag as the liquid sorbent of sulfur dioxide (SO 2 ) in a wet flue gas desulfurization (WFGD) system. On the basis of experimental data, the correlations of the desulfurization efficiency with flue gas flow rate, slurry flow rate, pH value of slurry and liquid-gas ratio were investigated. A non-dimensional empirical model was developed which correlates the mass transfer coefficient with the liquid Reynolds number, gas Reynolds number and liquid-gas ratio (L/G) based on the available experimental data. The kinetic reaction between the SO 2 and the carbide slag depends on the pressure distribution in this desulfurizing tower, gas liquid flow field, flue gas component, pH value of slurry and liquid-gas ratio mainly. The transient gas-liquid mass transfer involving with chemical reaction was quantified by measuring the inlet and outlet SO 2 concentrations of flue gas as well as the characteristics of the liquid-screen two-phase flow. The mass transfer model provides a necessary quantitative understanding of the hydration kinetics of sulfur dioxide in the liquid-screen flue gas desulfurization system using discarded carbide slag which is essential for the practical application. (author)
Mechanism of protein splicing of the Pyrococcus abyssi lon protease intein
International Nuclear Information System (INIS)
O'Brien, Kevin M.; Schufreider, Ann K.; McGill, Melissa A.; O'Brien, Kathryn M.; Reitter, Julie N.; Mills, Kenneth V.
2010-01-01
Research highlights: → The Pyrococcus abyssi lon protease intein promotes efficient protein splicing. → Inteins with mutations that interfere with individual steps of splicing do not promote unproductive side reactions. → The intein splices with Lys in place of the highly conserved penultimate His. → The intein is flanked by a Gly-rich region at its C terminus that may increase the efficiency of the third step of splicing, Asn cyclization coupled to peptide bond cleavage. -- Abstract: Protein splicing is a post-translational process by which an intervening polypeptide, the intein, excises itself from the flanking polypeptides, the exteins, coupled to ligation of the exteins. The lon protease of Pyrococcus abyssi (Pab) is interrupted by an intein. When over-expressed as a fusion protein in Escherichia coli, the Pab lon protease intein can promote efficient protein splicing. Mutations that block individual steps of splicing generally do not lead to unproductive side reactions, suggesting that the intein tightly coordinates the splicing process. The intein can splice, although it has Lys in place of the highly conserved penultimate His, and mutants of the intein in the C-terminal region lead to the accumulation of stable branched-ester intermediate.
Application of wasted sea-shell to desulfurizer in fluidized bed coal combustion
Energy Technology Data Exchange (ETDEWEB)
Naruse, Ichiro; Saito, Katsuhiro; Murakami, Takahiro
1999-07-01
Almost all wasted seashells consist of CaCo{sub 3}, and are similar to limestone. It would be proposed that the seashell could be applied as a desulfurizer. In this study, desulfurization characteristics of the seashell are fundamentally studied by using a thermobalance and a bubbling fluidized coal combustor with comparing the results obtained by limestone as a reference. Under the constant calcination temperature, the desulfurization efficiency for the seashells attains more than about 70% after the desulfurization period of 30 h. For the limestones, on the other hand, the desulfurization efficiency becomes only 38%. Under practical conditions of fluidized bed coal combustion, the desulfurization efficiency for the seashells also indicates higher value than that for the limestones. The desulfurization efficiency depends on the pore size distribution of CaO rather than its specific surface area. The mean pore size of the calcined seashell is about 10 times as large as that of the calcined limestones. from Scanning Electro-Microscope (SEM) photos of the surface of CaCO{sub 3}, CaO and the sulfurized particles of the seashells the large pores can be observed. In measuring cross-sectional distribution of sulfur inside the particles by using an Energy Dispersed X-ray (EDX) system, the sulfur in the sulfurized particle of limestone is only trapped near the particle surface. For the seashells, whereas, the sulfur is distributed over the whole body of particle. Desulfurization efficiency for the limestone, into which some alkali metal compounds are added, increases with increasing the concentration of alkali metal compounds added. In order of increasing effect the key elemental species to enhance the desulfurization activities are Cl, Na and K. Alkali metal compounds can enhance the desulfurization activities, due to solution of CaO in molten NaCl. This is one of the reasons why the desulfurization efficiency for the seashells improves.
Enzymatic desulfurization of coal
Energy Technology Data Exchange (ETDEWEB)
Boyer, Y.N.; Crooker, S.C.; Kitchell, J.P.; Nochur, S.V.
1991-05-16
The overall objective of this program was to investigate the feasibility of an enzymatic desulfurization process specifically intended for organic sulfur removal from coal. Toward that end, a series of specific objectives were defined: (1) establish the feasibility of (bio)oxidative pretreatment followed by biochemical sulfate cleavage for representative sulfur-containing model compounds and coals using commercially-available enzymes; (2) investigate the potential for the isolation and selective use of enzyme preparations from coal-utilizing microbial systems for desulfurization of sulfur-containing model compounds and coals; and (3) develop a conceptual design and economic analysis of a process for enzymatic removal of organic sulfur from coal. Within the scope of this program, it was proposed to carry out a portion of each of these efforts concurrently. (VC)
Desulfurization of organic sulfur from lignite by an electron transfer process
Energy Technology Data Exchange (ETDEWEB)
Demirbas, A. [Selcuk University, Konya (Turkey). Dept. for Chemical Engineering
2006-10-15
This study is an attempt to desulfurize organic sulfur from lignite samples with ferrocyanide ion as the electron transferring agent. Effect of temperature, particle size and concentration of ferrocyanide ion on desulfurization from the lignite samples has been investigated. The desulfurization process has been found to be continuous and gradually increases with increase of temperature from 298 to 368 K. The particle size has no significant impact on sulfur removal from the lignite samples. Particle size has no profound impact on the amount of sulfur removal. The desulfurization reaction has been found to be dependent on the concentration of potassium ferrocyanide. Gradual increase in the concentration of potassium ferrocyanide raised the magnitude of desulfurization, but at a higher concentration, the variation is not significant.
Huma, Tayyaba; Maryam, Arooma; Rehman, Shahid Ur; Qamar, Muhammad Tahir Ul; Shaheen, Tayyaba; Haque, Asma; Shaheen, Bushra
2014-01-01
Alpha amylase family is generally defined as a group of enzymes that can hydrolyse and transglycosylase α-(1, 4) or α-(1, 6) glycosidic bonds along with the preservation of anomeric configuration. For the comparative analysis of alpha amylase family, nucleotide sequences of seven thermo stable organisms of Kingdom Archea i.e. Pyrococcus furiosus (100-105°C), Kingdom Prokaryotes i.e. Bacillus licheniformis (90-95°C), Geobacillus stearothermophilus (75°C), Bacillus amyloliquefaciens (72°C), Bacillus subtilis (70°C) and Bacillus KSM K38 (55°C) and Eukaryotes i.e. Aspergillus oryzae (60°C) were selected from NCBI. Primary structure composition analysis and Conserved sequence analysis were conducted through Bio Edit tools. Results from BioEdit shown only three conserved regions of base pairs and least similarity in MSA of the above mentioned alpha amylases. In Mega 5.1 Phylogeny of thermo stable alpha amylases of Kingdom Archea, Prokaryotes and Eukaryote was handled by Neighbor-Joining (NJ) algorithm. Mega 5.1 phylogenetic results suggested that alpha amylases of thermo stable organisms i.e. Pyrococcus furiosus (100-105°C), Bacillus licheniformis (90-95°C), Geobacillus stearothermophilus (75°C) and Bacillus amyloliquefaciens (72°C) are more distantly related as compared to less thermo stable organisms. By keeping in mind the characteristics of most thermo stable alpha amylases novel and improved features can be introduced in less thermo stable alpha amylases so that they become more thermo tolerant and productive for industry.
ABB wet flue gas desulfurization
Energy Technology Data Exchange (ETDEWEB)
Niijhawan, P.
1994-12-31
The wet limestone process for flue gas desulfurization (FGD) is outlined. The following topics are discussed: wet flue gas desulfurization, wet FGD characteristics, wet scrubbers, ABB wet FGD experience, wet FGD forced oxidation, advanced limestone FGD systems, key design elements, open spray tower design, spray tower vs. packed tower, important performance parameters, SO{sub 2} removal efficiency, influence by L/G, limestone utilization, wet FGD commercial database, particulate removal efficiencies, materials of construction, nozzle layout, spray nozzles, recycle pumps, mist elimination, horizontal flow demister, mist eliminator washing, reagent preparation system, spray tower FGDS power consumption, flue gas reheat options, byproduct conditioning system, and wet limestone system.
Effect of Silicon on Desulfurization of Aluminum-killed Steels
Roy, Debdutta
Recent reports have suggested that silicon has a beneficial effect on the rate of desulfurization of Al-killed steel. This effect is difficult to understand looking at the overall desulfurization reaction which does not include silicon. However an explanation is proposed by taking into account the (SiO2)/[Si] equilibrium in which some Al reaching the slag-metal interface is used in reducing the SiO2 in the slag. This reaction can be suppressed to some extent if the silicon content of the metal is increased and in doing so, more Al will be available at the slag-metal interface for the desulfurization reaction and this would increase the rate of the desulfurization reaction. A model was developed, assuming the rates are controlled by mass transfer, taking into account the coupled reactions of the reduction of silica, and other unstable oxides, namely iron oxide and manganese oxide, in the slag and desulfurization reaction in the steel by aluminum. The model predicts that increasing silicon increases the rate and extent of desulfurization. Plant data was analyzed to obtain rough estimates of ladle desulfurization rates and also used to validate the model predictions. Experiments have been conducted on a kilogram scale of material in an induction furnace to test the hypothesis. The major conclusions of the study are as follows: The rate and extent of desulfurization improve with increasing initial silicon content in the steel; the effect diminishes at silicon contents higher than approximately 0.2% and with increasing slag basicity. This was confirmed with kilogram-scale laboratory experiments. The effects of the silicon content in the steel (and of initial FeO and MnO in the slag) largely arise from the dominant effects of these reactions on the equilibrium aluminum content of the steel: as far as aluminum consumption or pick-up is concerned, the Si/SiO2 reaction dominates, and desulfurization has only a minor effect on aluminum consumption. The rate is primarily
Radiation methods for demercaptanization and desulfurization of oil products
International Nuclear Information System (INIS)
Zaykina, R.F.; Zaykin, Yu.A.; Mamonova, T.B.; Nadirov, N.K.
2002-01-01
A two-stage method for the desulfurization of oil is presented. The first stage strongly oxidizes sulfuric material to do away with its chemical aggressiveness and promote its removal. Desulfurization of the overall product is reached at the second stage by means of conventional methods
Radiation methods for demercaptanization and desulfurization of oil products
Zaykina, R. F.; Zaykin, Yu. A.; Mamonova, T. B.; Nadirov, N. K.
2002-03-01
A two-stage method for the desulfurization of oil is presented. The first stage strongly oxidizes sulfuric material to do away with its chemical aggressiveness and promote its removal. Desulfurization of the overall product is reached at the second stage by means of conventional methods.
Radiation-induced desulfurization of Arabian crude oil and straight-run diesel
International Nuclear Information System (INIS)
Basfar, A.A.; Mohamed, K.A.
2011-01-01
Radiation-induced desulfurization of four types of Arabian crude oils (heavy, medium, light and extra light) and straight-run diesel (SRD) was investigated over the range of 10-200 kGy. Results show that gamma radiation processing at absorbed doses up to 200 kGy without further treatment is not sufficient for desulfurization. However, the combination of gamma-irradiation with other physical/chemical processes (i.e. L/L extraction, adsorption and oxidation) may be capable of removing considerable levels of sulfur compounds in the investigated products. Currently, this approach of combined radiation/physical/chemical processes is under investigation. The findings of these attempts will be reported in the future. - Highlights: → Irradiation effect on desulfurization in Arabian crude oils and straight-run diesel was investigated. → No noticeable changes in sulfur content after irradiation up to 200 kGy were observed. → Stricter regulations on sulfur levels in fuels motivate search for improved desulfurization processes. → Limited investigations on radiation-induced desulfurization of oil products are conducted.
Oxidative Desulfurization of Fuel Oil by Pyridinium-Based Ionic Liquids
Erhong Duan; Dishun Zhao; Yanan Wang
2009-01-01
In this work, an N-butyl-pyridinium-based ionic liquid [BPy]BF4 was prepared. The effect of extraction desulfurization on model oil with thiophene and dibenzothiophene (DBT) was investigated. Ionic liquids and hydrogen peroxide (30%) were tested in extraction-oxidation desulfurization of model oil. The results show that the ionic liquid [BPy]BF4 has a better desulfurization effect. The best technological conditions are: V(IL)/V(Oil) /V(H2O2) = 1:1:0.4, temperature 55 °C, the time 30 min. The ...
Energy Technology Data Exchange (ETDEWEB)
Suzuki, T.; Ueno, T. (The Hokkaido Electric Power CO. Inc., Hokkaido (Japan))
1992-01-30
Practical use of dry desulfurization equipment using coal ash installed in Atsuma power plant no.1 is explained. Outline of dry desulferization process is consisted of basic principles and structure of the process which includes desulfurizer production equipment and absorption equipment. When compared with conventional wet process, equipments for waste water and for reheating of exhaust gas are not necessary, and operation maintenance has been more convenient with the simplification of the system and absorber has graded up the elimination function. Advantages of simplification of treatment of used desulfurizer, and absorption of sulfurdioxide by desulfurizer together with characteristics of desulfurizer production are given. As far as practical macineries are concerned, outline of instrument facilities, construction technology and results of experimental operation are reported. Effective Use of desulfurizer using deodorant and hedro treatment has been verified from ammonium absorption experiment and practical investigation results. However use of hedro material has required, conformity of surface caking technology, under water caking technology, under water covering technology and effect on under water living environment. 13 figs., 4 tabs.
Single gene insertion drives bioalcohol production by a thermophilic archaeon
Energy Technology Data Exchange (ETDEWEB)
Basen, M; Schut, GJ; Nguyen, DM; Lipscomb, GL; Benn, RA; Prybol, CJ; Vaccaro, BJ; Poole, FL; Kelly, RM; Adams, MWW
2014-12-09
Bioethanol production is achieved by only two metabolic pathways and only at moderate temperatures. Herein a fundamentally different synthetic pathway for bioalcohol production at 70 degrees C was constructed by insertion of the gene for bacterial alcohol dehydrogenase (AdhA) into the archaeon Pyrococcus furiosus. The engineered strain converted glucose to ethanol via acetate and acetaldehyde, catalyzed by the host-encoded aldehyde ferredoxin oxidoreductase (AOR) and heterologously expressed AdhA, in an energy-conserving, redox-balanced pathway. Furthermore, the AOR/AdhA pathway also converted exogenously added aliphatic and aromatic carboxylic acids to the corresponding alcohol using glucose, pyruvate, and/or hydrogen as the source of reductant. By heterologous coexpression of a membrane-bound carbon monoxide dehydrogenase, CO was used as a reductant for converting carboxylic acids to alcohols. Redirecting the fermentative metabolism of P. furiosus through strategic insertion of foreign genes creates unprecedented opportunities for thermophilic bioalcohol production. Moreover, the AOR/AdhA pathway is a potentially game-changing strategy for syngas fermentation, especially in combination with carbon chain elongation pathways.
Desulfurization of chalcopyrite and molybdenite by atomic hydrogen
International Nuclear Information System (INIS)
Bagdasaryan, V.R.; Kosoyan, A.Zh.; Niazyan, O.M.
1989-01-01
Molybdenite (MoS 2 ) desulfurization by monatomic hydrogen in 625-800 K range was studied using helium as diluent gas. Desulfurization degree at 680 K equals 9%. Temperature growth elevates sulfur content in molybdenite. The effect of initial molybdenite enrichment with temperature growth up to 800 K is probably caused by removal of reduced molybdenum capable to form oxide in the presence of traces of oxygen contained in inert diluent gas
International Nuclear Information System (INIS)
Zhao, Na; Li, Siwen; Wang, Jinyi; Zhang, Ronglan; Gao, Ruimin; Zhao, Jianshe; Wang, Junlong
2015-01-01
M 2 (PcAN) 2 (M=Fe, Co, Ni, Cu, Zn and Mn) anchored onto W-HZSM-5 (M 2 (PcAN) 2 –W-HZSM-5) or the M 2 (PcTN) 2 doping W-HZSM-5 (M 2 (PcTN) 2 /W-HZSM-5) were prepared and their catalytic performances were tested for oxidative desulfurization in the presence of oxygen. Thiophene (T), benzothiophene (BT), and dibenzothiophene (DBT) were considered as sulfur compounds. Among zeolite-based catalysts, the Cu 2 (PcAN) 2 –W-HZSM-5 and Cu 2 (PcTN) 2 /W-HZSM-5 showed superior desulfurization performance and the activity of selectivity followed the order: T>BT>DBT. The effects of phthalocyanine concentration were studied by UV–Vis and calcination temperature was obtained by TG-DSC for Cu 2 (PcTN) 2 /W-HZSM-5. Catalysts were characterized by EA, IR, XRD, SEM, TEM, ICP, and N 2 adsorption. Reaction time, temperature and the amount of catalyst were investigated as the important parameters for optimization of the reaction. Furthermore, a possible process of oxidative desulfurization and the reaction products were proposed. - Graphical abstract: The ODS reaction schematic shows the reaction mechanism of ultra-deep desulfurization. The sulfur compounds are oxidized to their corresponding sulfoxides or sulfones through the use of oxygen and catalysts. The reaction process of ultra-deep desulfurization. - Highlights: • A kind of novel catalyst for deep desulfurization was synthesized. • Cu 2 (PcAN) 2 –W-HZSM-5 exhibits excellent catalytic performance for desulfurization. • The reaction conditions that affect desulfurization efficiency are investigated. • The reaction process of model sulfur compounds is proposed
Ultrasound-assisted oxidative desulfurization of bitumen
Kamal, Wan Mohamad Ikhwan bin Wan; Okawa, Hirokazu; Kato, Takahiro; Sugawara, Katsuyasu
2017-07-01
Bitumen contains a high percentage of sulfur (about 4.6 wt %). A hydrodesulfurization method is used to remove sulfur from bitumen. The drawback of this method is the requirement for a high temperature of >300 °C. Most of the sulfur in bitumen exists as thiophene. Oxidative desulfurization (ODS), involving oxidizing sulfur using H2O2, then removing it using NaOH, allows the removal of sulfur in thiophene at low temperatures. We removed sulfur from bitumen using ODS treatment under ultrasound irradiation, and 52% of sulfur was successfully removed. Additionally, the physical action of ultrasound assisted the desulfurization of bitumen, even at low H2O2 concentrations.
Energy Technology Data Exchange (ETDEWEB)
Zhao, Na; Li, Siwen; Wang, Jinyi; Zhang, Ronglan [Key Laboratory of Synthetic and Natural Functional Molecule Chemistry of Ministry of Education, Shaanxi Key Laboratory of Physico-Inorganic Chemistry, College of Chemistry & Material Science, Northwest University, Xi’an 710069, Shaanxi (China); Composites Research Institute, Weinan Normal University, Weinan 714000 (China); Gao, Ruimin [Research Institute of Shaanxi Yanchang Petroleum Group Corp. Ltd., Xi’an 710075 (China); Composites Research Institute, Weinan Normal University, Weinan 714000 (China); Zhao, Jianshe, E-mail: jszhao@nwu.edu.cn [Key Laboratory of Synthetic and Natural Functional Molecule Chemistry of Ministry of Education, Shaanxi Key Laboratory of Physico-Inorganic Chemistry, College of Chemistry & Material Science, Northwest University, Xi’an 710069, Shaanxi (China); Composites Research Institute, Weinan Normal University, Weinan 714000 (China); Wang, Junlong [Research Institute of Shaanxi Yanchang Petroleum Group Corp. Ltd., Xi’an 710075 (China); Composites Research Institute, Weinan Normal University, Weinan 714000 (China)
2015-05-15
M{sub 2}(PcAN){sub 2} (M=Fe, Co, Ni, Cu, Zn and Mn) anchored onto W-HZSM-5 (M{sub 2}(PcAN){sub 2}–W-HZSM-5) or the M{sub 2}(PcTN){sub 2} doping W-HZSM-5 (M{sub 2}(PcTN){sub 2}/W-HZSM-5) were prepared and their catalytic performances were tested for oxidative desulfurization in the presence of oxygen. Thiophene (T), benzothiophene (BT), and dibenzothiophene (DBT) were considered as sulfur compounds. Among zeolite-based catalysts, the Cu{sub 2}(PcAN){sub 2}–W-HZSM-5 and Cu{sub 2}(PcTN){sub 2}/W-HZSM-5 showed superior desulfurization performance and the activity of selectivity followed the order: T>BT>DBT. The effects of phthalocyanine concentration were studied by UV–Vis and calcination temperature was obtained by TG-DSC for Cu{sub 2}(PcTN){sub 2}/W-HZSM-5. Catalysts were characterized by EA, IR, XRD, SEM, TEM, ICP, and N{sub 2} adsorption. Reaction time, temperature and the amount of catalyst were investigated as the important parameters for optimization of the reaction. Furthermore, a possible process of oxidative desulfurization and the reaction products were proposed. - Graphical abstract: The ODS reaction schematic shows the reaction mechanism of ultra-deep desulfurization. The sulfur compounds are oxidized to their corresponding sulfoxides or sulfones through the use of oxygen and catalysts. The reaction process of ultra-deep desulfurization. - Highlights: • A kind of novel catalyst for deep desulfurization was synthesized. • Cu{sub 2}(PcAN){sub 2}–W-HZSM-5 exhibits excellent catalytic performance for desulfurization. • The reaction conditions that affect desulfurization efficiency are investigated. • The reaction process of model sulfur compounds is proposed.
A novel semidry flue gas desulfurization process with the magnetically fluidized bed reactor
International Nuclear Information System (INIS)
Zhang Qi; Gui Keting
2009-01-01
The magnetically fluidized bed (MFB) was used as the reactor in a novel semidry flue gas desulfurization (FGD) process to achieve high desulfurization efficiency. Experiments in a laboratory-scale apparatus were conducted to reveal the effects of approach to adiabatic saturation temperature, Ca/S molar ratio and applied magnetic field intensity on SO 2 removal. Results showed that SO 2 removal efficiency can be obviously enhanced by decreasing approach to adiabatic saturation temperature, increasing Ca/S molar ratio, or increasing applied magnetic field intensity. At a magnetic field intensity of 300 Oe and a Ca/S molar ratio of 1.0, the desulfurization efficiency (excluding desulfurization efficiency in the fabric filter) was over 80%, while spent sorbent appeared in the form of dry powder. With the SEM, XRD and EDX research, it can be found that the increase of DC magnetic field intensity can make the surface morphology on the surface of the ferromagnetic particles loose and enhance the oxidation of S(IV), hence reducing the liquid phase mass transfer resistance of the slurry droplets and increasing desulfurization reaction rate, respectively. Therefore, the desulfurization efficiency increased obviously with the increase of DC field intensity.
Heterologous Expression Of Two Putative Glutamate Synthase Subunits From Pyrococcus Horikoshii
Akçe, Hande
2006-01-01
Glutamat sentaz (GOGAT), bakteri, alg ve bitkilerde amonyak asimilasyonun ilk basamaklarında görev alan ve glutaminin amido azotunun 2-okzoglutarata transamidasyonu sonucu iki molekül glutamat oluşumunu katalizleyen önemli bir enzimdir. GOGAT tarafından kullanılan amonyak, bitkilerde fotorespirasyon, amino acid yıkımı gibi metabolik işlemler sonucu sağlanabildiği gibi, nitrat ve atmosferik diazot gibi dış azot kaynaklarının indirgenmesi yoluyla da sağlanabilir. Pyrococcus cinsinden olan P. ho...
International Nuclear Information System (INIS)
Wei Zaishan; Lin Zhehang; Niu Hejingying; He Haiming; Ji Yongfeng
2009-01-01
Microwave reactor with ammonium bicarbonate (NH 4 HCO 3 ) and zeolite was set up to study the simultaneous removal of sulfur dioxide (SO 2 ) and nitrogen oxides (NO x ) from flue gas. The results showed that the microwave reactor filled with NH 4 HCO 3 and zeolite could reduce SO 2 to sulfur with the best desulfurization efficiency of 99.1% and reduce NO x to nitrogen with the best NO x purifying efficiency of 86.5%. Microwave desulfurization and denitrification effect of the experiment using ammonium bicarbonate and zeolite together is much higher than that using ammonium bicarbonate or zeolite only. NO x concentration has little effect on denitrification but has no influence on desulfurization, SO 2 concentration has no effect on denitrification. The optimal microwave power and empty bed residence time (EBRT) on simultaneous desulfurization and dentrification are 211-280 W and 0.315 s, respectively. The mechanism for microwave reduced desulfurization and denitrification can be described as the microwave-induced catalytic reduction reaction between SO 2 , NO x and ammonium bicarbonate with zeolite being the catalyst and microwave absorbent
Desulfurization of Diesel Fuel by Oxidation and Solvent Extraction
Wadood Taher Mohammed; Raghad Fareed Kassim Almilly; Sheam Bahjat Abdulkareem Al-Ali
2015-01-01
This research presents a study in ultra-desulfurization of diesel fuel produced from conventional hydro desulfurization process, using oxidation and solvent extraction techniques. Dibenzothiophene (DBT) was the organosulfur compound that had been detected in sulfur removal. The oxidation process used hydrogen peroxide as an oxidant and acetic acid as homogeneous catalyst . The solvent extraction process used acetonitrile (ACN) and N-methyl – 2 - pyrrolidone (NMP) as extractants . Also the ef...
Results of the desulfurization programme at coal-fired power plants operated by CEZ a.s
International Nuclear Information System (INIS)
Anon.
1996-01-01
The Czech utility CEZ, which is the major power plant operator in the Czech Republic, is running an extensive coal-fired power plant desulfurization programme to improve the environmental situation in the region. Flue gas desulfurization is achieved in 2 ways: by augmenting the existing units with desulfurization equipment, and by replacing old boilers with new, fluidized-bed combustion facilities. Both wet limestone scrubbing and the dry limestone method are applied. A survey of the power plants, desulfurized power, desulfurization equipment suppliers, and contract prices is presented in a tabular form. Plots showing the contribution of CEZ's power plants to sulfur dioxide emissions in the Czech Republic are reproduced. (P.A.). 1 tab., 3 figs
Desulfurization kinetics of molten copper by gas bubbling
Fukunaka, Y.; Nishikawa, K.; Sohn, H. S.; Asaki, Z.
1991-02-01
Molten copper with 0.74 wt pct sulfur content was desulfurized at 1523 K by bubbling Ar-O2 gas through a submerged nozzle. The reaction rate was significantly influenced not only by the oxygen partial pressure but also by the gas flow rate. Little evolution of SO2 gas was observed in the initial 10 seconds of the oxidation; however, this was followed by a period of high evolution rate of SO2 gas. The partial pressure of SO2 gas decreased with further progress of the desulfurization. The effect of the immersion depth of the submerged nozzle was negligible. The overall reaction is decomposed to two elementary reactions: the desulfurization and the dissolution rate of oxygen. The assumptions were made that these reactions are at equilibrium and that the reaction rates are controlled by mass transfer rates within and around the gas bubble. The time variations of sulfur and oxygen contents in the melt and the SO2 partial pressure in the off-gas under various bubbling conditions were well explained by the mathematical model combined with the reported thermodynamic data of these reactions. Based on the present model, it was anticipated that the oxidation rate around a single gas bubble was mainly determined by the rate of gas-phase mass transfer, but all oxygen gas blown into the melt was virtually consumed to the desulfurization and dissolution reactions before it escaped from the melt surface.
Desulfurization of AL-Ahdab Crude Oil using Oxidative Processes
Neran Khalel Ibrahim; Saja Mohsen Jabbar
2015-01-01
Two different oxidative desulfurization strategies based on oxidation/adsorption or oxidation/extraction were evaluated for the desulfurization of AL-Ahdab (AHD) sour crude oil (3.9wt% sulfur content). In the oxidation process, a homogenous oxidizing agent comprising of hydrogen peroxide and formic acid was used. Activated carbons were used as sorbent/catalyst in the oxidation/adsorption process while acetonitrile was used as an extraction solvent in the oxidation/extraction process. For the ...
The ABC of ABC-transport in the hyperthermophilic archaeon Pyrococcus furiosus
Koning, S
2003-01-01
Living organisms of our earth can be divided into two groups, the prokaryotes and the eukaryotes. Eukaryotic cells have a nucleus, a special compartment in the cell, where the genetic material, the DNA is located. The DNA in the prokaryotic cell is floating freely in the cell. The eukaryotes, that
Crystal Structure of PAV1-137: A Protein from the Virus PAV1 That Infects Pyrococcus abyssi
Directory of Open Access Journals (Sweden)
N. Leulliot
2013-01-01
Full Text Available Pyrococcus abyssi virus 1 (PAV1 was the first virus particle infecting a hyperthermophilic Euryarchaeota (Pyrococcus abyssi strain GE23 that has been isolated and characterized. It is lemon shaped and is decorated with a short fibered tail. PAV1 morphologically resembles the fusiform members of the family Fuselloviridae or the genus Salterprovirus. The 18 kb dsDNA genome of PAV1 contains 25 predicted genes, most of them of unknown function. To help assigning functions to these proteins, we have initiated structural studies of the PAV1 proteome. We determined the crystal structure of a putative protein of 137 residues (PAV1-137 at a resolution of 2.2 Å. The protein forms dimers both in solution and in the crystal. The fold of PAV1-137 is a four-α-helical bundle analogous to those found in some eukaryotic adhesion proteins such as focal adhesion kinase, suggesting that PAV1-137 is involved in protein-protein interactions.
Study of variation grain size in desulfurization process of calcined petroleum coke
Pintowantoro, Sungging; Setiawan, Muhammad Arif; Abdul, Fakhreza
2018-04-01
Indonesia is a country with abundant natural resources, such as mineral mining and petroleum. In petroleum processing, crude oil can be processed into a source of fuel energy such as gasoline, diesel, oil, petroleum coke, and others. One of crude oil potentials in Indonesia is petroleum coke. Petroleum coke is a product from oil refining process. Sulfur reducing process in calcined petroleum cokes can be done by desulfurization process. The industries which have potential to become petroleum coke processing consumers are industries of aluminum smelting (anode, graphite block, carbon mortar), iron riser, calcined coke, foundry coke, etc. Sulfur reducing process in calcined petroleum coke can be done by thermal desulfurization process with alkaline substance NaOH. Desulfurization of petroleum coke process can be done in two ways, which are thermal desulfurization and hydrodesulphurization. This study aims to determine the effect of various grain size on sulfur, carbon, and chemical bond which contained by calcined petroleum coke. The raw material use calcined petroleum coke with 0.653% sulfur content. The grain size that used in this research is 50 mesh, then varied to 20 mesh and 100 mesh for each desulfurization process. Desulfurization are tested by ICP, UV-VIS, and FTIR to determine levels of sulfur, carbon, chemical bonding and sulfur dissolved water which contained in the residual washing of calcined petroleum coke. From various grain size that mentioned before, the optimal value is on 100 mesh grain size, where the sulfur content in petroleum coke is 0.24% and carbon content reaches the highest level of 97.8%. Meanwhile for grain size 100 mesh in the desulfurization process is enough to break the chemical bonds of organic sulfur in petroleum coke.
Oxidative Desulfurization of Gasoline by Ionic Liquids Coupled with Extraction by Organic Solvents
Abro, Rashid; Gao, Shurong; Chen, Xiaochun; Yu, Guangren; Abdeltawab, Ahmed A.; Al-Deyab, Salem S.
2016-01-01
In this work, desulfurization of real fluidized catalytic cracking (FCC) gasoline was investigated in dual steps; first in oxidative desulfurization (ODS) using imidazolium and pyrrolidonium based Brønsted acidic ionic liquids (ILs) as solvent and catalyst and hydrogen peroxide as oxidant. In second step, extractive desulfurization took place using organic solvents of furfural, furfural alcohol and ethylene glycol. Variety of factors such as temperature, time, mass ratio of oil/ILs and regene...
Energy Technology Data Exchange (ETDEWEB)
Wei Zaishan [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)], E-mail: weizaishan98@163.com; Lin Zhehang; Niu Hejingying; He Haiming; Ji Yongfeng [School of Environmental Science and Engineering, Sun Yat-sen University, Guangzhou 510275 (China)
2009-03-15
Microwave reactor with ammonium bicarbonate (NH{sub 4}HCO{sub 3}) and zeolite was set up to study the simultaneous removal of sulfur dioxide (SO{sub 2}) and nitrogen oxides (NO{sub x}) from flue gas. The results showed that the microwave reactor filled with NH{sub 4}HCO{sub 3} and zeolite could reduce SO{sub 2} to sulfur with the best desulfurization efficiency of 99.1% and reduce NO{sub x} to nitrogen with the best NO{sub x} purifying efficiency of 86.5%. Microwave desulfurization and denitrification effect of the experiment using ammonium bicarbonate and zeolite together is much higher than that using ammonium bicarbonate or zeolite only. NO{sub x} concentration has little effect on denitrification but has no influence on desulfurization, SO{sub 2} concentration has no effect on denitrification. The optimal microwave power and empty bed residence time (EBRT) on simultaneous desulfurization and dentrification are 211-280 W and 0.315 s, respectively. The mechanism for microwave reduced desulfurization and denitrification can be described as the microwave-induced catalytic reduction reaction between SO{sub 2}, NO{sub x} and ammonium bicarbonate with zeolite being the catalyst and microwave absorbent.
Multi-objective optimization of oxidative desulfurization in a sono-photochemical airlift reactor.
Behin, Jamshid; Farhadian, Negin
2017-09-01
Response surface methodology (RSM) was employed to optimize ultrasound/ultraviolet-assisted oxidative desulfurization in an airlift reactor. Ultrasonic waves were incorporated in a novel-geometry reactor to investigate the synergistic effects of sono-chemistry and enhanced gas-liquid mass transfer. Non-hydrotreated kerosene containing sulfur and aromatic compounds was chosen as a case study. Experimental runs were conducted based on a face-centered central composite design and analyzed using RSM. The effects of two categorical factors, i.e., ultrasound and ultraviolet irradiation and two numerical factors, i.e., superficial gas velocity and oxidation time were investigated on two responses, i.e., desulfurization and de-aromatization yields. Two-factor interaction (2FI) polynomial model was developed for the responses and the desirability function associate with overlay graphs was applied to find optimum conditions. The results showed enhancement in desulfurization ability corresponds to more reduction in aromatic content of kerosene in each combination. Based on desirability approach and certain criteria considered for desulfurization/de-aromatization, the optimal desulfurization and de-aromatization yields of 91.7% and 48% were obtained in US/UV/O 3 /H 2 O 2 combination, respectively. Copyright © 2017 Elsevier B.V. All rights reserved.
Inhibition of carbon disulfide on bio-desulfurization in the process of ...
African Journals Online (AJOL)
Biological desulfurization is a novel technology for the removal of hydrogen sulfide from some biogas or sour gas, in which there are always a certain amounts of carbon disulfide together with much hydrogen sulfide. Nowadays, carbon disulfide is found to have negative effect on the biological desulfurization, but seldom ...
Nano-magnetic particles as multifunctional microreactor for deep desulfurization
Energy Technology Data Exchange (ETDEWEB)
Cui, Xinai; Yao, Dongdong [Engineering Research Center of Historical and Cultural Heritage Protection, Ministry of Education, School of Materials Science and Engineering, Shaanxi Normal University, Xi' an 710062 (China); Li, Hong [College of Environment and Chemical Engineering, Xi' an Polytechnic University, Xi' an 710048 (China); Yang, Juxiang [Department of Chemistry, Xi' an University of Arts and Science, Xi' an 710065 (China); Hu, Daodao, E-mail: daodaohu@snnu.edu.cn [Engineering Research Center of Historical and Cultural Heritage Protection, Ministry of Education, School of Materials Science and Engineering, Shaanxi Normal University, Xi' an 710062 (China)
2012-02-29
Highlights: Black-Right-Pointing-Pointer An easy-separated amphiphilic catalyst with small size was prepared for deep desulfurization. Black-Right-Pointing-Pointer The effects of several factors on desulfurization reactivity were systematically investigated. Black-Right-Pointing-Pointer The catalyst demonstrates high performance in the deep desulfurization. Black-Right-Pointing-Pointer The material could make integration of micro-reactor and micro-extractor into one system. - Abstract: Oxidation of dibenzothiophene with hydrogen peroxide using a recyclable amphiphilic catalyst has been studied. The catalyst was synthesized by surfacely covering magnetic silica nanospheres (MSN) with the complexes between 3-(trimethoxysilyl)-propyldimethyloctadecyl ammonium chloride (AEM) and phosphotungstic acid (PTA). The morphology and components of the composite material were characterized by TEM, EDX, XPS, FT-IR, and VSM, respectively. The effects of several factors on desulfurization reactivity were systematically investigated. The results showed that the composite nanospheres have core/shell structure with the properties of amphiphilicity and superparamagnetism. The composite nanospheres have high catalytic activity in the oxidation of dibenzothiophene to corresponding sulfones by hydrogen peroxide under mild reaction conditions. The sulfur level could be lowered from 487 ppm to less than 0.8 ppm under optimal conditions. Additionally, the amphiphilic catalyst and the oxidized product could be simultaneously separated from medium by external magnetism, and the recovered composite material could be recycled for three times with almost constant activity.
Nano-magnetic particles as multifunctional microreactor for deep desulfurization
International Nuclear Information System (INIS)
Cui, Xinai; Yao, Dongdong; Li, Hong; Yang, Juxiang; Hu, Daodao
2012-01-01
Highlights: ► An easy-separated amphiphilic catalyst with small size was prepared for deep desulfurization. ► The effects of several factors on desulfurization reactivity were systematically investigated. ► The catalyst demonstrates high performance in the deep desulfurization. ► The material could make integration of micro-reactor and micro-extractor into one system. - Abstract: Oxidation of dibenzothiophene with hydrogen peroxide using a recyclable amphiphilic catalyst has been studied. The catalyst was synthesized by surfacely covering magnetic silica nanospheres (MSN) with the complexes between 3-(trimethoxysilyl)-propyldimethyloctadecyl ammonium chloride (AEM) and phosphotungstic acid (PTA). The morphology and components of the composite material were characterized by TEM, EDX, XPS, FT-IR, and VSM, respectively. The effects of several factors on desulfurization reactivity were systematically investigated. The results showed that the composite nanospheres have core/shell structure with the properties of amphiphilicity and superparamagnetism. The composite nanospheres have high catalytic activity in the oxidation of dibenzothiophene to corresponding sulfones by hydrogen peroxide under mild reaction conditions. The sulfur level could be lowered from 487 ppm to less than 0.8 ppm under optimal conditions. Additionally, the amphiphilic catalyst and the oxidized product could be simultaneously separated from medium by external magnetism, and the recovered composite material could be recycled for three times with almost constant activity.
Experimental study of desulfurization of Zhong Liang Shau high sulfur coal by flotation
Energy Technology Data Exchange (ETDEWEB)
Jiang, Z.; Huang, B.; Cao, J. [China University of Mining and Technology (China). Beijing Graduate School
1994-12-01
Emission of large amount of SO{sub 2} from combustion of high sulfur coal causes serious environmental pollution. Pre-combustion desulfurization of high sulfur coal has become a necessity. This paper reports test results of fine coal desulfurization with different flotation technology and the effect of pyrite depressant. Test work showed that when the coal sample from Zhong Liang Shau was processed with a Free Jet Flotation Column its pyritic sulfur content was reduced from 3.08% to 0.84%, with 72.22% recovery of combustible matter in clean coal. The concept of Desulfurization Efficiency Index E{sub ds} for comprehensive evaluation of desulfurization process is proposed, which is defined as the product of the ratio of sulfur content reduction of clean coal and the recovery of combustible matters. 6 refs., 4 figs., 3 tabs.
Process for desulfurizing shale oil, etc
Energy Technology Data Exchange (ETDEWEB)
Escherich, F
1922-12-17
A process is described for the desulfurizing of shale oil or tar, with recovery of valuable oils and hydrocarbons, characterized in that the raw material is heated in an autoclave to a pressure of 100 atmospheres or more.
Desulfurization technology in the blast furnace raceway by MgO-SiO{sub 2} flux injection
Energy Technology Data Exchange (ETDEWEB)
Orimoto, T.; Noda, T.; Ichida, M.; Nagasaka, T. [Hokkai Iron & Coke Corporation, Hokkaido (Japan)
2008-07-01
This paper presents a study on desulfurization technology in the steel industry, with attention focused on the removal of sulfur that forms acid rain, which has been creating various global problems. The study was confined to the technology that injects a mixture of serpentine and pulverized coals. Thermodynamically, a magnesium gas producing reaction occurs when magnesium oxide is turned into a hot strongly reducing atmosphere and the resulting magnesium gas forms magnesium sulfide by reaction with the sulfur in the molten iron. By dividing this desulfurization process into a magnesium gas producing reaction and a desulfurization reaction by the magnesium gas, the desulfurization effect of the magnesium oxide flux was confirmed through laboratory experiment. A thermodynamic study on the desulfurization reaction in which SiO gas resulting from the reduction of SiO{sub 2} produces a silicon sulfide gas by reaction with the sulfur in the molten iron revealed that the possibility of desulfurization of the molten iron by the silicon sulfide gas is not negligible.
International Nuclear Information System (INIS)
Naumoski, Koce
1997-01-01
Harms on life environment, caused by aero pollution, for the last decades enforced fast development of technologies for filtration of gases that come from thermal power plants and other objects. SO 2 , that appear as one of outputs of fossil fuels combustion, and also processing of sulphide ore, is a main component of acid rains. Acid rains represent one of the most risky factors, responsible for dryne of woods and changing of flora and fauna on land and in water. Starting from 1931 year when on the thermal power plant BATTERSEA STATION, property of London Power, first scrubbers were monnted for filtration of flue gases of SO 2 , and up till today, many procedures are developed for desulfurization of flue gases. For easier coping with numerous technologies for desulfurization , various classifications were made. By state of aggregation of the absorption agent , the technologies for desulfurization of gases are divided in wet , semidry and dry procedures. Wet procedures are technologies with highness rate of desulfurization of 90-95 % and most flexible of the quality of fuel whose flue gases are filtered. Presently they have high price of 90-220 $/kw installed power. According to American sources, their price at the world market is forecasted that till 2000 year will reach price of 100 $/kw. Dry technologies for desulfurization of flue gases are last technologies. The rate of desulfurization is 50-60 % and its prise is 76 -113 $/kw. Their negative side is high variable costs 250 - 388 $/ ton SO 2 (at wet procedures variable costs 76 - 157 $/ton SO 2 ). Semidry technologies by financial and technological characteristics are wet and dry procedures. (Author)
Desulfurization and denitrogenation in copyrolysis of coal with hydrogen-rich gases
Energy Technology Data Exchange (ETDEWEB)
Liao, H.; Li, B.; Zhang, B. [Chinese Academy of Sciences, Taiyuan (China). Institute of Coal Chemistry
1999-06-01
Desulfurization and denitrogenation were systematically investigated by analyzing the chars and tars from copyrolysis of Yanzhou high sulfur bituminous coal with coke-oven gas (COG), synthesis gas (SG) and hydrogen. The results indicated that under the conditions of 3MPa, up to 650{degree}C with a heating rate of 10{degree}C/min, the desulfurization of coal pyrolysis with COG, SG and hydrogen were almost equal (about 80%, w%, ad), the order of denitrogenation were: hydrogen (41%) {gt} SG(35%) {gt} COG(30%). The distributions of sulfur in char, oil and gas was very similar under the three reactive gases, i.e., about 205 in char, 105 in tar and 70% (diff.) in gas, respectively. Compared with hydropyrolysis at the same hydrogen partial pressure, the desulfurization of coal pyrolysis with coke oven gas was increased by about 4.5%, while the denitrogenation was decreased by about 3.5%. There is an important desulfurization advantage for hydropyrolysis using COG and SG instead of pure hydrogen. Compared with the copyrolysis of coal with COG, Yanzhou coal pyrolysis under SG can achieve the same level of desufurization but higher denitrogenation. 11 refs., 3 figs., 4 tabs.
Mercury isotope fractionation during transfer from post-desulfurized seawater to air.
Huang, Shuyuan; Lin, Kunning; Yuan, Dongxing; Gao, Yaqin; Sun, Lumin
2016-12-15
Samples of dissolved gaseous mercury (DGM) in the post-desulfurized seawater discharged from a coal-fired power plant together with samples of gaseous elemental mercury (GEM) over the post-desulfurized seawater surface were collected and analyzed to study the mercury isotope fractionation during transfer from post-desulfurized seawater to air. Experimental results showed that when DGM in the seawater was converted to GEM in the air, the δ 202 Hg and Δ 199 Hg values were changed, ranging from -2.98 to -0.04‰ and from -0.31 to 0.64‰, respectively. Aeration played a key role in accelerating the transformation of DGM to GEM, and resulted in light mercury isotopes being more likely to be enriched in the GEM. The ratio Δ 199 Hg/Δ 201 Hg was 1.626 in all samples, suggesting that mercury mass independent fractionation occurred owing to the nuclear volume effect during the transformation. In addition, mass independent fractionation of mercury even isotopes was found in the GEM above the post-desulfurized seawater surface in the aeration pool. Copyright © 2016 Elsevier Ltd. All rights reserved.
Ultrasound-Assisted Oxidative Desulfurization of Diesel
Directory of Open Access Journals (Sweden)
Niran K. Ibrahim
2016-11-01
Full Text Available Due to the dramatic environmental impact of sulfur emissions associated with the exhaust of diesel engines, last environmental regulations for ultra-low-sulfur diesel require a very deep desulfurization (up to 15 ppm, which cannot be met by the conventional hydrodesulfurization units alone. The proposed method involves a batch ultrasound-assisted oxidative desulfurization (UAODS of a previously hydrotreated diesel (containing 480 ppm sulfur so as to convert the residual sulfur-bearing compounds into their corresponding highly polar oxides, which can be eliminated easily by extraction with a certain highly polar solvent. The oxidizing system utilized was H2O2 as an oxidant, CH3COOH as a promoter, with FeSO4 as a catalyst; whereas acetonitrile was used as extractant. The major influential parameters related to UAODS process have been investigated, namely: ratio of oxidant/fuel, ratio of the promoter/oxidant, dose of catalyst, reaction temperature, and intensity of ultrasonic waves. Kinetics of the reaction has been also studied; it was observed that the UAODS of diesel fuels fitted pseudo-first-order kinetics under the best experimental conditions, whereas values of the apparent rate constant and activation energy were 0.373 min-1 and 24 KJ/mol, respectively. The oxidation treatment, in combination with ultrasonic irradiation, revealed a synergistic effect for diesel desulfurization. The experimental results showed that sulfur removal efficiency could amount to 98% at mild operating conditions (70 ○C and 1 bar. This indicates that the process is efficient and promising for the production of ultra-low-sulfur diesel fuels.
Cao, Qing; Nastac, Laurentiu; Pitts-Baggett, April; Yu, Qiulin
2018-03-01
A quick modeling analysis approach for predicting the slag-steel reaction and desulfurization kinetics in argon gas-stirred ladles has been developed in this study. The model consists of two uncoupled components: (i) a computational fluid dynamics (CFD) model for predicting the fluid flow and the characteristics of slag-steel interface, and (ii) a multicomponent reaction kinetics model for calculating the desulfurization evolution. The steel-slag interfacial area and mass transfer coefficients predicted by the CFD simulation are used as the processing data for the reaction model. Since the desulfurization predictions are uncoupled from the CFD simulation, the computational time of this uncoupled predictive approach is decreased by at least 100 times for each case study when compared with the CFD-reaction kinetics fully coupled model. The uncoupled modeling approach was validated by comparing the evolution of steel and slag compositions with the experimentally measured data during ladle metallurgical furnace (LMF) processing at Nucor Steel Tuscaloosa, Inc. Then, the validated approach was applied to investigate the effects of the initial steel and slag compositions, as well as different types of additions during the refining process on the desulfurization efficiency. The results revealed that the sulfur distribution ratio and the desulfurization reaction can be promoted by making Al and CaO additions during the refining process. It was also shown that by increasing the initial Al content in liquid steel, both Al oxidation and desulfurization rates rapidly increase. In addition, it was found that the variation of the initial Si content in steel has no significant influence on the desulfurization rate. Lastly, if the initial CaO content in slag is increased or the initial Al2O3 content is decreased in the fluid-slag compositional range, the desulfurization rate can be improved significantly during the LMF process.
Cao, Qing; Nastac, Laurentiu; Pitts-Baggett, April; Yu, Qiulin
2018-06-01
A quick modeling analysis approach for predicting the slag-steel reaction and desulfurization kinetics in argon gas-stirred ladles has been developed in this study. The model consists of two uncoupled components: (i) a computational fluid dynamics (CFD) model for predicting the fluid flow and the characteristics of slag-steel interface, and (ii) a multicomponent reaction kinetics model for calculating the desulfurization evolution. The steel-slag interfacial area and mass transfer coefficients predicted by the CFD simulation are used as the processing data for the reaction model. Since the desulfurization predictions are uncoupled from the CFD simulation, the computational time of this uncoupled predictive approach is decreased by at least 100 times for each case study when compared with the CFD-reaction kinetics fully coupled model. The uncoupled modeling approach was validated by comparing the evolution of steel and slag compositions with the experimentally measured data during ladle metallurgical furnace (LMF) processing at Nucor Steel Tuscaloosa, Inc. Then, the validated approach was applied to investigate the effects of the initial steel and slag compositions, as well as different types of additions during the refining process on the desulfurization efficiency. The results revealed that the sulfur distribution ratio and the desulfurization reaction can be promoted by making Al and CaO additions during the refining process. It was also shown that by increasing the initial Al content in liquid steel, both Al oxidation and desulfurization rates rapidly increase. In addition, it was found that the variation of the initial Si content in steel has no significant influence on the desulfurization rate. Lastly, if the initial CaO content in slag is increased or the initial Al2O3 content is decreased in the fluid-slag compositional range, the desulfurization rate can be improved significantly during the LMF process.
Sun, Tonghua; Shen, Yafei; Jia, Jinping
2014-02-18
This paper proposes a novel self-developed JTS-01 desulfurizer and JZC-80 alkaline adsorbent for H2S removal and gas cleaning of the COREX coal gas in small-scale and commercial desulfurizing devices. JTS-01 desulfurizer was loaded with metal oxide (i.e., ferric oxides) catalysts on the surface of activated carbons (AC), and the catalyst capacity was improved dramatically by means of ultrasonically assisted impregnation. Consequently, the sulfur saturation capacity and sulfur capacity breakthrough increased by 30.3% and 27.9%, respectively. The whole desulfurizing process combined selective adsorption with catalytic oxidation. Moreover, JZC-80 adsorbent can effectively remove impurities such as HCl, HF, HCN, and ash in the COREX coal gas, stabilizing the system pressure drop. The JTS-01 desulfurizer and JZC-80 adsorbent have been successfully applied for the COREX coal gas cleaning in the commercial plant at Baosteel, Shanghai. The sulfur capacity of JTS-01 desulfurizer can reach more than 50% in industrial applications. Compared with the conventional dry desulfurization process, the modified AC desulfurizers have more merit, especially in terms of the JTS-01 desulfurizer with higher sulfur capacity and low pressure drop. Thus, this sorption enhanced catalytic desulfurization has promising prospects for H2S removal and other gas cleaning.
Peroxide-mediated desulfurization of phosphorothioate oligonucleotides and its prevention.
Krotz, Achim H; Mehta, Rahul C; Hardee, Gregory E
2005-02-01
Desulfurization at the internucleotide phosphorothioate linkage of antisense oligonucleotides (ASOs) in dermatological formulations has been investigated using strong ion exchange chromatography and mass spectroscopy. The formation of phosphate diester linkages appeared to arise from a reaction between the phosphorothioate oligonucleotide and a potent oxidizing agent. Screening of excipients used in the formulation indicated that the cause of desulfurization was related to the presence of polyethylene glycol-derived nonionic surfactants MYRJ 52 or BRIJ 58. Autoxidation of the polyethylene glycol chain is suggested as the probable origin for the observed incompatibility. The ability of various antioxidants to prevent oxidative degradation of ASO-1 in simple test systems and in oil-in-water emulsions is described. It is found that in test systems both lipophilic and hydrophilic antioxidants are effective. However, in cream formulation (oil-in-water emulsions) of ASO-1 the addition of hydrophilic antioxidants L-cysteine or DL-alpha-lipoic acid has been shown to be superior in protecting the oligonucleotide from desulfurization upon storage. Copyright 2004 Wiley-Liss, Inc.
The effect of annealing and desulfurization on oxide spallation of turbine airfoil material
International Nuclear Information System (INIS)
Briant, C.L.; Murphy, W.H.; Schaeffer, J.C.
1995-01-01
In this paper the authors report a study that addresses the sulfur-induced spallation theory. Previous work has shown that a high temperature anneal in hydrogen desulfurizes nickel-base alloys and greatly improves their resistance to oxide spallation. The authors will show that such an anneal can be applied successfully to a Ni-base airfoil material. Both Auger segregation experiments and chemical analyses show that this anneal desulfurizes the material, at least in the absence of yttrium. However, the results suggest that factors other than desulfurization may be contributing to the improvement in spallation resistance produced by the anneal
湿法脱硫运行情况总结%Operation Summary of Wet Desulfurization Unit
Institute of Scientific and Technical Information of China (English)
杨文斌
2013-01-01
因栲胶法脱硫效果差,采用添加NDC脱硫剂进行改进,改进后,脱硫效果好,但存在变脱效果差,副盐高等问题。针对这些问题,提出改进方法。%The tanin extract desulfurization unit runs poorly in our company , after dosing NDC desulfurization agent , the desulfurization effects are good . But the problems of the shift gas poor desulfurization and the high secondary salt content have not been solved , some improving methods are put forward .
Chan, Ngo Yeung
This study is aimed at improving the current ultrasound assisted oxidative desulfurization (UAOD) process by utilizing superoxide radical as oxidant. Research was also conducted to investigate the feasibility of ultraviolet (UV) irradiation-assisted desulfurization. These modifications can enhance the process with the following achievements: (1) Meet the upcoming sulfur standards on various fuels including diesel fuel oils and residual oils; (2) More efficient oxidant with significantly lower consumption in accordance with stoichiometry; (3) Energy saving by 90%; (4) Greater selectivity in petroleum composition. Currently, the UAOD process and subsequent modifications developed in University of Southern California by Professor Yen's research group have demonstrated high desulfurization efficiencies towards various fuels with the application of 30% wt. hydrogen peroxide as oxidant. The UAOD process has demonstrated more than 50% desulfurization of refractory organic sulfur compounds with the use of Venturella type catalysts. Application of quaternary ammonium fluoride as phase transfer catalyst has significantly improved the desulfurization efficiency to 95%. Recent modifications incorporating ionic liquids have shown that the modified UAOD process can produce ultra-low sulfur, or near-zero sulfur diesels under mild conditions with 70°C and atmospheric pressure. Nevertheless, the UAOD process is considered not to be particularly efficient with respect to oxidant and energy consumption. Batch studies have demonstrated that the UAOD process requires 100 fold more oxidant than the stoichiometic requirement to achieve high desulfurization yield. The expected high costs of purchasing, shipping and storage of the oxidant would reduce the practicability of the process. The excess use of oxidant is not economically desirable, and it also causes environmental and safety issues. Post treatments would be necessary to stabilize the unspent oxidant residual to prevent the waste
Subsequent flue gas desulfurization of coal-fired power plant units
International Nuclear Information System (INIS)
Willibal, U.; Braun, Gy.
1998-01-01
The presently operating coal-fired power plant in Hungary do not satisfy the pollution criteria prescribed by the European Union norms. The main polluting agent is the sulfur dioxide emitted by some of the power plants in Hungary in quantities over the limit standards. The power plant units that are in good operating state could be made competitive by using subsequent desulfurization measures. Various flue gas desulfurization technologies are presented through examples that can be applied to existing coal-fired power plants. (R.P.)
Directory of Open Access Journals (Sweden)
Mahidin Mahidin
2016-08-01
Full Text Available Calcium oxide-based material is available abundantly and naturally. A potential resource of that material comes from marine mollusk shell such as clams, scallops, mussels, oysters, winkles and nerites. The CaO-based material has exhibited a good performance as the desulfurizer oradsorbent in coal combustion in order to reduce SO2 emission. In this study, pulverized green mussel shell, without calcination, was utilized as the desulfurizer in the briquette produced from a mixture of low rank coal and palm kernel shell (PKS, also known as bio-briquette. The ratio ofcoal to PKS in the briquette was 90:10 (wt/wt. The influence of green mussel shell contents and combustion temperature were examined to prove the possible use of that materialas a desulfurizer. The ratio of Ca to S (Ca = calcium content in desulfurizer; S = sulfur content in briquette werefixed at 1:1, 1.25:1, 1.5:1, 1.75:1, and 2:1 (mole/mole. The burning (or desulfurization temperature range was 300-500 °C; the reaction time was 720 seconds and the air flow rate was 1.2 L/min. The results showed that green mussel shell can be introduced as a desulfurizer in coal briquette or bio-briquette combustions. The desulfurization process using that desulfurizer exhibited the first order reaction and the highest average efficiency of 84.5%.
Zhao, Na; Li, Siwen; Wang, Jinyi; Zhang, Ronglan; Gao, Ruimin; Zhao, Jianshe; Wang, Junlong
2015-05-01
M2(PcAN)2 (M=Fe, Co, Ni, Cu, Zn and Mn) anchored onto W-HZSM-5 (M2(PcAN)2-W-HZSM-5) or the M2(PcTN)2 doping W-HZSM-5 (M2(PcTN)2/W-HZSM-5) were prepared and their catalytic performances were tested for oxidative desulfurization in the presence of oxygen. Thiophene (T), benzothiophene (BT), and dibenzothiophene (DBT) were considered as sulfur compounds. Among zeolite-based catalysts, the Cu2(PcAN)2-W-HZSM-5 and Cu2(PcTN)2/W-HZSM-5 showed superior desulfurization performance and the activity of selectivity followed the order: T>BT>DBT. The effects of phthalocyanine concentration were studied by UV-Vis and calcination temperature was obtained by TG-DSC for Cu2(PcTN)2/W-HZSM-5. Catalysts were characterized by EA, IR, XRD, SEM, TEM, ICP, and N2 adsorption. Reaction time, temperature and the amount of catalyst were investigated as the important parameters for optimization of the reaction. Furthermore, a possible process of oxidative desulfurization and the reaction products were proposed. The reaction process of ultra-deep desulfurization.
Robust, high-throughput solution structural analyses by small angle X-ray scattering (SAXS)
Energy Technology Data Exchange (ETDEWEB)
Hura, Greg L.; Menon, Angeli L.; Hammel, Michal; Rambo, Robert P.; Poole II, Farris L.; Tsutakawa, Susan E.; Jenney Jr, Francis E.; Classen, Scott; Frankel, Kenneth A.; Hopkins, Robert C.; Yang, Sungjae; Scott, Joseph W.; Dillard, Bret D.; Adams, Michael W. W.; Tainer, John A.
2009-07-20
We present an efficient pipeline enabling high-throughput analysis of protein structure in solution with small angle X-ray scattering (SAXS). Our SAXS pipeline combines automated sample handling of microliter volumes, temperature and anaerobic control, rapid data collection and data analysis, and couples structural analysis with automated archiving. We subjected 50 representative proteins, mostly from Pyrococcus furiosus, to this pipeline and found that 30 were multimeric structures in solution. SAXS analysis allowed us to distinguish aggregated and unfolded proteins, define global structural parameters and oligomeric states for most samples, identify shapes and similar structures for 25 unknown structures, and determine envelopes for 41 proteins. We believe that high-throughput SAXS is an enabling technology that may change the way that structural genomics research is done.
Geus, de D.; Hartley, A.P.; Sedelnikova, S.E.; Glynn, S.E.; Baker, P.J.; Verhees, C.H.; Oost, van der J.; Rice, D.W.
2003-01-01
Galactokinase catalyses the conversion of galactose to galactose-1-phosphate as the first step in the Leloir pathway, a metabolic route that eventually enables the degradation of galactose via the glycolytic pathway. Galactokinases have been isolated from a wide range of prokaryotic and eukaryotic
Enhanced durability and reactivity for zinc ferrite desulfurization sorbent
Energy Technology Data Exchange (ETDEWEB)
Jha, M.C.; Berggren, M.H.
1989-05-02
AMAX Research Development Center (AMAX R D) has been investigating methods for enhancing the reactivity and durability of the zinc ferrite desulfurization sorbent. Zinc ferrite sorbents are intended for use in desulfurization of hot coal gas in integrated gasification combined cycle (IGCC) or molten carbonate fuel cell (MCFC) applications. For the present program, the reactivity of the sorbent may be defined as its sulfur sorption capacity at the breakthrough point and at saturation in a bench-scale, fixed-bed reactor. Durability may be defined as the ability of the sorbent to maintain important physical characteristics such As size, strength, and specific surface area during 10 cycles of sulfidation and oxidation.
DEEP DESULFURIZATION OF DIESEL FUELS BY A NOVEL INTEGRATED APPROACH
Energy Technology Data Exchange (ETDEWEB)
Xiaoliang Ma; Michael Sprague; Lu Sun; Chunshan Song
2002-10-01
In order to reduce the sulfur level in liquid hydrocarbon fuels for environmental protection and fuel cell applications, deep desulfurization of a model diesel fuel and a real diesel fuel was conducted by our SARS (selective adsorption for removing sulfur) process using the adsorbent A-2. Effect of temperature on the desulfurization process was examined. Adsorption desulfurization at ambient temperature, 24 h{sup -1} of LHSV over A-2 is efficient to remove dibenzothiophene (DBT) in the model diesel fuel, but difficult to remove 4-methyldibenzothiophene (4-MDBT) and 4,6-dimethyl-dibenzothiophene (4,6-DMDBT). Adsorption desulfurization at 150 C over A-2 can efficiently remove DBT, 4-MDBT and 4,6-DMDBT in the model diesel fuel. The sulfur content in the model diesel fuel can be reduced to less than 1 ppmw at 150 C without using hydrogen gas. The adsorption capacity corresponding to the break-through point is 6.9 milligram of sulfur per gram of A-2 (mg-S/g-A-2), and the saturate capacity is 13.7 mg-S/g-A-2. Adsorption desulfurization of a commercial diesel fuel with a total sulfur level of 47 ppmw was also performed at ambient temperature and 24 h{sup -1} of LHSV over the adsorbent A-2. The results show that only part of the sulfur compounds existing in the low sulfur diesel can be removed by adsorption over A-2 at such operating conditions, because (1) the all sulfur compounds in the low sulfur diesel are the refractory sulfur compounds that have one or two alkyl groups at the 4- and/or 6-positions of DBT, which inhibit the approach of the sulfur atom to the adsorption site; (2) some compounds coexisting in the commercial low sulfur diesel probably inhibit the interaction between the sulfur compounds and the adsorbent. Further work in determining the optimum operating conditions and screening better adsorbent is desired.
Thermodynamic assessment of IGCC power plants with hot fuel gas desulfurization
International Nuclear Information System (INIS)
Giuffrida, Antonio; Romano, Matteo C.; Lozza, Giovanni G.
2010-01-01
In IGCC power plants, hot gas desulfurization (HGD) represents an attractive solution to simplify syngas treatments and to improve the efficiency, potentially reducing the final cost of electricity. In the present study, the various consequences of the introduction of a HGD station in the power plant are discussed and evaluated, in comparison with conventional near-ambient temperature clean-up. Attention is paid to the potential improvements of the overall energy balance of the complete power station, along with the requirements of the sorbent regeneration process, to the influence of the desulfurization temperature and to the different solutions needed to control the NO x emissions (altered by the presence of HGD). The net performance of complete IGCC power plants (with HGD or with conventional desulfurization) were predicted, with reference to status-of-the-art solutions based on an entrained flow, dry-feed, oxygen-blown gasifier and on an advanced, FB-class combined cycle. The net efficiency experiences about 2.5% point improvement with HGD, even if a small reduction in the power output was predicted, when using the same combustion turbine. An exhaustive sensitivity analysis was carried out to evaluate the effects of different working conditions at the HGD station, e.g. desulfurization temperature and oxygen content in the gaseous stream for sorbent regeneration. According to the obtained results, these parameters have a weak influence on the efficiency. In particular, a very elevated desulfurization temperature (above 400-500 o C) does not provide decisive thermodynamic advantages. Therefore, the HGD unit optimization can be driven by technical and economical aspects and by emission abatement requirements. For instance, utilization of nitrogen for HGD sorbent regeneration (rather than for syngas dilution) and higher fuel temperature may improve the NO formation. Hence, different strategies to achieve acceptable NO x emissions (e.g. steam dilution) and their
Ultrasound-assisted oxidative desulfurization of bunker-C oil using tert-butyl hydroperoxide.
Tang, Qiong; Lin, Song; Cheng, Ying; Liu, Sujun; Xiong, Jun-Ru
2013-09-01
This work investigated the ultrasonic assisted oxidative desulfurization of bunker-C oil with TBHP/MoO3 system. The operational parameters for the desulfurization procedure such as ultrasonic irradiation time, ultrasonic wave amplitude, catalyst initial concentration and oxidation agent initial concentration were studied. The experimental results show that the present oxidation system was very efficient for the desulfurization of bunker-C oil and ~35% sulfur was removed which was dependent on operational parameters. The application of ultrasonic irradiation allowed sulfur removal in a shorter time. The stronger the solvent polarity is, the higher the sulfur removal rate, but the recovery rate of oil is lower. The sulfur compounds in bunker-C oil reacted with TBHP to produce corresponding sulfoxide, and further oxidation produced the corresponding sulfone. Copyright © 2013 Elsevier B.V. All rights reserved.
Experimental Study on Hot Metal Desulfurization Using Sintered Red Mud-Based Flux
Li, Fengshan; Zhang, Yanling; Guo, Zhancheng
2017-09-01
This research presents the results of laboratory and pilot-scale tests conducted on the use of sintered red mud (RM)-based flux in the hot metal desulfurization (HMD) process. Al2O3/Na2O in RM can decrease the melting point of lime-based slag and can work as a flux in the HMD process. Good slag fluidity was observed throughout the process, and high desulfurization rates ( 80%) with a low final S content (pilot-scale test results indicated that a desulfurization rate as high as 91% and a S content <0.0099% could be acquired when RM:lime = 1:1, verifying the feasibility of using sintered RM-based flux in HMD. The data obtained provide important information for promoting the large-scale application of sintered RM in steelmaking.
Determinació de l'estructura tridimensional de la glicogen sintasa de "Pyrococcus abyssi"
Horcajada Garro, Cristina
2005-01-01
Les glicogen i midó sintases són glicosiltransferases que catalitzen la transferència de residus glucosil a l'extrem no reductor d'una cadena creixent d'un glucà α-1,4, retenint la configuració del carboni anomèric del sucre transferit. Aquest procès és central en el metabolisme energètic de la majoria d'èssers vius.En aquest treball presentem l'estructura cristal·logràfica de la glicogen sintasa de Pyrococcus abyssi (PaGS). Aquest enzim és termoestable i presenta una activitat màxima a ...
Progress on flue gas desulfurization and denitration with electron beam irradiation in CAEP
International Nuclear Information System (INIS)
Ren Min; Wang Baojian; Yang Ruizhuang; Huang Wenfeng; He Xiaohai; Mao Benjiang
2005-01-01
The first pilot plant with electron beam irradiation for desulfurization and denitration of flue gas in China and the experimental results based on the pilot plant are briefly introduced in this paper. The FGD (flue gas desulfurization) demonstration installation designed by CAEP (China Academy of Engineering Physics) in Beijing Jingfeng Thermal Powe Co., Ltd. is recommended. (author)
Extractive de-sulfurization and de-ashing of high sulfur coals by oxidation with ionic liquids
International Nuclear Information System (INIS)
Saikia, Binoy K.; Khound, Kakoli; Baruah, Bimala P.
2014-01-01
Highlights: • Extractive de-sulfurization and de-ashing process for cleaning high sulfur coals. • The process removes inorganic as well as organic sulfur components from high sulfur coals. • The process has less risk to chemists and other surroundings. - Abstract: The environmental consequences of energy production from coals are well known, and are driving the development of desulfurization technologies. In this investigation, ionic liquids were examined for extractive desulfurization and de-ashing in industrially important high sulfur sub-bituminous Indian coals. The ionic liquids, namely, 1-n-butyl-3-methylimidazolium tetrafluoroborate (IL1) and 1-n-butyl 3-methylimidazolium chloride (IL2) were employed for desulfurization of a few Indian coal samples in presence of HCOOH/H 2 O 2 and V 2 O 5 . Results show the maximum removal of 50.20% of the total sulfur, 48.00% of the organic sulfur, and 70.37 wt% of the ash in this process. The ionic liquids were recovered and subsequently used for further desulfurization. FT-IR spectra reveal the transformation of organic sulfur functionalities into the sulfoxides (S=O) and sulfones (-SO 2 ) due to the oxidative reactions. The sulfate, pyrite and sulfides (aryls) signals in the near edge X-ray absorption fine structure (NEXAFS) of the oxidized coal samples showed sulfur transformation during the desulfurization process. The study demonstrates the removal of significant amount of inorganic as well as organic sulfur (aryls) components from the original high sulfur coal samples to make them cleaner
Osawa, Takuo; Inanaga, Hideko; Numata, Tomoyuki
2015-06-01
Clustered regularly interspaced short palindromic repeat (CRISPR)-derived RNA (crRNA) and CRISPR-associated (Cas) proteins constitute a prokaryotic adaptive immune system (CRISPR-Cas system) that targets and degrades invading genetic elements. The type III-B CRISPR-Cas Cmr complex, composed of the six Cas proteins (Cmr1-Cmr6) and a crRNA, captures and cleaves RNA complementary to the crRNA guide sequence. Here, a Cmr1-deficient functional Cmr (CmrΔ1) complex composed of Pyrococcus furiosus Cmr2-Cmr3, Archaeoglobus fulgidus Cmr4-Cmr5-Cmr6 and the 39-mer P. furiosus 7.01-crRNA was prepared. The CmrΔ1 complex was cocrystallized with single-stranded DNA (ssDNA) complementary to the crRNA guide by the vapour-diffusion method. The crystals diffracted to 2.1 Å resolution using synchrotron radiation at the Photon Factory. The crystals belonged to the triclinic space group P1, with unit-cell parameters a = 75.5, b = 76.2, c = 139.2 Å, α = 90.3, β = 104.8, γ = 118.6°. The asymmetric unit of the crystals is expected to contain one CmrΔ1-ssDNA complex, with a Matthews coefficient of 2.03 Å(3) Da(-1) and a solvent content of 39.5%.
A First Analysis of Metallome Biosignatures of Hyperthermophilic Archaea
Directory of Open Access Journals (Sweden)
Vyllinniskii Cameron
2012-01-01
Full Text Available To date, no experimental data has been reported for the metallome of hyperthermophilic microorganisms although their metal requirements for growth are known to be unique. Here, experiments were conducted to determine (i cellular trace metal concentrations of the hyperthermophilic Archaea Methanococcus jannaschii and Pyrococcus furiosus, and (ii a first estimate of the metallome for these hyperthermophilic species via ICP-MS. The metal contents of these cells were compared to parallel experiments using the mesophilic bacterium Escherichia coli grown under aerobic and anaerobic conditions. Fe and Zn were typically the most abundant metals in cells. Metal concentrations for E. coli grown aerobically decreased in the order Fe > Zn > Cu > Mo > Ni > W > Co. In contrast, M. jannaschii and P. furiosus show almost the reverse pattern with elevated Ni, Co, and W concentrations. Of the three organisms, a biosignature is potentially demonstrated for the methanogen M. jannaschii that may, in part, be related to the metallome requirements of methanogenesis. The bioavailability of trace metals more than likely has varied through time. If hyperthermophiles are very ancient, then the trace metal patterns observed here may begin to provide some insights regarding Earth's earliest cells and in turn, early Earth chemistry.
Use of Flue Gas Desulfurization (FGD) Gypsum as a Heavy Metal Stabilizer in Contaminated Soils
Flue Gas Desulfurization (FGD) gypsum is a synthetic by-product generated from the flue gas desulfurization process in coal power plants. It has several beneficial applications such as an ingredient in cement production, wallboard production and in agricultural practice as a soil...
Energy Technology Data Exchange (ETDEWEB)
Wang Fang-fang; Zhao Hai; Zhang De-xiang; Gao Jin-sheng [East China University of Science and Technology. Shanghai (China). School of Resource and Environmental Engineering
2008-02-15
The sorbent, atmospheric and components of outlet gas were analyzed by mass spectra, XRD, SEM, EDS etc. Desulfurisation performance of sorbents is good at 240 - 400 {sup o}C, atmospheric pressure and space speed of 500 - 2,000 h {sup -1}. The possible mechanism of desulfurisation reactions was obtained by analyzing the reduction- adsorption-sulfidation process. Carbon oxysulfide (COS) was converted to H{sub 2}S by hydrogen in strongly reducing atmosphere firstly. Then H{sub 2}S was adsorbed on the surface of desulfurizers, reacted with active component and transformed metal sulfides and water. Efficiency of removal of carbonyl sulfur is better in an atmosphere without carbonaceous oxide than in one with it, under test conditions. The existence of carbonaceous oxide restrains hydrogenation and the hydrolytic process of COS, which leads to a higher concentration of COS in the outlet. It is shown that chemical conversion is the main pathway in the reaction system of COS. Hydrogenation is the main process in the removal of COS from syngas. COS is preferentially catalyzed with active components n desulfurization sorbents, and generates H{sub 2}S which is subsequently absorbed. 13 refs., 4 figs., 2 tabs.
Method for enhancing the desulfurization of hot coal gas in a fluid-bed coal gasifier
Grindley, Thomas
1989-01-01
A process and apparatus for providing additional desulfurization of the hot gas produced in a fluid-bed coal gasifier, within the gasifier. A fluid-bed of iron oxide is located inside the gasifier above the gasification bed in a fluid-bed coal gasifier in which in-bed desulfurization by lime/limestone takes place. The product gases leave the gasification bed typically at 1600.degree. to 1800.degree. F. and are partially quenched with water to 1000.degree. to 1200.degree. F. before entering the iron oxide bed. The iron oxide bed provides additional desulfurization beyond that provided by the lime/limestone.
Energy Technology Data Exchange (ETDEWEB)
Dipu Borah [Pragjyotika J College, Titabar (India). Department of Chemistry
2006-02-01
The desulfurization reaction involving direct electron transfer from potassium ferrocyanide, K{sub 4}(Fe(CN){sub 6}), successfully removed organic sulfur from a subbituminous coal. The temperature variation of desulfurization revealed that increase of temperature enhanced the level of sulfur removal. Moreover, the desulfurization reaction was found to be dependent on the concentration of K{sub 4}(Fe(CN){sub 6}). Gradual increase in the concentration of K{sub 4}(Fe(CN){sub 6}) raised the magnitude of desulfurization, but at higher concentration the variation was not significant. The removal of organic sulfur from unoxidized coal slightly increased with reduced particle size. Desulfurization from oxidized coals (prepared by aerial oxidation) revealed a higher level of sulfur removal in comparison to unoxidized coal. Highest desulfurization of 36.4 wt % was obtained at 90{sup o}C and 0.1 M concentration of K{sub 4}(Fe(CN){sub 6}) in the 100-mesh size oxidized coal prepared at 200{sup o}C. Model sulfur compound study revealed that aliphatic types of sulfur compounds are primarily responsible for desulfurization. Because of higher stability, thiophene and condensed thiophene-type of compounds perhaps remained unaffected by the electron-transfer agent. Infrared study revealed the formation of oxidized sulfur compounds (sulfoxide, sulfone, sulfonic acid, etc.) in the oxidized coals. The desulfurization reaction in different systems is well-represented by the pseudo-first-order kinetic model. Application of the transition state theory indicated that the desulfurization reaction proceeds with the absorption of heat (endothermic reaction) and is nonspontaneous in nature. 53 refs., 6 figs., 3 tabs.
Energy Technology Data Exchange (ETDEWEB)
Ren, Bin, E-mail: ren@csb.ki.se [Center for Structural Biochemistry, Karolinska Institute, NOVUM, S-141 57 Huddinge (Sweden); Kuhn, Joëlle; Meslet-Cladiere, Laurence; Myllykallio, Hannu [Université Paris-Sud, Institut de Génétique et Microbiologie, Centre National de la Recherche Scientifique Unité Mixte de Recherche 8621, F-91405 Orsay CEDEX (France); Ladenstein, Rudolf [Center for Structural Biochemistry, Karolinska Institute, NOVUM, S-141 57 Huddinge (Sweden)
2007-05-01
A RecB-like nuclease from the archaeon Pyrococcus abyssi was expressed, purified and crystallized. The crystals belong to the orthorhombic space group C222{sub 1} with a = 81.5, b = 159.8, c = 100.8 Å, and a native data set was collected to 2.65 Å resolution. Nucleases are required to process and repair DNA damage in living cells. One of the best studied nucleases is the RecB protein, which functions in Escherichia coli as a component of the RecBCD enzyme complex that amends double-strand breaks in DNA. Although archaea do not contain the RecBCD complex, a RecB-like nuclease from Pyrococcus abyssi has been cloned, expressed and purified. The protein was crystallized by the sitting-drop vapour-diffusion method using polyethylene glycol 8000 as the precipitant. The crystals belong to the orthorhombic space group C222{sub 1}, with unit-cell parameters a = 81.5, b = 159.8, c = 100.8 Å. Self-rotation function and native Patterson map calculations revealed that there is a dimer in the asymmetric unit with its local twofold axis running parallel to the crystallographic twofold screw axis. The crystals diffracted to about 2 Å and a complete native data set was collected to 2.65 Å resolution.
Simple biogas desulfurization by microaeration - Full scale experience.
Jeníček, P; Horejš, J; Pokorná-Krayzelová, L; Bindzar, J; Bartáček, J
2017-08-01
Hydrogen sulfide in biogas is common problem during anaerobic treatment of wastewater with high sulfate concentration (breweries, distilleries, etc.) and needs to be removed before biogas utilization. Physico-chemical desulfurization methods are energetically demanding and expensive compare to biochemical methods. Microaeration, i.e. dosing of small amount of air, is suitable and cost effective biochemical method of sulfide oxidation to elemental sulfur. It has been widely used in biogas plants, but its application in anaerobic reactors for wastewater treatment has been rarely studied or tested. The lack of full-scale experience with microaeration in wastewater treatment plants has been overcome by evaluating the results of seven microaerobic digesters in central Europe. The desulfurization efficiency has been more than 90% in most of the cases. Moreover, microaeration improved the degradability of COD and volatile suspended solids. Copyright © 2017 Elsevier Ltd. All rights reserved.
Design considerations for wet flue gas desulfurization systems - wet scrubber hardware issues
Energy Technology Data Exchange (ETDEWEB)
Hurwitz, H.
1994-12-31
About 20 years ago the first wet flue gas desulfurization systems installed on coal fired utility boilers in the United States were experiencing extreme operating problems. In addition to their failure to achieve the necessary SO{sub 2} removal efficiencies, these FGD systems required a major investment in maintenance, both material and labor, just to remain operational. These first generation systems demonstrated that a lack of understanding of the chemistry and operating conditions of wet flue gas desulfurization can lead to diastrous results. As the air pollution control industry developed, both in the United States and in Japan, a second generation of FGD systems was introduced. These designs incorporated major improvements in both system chemistry control and in the equipment utilized in the process. Indeed, the successful introduction of utility gas desulfurization systems in Germany was possible only through the transfer of the technology improvements developed in the US and in Japan. Today, technology has evolved to a third generation of wet flue gas desulfurication systems and these systems are now offered worldwide through a series of international licensing agreements. The rapid economic growth and development in Asia and the Pacific Rim combined with existing problems in ambient air quality in these same geographic areas, has resulted in the use of advanced air pollution control systems; including flue gas desulfurization both for new utility units and for many retrofit projects. To meet the requirements of the utility industry, FGD systems must meet high standards of reliability, operability and performance. Key components in achieving these objectives are: FGD System reliability/operability/performance; FGD system supplier qualifications; process design; equipment selection. This paper will discuss each of the essential factors with a concentration on the equipment selection and wet scrubber hardware issues.
Comments on "Ceria-Zirconia High-Temperature Desulfurization Sorbents".
Czech Academy of Sciences Publication Activity Database
Hartman, Miloslav; Trnka, Otakar
2006-01-01
Roč. 45, č. 4 (2006), s. 1548-1549 ISSN 0888-5885 Institutional research plan: CEZ:AV0Z40720504 Keywords : hydrogen sulfide * desulfurization * cerium sorbent Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.518, year: 2006
Hiraki, Takehito; Kobayashi, Junichi; Urushibata, Satomi; Matsubae, Kazuyo; Nagasaka, Tetsuya
2012-08-01
The oxidation behavior of sulfur in desulfurization slag generated from the secondary steelmaking process with air has been investigated in the temperature range of 973 K to 1373 K (700 °C to 1100 °C). Although a high removal rate of sulfur is not achieved at temperatures lower than 1273 K (1000 °C) because of the formation of CaSO4, most of the sulfur is rapidly removed from slag as SO2 gas in the 1273 K to 1373 K (700 °C to 1100 °C) range. This finding indicates that the desulfurization slag generated from the secondary steelmaking process can be reused as a desulfurized flux through air oxidation, making it possible to reduce significantly the amount of desulfurization slag for disposal.
Lü, Hongying; Li, Pengcheng; Deng, Changliang; Ren, Wanzhong; Wang, Shunan; Liu, Pan; Zhang, Han
2015-07-07
An oxalate-based DES with a tetrabutyl ammonium chloride and oxalate acid molar ratio of 1/2 (TBO1 : 2) exhibited high activity in oxidative desulfurization (ODS) of dibenzothiophene (DBT) under mild reaction conditions. It is potentially a promising and highly environmentally friendly approach for desulfurization of fuels.
Advanced sulfur control concepts for hot gas desulfurization technology
International Nuclear Information System (INIS)
1998-01-01
The objective of this project is to develop a hot-gas desulfurization process scheme for control of H 2 S in HTHP coal gas that can be more simply and economically integrated with known regenerable sorbents in DOE/METC-sponsored work than current leading hot-gas desulfurization technologies. In addition to being more economical, the process scheme to be developed must yield an elemental sulfur byproduct. The Direct Sulfur Recovery Process (DSRP), a leading process for producing an elemental sulfur byproduct in hot-gas desulfurization systems, incurs a coal gas use penalty, because coal gas is required to reduce the SO 2 in regeneration off-gas to elemental sulfur. Alternative regeneration schemes, which avoid coal gas use and produce elemental sulfur, will be evaluated. These include (i) regeneration of sulfided sorbent using SO 2 ; (ii) partial oxidation of sulfided sorbent in an O 2 starved environment; and (iii) regeneration of sulfided sorbent using steam to produce H 2 S followed by direct oxidation of H 2 S to elemental sulfur. Known regenerable sorbents will be modified to improve the feasibility of the above alternative regeneration approaches. Performance characteristics of the modified sorbents and processes will be obtained through lab- and bench-scale testing. Technical and economic evaluation of the most promising processes concept(s) will be carried out
HIGH EFFICIENCY DESULFURIZATION OF SYNTHESIS GAS
Energy Technology Data Exchange (ETDEWEB)
Anirban Mukherjee; Kwang-Bok Yi; Elizabeth J. Podlaha; Douglas P. Harrison
2001-11-01
Mixed metal oxides containing CeO{sub 2} and ZrO{sub 2} are being studied as high temperature desulfurization sorbents capable of achieving the DOE Vision 21 target of 1 ppmv of less H{sub 2}S. The research is justified by recent results in this laboratory that showed that reduced CeO{sub 2}, designated CeO{sub n} (1.5 < n < 2.0), is capable of achieving the 1 ppmv target in highly reducing gas atmospheres. The addition of ZrO{sub 2} has improved the performance of oxidation catalysts and three-way automotive catalysts containing CeO{sub 2}, and should have similar beneficial effects on CeO{sub 2} desulfurization sorbents. An electrochemical method for synthesizing CeO{sub 2}-ZrO{sub 2} has been developed and the products have been characterized by XRD and TEM during year 01. Nanocrystalline particles having a diameter of about 5 nm and containing from approximately 10 mol% to 80 mol% ZrO{sub 2} have been prepared. XRD showed the product to be a solid solution at low ZrO{sub 2} contents with a separate ZrO{sub 2} phase emerging at higher ZrO{sub 2} levels. Phase separation did not occur when the solid solutions were heat treated at 700 C. A flow reactor system constructed of quartz and teflon has been constructed, and a gas chromatograph equipped with a pulsed flame photometric detector (PFPD) suitable for measuring sub-ppmv levels of H{sub 2}S has been purchased with LSU matching funds. Preliminary desulfurization tests using commercial CeO{sub 2} and CeO{sub 2}-ZrO{sub 2} in highly reducing gas compositions has confirmed that CeO{sub 2}-ZrO{sub 2} is more effective than CeO{sub 2} in removing H{sub 2}S. At 700 C the product H{sub 2}S concentration using CeO{sub 2}-ZrO{sub 2} sorbent was near the 0.1 ppmv PFPD detection limit during the prebreakthrough period.
Enhancement of Oxidative Desulfurization Performance over UiO-66(Zr) by Titanium Ion Exchange.
Ye, Gan; Qi, Hui; Li, Xiaolin; Leng, Kunyue; Sun, Yinyong; Xu, Wei
2017-07-19
Oxidative desulfurization is considered to be one of the most promising methods for producing ultra-low-sulfur fuels because it can effectively remove refractory sulfur-containing aromatic compounds under mild conditions. In this work, the oxidative desulfurization performance over UiO-66(Zr) is greatly enhanced by Ti ion exchange. This strategy is not only efficient for UiO-66(Zr) with crystal defects but also for UiO-66(Zr) with high crystallinity. In particular, the performance of UiO-66(Zr) with high crystallinity in the oxidative desulfurization of dibenzothiophene can be improved more than 11-fold, which can be mainly attributed to the introduction of active Ti sites. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Effect of Rhodococcus sp. on desulfurization, swelling and extraction of coal
Energy Technology Data Exchange (ETDEWEB)
Wang De-qiang; Shui Heng-fu [University of Technology of Anhui, Maanshang (China). School of Chemical Engineering
2006-08-15
Bio-desulfurization of coal by rhodococcus sp. was studied. Some kinds of coal were swelled with different organic solvents, and then the swelled coals were treated by rhodococcus sp. The results show that the ratios of desulfurization of coals increase after they are swelled, especially swelled with NMP, the ratio is more than 80%. The swelling and extraction of coal were also studied after the coal had been treated by rhodococcus sp. The results show that the ratios of swelling increase more than 65%, but the extraction yield decreases for the coal treated by rhodococcus sp. 11 refs., 5 tabs.
Production and performance of desulfurized rubber asphalt binder
Directory of Open Access Journals (Sweden)
Yanping Sheng
2017-05-01
Full Text Available Asphalt rubber binder typically exhibits disadvantages like segregation and high viscosity; however, this can be improved by the incorporation of desulfurized rubber powder. This study examined the swelling principle of desulfurized rubber asphalt (DRA. In addition, it evaluated the performance of DRA fabricated with various rubber powder contents under different shear conditions and development time. Superpave binders tests, including Brookfield viscosity, dynamic shear rheometer (DSR and bending beam rheometer (BBR tests, were applied on three control binders (i.e., neat, 20 mesh asphalt rubber binder, 40 mesh asphalt rubber binder and a DRA binder. Binder testing results indicated that rubber powder swelled into the base binder and resulted in enhanced stability. Optimum performance of the DRA binder was achieved by adding 20% (by weight of rubber powder into the base binder at shear rate, shear temperature, shear time and development time of 7000 r/min, 170 °C, 60 min and 45 min, respectively. Modified ranges of production conditions were also provided to widen the application of DRA in field construction. It appeared that DRA binder benefited from the recovered plasticity and viscosity of the rubber and consequently, exhibited superior performance over the neat and conventional asphalt rubber binders. Preliminary mixture evaluation was also conducted and the DRA binder was found to significantly improve the mixture resistance to permanent deformation and water damage. Overall, the DAR binder is encouraged to be used as a modified binder for flexible pavements. Keywords: Desulfurized rubber asphalt, Swelling model, Production process, Asphalt performance, Rubber asphalt
A modeling and experimental study of flue gas desulfurization in a dense phase tower
International Nuclear Information System (INIS)
Chang, Guanqin; Song, Cunyi; Wang, Li
2011-01-01
We used a dense phase tower as the reactor in a novel semi-dry flue gas desulfurization process to achieve a high desulfurization efficiency of over 95% when the Ca/S molar ratio reaches 1.3. Pilot-scale experiments were conducted for choosing the parameters of the full-scale reactor. Results show that with an increase in the flue gas flow rate the rate of the pressure drop in the dense phase tower also increases, however, the rate of the temperature drop decreases in the non-load hot gas. We chose a water flow rate of 0.6 kg/min to minimize the approach to adiabatic saturation temperature difference and maximize the desulfurization efficiency. To study the flue gas characteristics under different processing parameters, we simulated the desulfurization process in the reactor. The simulated data matched very well with the experimental data. We also found that with an increase in the Ca/S molar ratio, the differences between the simulation and experimental data tend to decrease; conversely, an increase in the flue gas flow rate increases the difference; this may be associated with the surface reactions caused by collision, coalescence and fragmentation between the dispersed phases.
Ma, Shuangchen; Chai, Jin; Wu, Kai; Xiang, Yajun; Jia, Shaoguang; Li, Qingsong
2018-03-20
Zero liquid discharge (ZLD) of wastewater has become the trend of environmental governance after the implementation of 'The Action Plan for Prevention and Treatment of Water Pollution' in China, desulfurization wastewater has gained more attention due to its complex composition and heavy metals. However, current technologies for ZLD have some shortcomings such as high cost and insufficient processing capacity, ZLD cannot be achieved actually. This paper proposes a new evaporation drying technology. An independent bypass evaporation tower was built, part of the hot flue gas before the air preheater was introduced into the evaporation tower for desulfurization wastewater evaporation, and the generated dust after evaporation was discharged back to the flue duct before electrostatic precipitator. This paper reports on the performance of desulfurization wastewater evaporation and the characteristics of evaporation products in depth and makes a comprehensive discussion of the impact on the existing equipment based on the self-designed evaporation tower. Research suggests that this technology has high system reliability and little effect on subsequent equipment and provides theoretical and practical data. Due to environmental policies and huge market demand for ZLD of desulfurization wastewater, bypass evaporation tower technology has a great application prospect in the future.
MARKETING OF BYPRODUCT GYPSUM FROM FLUE GAS DESULFURIZATION
The report gives results of an evaluation of the 1985 marketing potential of byproduct gypsum from utility flue gas desulfurization (FGD), for the area east of the Rocky Mountains, using the calculated gypsum production rates of 14 selected power plants. The 114 cement plants and...
Xu, Junhua; Zhao, Shen; Ji, Yuanchun; Song, Yu-Fei
2013-01-07
Amphiphilic lanthanide-containing polyoxometalates (POMs) were prepared by surfactant encapsulation. Investigation of these lanthanide-containing POMs in oxidative desulfurization (ODS) showed that highly efficient deep desulfurization could be achieved in only 14 min with 100% conversion of dibenzothiophene under mild conditions by using (DDA)(9)LaW(10)/[omim]PF(6) (DDA=dimethyldioctadecylammonium, omim=1-octyl-3-methyl-imidazolium) in the presence of H(2) O(2) . Furthermore, deep desulfurization proceeds smoothly in model oil with an S content as low as 50 ppm. A scaled-up experiment in which the volume of model oil was increased from 5 to 1000 mL with S content of 1000 ppm indicated that about 99% sulfur removal can be achieved in 40 mins in an ionic-liquid emulsion system. To the best of our knowledge, the (DDA)(9)LaW(10)/[omim]PF(6) catalyst system with H(2)O(2) as oxidant is one of the most efficient desulfurization systems reported so far. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
A three-phase comprehensive mathematical model of desulfurization in electroslag remelting process
International Nuclear Information System (INIS)
Wang, Qiang; Li, Guangqiang; He, Zhu; Li, Baokuan
2017-01-01
Highlights: • First developed a three-phase coupled model of desulfurization in ESR process. • The MHD thermal flow in the reactor was clarified. • Distributions of sulfur concentration in the three phases were demonstrated. • An experiment was carried out to validate the simulation. - Abstract: A three-phase comprehensive mathematical model has been established to study the desulfurization behavior in electroslag remelting (ESR) process. The solutions of the mass, momentum, energy, and species conservation equations were simultaneously calculated by the finite volume method. The Joule heating and Lorentz force were fully coupled through solving the Maxwell’s equations with the assistance of the magnetic potential vector. The movements of the air-slag and slag-metal interfaces were described by the volume of fluid (VOF) approach. In order to include the influences of the air, the slag and the electric current on the desulfurization, a thermodynamic and kinetic module was introduced. An experiment was conducted to validate the model. The completely comparison between the measured and simulated data indicates that the model can describe the desulfurization behavior in the ESR process with an acceptable accuracy. The sulfur in the metal would be transferred into the slag under the combined effect of the slag treatment and the electrochemical reaction, and is primarily achieved in the period of the droplet formation. The sulfur in the slag then could be transferred into the air because of the oxidation. The maximum calculated removal ratio in the whole process is around 88%.
Energy Technology Data Exchange (ETDEWEB)
Qiu, Jianghua; Wang, Guanghui; Zeng, Danlin; Tang, Yan [College of Chemical Engineering and Technology, Wuhan University of Science and Technology, Wuhan 430081 (China); Wang, Meng; Li, Yanjun [College of Chemistry and Molecular Sciences, Wuhan University, Wuhan 430072 (China)
2009-12-15
Phosphomolybdic acid (HPMo) modified respectively with tetramethyl ammonium chloride (TMAC), dodecyl trimethyl ammonium chloride (DTAC) and hexadecyl trimethyl ammonium chloride (HTAC) as the catalysts were prepared and characterized by FT-IR, XRD and SEM. The catalysts were evaluated for the oxidative desulfurization of benzothiophene (BT), dibenzothiophene (DBT) and straight-run diesel using hydrogen peroxide as an oxidant. Results show that all of the catalysts keep the Keggin structures and are finely dispersed with mixing of quaternary ammonium salts. Hexadecyl chains are more favorable to wrap up DBT to the catalytic center and form stable emulsion system with higher conversion rates of DBT. The shorter dodecyl chains can wrap up BT more suitably and bring smaller steric hindrance, which display higher conversion rates of BT. The oxidative reactions fit apparent first-order kinetics, and the apparent activation energies of DBT are much lower than those of BT. The desulfurization rate of straight-run diesel can be up to 84.4% with the recovery rate of 98.1% catalyzed by [HPMo][HTAC]{sub 2} in 2 h. When increasing the extraction times, the desulfurization rates increase, but the recovery rates of diesel decrease significantly. (author)
Improving the desulfurization performance of CaCO3 with sodium humate
Feng, Run; Sun, Zhiguo; Zhang, Wenqing; Huang, Hao; Hu, Haihang; Zhang, Li; Xie, Hongyong
2018-02-01
The influence of these factors on desulphurization efficiency was studied by changing the amount of calcium carbonate, the concentration of sulfur dioxide, the liquid flow rate of absorbent and the air flow rate, the optimum working condition was determined by the research of limestone-gypsum desulphurization process commonly used in industry. By changing the amount of calcium carbonate, we conclude that the volume of water in the desulfurization efficiency does not increase with the adding amount of calcium carbonate. The optimum conditions were determined : at the condicion of the concentration of 500ppm of sulfur dioxide, 10g calcium carbonate, 150L/h liquid flow and the minimum air flow rate of 6.75m3/h, the highest desulfurization efficiency was close to 100% when sodium humate was not added, but the holding time was only about 5 minutes. After adding 3g of humic acid, the desulfurization efficiency was improved obviously, and the instantaneous efficiency of 100% lasting for about 40 minutes. It can be seen that, calcium carbonate in the addition of humic acid sodium can significantly improve the absorption of calcium carbonate performance of SO2.
Radiation-induced desulfurization of Arabian crude oil and straight-run diesel
Basfar, A. A.; Mohamed, K. A.
2011-11-01
Radiation-induced desulfurization of four types of Arabian crude oils (heavy, medium, light and extra light) and straight-run diesel (SRD) was investigated over the range of 10-200 kGy. Results show that gamma radiation processing at absorbed doses up to 200 kGy without further treatment is not sufficient for desulfurization. However, the combination of gamma-irradiation with other physical/chemical processes (i.e. L/L extraction, adsorption and oxidation) may be capable of removing considerable levels of sulfur compounds in the investigated products. Currently, this approach of combined radiation/physical/chemical processes is under investigation. The findings of these attempts will be reported in the future.
Workshop on sulfur chemistry in flue gas desulfurization
Energy Technology Data Exchange (ETDEWEB)
Wallace, W.E. Jr.
1980-05-01
The Flue Gas Desulfurization Workshop was held at Morgantown, West Virginia, June 7-8, 1979. The presentations dealt with the chemistry of sulfur and calcium compounds in scrubbers. DOE and EPRI programs in this area are described. Ten papers have been entered individually into EDB and ERA. (LTN)
International Nuclear Information System (INIS)
González Sánchez, Armando; Flores Márquez, Trinidad Eliseo; Revah, Sergio; Morgan Sagastume, Juan Manuel
2014-01-01
Operational experiences and strategies to get suitable chemolithoautotrophic sulfide-oxidizing biomass from activated sludge wastewater treatment plant for its deploying in a full-scale biogas desulfurization plant are described. An economic nutrient source was applied to foster microbial selection and rapid growth. Respirometry was implemented on full-scale installations to monitor the ability of the specialized bacteria consortium to oxidize reduced sulfur i.e. H 2 S. During the deployment in the full-scale desulfurization reactor, intermittent sulfide feed from biogas scrubbing was performed to accelerate the startup the desulfurization process. - Highlights: • A simple method for reaching high amounts of specialized sulfide-oxidizing bacterial consortium from activated sludge was developed. • The full-scale desulfurization process can be continuously monitored by respirometry allowing fast decision making if problems arise. • The dissolved sulfide concentration was estimated with an empirical correlation between measurements of ORP, dissolved oxygen and pH
HIGH EFFICIENCY DESULFURIZATION OF SYNTHESIS GAS
Energy Technology Data Exchange (ETDEWEB)
Kwang-Bok Yi; Anirban Mukherjee; Elizabeth J. Podlaha; Douglas P. Harrison
2004-03-01
Mixed metal oxides containing ceria and zirconia have been studied as high temperature desulfurization sorbents with the objective of achieving the DOE Vision 21 target of 1 ppmv or less H{sub 2}S in the product gas. The research was justified by recent results in this laboratory that showed that reduced CeO{sub 2}, designated CeOn (1.5 < n < 2.0), is capable of achieving the 1 ppmv target in highly reducing gas atmospheres. The addition of ZrO{sub 2} has improved the performance of oxidation catalysts and three-way automotive catalysts containing CeO{sub 2}, and was postulated to have similar beneficial effects on CeO{sub 2} desulfurization sorbents. An electrochemical method for synthesizing CeO{sub 2}-ZrO{sub 2} mixtures was developed and the products were characterized by XRD and TEM during year 01. Nanocrystalline particles having a diameter of about 5 nm and containing from approximately 10 mol% to 80 mol% ZrO{sub 2} were prepared. XRD analysis showed the product to be a solid solution at low ZrO{sub 2} contents with a separate ZrO{sub 2} phase emerging at higher ZrO{sub 2} levels. Unfortunately, the quantity of CeO{sub 2}-ZrO{sub 2} that could be prepared electrochemically was too small to permit desulfurization testing. Also during year 01 a laboratory-scale fixed-bed reactor was constructed for desulfurization testing. All components of the reactor and analytical systems that were exposed to low concentrations of H{sub 2}S were constructed of quartz, Teflon, or silcosteel. Reactor product gas composition as a function of time was determined using a Varian 3800 gas chromatograph equipped with a pulsed flame photometric detector (PFPD) for measuring low H{sub 2}S concentrations from approximately 0.1 to 10 ppmv, and a thermal conductivity detector (TCD) for higher concentrations of H{sub 2}S. Larger quantities of CeO{sub 2}-ZrO{sub 2} mixtures from other sources, including mixtures prepared in this laboratory using a coprecipitation procedure, were obtained
3D CFD Modeling of the LMF System: Desulfurization Kinetics
Cao, Qing; Pitts, April; Zhang, Daojie; Nastac, Laurentiu; Williams, Robert
A fully transient 3D CFD modeling approach capable of predicting the three phase (gas, slag and steel) fluid flow characteristics and behavior of the slag/steel interface in the argon gas bottom stirred ladle with two off-centered porous plugs (Ladle Metallurgical Furnace or LMF) has been recently developed. The model predicts reasonably well the fluid flow characteristics in the LMF system and the observed size of the slag eyes for both the high-stirring and low-stirring conditions. A desulfurization reaction kinetics model considering metal/slag interface characteristics is developed in conjunction with the CFD modeling approach. The model is applied in this study to determine the effects of processing time, and gas flow rate on the efficiency of desulfurization in the studied LMF system.
Lou, Wentao; Zhu, Miaoyong
2014-10-01
A computation fluid dynamics-simultaneous reaction model (CFD-SRM) coupled model has been proposed to describe the desulfurization behavior in a gas-stirred ladle. For the desulfurization thermodynamics, different models were investigated to determine sulfide capacity and oxygen activity. For the desulfurization kinetic, the effect of bubbly plume flow, as well as oxygen absorption and oxidation reactions in slag eyes are considered. The thermodynamic and kinetic modification coefficients are proposed to fit the measured data, respectively. Finally, the effects of slag basicity and gas flow rate on the desulfurization efficiency are investigated. The results show that as the interfacial reactions (Al2O3)-(FeO)-(SiO2)-(MnO)-[S]-[O] simultaneous kinetic equilibrium is adopted to determine the oxygen activity, and the Young's model with the modification coefficient R th of 1.5 is adopted to determine slag sulfide capacity, the predicted sulfur distribution ratio LS agrees well with the measured data. With an increase of the gas blowing time, the predicted desulfurization rate gradually decreased, and when the modification parameter R k is 0.8, the predicted sulfur content changing with time in ladle agrees well with the measured data. If the oxygen absorption and oxidation reactions in slag eyes are not considered in this model, then the sulfur removal rate in the ladle would be overestimated, and this trend would become more obvious with an increase of the gas flow rate and decrease of the slag layer height. With the slag basicity increasing, the total desulfurization ratio increases; however, the total desulfurization ratio changes weakly as the slag basicity exceeds 7. With the increase of the gas flow rate, the desulfurization ratio first increases and then decreases. When the gas flow rate is 200 NL/min, the desulfurization ratio reaches a maximum value in an 80-ton gas-stirred ladle.
Institute of Scientific and Technical Information of China (English)
翁斯灏; 吴幼青
1996-01-01
57Fe Mossbauer spectroscopy was used to investigate the evolution of Fe-Zn binary metal oxide sorbent in the process of high-temperature fuel gas desulfurization. The results of phase analyses show that Fe-Zn binary metal oxide sorbent is rapidly reduced in hot fuel gas and decomposed to new phases of highly dispersed microcrystalline elemental iron and zinc oxide, both of which become the active desulfurization constituents. A complementary and synergistic effect between active iron acting as a high sulfur capacity constituent and active zinc oxide acting as a deep refining desulfurization constituent exists in this type of sorbent for hot fuel gas desulfurization.
Methods for dry desulfurization of flue gas
International Nuclear Information System (INIS)
Bjondahl, F.
2002-01-01
In this report different types of dry desulfurization processes are de-scribed. These processes are utilized for the removal of SO 2 from flue gases. Basic process descriptions, information on different sorbent types and their properties and some comments based on the authors own experience are included. Information on disposal or use of the end product from these processes is also provided. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ambedkar, B. [Indian Institute of Technology Madras, Chennai (India). Dept. of Chemical Engineering
2012-07-01
This study focuses on the physical aspects of ultrasonic de-ashing and de-sulfurization, such as cavitation, streaming and their combined effects. Ambedkar Balraj proposes an ultrasound-assisted coal particle breakage mechanism and explores aqueous and solvent-based ultrasonic techniques for de-ashing and de-sulfurization. Ambedkar designs a Taguchi L-27 fractional-factorial matrix to assess the individual effects of key process variables. In this volume he also describes process optimization and scale-up strategies. The author provides a mechanism-based model for ultrasonic reagent-based coal de-sulfurization, proposes a flow diagram for ultrasonic methods of high-throughput coal-wash and discusses the benefits of ultrasonic coal-wash. Coal will continue to be a major fuel source for the foreseeable future and this study helps improve its use by minimising ash and sulfur impurities.
Method and apparatus for enhancing the desulfurization of hot coal gas in a fluid-bed coal gasifier
Grindley, T.
1988-04-05
A process and apparatus for providing additional desulfurization of the hot gas produced in a fluid-bed coal gasifier, within the gasifier is described. A fluid-bed of iron oxide is located inside the gasifier above the gasification bed in a fluid-bed coal gasifier in which in-bed desulfurization by lime/limestone takes place. The product gases leave the gasification bed typically at 1600 to 1800 F and are partially quenched with water to 1000 to 1200 F before entering the iron oxide bed. The iron oxide bed provides additional desulfurization beyond that provided by the lime /limestone. 1 fig.
Hao, Lingwan; Wang, Meiri; Shan, Wenjuan; Deng, Changliang; Ren, Wanzhong; Shi, Zhouzhou; Lü, Hongying
2017-10-05
A series of L-proline-based DESs was prepared through an atom economic reaction between L-proline (L-Pro) and four different kinds of organic acids. The DESs were characterized by Fourier transform infrared spectroscopy (FT-IR), H nuclear magnetic resonance ( 1 HNMR), cyclic voltammogram (CV) and the Hammett method. The synthesized DESs were used for the oxidative desulfurization and the L-Pro/p-toluenesultonic acid (L-Pro/p-TsOH) system shows the highest catalytic activity that the removal of dibenzothiophene (DBT) reached 99% at 60°C in 2h, which may involve the dual activation of the L-Pro/p-TsOH. The acidity of four different L-proline-based DESs was measured and the results show that it could not simply conclude that the correlation between the acidity of DESs and desulfurization capability was positive or negative. The electrochemical measurements evidences and recycling experiment indicate a good stability performance of L-Pro/p-TsOH in desulfurization. This work will provide a novel and potential method for the deep oxidation desulfurization. Copyright © 2017 Elsevier B.V. All rights reserved.
Anion binding in biological systems
Energy Technology Data Exchange (ETDEWEB)
Feiters, Martin C [Department of Organic Chemistry, Institute for Molecules and Materials, Faculty of Science, Radboud University Nijmegen, Heyendaalseweg 135, 6525 AJ Nijmegen (Netherlands); Meyer-Klaucke, Wolfram [EMBL Hamburg Outstation at DESY, Notkestrasse 85, D-22607 Hamburg (Germany); Kostenko, Alexander V; Soldatov, Alexander V [Faculty of Physics, Southern Federal University, Sorge 5, Rostov-na-Donu, 344090 (Russian Federation); Leblanc, Catherine; Michel, Gurvan; Potin, Philippe [Centre National de la Recherche Scientifique and Universite Pierre et Marie Curie Paris-VI, Station Biologique de Roscoff, Place Georges Teissier, BP 74, F-29682 Roscoff cedex, Bretagne (France); Kuepper, Frithjof C [Scottish Association for Marine Science, Dunstaffnage Marine Laboratory, Oban, Argyll PA37 1QA, Scotland (United Kingdom); Hollenstein, Kaspar; Locher, Kaspar P [Institute of Molecular Biology and Biophysics, ETH Zuerich, Schafmattstrasse 20, Zuerich, 8093 (Switzerland); Bevers, Loes E; Hagedoorn, Peter-Leon; Hagen, Wilfred R, E-mail: m.feiters@science.ru.n [Department of Biotechnology, Delft University of Technology, Julianalaan 67, 2628 BC Delft (Netherlands)
2009-11-15
We compare aspects of biological X-ray absorption spectroscopy (XAS) studies of cations and anions, and report on some examples of anion binding in biological systems. Brown algae such as Laminaria digitata (oarweed) are effective accumulators of I from seawater, with tissue concentrations exceeding 50 mM, and the vanadate-containing enzyme haloperoxidase is implicated in halide accumulation. We have studied the chemical state of iodine and its biological role in Laminaria at the I K edge, and bromoperoxidase from Ascophyllum nodosum (knotted wrack) at the Br K edge. Mo is essential for many forms of life; W only for certain archaea, such as Archaeoglobus fulgidus and the hyperthermophilic archaeon Pyrococcus furiosus, and some bacteria. The metals are bound and transported as their oxo-anions, molybdate and tungstate, which are similar in size. The transport protein WtpA from P. furiosus binds tungstate more strongly than molybdate, and is related in sequence to Archaeoglobus fulgidus ModA, of which a crystal structure is known. We have measured A. fulgidus ModA with tungstate at the W L{sub 3} (2p{sub 3/2}) edge, and compared the results with the refined crystal structure. XAS studies of anion binding are feasible even if only weak interactions are present, are biologically relevant, and give new insights in the spectroscopy.
Anion binding in biological systems
International Nuclear Information System (INIS)
Feiters, Martin C; Meyer-Klaucke, Wolfram; Kostenko, Alexander V; Soldatov, Alexander V; Leblanc, Catherine; Michel, Gurvan; Potin, Philippe; Kuepper, Frithjof C; Hollenstein, Kaspar; Locher, Kaspar P; Bevers, Loes E; Hagedoorn, Peter-Leon; Hagen, Wilfred R
2009-01-01
We compare aspects of biological X-ray absorption spectroscopy (XAS) studies of cations and anions, and report on some examples of anion binding in biological systems. Brown algae such as Laminaria digitata (oarweed) are effective accumulators of I from seawater, with tissue concentrations exceeding 50 mM, and the vanadate-containing enzyme haloperoxidase is implicated in halide accumulation. We have studied the chemical state of iodine and its biological role in Laminaria at the I K edge, and bromoperoxidase from Ascophyllum nodosum (knotted wrack) at the Br K edge. Mo is essential for many forms of life; W only for certain archaea, such as Archaeoglobus fulgidus and the hyperthermophilic archaeon Pyrococcus furiosus, and some bacteria. The metals are bound and transported as their oxo-anions, molybdate and tungstate, which are similar in size. The transport protein WtpA from P. furiosus binds tungstate more strongly than molybdate, and is related in sequence to Archaeoglobus fulgidus ModA, of which a crystal structure is known. We have measured A. fulgidus ModA with tungstate at the W L 3 (2p 3/2 ) edge, and compared the results with the refined crystal structure. XAS studies of anion binding are feasible even if only weak interactions are present, are biologically relevant, and give new insights in the spectroscopy.
Anion binding in biological systems
Feiters, Martin C.; Meyer-Klaucke, Wolfram; Kostenko, Alexander V.; Soldatov, Alexander V.; Leblanc, Catherine; Michel, Gurvan; Potin, Philippe; Küpper, Frithjof C.; Hollenstein, Kaspar; Locher, Kaspar P.; Bevers, Loes E.; Hagedoorn, Peter-Leon; Hagen, Wilfred R.
2009-11-01
We compare aspects of biological X-ray absorption spectroscopy (XAS) studies of cations and anions, and report on some examples of anion binding in biological systems. Brown algae such as Laminaria digitata (oarweed) are effective accumulators of I from seawater, with tissue concentrations exceeding 50 mM, and the vanadate-containing enzyme haloperoxidase is implicated in halide accumulation. We have studied the chemical state of iodine and its biological role in Laminaria at the I K edge, and bromoperoxidase from Ascophyllum nodosum (knotted wrack) at the Br K edge. Mo is essential for many forms of life; W only for certain archaea, such as Archaeoglobus fulgidus and the hyperthermophilic archaeon Pyrococcus furiosus, and some bacteria. The metals are bound and transported as their oxo-anions, molybdate and tungstate, which are similar in size. The transport protein WtpA from P. furiosus binds tungstate more strongly than molybdate, and is related in sequence to Archaeoglobus fulgidus ModA, of which a crystal structure is known. We have measured A. fulgidus ModA with tungstate at the W L3 (2p3/2) edge, and compared the results with the refined crystal structure. XAS studies of anion binding are feasible even if only weak interactions are present, are biologically relevant, and give new insights in the spectroscopy.
Directory of Open Access Journals (Sweden)
Swapnil A. Dharaskar
2016-07-01
Full Text Available In the present paper the experimental data of extractive desulfurization of liquid fuel using 1-butyl-3-methylimidazolium tetrafluoroborate [BMIM]BF4 have been presented. The data of FTIR, 1H NMR and 13C NMR have been discussed for the molecular confirmation of synthesized [BMIM]BF4. Further, the thermal properties, conductivity, solubility, and viscosity analysis of the [BMIM]BF4 were carried out. The effects of reaction time, reaction temperature, sulfur compounds, and recycling of ionic liquid without regeneration on dibenzothiophene removal of liquid fuel were presented. In extractive desulfurization process, the removal of dibenzothiophene in n-dodecane was 73.02% for mass ratio of 1:1 in 30 min at 30 °C under the mild reaction conditions. The ionic liquids could be reused four times without a significant decrease in activity. Also, the desulfurizations of real fuels, multistage extraction were presented. The data and results provided in the present paper explore the significant insights of imidazoled ILs for extractive desulfurization of liquid fuels.
Mao, Gui-Lian; Xu, Xing; Zeng, Jin; Yue, Zi-Hui; Yang, Shu-Juan
2012-02-01
To approach the action mechanisms of desulfurization waste on alleviating alkali stress-induced injury of rice, a pot experiment was conducted to study the variations of leaf total calcium content, calcium distribution, plasma membrane Ca(2+)-ATPase activity, and reactive oxygen content of rice seedlings under alkali stress after the application of desulfurization waste. In the control, a few calcium particulates scattered in the cell wall and chloroplasts, while applying desulfurization waste or CaSO4 increased the calcium particulates in the plasma membrane, intercellular space, cell wall, and vacuole significantly. With the increasing application rate of desulfurization waste or CaSO4, the leaf total calcium content increased, Ca(2+)-ATPase activity in plasma membrane and tonoplast presented an increasing trend, plasma membrane relative permeability, MDA content, and O2 production rate decreased, and SOD and POD activities increased. The desulfurization waste could relieve the alkali stress to rice in some extent, and the main reactive compound in the waste could be CaSO4.
Julião, Diana; Gomes, Ana C; Pillinger, Martyn; Valença, Rita; Ribeiro, Jorge C; Gonçalves, Isabel S; Balula, Salete S
2016-10-14
The oxidative desulfurization of model and real diesel has been studied using the complex [MoO2Cl2(4,4'-di-tert-butyl-2,2'-bipyridine)] as (pre)catalyst, aq. H2O2 as oxidant, and an ionic liquid as extraction solvent. Under moderate conditions (50 °C) and short reaction times (desulfurization and ECODS steps, 76% sulfur removal was achieved for a real diesel (Sinitial = 2300 ppm). For both the model and real diesels, the catalyst/IL phase could be easily recycled and reused with no loss of desulfurization efficiency.
Fundamental Studies of Recombinant Hydrogenases
Energy Technology Data Exchange (ETDEWEB)
Adams, Michael W. [Univ. of Georgia, Athens, GA (United States)
2014-01-25
This research addressed the long term goals of understanding the assembly and organization of hydrogenase enzymes, of reducing them in size and complexity, of determining structure/function relationships, including energy conservation via charge separation across membranes, and in screening for novel H2 catalysts. A key overall goal of the proposed research was to define and characterize minimal hydrogenases that are produced in high yields and are oxygen-resistant. Remarkably, in spite of decades of research carried out on hydrogenases, it is not possible to readily manipulate or design the enzyme using molecular biology approaches since a recombinant form produced in a suitable host is not available. Such resources are essential if we are to understand what constitutes a “minimal” hydrogenase and design such catalysts with certain properties, such as resistance to oxygen, extreme stability and specificity for a given electron donor. The model system for our studies is Pyrococcus furiosus, a hyperthermophile that grows optimally at 100°C, which contains three different nickel-iron [NiFe-] containing hydrogenases. Hydrogenases I and II are cytoplasmic while the other, MBH, is an integral membrane protein that functions to both evolve H2 and pump protons. Three important breakthroughs were made during the funding period with P. furiosus soluble hydrogenase I (SHI). First, we produced an active recombinant form of SHI in E. coli by the co-expression of sixteen genes using anaerobically-induced promoters. Second, we genetically-engineered P. furiosus to overexpress SHI by an order of magnitude compared to the wild type strain. Third, we generated the first ‘minimal’ form of SHI, one that contained two rather than four subunits. This dimeric form was stable and active, and directly interacted with a pyruvate-oxidizing enzyme with any intermediate electron carrier. The research resulted in five peer-reviewed publications.
Natural desulfurization in coal-fired units using Greek lignite.
Konidaris, Dimitrios N
2010-10-01
This paper analyzes the natural desulfurization process taking place in coal-fired units using Greek lignite. The dry scrubbing capability of Greek lignite appears to be extremely high under special conditions, which can make it possible for the units to operate within the legislative limits of sulfur dioxide (SO2) emissions. According to this study on several lignite-fired power stations in northern Greece, it was found that sulfur oxide emissions depend on coal rank, sulfur content, and calorific value. On the other hand, SO2 emission is inversely proportional to the parameter gammaCO2(max), which is equal to the maximum carbon dioxide (CO2) content by volume of dry flue gas under stoichiometric combustion. The desulfurization efficiency is positively correlated to the molar ratio of decomposed calcium carbonate to sulfur and negatively correlated to the free calcium oxide content of fly ash.
Oxidative desulfurization of dibenzothiophene from model oil using ionic liquids as extracting agent
Taha, Mohd F.; Atikah, N.; Chong, F. K.; Shaharun, Maizatul S.
2012-09-01
The oxidative desulfurization of dibenzothiophene (DBT) from model oil (in n-dodecane) was carried out using ionic liquid as the extractant and catalyst, and hydrogen peroxide (H2O2) in combination with acetic acid (CH3COOH) and sulphuric acid (H2SO4) as the oxidant. The ionic liquids used were 1-butyl-3-methylimidazolium octyl sulphate ([Bmim][OcSO4]) and 1-butyl-3-methylimidazolium acetate ([Bmim][Ac]). The effect of the amounts of H2O2 on oxidative desulphurization of model oil was first investigated without the usage of ionic liquids at room temperature. The results indicate that greater amount of H2O2 give higher desulfurization and the maximum desulfurization in this study, i.e. 34 %, was occurred when the molar ratio of H2O2 to sulfur was 5:1. With the usage of ionic liquid and the molar ratio of 5:1 (H2O2:sulfur), the efficiency of DBT removal from model oil was increased significantly in terms of percent removal and removal time. Ionic liquid of [Bmim][OcSO4] performed better than [Bmim][Ac] with 72 % DBT removal. When molar ratio of H2O2 to sulphur was 5:1, volume ratio of ionic liquid to model oil was 1:1 and mixing time was 60 min at room temperature. The results indicate the potential of ionic liquids as the extractant and catalyst for oxidative desulfurization of hydrocarbon fuels.
Energy Technology Data Exchange (ETDEWEB)
Takarada, Y; Kato, K; Kuroda, M; Nakagawa, N [Gunma University, Gunma (Japan). Faculty of Engineering; Roman, M [New Energy and Industrial Technology Development Organization, Tokyo, (Japan)
1997-02-01
Experiment reveals the characteristics of low rank coal serving as a desulfurizing material in fluidized coal bed reactor with oxygen-containing functional groups exchanged with Ca ions. This effort aims at identifying inexpensive Ca materials and determining the desulfurizing characteristics of Ca-carrying brown coal. A slurry of cement sludge serving as a Ca source and low rank coal is agitated for the exchange of functional groups and Ca ions, and the desulfurizing characteristics of the Ca-carrying brown coal is determined. The Ca-carrying brown coal and high-sulfur coal char is mixed and incinerated in a fluidized bed reactor, and it is found that a desulfurization rate of 75% is achieved when the Ca/S ratio is 1 in the desulfurization of SO2. This rate is far higher than the rate obtained when limestone or cement sludge without preliminary treatment is used as a desulfurizer. Next, Ca-carrying brown coal and H2S are caused to react upon each other in a fixed bed reactor, and then it is found that desulfurization characteristics are not dependent on the diameter of the Ca-carrying brown coal grain, that the coal is different from limestone in that it stays quite active against H2S for long 40 minutes after the start of the reaction, and that CaO small in crystal diameter is dispersed in quantities into the char upon thermal disintegration of Ca-carrying brown coal to cause the coal to say quite active. 5 figs.
Bench-Scale Demonstration of Hot-Gas Desulfurization Technology
International Nuclear Information System (INIS)
Portzer, Jeffrey W.; Gangwal, Santosh K.
1997-01-01
Prior to the current project, development of the DSRP was done in a laboratory setting, using synthetic gas mixtures to simulate the regeneration off-gas and coal gas feeds. The objective of the current work is to further the development of zinc titanate fluidized-bed desulfurization (ZTFBD) and the DSRP for hot-gas cleanup by testing with actual coal gas. The objectives of this project are to: (1) Develop and test an integrated, skid-mounted, bench-scale ZTFBD/DSRP reactor system with a slipstream of actual coal gas; (2) Test the bench-scale DSRP over an extended period with a slipstream of actual coal gas to quantify the degradation in performance, if any, caused by the trace contaminants present in coal gas (including heavy metals, chlorides, fluorides, and ammonia); (3) Expose the DSRP catalyst to actual coal gas for extended periods and then test its activity in a laboratory reactor to quantify the degradation in performance, if any, caused by static exposure to the trace contaminants in coal gas; (4) Design and fabricate a six-fold larger-scale DSRP reactor system for future slipstream testing; (5) Further develop the fluidized-bed DSRP to handle high concentrations (up to 14 percent) of SO 2 that are likely to be encountered when pure air is used for regeneration of desulfurization sorbents; and (6) Conduct extended field testing of the 6X DSRP reactor with actual coal gas and high concentrations of SO 2 . The accomplishment of the first three objectives--testing the DSRP with actual coal gas, integration with hot-gas desulfurization, and catalyst exposure testing--was described previously (Portzer and Gangwal, 1994, 1995; Portzer et al., 1996). This paper summarizes the results of previous work and describes the current activities and plans to accomplish the remaining objectives
Shell launches its Claus off-gas desulfurization process
Energy Technology Data Exchange (ETDEWEB)
Groenendaal, W; van Meurs, H C.A.
1972-01-01
The Shell Flue Gas Desulfurization (SFGD) Process was developed for removal of sulfur oxides from flue gases originating from oil-fired boilers or furnaces. It can also be used to remove sulfur dioxide from Claus sulfur recovery tail gases if they are combined with boiler/furnace flue gases. For Claus tail gas only, the Shell Claus off-gas desulfurization process was developed. Claus unit operation and desulfurization by low temperature Claus processes and conversion/concentration processes are discussed. The new Shell process consists of a conversion/concentration process involving a reduction section and an amine absorption section. In the reduction section, all sulfur compounds and free sulfur are completely reduced to hydrogen sulfide with hydrogen, or hydrogen plus carbon monoxide, over a cobalt/molybdenum-on-alumina catalyst at a temperature of about 300/sup 0/C. Extensive bench scale studies on the reduction system have been carried out. A life test of more than 4000 hr showed a stable activity of the reduction catalyst, which means that in commercial units, very long catalyst lives can be expected. The commercial feasibility of the reduction section was further demonstrated in the Godorf refinery of Deutsche Shell AG. More than 80 absorption units using alkanolamine (AIDP) solutions have been installed. Bench scale studies of the ADIP absorption units were compared to commercial experience.The total capital investment of the new Shell process is 0.7, 2.0, and 3.2 $ times 10 to the 6th power for 100, 500, and 1000 tons of sulfur/sd capacity Claus units, respectively. The total operating costs for these units are, respectively, 610, 1930 and 3310 $/stream day. The capital investment corresponds to about 75% of the capital investment of the preceding Claus unit.
Zeng, Fan; Liao, Xiaofeng; Hu, Hui; Liao, Li
2018-03-01
Series sludge straw-based activated carbons were prepared by sewage sludge and corn straw with potassium hydroxide (KOH) activation, and the desulfurization performance of activated carbons was studied. To obtain the best desulfurization performance, the optimum ratio between the raw materials and the activator was investigated. The results showed that when the mass ratio of sewage sludge, corn straw, and KOH was 3:7:2, the activated carbon obtained the best breakthrough and saturation sulfur sorption capacities, which were 12.38 and 5.74 times, respectively, those of samples prepared by the nonactivated raw materials. The appropriate KOH could improve the microporosity and alkaline groups, meanwhile reducing the lactone groups, which were all beneficial to desulfurization performance. The chemical adsorption process of desulfurization can be simplified to four main steps, and the main desulfurization products are elemental sulfur and sulfate. Sewage sludge (SS) and corn straw (CS) both have great production and wide distribution and are readily available in China. Much attention has been paid on how to deal with them effectively. Based on the environment protection idea of waste treatment with waste and resource recycling, low-cost adsorbents were prepared by these processes. The proposed method can be expanded to the municipal solid waste recycling programs and renewable energy plan. Thus, proceeding with the study of preparing activated carbon by SS and straw as a carbon-based dry desulfurization agent could obtain huge social, economic, and environmental benefits.
Zhaksyntay K. Kairbekov; Zhannur K. Myltykbaeva; Nazym T. Smagulova; Dariya K. Kanseitova
2015-01-01
In this paper we studied sono catalytic oxidative desulfurization of oil and diesel fraction from “Zhanazhol” oil deposits. We have established that the combined effect of the ultrasonic field and oxidant (ozone-air mixture) in the presence of the catalyst on the oil is potentially very effective method of desulfurization of oil and oil products. This method allows increasing the degree of desulfurization of oil by 62%.
Economic analysis of ultrasound-assisted oxidative desulfurization
Anderson, K.; Atkins, M.P.; Borges, P; Chan, Z.P.; Rafeen, M.S.; Sebran, N.H.; van der Pool, E; Vleeming, J.H.
2017-01-01
Oxidative desulfurization is a method of removing sulfur from diesel fuel that has the potential to compete with conventional hydrodesulfurization processes in refineries. Ultrasound has been shown to greatly increase peroxide oxidation rates of sulfur compounds and can thereby enhance the technology. Through the use of conceptual design modeling, this article critically assesses a range of novel process options. Calculations show that the rate enhancement achieved by ultrasound can translate...
Effects of nano-TiO2 on combustion and desulfurization
International Nuclear Information System (INIS)
Zhao, Yi; Wang, Shuqin; Shen, Yanmei; Lu, Xiaojuan
2013-01-01
Nanosized titanium oxide powder was prepared via the sol–gel process and characterized by transmission electron microscope. The effects of nano-TiO 2 on combustion characteristics of lignite, desulfurization in combustion and the properties of ashes were investigated. The calorific value of coals and the fusion point of the coal ashes were measured by calorimeter and ash fusion point determination meter; the components of coal ashes and the contents of combustible matters in ash were determined by chemical methods; the pore-size distribution and specific surface area of the coal ash were analyzed by surface area analyzer. A thermogravimetric analyzer was used to investigate the effect of nano-TiO 2 on combustion. The results showed that the calorific value of the coal and the fusion temperature of the coal ash were lowered by adding CaO, while on the other hand adding nano-TiO 2 to coal increased the calorific value and the melting temperature effectively. Meanwhile, the coal combustion efficiency and desulfurization in combustion could be effectively improved by the co-action of TiO 2 . - Highlights: • The burn-off rate of coals was raised and the combustible contents were reduced by adding nano-TiO 2 . • The desulfurization in combustion can be achieved by adding CaO, but the combustion efficiency was inhibited. • Nano-TiO 2 can promote the transfer rate of oxygen from gas phase to the surface of char
Energy Technology Data Exchange (ETDEWEB)
Sachdeva, T.O.; Pant, K.K. [Department of Chemical Engineering, Indian Institute of Technology, Delhi, New Delhi, 110016 (India)
2010-09-15
High sulfur level in diesel fuel has been identified as a major contributor to air pollutant in term of sulfur dioxide (SO{sub x}) through diesel fueled vehicles. The main aim of the present work is to develop a promising methodology for ultra deep desulfurization of diesel fuel using oxidation followed by phase transfer of oxidized sulfur. Experiments were carried out in a batch reactor using n-decane as the model diesel compound and also using commercial diesel feedstock. To remove sulfur tetraoctylammonium bromide, phosphotungstic acid, and hydrogen peroxide were used as phase transfer agent, catalyst and oxidant respectively. The percent sulfur removal increases with increasing the initial concentration of sulfur in fuel and with increasing the reaction temperature. Similar trends were observed when commercial diesel was used to carry out desulfurization studies. The amphiphilic catalyst serves as a catalyst and also as an emulsifying agent to stabilize the emulsion droplets. The effects of temperature, agitation speed, quantity of catalyst and the phase transfer agent were studied to estimate the optimal conditions for the reactions. The sulfur removal from a commercial diesel by phase transfer catalysis has been found effective and removal efficiency was more than 98%. Kinetic experiments carried out for the desulfurization revealed that the sulfur removal results are best fitted to a pseudo first order kinetics and the apparent activation energy of desulfurization was 30.6 kJ/mol. (author)
International Nuclear Information System (INIS)
Sachdeva, T.O.; Pant, K.K.
2010-01-01
High sulfur level in diesel fuel has been identified as a major contributor to air pollutant in term of sulfur dioxide (SO x ) through diesel fueled vehicles. The main aim of the present work is to develop a promising methodology for ultra deep desulfurization of diesel fuel using oxidation followed by phase transfer of oxidized sulfur. Experiments were carried out in a batch reactor using n-decane as the model diesel compound and also using commercial diesel feedstock. To remove sulfur tetraoctylammonium bromide, phosphotungstic acid, and hydrogen peroxide were used as phase transfer agent, catalyst and oxidant respectively. The percent sulfur removal increases with increasing the initial concentration of sulfur in fuel and with increasing the reaction temperature. Similar trends were observed when commercial diesel was used to carry out desulfurization studies. The amphiphilic catalyst serves as a catalyst and also as an emulsifying agent to stabilize the emulsion droplets. The effects of temperature, agitation speed, quantity of catalyst and the phase transfer agent were studied to estimate the optimal conditions for the reactions. The sulfur removal from a commercial diesel by phase transfer catalysis has been found effective and removal efficiency was more than 98%. Kinetic experiments carried out for the desulfurization revealed that the sulfur removal results are best fitted to a pseudo first order kinetics and the apparent activation energy of desulfurization was 30.6 kJ/mol. (author)
THERMODYNAMIC AND KINETIC PARAMETERS OF MIXTURES DESULFURIZING THE MADE WITH CaO, MgO, SiO2 AND CaF2
Directory of Open Access Journals (Sweden)
Felipe Nylo de Aguiar
2012-09-01
Full Text Available This paper presents an analysis of the kinetics and thermodynamics of marble residue mixtures utilisation on desulfurization of pig iron. The desulfurization was carried out using lime, marble residue, fluorite and pig iron. Different mixtures of these materials were added into a bath of pig iron at 1,450°C. Metal samples were collected via vacuum samplers at times of 5, 10, 15, 20 and 30 minutes, in order to check the variation of sulfur content. Based on the results of chemical analysis of the metal and the desulfurizer mixture, the sulfide capacity of mixtures, the sulfur partition coefficient and the sulfur mass transport coefficient values were calculated.The results show the technical feasibility of using marble waste as desulfurizer agent.
Wu, Yingcheng; Wu, Peiwen; Chao, Yanhong; He, Jing; Li, Hongping; Lu, Linjie; Jiang, Wei; Zhang, Beibei; Li, Huaming; Zhu, Wenshuai
2018-01-01
Hexagonal boron nitride has been regarded to be an efficient catalyst in aerobic oxidation fields, but limited by the less-exposed active sites. In this contribution, we proposed a simple green liquid nitrogen gas exfoliation strategy for preparation of porous monolayer nanosheets (BN-1). Owing to the reduced layer numbers, decreased lateral sizes and artificially-constructed pores, increased exposure of active sites was expected, further contributed to an enhanced aerobic oxidative desulfurization (ODS) performance up to ˜98% of sulfur removal, achieving ultra-deep desulfurization. This work not only introduced an excellent catalyst for aerobic ODS, but also provided a strategy for construction of some other highly-efficient monolayer two-dimensional materials for enhanced catalytic performance.
Microbiological desulfurization and conversion of coal
International Nuclear Information System (INIS)
Quigley, D.R.; Stoner, D.L.; Dugan, P.R.
1991-01-01
Bio processing of coal is a young and emerging technology. Until the early 1980's it consisted primarily of coal depyritization using Thiobacillus ferro oxidans to either oxidize pyritic sulfur or to alter particle wettability or floatation properties by binding to exposed pyrite inclusions. Since then, other major avenues of research have been pursued. One of these is the microbiologically mediated liquefaction of coal. Initial work indicated that microorganisms were able to transform low rank coal into a black liquid that was later identified as water solubilized by alkaline substances produced by the microbes and could be enhanced by the removal of multi valent cations from coal. Current work at the INEL involves of the identification and characterization of microorganisms that are able to alter the structure of polymeric desulfurization of coal. This work initially focused on the ability of microorganisms to oxidatively remove organic sulfur from model compounds that were representative of those sulfur containing moieties identified as being in coals (e.g., dibenzo thiophene). The work also focused on those organisms that were could remove the organic sulfur without degrading the carbon structure. While some organisms that are able to perform such these reactions will effectively remove organo sulfur from coal. These concerns stem from steric hindrance considerations and the thermodynamically unfavourable nature of reaction. Current work at the INEL involves the isolation and biochemical characterization of microorganisms that are able to desulfurize and solubilized coals that have high organic sulfur contents. (author)
Energy Technology Data Exchange (ETDEWEB)
Dai, Yongchuan; Qi, Yutai [Department of Applied Chemistry, School of Science, Harbin Institute of Technology, Harbin 115001 (China); Zhao, Dezhi [Department of Petroleum Chemical Engineering, Liaoning Shihua University, Fushun 113001 (China); Zhang, Huicheng [Fushun Research Institute of Petroleum and Petrochemicals of SINOPEC Corp., Fushun 113001 (China)
2008-10-15
The total development trend in the world is towards continuously lower of sulfur content as a quality standard of diesel fuels. Integrating of an oxidative desulfurization unit with a conventional hydrotreating unit can bring benefits to producing low and/or ultra-low sulfur diesel fuels. Using the hydrotreated Middle East diesel fuel as a feedstock, four processes of the oxidative desulfurization have been studied: a hydrogen peroxide-acetic acid system and a Fenton's reagent system both without/with ultrasound. Results showed that the oxidative desulfurization reaction mechanics fitted apparent first-order kinetics. The addition of Fenton's reagent could enhance the oxidative desulfurization efficiency for diesel fuels and sono-oxidation treatment in combination with Fenton's reagent shows a good synergistic effect. Under our best operating condition for the oxidative desulfurization: temperature 313 K, ultrasonic power 200 W, ultrasonic frequency 28 kHz, Fe{sup 2+}/H{sub 2}O{sub 2} 0.05 mol/mol, pH 2.10 in aqueous phase and reaction time 15 min, the sulfur content in the diesel fuels was decreased from 568.75 {mu}g/g to 9.50 {mu}g/g. (author)
Desulfurization Sorbents for Transport-Bed Applications
International Nuclear Information System (INIS)
Gupta, Raghubir P.; Turk, Brian S.; Vierheilig, Albert A.
1997-01-01
This project extends the prior work on the development of fluidizable zinc titanate particles using a spray-drying technique to impart high reactivity and attrition resistance. The specific objectives are: (1) To develop highly reactive and attrition-resistant zinc titanate sorbents in 40- to 150-(micro)m particle size range for transport reactor applications; (2) To transfer sorbent production technology to private sector; and (3) To provide technical support to Sierra Pacific Clean Coal Technology Demonstration plant and FETC's Hot-Gas Desulfurization Process Development Unit (PDU), both employing a transport reactor system
Desulfurization of petroleum by Co-60 gamma irradiation and analysis of products using GC-MS
International Nuclear Information System (INIS)
Mathuthu, M.; Tshivhase, V.M.; Olobatoke, R.Y.; Gaxela, N.N.
2014-01-01
Sulfur is an undesirable hetero-atom that has negative on motor engines if present in quantities between 50 and 180.000 ppm. Research has shown that sour petroleum can be 'sweetened' by gamma irradiation to de-sulfurize the crude oil. In this research we will report experimental results of desulfurizing petroleum locally procured. The objective is to improve the quality of product delivered to the motor market and also reduce the environmental pollution due to SO 2 emissions from engines. The gamma irradiated (de-sulfurized petroleum was chemically analyzed using GC-MS. The preliminary results show that the petroleum is polymerized by gamma radiation to higher molecular mass. The un-irradiated petroleum had a sulfur concentration of 3.24% and 0.020% wt after gamma irradiation. The sulfur content was reduced by a factor of about 160 when dose was increased from zero to 50 kGys. GC-MS Chromatographs are presented for the identified hydrocarbons after gamma irradiation. (authors)
Directory of Open Access Journals (Sweden)
Trauger Sunia A
2011-02-01
Full Text Available Abstract Background Metal-containing proteins comprise a diverse and sizable category within the proteomes of organisms, ranging from proteins that use metals to catalyze reactions to proteins in which metals play key structural roles. Unfortunately, reliably predicting that a protein will contain a specific metal from its amino acid sequence is not currently possible. We recently developed a generally-applicable experimental technique for finding metalloproteins on a genome-wide scale. Applying this metal-directed protein purification approach (ICP-MS and MS/MS based to the prototypical microbe Pyrococcus furiosus conclusively demonstrated the extent and diversity of the uncharacterized portion of microbial metalloproteomes since a majority of the observed metal peaks could not be assigned to known or predicted metalloproteins. However, even using this technique, it is not technically feasible to purify to homogeneity all metalloproteins in an organism. In order to address these limitations and complement the metal-directed protein purification, we developed a computational infrastructure and statistical methodology to aid in the pursuit and identification of novel metalloproteins. Results We demonstrate that our methodology enables predictions of metal-protein interactions using an experimental data set derived from a chromatography fractionation experiment in which 870 proteins and 10 metals were measured over 2,589 fractions. For each of the 10 metals, cobalt, iron, manganese, molybdenum, nickel, lead, tungsten, uranium, vanadium, and zinc, clusters of proteins frequently occurring in metal peaks (of a specific metal within the fractionation space were defined. This resulted in predictions that there are from 5 undiscovered vanadium- to 13 undiscovered cobalt-containing proteins in Pyrococcus furiosus. Molybdenum and nickel were chosen for additional assessment producing lists of genes predicted to encode metalloproteins or metalloprotein
International Nuclear Information System (INIS)
Jolivet, E.
2002-10-01
In this study, we have first tested in vivo the effect of gamma irradiation on Pyrococcus abyssi, a hyper-thermophilic archaeon, isolated from a deep-sea hydrothermal vent. We have shown that this strain was as radioresistant as P. furiosus but less than Deinococcus radiodurans. The rates of double stranded breaks provoked into DNA following irradiation were monitored by the pulsed-field gel electrophoresis technique (P.F.G.E.) with P. abyssi, P. furiosus, D. radiodurans and Escherichia coli. Results clearly showed that all these rates were similar suggesting that no specific DNA protection system exits in Pyrococcus species. The growth of P. abyssi was efficiently recovered within two hours following the exposure to 2.5 kGy of gamma irradiation. As revealed by P.F.G.E., genomic DNA of P. abyssi totally fragmented after irradiation was efficiently restored within two hours presumably by inter chromosomal homologous recombination. The DNA replication in P. abyssi cells following irradiation at 2.5 kGy was blocked for 90 minutes that corresponds to the decay for repairing damaged DNA. Moreover, following irradiation P. abyssi actively expulse damaged DNA material before DNA replication resumes, preventing the amplification of genetic mutations. We have also showed that at least a subset cf P. abyssi DNA repair and replication proteins, such as RadA, RPA-41 and RFC-S. were constitutively expressed in chromatin bound forms in stationary phase cells. Our results were in agreement with the view that P. abyssi contains a very efficient DNA repair system, which is continuously ready to counteract the DNA damaged caused by the high temperature and/or ionizing radiation. For the first time, three novel hyper-thermophilic archaea species from deep-sea hydrothermal vents more radioresistant than P. abyssi were isolated and characterized, after 'y-irradiation exposures of some enrichment cultures. Thermococcus marinus, Thermococcus radiophilus and Thermococcus gammafolerans
Goda, Shuichiro; Koga, Tomoyuki; Yamashita, Kenichiro; Kuriura, Ryo; Ueda, Toshifumi
2018-04-08
In Archaea and Bacteria, surface layer (S-layer) proteins form the cell envelope and are involved in cell protection. In the present study, a putative S-layer protein was purified from the crude extract of Pyrococcus horikoshii using affinity chromatography. The S-layer gene was cloned and expressed in Escherichia coli. Isothermal titration calorimetry analyses showed that the S-layer protein bound N-acetylglucosamine and induced agglutination of the gram-positive bacterium Micrococcus lysodeikticus. The protein comprised a 21-mer structure, with a molecular mass of 1,340 kDa, as determined using small-angle X-ray scattering. This protein showed high thermal stability, with a midpoint of thermal denaturation of 79 °C in dynamic light scattering experiments. This is the first description of the carbohydrate-binding archaeal S-layer protein and its characteristics.
Process for desulfurizing hydrocarbons
Energy Technology Data Exchange (ETDEWEB)
1937-04-12
A process is described for the desulfurization of a mixture of hydrocarbons, and in particular hydrocarbons containing less than 7 atoms of carbon and sulfur compounds of the type of sulfur carbonyl, characterized by the fact that the mixture, preferably in the liquid phase, is brought in contact with a solution of caustic alkali, essentially anhydrous or preferably with a solution of alkali hydroxide in an organic hydroxy nonacid solvent, for example, an alcohol, or with an alkaline alcoholate, under conditions suitable to the formation of hydrogen sulfide which produces a hydrocarbon mixture free from sulfur compounds of the sulfur carbonyl type but containing hydrogen sulfide, and that it is treated, following mixing, having beem submitted to the first treatment, by means of aqueous alkaline hydroxide to eliminate the hydrogen sulfide.
Oxidative desulfurization of fuels catalyzed by Fenton-like ionic liquids at room temperature.
Jiang, Yunqing; Zhu, Wenshuai; Li, Huaming; Yin, Sheng; Liu, Hua; Xie, Qingjie
2011-03-21
Oxidation of the sulfur-containing compounds benzothiophene (BT), dibenzothiophene (DBT), and 4,6-dimethyldibenzothiophene (4,6-DMDBT) has been studied in a desulfurization system composed of model oil, hydrogen peroxide, and different types of ionic liquids [(C(8)H(17))(3)CH(3)N]Cl/FeCl(3), [(C(8)H(17))(3)CH(3)N]Cl/CuCl(2), [(C(8)H(17))(3)CH(3)N]Cl/ZnCl(2), [(C(8)H(17))(3)CH(3)N]Cl/SnCl(2), [(C(4)H(9))(3)CH(3)N]Cl/FeCl(3), [C(10)H(21)(CH(3))(3)N]Cl/FeCl(3), [(C(10)H(21))(2)(CH(3))(2)N]Cl/FeCl(3). Deep desulfurization is achieved in the Fenton-like ionic liquid [(C(8)H(17))(3)CH(3)N]Cl/FeCl(3) at 25 °C for 1 h. The desulfurization of DBT reaches 97.9%, in consuming very low amount of [(C(8)H(17))(3)CH(3)N]Cl/FeCl(3) (only 0.702 mmol). The reaction conditions, for example, the amount of [(C(8)H(17))(3)CH(3)N]Cl/FeCl(3) or H(2)O(2), the temperature, and the molar ratio of FeCl(3) to [(C(8)H(17))(3)CH(3)N]Cl, are investigated for this system. The oxidation reactivity of the different sulfur-containing compounds is found to decrease in the order of DBT>BT>4,6-DMDBT. The desulfurization system can be recycled six times without significant decrease in activity. The sulfur level of FCC gasoline could be reduced from 360 ppm to 110 ppm. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Angelo Earvin Sy Choi; Susan Roces; Nathaniel Dugos; Meng-Wei Wan
2016-01-01
Desulfurization of fossil fuel derived oil is needed in order to comply with environmental regulations. Dibenzothiophene and benzothiophene are among the predominant sulfur compound present in raw diesel oil. In this study, mixing-assisted oxidative desulfurization of dibenzothiophene and benzothiophene were carried out using polyoxometalate/H2O2 systems and a phase transfer agent. The effects of reaction time (2–30 min) and temperature (30–70 °C) were examined in the oxidation of model sulfu...
Oxidative desulfurization of model diesel via dual activation by a protic ionic liquid
Energy Technology Data Exchange (ETDEWEB)
Lü, Hongying, E-mail: hylv@ytu.edu.cn; Wang, Shunan; Deng, Changliang; Ren, Wanzhong; Guo, Baocun
2014-08-30
Highlights: • A protic ionic liquid, [Hnmp]HCOO, was used as in ODS. • The mechanism of ODS was involved in dual activation by the PIL. • The [Hnmp]HCOO exhibited high catalytic activity in ODS. • The amounts of PILs and oxidant dosage play vital roles in desulfurization system. • This system can be recycled five times with an unnoticeable decrease in activity. - Abstract: A novel and green carboxylate-anion-based protic ionic liquid (PIL), [Hnmp]HCOO, was prepared through a simple and atom economic neutralization reaction between N-methyl-2-pyrrolidonium (NMP) and formic acids. Both FT-IR spectra and {sup 1}H NMR confirmed its simple salt structure. [Hnmp]HCOO exhibited so high catalytic activity that the dibenzothiophene (DBT) removal reached 99% at 50 °C in 3 h under conditions of V{sub PIL}/V{sub model} {sub oil} = 1:10 and H{sub 2}O{sub 2}/DBT (O/S, molar ratio) = 5. The catalytic oxidation reactivity of S-compounds was found to be in the order of DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT) > benzothiophene (BT). The investigation on mechanism showed that oxidative desulfurization was realized through dual activation of PIL. Moreover, [Hnmp]HCOO can be recycled for five times with an unnoticeable decrease in desulfurization activity.
Oxidative desulfurization of model diesel via dual activation by a protic ionic liquid
International Nuclear Information System (INIS)
Lü, Hongying; Wang, Shunan; Deng, Changliang; Ren, Wanzhong; Guo, Baocun
2014-01-01
Highlights: • A protic ionic liquid, [Hnmp]HCOO, was used as in ODS. • The mechanism of ODS was involved in dual activation by the PIL. • The [Hnmp]HCOO exhibited high catalytic activity in ODS. • The amounts of PILs and oxidant dosage play vital roles in desulfurization system. • This system can be recycled five times with an unnoticeable decrease in activity. - Abstract: A novel and green carboxylate-anion-based protic ionic liquid (PIL), [Hnmp]HCOO, was prepared through a simple and atom economic neutralization reaction between N-methyl-2-pyrrolidonium (NMP) and formic acids. Both FT-IR spectra and 1 H NMR confirmed its simple salt structure. [Hnmp]HCOO exhibited so high catalytic activity that the dibenzothiophene (DBT) removal reached 99% at 50 °C in 3 h under conditions of V PIL /V model oil = 1:10 and H 2 O 2 /DBT (O/S, molar ratio) = 5. The catalytic oxidation reactivity of S-compounds was found to be in the order of DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT) > benzothiophene (BT). The investigation on mechanism showed that oxidative desulfurization was realized through dual activation of PIL. Moreover, [Hnmp]HCOO can be recycled for five times with an unnoticeable decrease in desulfurization activity
The Biocatalytic Desulfurization Project
Energy Technology Data Exchange (ETDEWEB)
David Nunn; James Boltz; Philip M. DiGrazia; Larry Nace
2006-03-03
The material in this report summarizes the Diversa technical effort in development of a biocatalyst for the biodesulfurization of Petro Star diesel as well as an economic report of standalone and combined desulfurization options, prepared by Pelorus and Anvil, to support and inform the development of a commercially viable process. We will discuss goals of the projected as originally stated and their modification as guided by parallel efforts to evaluate commercialization economics and process parameters. We describe efforts to identify novel genes and hosts for the generation of an optimal biocatalyst, analysis of diesel fuels (untreated, chemically oxidized and hydrotreated) for organosulfur compound composition and directed evolution of enzymes central to the biodesulfurization pathway to optimize properties important for their use in a biocatalyst. Finally we will summarize the challenges and issues that are central to successful development of a viable biodesulfurization process.
Core-in-shell sorbent for hot coal gas desulfurization
Wheelock, Thomas D.; Akiti, Jr., Tetteh T.
2004-02-10
A core-in-shell sorbent is described herein. The core is reactive to the compounds of interest, and is preferably calcium-based, such as limestone for hot gas desulfurization. The shell is a porous protective layer, preferably inert, which allows the reactive core to remove the desired compounds while maintaining the desired physical characteristics to withstand the conditions of use.
Chen, Ying-Liang; Chang, Juu-En; Shih, Pai-Haung; Ko, Ming-Sheng; Chang, Yi-Kuo; Chiang, Li-Choung
2010-09-01
The purpose of this study was to combine the physical pretreatments of grinding, sieving, and magnetic-separation processes to reclaim iron-rich materials from the desulfurization slag, and to use the remainder for cement clinker production. The iron-rich materials can be separated out efficiently by grinding for 30 min and sieving with a 0.3 mm mesh. The non-magnetic fraction of the particles smaller than 0.3 mm was in the majority, and proved to be suitable for use as a cement raw material. The raw mixes prepared with a pretreated desulfurization slag had a relatively high reactivity, and the temperature at which alite forms was significantly reduced during the clinkerization process. The clinkers produced with 10% desulfurization slag had a high level of alite and good grindability. Generally, the improvements in clinkerization and clinker grindability are beneficial to energy conservation in cement manufacture. 2010 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Angelo Earvin Sy Choi
2016-07-01
Full Text Available Desulfurization of fossil fuel derived oil is needed in order to comply with environmental regulations. Dibenzothiophene and benzothiophene are among the predominant sulfur compound present in raw diesel oil. In this study, mixing-assisted oxidative desulfurization of dibenzothiophene and benzothiophene were carried out using polyoxometalate/H2O2 systems and a phase transfer agent. The effects of reaction time (2–30 min and temperature (30–70 °C were examined in the oxidation of model sulfur compounds mixed in toluene. A pseudo first-order reaction kinetic model and the Arrhenius equation were utilized in order to evaluate the kinetic rate constant and activation energy of each catalyst tested in the desulfurization process. Results showed the order of catalytic activity and activation energy of the different polyoxometalate catalysts to be H3PW12O40 > H3PM12O40 > H4SiW12O40 for both dibenzothiophene and benzothiophene.
Desulfurization of chemical waste gases and flue gases with economic utilization of air pollutants
Energy Technology Data Exchange (ETDEWEB)
Asperger, K.; Wischnewski, W.
1983-09-01
The technological state of recovery of sulfur dioxide from waste and flue gases in the GDR is discussed. Two examples of plants are presented: a pyrosulfuric acid plant in Coswig, recovering sulfur dioxide from gases by absorption with sodium hydroxide, followed by catalytic oxidation to sulfur trioxide, and a plant for waste sulfuric acid recovery from paraffin refining, where the diluted waste acid is sprayed into a furnace and recovered by an ammonium-sulfite-bisulfite solution from the combustion gas (with 4 to 10% sulfur dioxide content). Investment and operation costs as well as profits of both plants are given. Methods employed for power plant flue gas desulfurization in major industrial countries are further assessed: about 90% of these methods uses wet flue gas scrubbing with lime. In the USA flue gas from 25,000 MW of power plant capacity is desulfurized. In the USSR, a 35,000 m/sup 3//h trial plant at Severo-Donetzk is operating using lime, alkali and magnesite. At the 150 MW Dorogobush power plant in the USSR a desulfurization plant using a cyclic ammonia process is under construction.
Photooxidative desulfurization for diesel using Fe / N - TiO2 photocatalyst
Khan, Muhammad Saqib; Kait, Chong Fai; Mutalib, Mohd Ibrahim Abdul
2014-10-01
A series of N - TiO2 with different mol% N was synthesized via sol-gel method and characterized using thermal gravimetric analyzer and raman spectroscopy. 0.2 wt% Fe was incorporated onto the calcined (200°C) N - TiO2 followed by calcination at 200°C, 250°C and 300°C. Photooxidative desulfurization was conducted in the presence of 0.2wt% Fe / N - TiO2 with different mol% N with and without oxidant (H2O2). Oxidative desulfurization was only achieved when H2O2 was used while without H2O2 no major effect on the sulfur removal. 0.2Fe -30N - H2O2 photocatalysts showed best performance at all calcination temperatures as compared to other mol% N - H2O2 photocatalysts. 16.45% sulfur removal was achieved using photocatalysts calcined at 300 °C.
Investigation of organic desulfurization additives affecting the calcium sulfate crystals formation
Directory of Open Access Journals (Sweden)
Lv Lina
2017-01-01
Full Text Available In the study, the optimal experimental conditions for gypsum crystals formation were 323 K, 300 rpm stirring speed. The major impurities of Mg2+, Al3+ and Fe3+ were found to inhibit calcium sulfate crystals formation. Fe3+ caused the strongest inhibition, followed by Mg2+ and Al3+. The influence of desulfurization additives on the gypsum crystals formation was explored with the properties of moisture content, particle size distribution and crystal morphology. The organic desulfurization additives of adipic acid, citric acid, sodium citrate and benzoic acid were investigated. Citric acid and sodium citrate were found to improve the quality of gypsum. Moisture contents were reduced by more than 50%, gypsum particle sizes were respectively enlarged by 9.1 and 22.8%, induction time extended from 4.3 (blank to 5.3 and 7.8 min, and crystal morphology trended to be thicker.
Energy Technology Data Exchange (ETDEWEB)
Rossow, Silvana; Deerberg, Goerge; Goetze, Toralf; Kanswohl, Norbert; Nelles, Michael [Univ. Rostock (Germany). Lehrstuhl fuer Abfall- und Stoffstromwirtschaft
2009-05-15
Doped activated carbon is a special developed activated carbon for the desulfurization of technical gases. Based on its special adsorption properties, it is able to bond a large amount of hydrogen sulfide. By the special manufacturing method it was possible to optimize further the performance for the desulfurization of gases. In a biogas plant with an installed electric capacity of 2 MW the functionality of the doped activated carbon was proofed in a real biogas stream in a 20 month pilot test. The activated carbon was used in a special adsorption system that was tunes on the requirement of the activated carbon and on the site of installation. Because the biogas plant was in the starting period, all the time there were variable operation conditions. In spite of the variable conditions the doped activated carbon shows a permanent complete desulfurization, as in the executed laboratory experiments. By the use of the desulfurization system the concentration of hydrogen sulfide is decreased less than 1 ppm. The prejudices with are often caused by hydrogen sulphide could not identify until now. A positive evidence of the excellent desulfurization is the doubling of the oil lifetime of the block heating station. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Wang, Yong
2012-07-01
Fuel cell powered APUs are promising for the on-board electricity supply in heavy vehicles, aircraft and ships because of their high efficiency and low emission of pollutants. The catalytical reforming with subsequent gas processing units is applied to operate the fuel cell system with onboard available fuels. Within the reformer the liquid fuel is converted into a hydrogen-rich synthesis gas in the presence of metal catalysts. However, an on-board desulfurization of fuels is required to avoid the deactivation of catalysts in the fuel processing unit as well as in the fuel cell. The present work aims at developing a technically feasible deep desulfurization process for fuel cell powered APUs with theoretical and experimental study as well as procedural analysis. The focus of the work is on the desulfurization of jet fuels in liquid phase, since the reformer currently developed in IEK-3 is designed for aviation applications of fuel cell APUs and it can only be operated by liquid jet fuels. In addition, the desulfurization of marine gas oil was investigated to fulfill the sulfur requirement of the fuels for the application of fuel cell A PUs for inland navigation. In the petroleum industry, low-sulfur fuels are often obtained by hydrodesulfurization and the S-Zorb Process. However, these conventional methods are highly inconvenient for reducing sulfur compounds to the desired level in a mobile fuel cell system, since improvements of the desulfurization efficiency are limited by increasingly severe operating conditions and escalating costs. Moreover, the hydrodesulfurization and the S-Zorb Process are not suitable for mobile applications, since hydrogen recycling is required, which is not possible with H{sub 2} syngas. To this end, a large number of processes discussed in the literature were assessed with regard to their application in fuel cell APUs. Three potentially suitable processes were selected: pervaporation, adsorption, and hydrodesulfurization with pre
Desulfurization of waste gases of the incinerator after petroleum refining
International Nuclear Information System (INIS)
Samesova, D.; Ladomersky, J.
2001-01-01
Desulfurization of waste gases of the incinerator after petroleum refining was developed. Mixing of wastes with lime (10% of additive of total volume of waste) was proved before introduction into incinerator. Concentrations of CO, CO 2 , O 2 , NO 2 , SO 2 and temperature of combustion products were measured by automatic analyser
Identification of a mismatch-specific endonuclease in hyperthermophilic Archaea.
Ishino, Sonoko; Nishi, Yuki; Oda, Soichiro; Uemori, Takashi; Sagara, Takehiro; Takatsu, Nariaki; Yamagami, Takeshi; Shirai, Tsuyoshi; Ishino, Yoshizumi
2016-04-20
The common mismatch repair system processed by MutS and MutL and their homologs was identified in Bacteria and Eukarya. However, no evidence of a functional MutS/L homolog has been reported for archaeal organisms, and it is not known whether the mismatch repair system is conserved in Archaea. Here, we describe an endonuclease that cleaves double-stranded DNA containing a mismatched base pair, from the hyperthermophilic archaeon Pyrococcus furiosus The corresponding gene revealed that the activity originates from PF0012, and we named this enzyme Endonuclease MS (EndoMS) as the mismatch-specific Endonuclease. The sequence similarity suggested that EndoMS is the ortholog of NucS isolated from Pyrococcus abyssi, published previously. Biochemical characterizations of the EndoMS homolog from Thermococcus kodakarensis clearly showed that EndoMS specifically cleaves both strands of double-stranded DNA into 5'-protruding forms, with the mismatched base pair in the central position. EndoMS cleaves G/T, G/G, T/T, T/C and A/G mismatches, with a more preference for G/T, G/G and T/T, but has very little or no effect on C/C, A/C and A/A mismatches. The discovery of this endonuclease suggests the existence of a novel mismatch repair process, initiated by the double-strand break generated by the EndoMS endonuclease, in Archaea and some Bacteria. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.
Semi-dry flue gas desulfurization using Ca(OH)2 in a fluidized bed reactor with bed materials
International Nuclear Information System (INIS)
Park, Young Oak; Roh, Hak Jae; Oh, Chang Sup; Kim, Yong Ha
2010-01-01
The main objective of present work is to reduce sulfur dioxide emission from power plant for the environment protection. The fluidized bed (FB) was used as the reactor with bed materials in a new semi-dry flue gas desulfurization (FGD) process to achieve high desulfurization efficiency (>98%). Fine powder of Ca(OH) 2 as sorbent and water were continuously fed separately to the bed reactor where bed materials (2 mm glass beads) were fluidized vigorously with flue gas (flow 720 Nm 3 / hr) using bench scale plant of stainless steel column. We have investigated different effects of water injection flow rate, Ca/ S molar ratio and weight of bed materials on SO 2 removal. The increments in the Ca/ S molar ratio and water injection flow rate have been resulted higher desulfurization efficiency with certain disadvantages such as higher sorbent cost and lower temperature of the treated flue gas, respectively. (author)
Bio-desulfurization technology in Japan; Wagakuni ni okeru baio datsuryu gijutsu
Energy Technology Data Exchange (ETDEWEB)
Maruhashi, K. [Petroleum Energy Center, Tokyo (Japan)
2000-05-01
A bio-reaction of microbes (catalytic reaction by an enzyme) is characterized in that the reaction is carried out at a normal temperature and under a normal pressure and has particularly high specificity with respect to substrate (reactant). It is considered that a low loading process of environment harmony type can be constructed by applying the bio-reaction in petroleum refinery process. CO{sub 2} exhaust and energy consumption in the bio-desulfurization (BDS) is estimated to be 70 to 80% lower than those in hydrodesulfurization (HDS). The bio-technologies that can be applied to the petroleum refinery process include, for example, desulfurization, demetallation, dewaxing, denitration, cracking and so on. In this paper, the present state of bio-desulphurization technology is introduced. Particularly, as the research results in Japan, acquirement of mesophile R.erythropolis KA2-5-1 strain, thermophile Paenibacillus sp. A11-2 strain whose optimum temperature is 50 degrees C, BT degradation fungus Rhodococcus sp. T09 and the like are introduced. (NEDO)
Biological flue gas desulfurization
Energy Technology Data Exchange (ETDEWEB)
Buisman, C.J.N.; Dijkman, H.; Wijte, G.; Prins, W.L.; Verbraak, P.; Hartog, H.A.J. den [Paper B.V. Blak (Netherlands)
1995-08-01
A new biological flue gas desulfurization process (BIO-FGD) producing sulphur as a by-product was invented by Paques BV and Hoogens Technical Services in 1993. Sulphur dioxide is absorbed from flue gas using a combination of a sodium based scrubber and two biological reactors, an anaerobic and an aerobic biological reactor. The article describes the process and its evaluation in a pilot plant at 2 MW scale, designed to remove 6 kg/hr SO{sub 2} of the 2 million m{sup 3}/hr of flue gas produced at the 600 MW coal fired power station Amer-8 situated in Geertruidenberg in the south of the Netherlands. Research so far has proved the process works successfully and at low cost. A second pilot plant due to start-up in May 1995 will provide data on scale up and further information on sulphur recovery. 5 refs., 5 figs.
Mechanical, Hygric and Thermal Properties of Flue Gas Desulfurization Gypsum
Directory of Open Access Journals (Sweden)
P. Tesárek
2004-01-01
Full Text Available The reference measurements of basic mechanical, thermal and hygric parameters of hardened flue gas desulfurization gypsum are carried out. Moisture diffusivity, water vapor diffusion coefficient, thermal conductivity, volumetric heat capacity and linear thermal expansion coefficient are determined with the primary aim of comparison with data obtained for various types of modified gypsum in the future.
International Nuclear Information System (INIS)
Cao Ruijian; Zhang Xiongfei; Wu Hong; Wang Jingtao; Liu Xiaofei; Jiang Zhongyi
2011-01-01
Pervaporative desulfurization based on membrane technology provides a promising alternative for removal of sulfur substances (as represented by thiophene) in fluid catalytic cracking (FCC) gasoline. The present study focused on the performance enhancement of polydimethylsiloxane (PDMS) membrane by incorporation of core-shell structured silver/silica microspheres. A silane coupling agent, N-[3-(trimethoxysily)propyl]-ethylenediamine (TSD), was used to chelate the Ag + via its amino groups and attach the silver seeds onto the silica surface via condensation of its methoxyl groups. The resultant microspheres were characterized by Zeta-positron annihilation lifetime spectroscopy (ZetaPALS), inductively coupled plasmaoptical emission spectrophotometer (ICP), transmission electron microscopy (TEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS). The Ag + /SiO 2 -PDMS composite membranes were prepared by blending PDMS with the as-synthesized silver/silica microspheres. PALS analysis was used to correlate the apparent fractional free volume with permeation flux. The sorption selectivity towards thiophene was enhanced after incorporation of silver/silica microspheres due to the π-complexation between the silver on the microsphere surface and the thiophene molecules. The pervaporative desulfurization performance of the composite membrane was investigated using thiophene/n-octane mixture as a model gasoline. The composite membrane exhibited an optimum desulfurization performance with a permeation flux of 7.76 kg/(m 2 h) and an enrichment factor of 4.3 at the doping content of 5%.
BENCH-SCALE DEMONSTRATION OF HOT-GAS DESULFURIZATION TECHNOLOGY
International Nuclear Information System (INIS)
Unknown
2000-01-01
The U.S. Department of Energy (DOE), National Energy Technology Laboratory (NETL), is sponsoring research in advanced methods for controlling contaminants in hot coal gasifier gas (coal-derived fuel-gas) streams of integrated gasification combined-cycle (IGCC) power systems. The hot gas cleanup work seeks to eliminate the need for expensive heat recovery equipment, reduce efficiency losses due to quenching, and minimize wastewater treatment costs. Hot-gas desulfurization research has focused on regenerable mixed-metal oxide sorbents that can reduce the sulfur in coal-derived fuel-gas to less than 20 ppmv and can be regenerated in a cyclic manner with air for multicycle operation. Zinc titanate (Zn(sub 2)TiO(sub 4) or ZnTiO(sub 3)), formed by a solid-state reaction of zinc oxide (ZnO) and titanium dioxide (TiO(sub 2)), is currently one of the leading sorbents. Overall chemical reactions with Zn(sub 2)TiO(sub 4) during the desulfurization (sulfidation)-regeneration cycle are shown. The sulfidation/regeneration cycle can be carried out in a fixed-bed, moving-bed, or fluidized-bed reactor configuration. The fluidized-bed reactor configuration is most attractive because of several potential advantages including faster kinetics and the ability to handle the highly exothermic regeneration to produce a regeneration offgas containing a constant concentration of SO(sub 2)
BENCH-SCALE DEMONSTRATION OF HOT-GAS DESULFURIZATION TECHNOLOGY
International Nuclear Information System (INIS)
Unknown
1999-01-01
The U.S. Department of Energy (DOE), National Energy Technology Laboratory (NETL), is sponsoring research in advanced methods for controlling contaminants in hot coal gasifier gas (coal-derived fuel-gas) streams of integrated gasification combined-cycle (IGCC) power systems. The hot gas cleanup work seeks to eliminate the need for expensive heat recovery equipment, reduce efficiency losses due to quenching, and minimize wastewater treatment costs. Hot-gas desulfurization research has focused on regenerable mixed-metal oxide sorbents that can reduce the sulfur in coal-derived fuel-gas to less than 20 ppmv and can be regenerated in a cyclic manner with air for multicycle operation. Zinc titanate (Zn(sub 2)TiO(sub 4) or ZnTiO(sub 3)), formed by a solid-state reaction of zinc oxide (ZnO) and titanium dioxide (TiO(sub 2)), is currently one of the leading sorbents. Overall chemical reactions with Zn(sub 2)TiO(sub 4) during the desulfurization (sulfidation)-regeneration cycle are shown. The sulfidation/regeneration cycle can be carried out in a fixed-bed, moving-bed, or fluidized-bed reactor configuration. The fluidized-bed reactor configuration is most attractive because of several potential advantages including faster kinetics and the ability to handle the highly exothermic regeneration to produce a regeneration offgas containing a constant concentration of SO(sub 2)
International Nuclear Information System (INIS)
Huang, Shuyuan; Yuan, Dongxing; Lin, Haiying; Sun, Lumin; Lin, Shanshan
2017-01-01
In the current study, fractionation of mercury isotopes during coal combustion and seawater flue gas desulfurization (SFGD) in a coal-fired power plant using a SFGD system was investigated. Fourteen samples were collected from the power plant. The samples were pretreated with a combustion-trapping method and were analyzed with a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS). Compared with the raw coal, the bottom ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −0.45 to −0.03‰. The fly ash was enriched with lighter mercury isotopes with δ 202 Hg values ranging from −1.49 to −0.73‰ for Chinese coal and from −1.47 to −0.62‰ for Indonesian coal. The δ 202 Hg of fresh seawater and desulfurized seawater was found to be −1.32 and −0.32‰ respectively. These δ 202 Hg values indicated that the desulfurized seawater was enriched with heavier mercury isotopes. Based upon the calculated results obtained from the mass balance equation, it was suggested that the stack emissions were enriched with lighter mercury isotopes. Mass independent fractionation was observed in most of the samples with a Δ 199 Hg/Δ 201 Hg ratio of approximately 0.96. The results help in improving the understanding of mercury isotope fractionation during coal combustion and SFGD, and are also useful in tracing the mercury emissions from coal fired power plants. - Highlights: • Spread of 1.5‰ was observed in δ 202 Hg values of raw coals and coal related samples. • The δ 202 Hg values were more negative in fly ash than those in the raw coal. • The flue gas had a significant Hg fractionation after desulfurization. • The stack emissions were enriched with lighter isotopes compared with the raw coal.
Verhaart, Marcel R A; Bielen, Abraham A M; van der Oost, John; Stams, Alfons J M; Kengen, Servé W M
2010-01-01
Hydrogen produced from biomass by bacteria and archaea is an attractive renewable energy source. However, to make its application more feasible, microorganisms are needed with high hydrogen productivities. For several reasons, hyperthermophilic and extremely thermophilic bacteria and archaea are promising is this respect. In addition to the high polysaccharide-hydrolysing capacities of many of these organisms, an important advantage is their ability to use most of the reducing equivalents (e.g. NADH, reduced ferredoxin) formed during glycolysis for the production of hydrogen, enabling H2/hexose ratios of between 3.0 and 4.0. So, despite the fact that the hydrogen-yielding reactions, especially the one from NADH, are thermodynamically unfavourable, high hydrogen yields are obtained. In this review we focus on three different mechanisms that are employed by a few model organisms, viz. Caldicellulosiruptor saccharolyticus and Thermoanaerobacter tengcongensis, Thermotoga maritima, and Pyrococcus furiosus, to efficiently produce hydrogen. In addition, recent developments to improve hydrogen production by hyperthermophilic and extremely thermophilic bacteria and archaea are discussed.
Zheng, Wenjun; Wang, Qingsong; Bi, Qun
2016-04-01
Pfu DNA polymerase (Pfu) is a DNA polymerase isolated from the hyperthermophilic archaeon Pyrococcus furiosus. With its excellent thermostability and high fidelity, Pfu is well known as one of the enzymes widely used in the polymerase chain reaction. In this study, the recombinant plasmid pLysS His6-tagged Pfu-pET28a was constructed. His-tagged Pfu was expressed in Escherichia coli BL21 (DE3) competent cells and then successfully purified with the ÄKTAprime plus compact one-step purification system by Ni(2+) chelating affinity chromatography after optimization of the purification conditions. The authenticity of the purified Pfu was further confirmed by peptide mass fingerprinting. A bio-assay indicated that its activity in the polymerase chain reaction was equivalent to that of commercial Pfu and its isoelectric point was found to be between 6.85 and 7.35. These results will be useful for further studies on Pfu and its wide application in the future.
Analysis of the crystal structure of an active MCM hexamer.
Miller, Justin M; Arachea, Buenafe T; Epling, Leslie B; Enemark, Eric J
2014-09-29
In a previous Research article (Froelich et al., 2014), we suggested an MCM helicase activation mechanism, but were limited in discussing the ATPase domain because it was absent from the crystal structure. Here we present the crystal structure of a nearly full-length MCM hexamer that is helicase-active and thus has all features essential for unwinding DNA. The structure is a chimera of Sulfolobus solfataricus N-terminal domain and Pyrococcus furiosus ATPase domain. We discuss three major findings: 1) a novel conformation for the A-subdomain that could play a role in MCM regulation; 2) interaction of a universally conserved glutamine in the N-terminal Allosteric Communication Loop with the AAA+ domain helix-2-insert (h2i); and 3) a recessed binding pocket for the MCM ssDNA-binding motif influenced by the h2i. We suggest that during helicase activation, the h2i clamps down on the leading strand to facilitate strand retention and regulate ATP hydrolysis.
Thermostability in rubredoxin and its relationship to mechanical rigidity
Rader, A. J.
2010-03-01
The source of increased stability in proteins from organisms that thrive in extreme thermal environments is not well understood. Previous experimental and theoretical studies have suggested many different features possibly responsible for such thermostability. Many of these thermostabilizing mechanisms can be accounted for in terms of structural rigidity. Thus a plausible hypothesis accounting for this remarkable stability in thermophilic enzymes states that these enzymes have enhanced conformational rigidity at temperatures below their native, functioning temperature. Experimental evidence exists to both support and contradict this supposition. We computationally investigate the relationship between thermostability and rigidity using rubredoxin as a case study. The mechanical rigidity is calculated using atomic models of homologous rubredoxin structures from the hyperthermophile Pyrococcus furiosus and mesophile Clostridium pasteurianum using the FIRST software. A global increase in structural rigidity (equivalently a decrease in flexibility) corresponds to an increase in thermostability. Locally, rigidity differences (between mesophilic and thermophilic structures) agree with differences in protection factors.
Thermostability in rubredoxin and its relationship to mechanical rigidity
International Nuclear Information System (INIS)
Rader, A J
2010-01-01
The source of increased stability in proteins from organisms that thrive in extreme thermal environments is not well understood. Previous experimental and theoretical studies have suggested many different features possibly responsible for such thermostability. Many of these thermostabilizing mechanisms can be accounted for in terms of structural rigidity. Thus a plausible hypothesis accounting for this remarkable stability in thermophilic enzymes states that these enzymes have enhanced conformational rigidity at temperatures below their native, functioning temperature. Experimental evidence exists to both support and contradict this supposition. We computationally investigate the relationship between thermostability and rigidity using rubredoxin as a case study. The mechanical rigidity is calculated using atomic models of homologous rubredoxin structures from the hyperthermophile Pyrococcus furiosus and mesophile Clostridium pasteurianum using the FIRST software. A global increase in structural rigidity (equivalently a decrease in flexibility) corresponds to an increase in thermostability. Locally, rigidity differences (between mesophilic and thermophilic structures) agree with differences in protection factors
Shiraishi, Miyako; Ishino, Sonoko; Cann, Isaac; Ishino, Yoshizumi
2017-05-01
DNA base deamination occurs spontaneously under physiological conditions and is promoted by high temperature. Therefore, hyperthermophiles are expected to have efficient repair systems of the deaminated bases in their genomes. Endonuclease Q (EndoQ) was originally identified from the hyperthermophlic archaeon, Pyrococcus furiosus, as a hypoxanthine-specific endonuclease recently. Further biochemical analyses revealed that EndoQ also recognizes uracil, xanthine, and the AP site in DNA, and is probably involved in a specific repair process for damaged bases. Initial phylogenetic analysis showed that an EndoQ homolog is found only in the Thermococcales and some of the methanogens in Archaea, and is not present in most members of the domains Bacteria and Eukarya. A better understanding of the distribution of the EndoQ-mediated repair system is, therefore, of evolutionary interest. We showed here that an EndoQ-like polypeptide from Bacillus pumilus, belonging to the bacterial domain, is functional and has similar properties with the archaeal EndoQs.
Feasibility Study of Commercial Sorbent in Coal-derived Syngas Desulfurization Field.
Czech Academy of Sciences Publication Activity Database
Chien, H.-Y.; Chyou, Y.-P.; Svoboda, Karel
2015-01-01
Roč. 6, č. 4 (2015), s. 236-242 ISSN 2078-0737 R&D Projects: GA ČR GC14-09692J Grant - others:MOST(TW) NSC 103-2923-E-042A-001 -MY3 Institutional support: RVO:67985858 Keywords : gasification * desulfurization * sorbent Subject RIV: CI - Industrial Chemistry, Chemical Engineering
Biological (flue) gas desulfurization
Energy Technology Data Exchange (ETDEWEB)
Buisman, C.J.N.; Dijkman, H. [PAQUES, Balk (Netherlands); Prins, W.L.; Verbraak, P. [Biostar CV, Balk (Netherlands); Den Hartog, A.J. [Hoogovens Groep BV, IJmuiden (Netherlands)
1995-12-31
Biotechnological research has been carried out to find new micro-organisms and processes to make useful products, and to reveal new ways and biotechnological mechanisms to produce elemental sulfur in waste water treatment. Biotechnological development work has been carried out and the first commercial installation (on 300 m{sup 3}/hr scale) to produce sulfur from polluted waste water was started up in 1992. The importance of this recent research and development in the area of waste water treatment was recognized. In an intensive cooperation between Hoogovens Technical Services and PACQUES the concept for a totally new Biological Flue Gas Desulfurization process (BIO-FGD), producing sulfur as by-product, was invented. It consists of the combination of a sodium scrubber with two biological reactors resulting in a very attractive new concept for a gas cleaning process. A description of the process is given and the pilot plant results are outlined. 4 figs., 5 refs.
Desulfurization Activated Phosphorothioate DNAzyme for the Detection of Thallium.
Huang, Po-Jung Jimmy; Vazin, Mahsa; Liu, Juewen
2015-10-20
Thallium (Tl) is a highly toxic heavy metal situated between mercury and lead in the periodic table. While its neighbors have been thoroughly studied for DNA-based sensing, little is known about thallium detection. In this work, in vitro selection of RNA-cleaving DNAzymes is carried out using Tl(3+) as the target metal cofactor. Both normal DNA and phosphorothioate (PS)-modified DNA are tested for this purpose. While no Tl(3+)-dependent DNAzymes are obtained, a DNA oligonucleotide containing a single PS-modified RNA nucleotide is found to cleave by ∼7% by Tl(3+) at the RNA position. The remaining 93% are desulfurized. By hybridization of this PS-modified oligonucleotide with the Tm7 DNAzyme, the cleavage yield increases to ∼40% in the presence of Tl(3+) and Er(3+). Tm7 is an Er(3+)-dependent RNA-cleaving DNAzyme. It cleaves only the normal substrate but is completely inactive using the PS-modified substrate. Tl(3+) desulfurizes the PS substrate to the normal substrate to be cleaved by Tm7 and Er(3+). This system is engineered into a catalytic beacon for Tl(3+) with a detection limit of 1.5 nM, which is below its maximal contamination limit defined by the U.S. Environmental Protection Agency (10 nM).
Highly flexible sub-1 nm tungsten oxide nanobelts as efficient desulfurization catalysts.
He, Jie; Liu, Huiling; Xu, Biao; Wang, Xun
2015-03-01
Ultrathin tungsten oxide nanobelts are successfully synthesized via a facile solvothermal method. Sub-1 nm thickness and hydrophobic surface property endow the nanobelts with flexibility, viscosity, gelation, and good catalytic performance in oxidative desulfurization. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Afzalinia, Ahmad; Mirzaie, Abbas; Nikseresht, Ahmad; Musabeygi, Tahereh
2017-01-01
In this work, ultrasound-assisted oxidative desulfurization (UAOD) of liquid fuels performed with a novel heterogeneous highly dispersed Keggin-type phosphotungstic acid (H 3 PW 12 O 40 , PTA) catalyst that encapsulated into an amino-functionalized MOF (TMU-17-NH 2 ). The prepared composite exhibits high catalytic activity and reusability in oxidative desulfurization of model fuel. Ultrasound-assisted oxidative desulfurization (UAOD) is a new way to performed oxidation reaction of sulfur-contain compounds rapidly, economically, environment-friendly and safely, under mild conditions. Ultrasound waves can be apply as an efficient tool to decrease the reaction time and improves oxidative desulfurization system performance. PTA@TMU-17-NH 2 could be completely performed desulfurization of the model oil by 20mg of catalyst, O/S molar ratio of 1:1 in presence of MeCN as extraction solvent. The obtained results indicated that the conversions of DBT to DBTO 2 achieve 98% after 15min in ambient temperature. In this work, we prepared TMU-17-NH 2 and PTA/TMU-17-NH 2 composite by ultrasound irradiation for first time and employed in UAOD process. Prepared catalyst exhibit an excellent reusability without PTA leaching and loss of activity. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
ADVANCED SULFUR CONTROL CONCEPTS FOR HOT-GAS DESULFURIZATION TECHNOLOGY
Energy Technology Data Exchange (ETDEWEB)
A. LOPEZ ORTIZ; D.P. HARRISON; F.R. GROVES; J.D. WHITE; S. ZHANG; W.-N. HUANG; Y. ZENG
1998-10-31
This research project examined the feasibility of a second generation high-temperature coal gas desulfurization process in which elemental sulfur is produced directly during the sorbent regeneration phase. Two concepts were evaluated experimentally. In the first, FeS was regenerated in a H2O-O2 mixture. Large fractions of the sulfur were liberated in elemental form when the H2O-O2 ratio was large. However, the mole percent of elemental sulfur in the product was always quite small (<<1%) and a process based on this concept was judged to be impractical because of the low temperature and high energy requirements associated with condensing the sulfur. The second concept involved desulfurization using CeO2 and regeneration of the sulfided sorbent, Ce2O2S, using SO2 to produce elemental sulfur directly. No significant side reactions were observed and the reaction was found to be quite rapid over the temperature range of 500°C to 700°C. Elemental sulfur concentrations (as S2) as large as 20 mol% were produced. Limitations associated with the cerium sorbent process are concentrated in the desulfurization phase. High temperature and highly reducing coal gas such as produced in the Shell gasification process are required if high sulfur removal efficiencies are to be achieved. For example, the equilibrium H2S concentration at 800°C from a Shell gas in contact with CeO2 is about 300 ppmv, well above the allowable IGCC specification. In this case, a two-stage desulfurization process using CeO2 for bulk H2S removal following by a zinc sorbent polishing step would be required. Under appropriate conditions, however, CeO2 can be reduced to non-stoichiometric CeOn (n<2) which has significantly greater affinity for H2S. Pre-breakthrough H2S concentrations in the range of 1 ppmv to 5 ppmv were measured in sulfidation tests using CeOn at 700°C in highly reducing gases, as measured by equilibrium O2 concentration, comparable to the Shell gas. Good sorbent durability was indicated in
Advanced sulfur control concepts for hot-gas desulfurization technology
International Nuclear Information System (INIS)
Lopez Ortiz, A.; Harrison, D.P.; Groves, F.R.; White, J.D.; Zhang, S.; Huang, W.N.; Zeng, Y.
1998-01-01
This research project examined the feasibility of a second generation high-temperature coal gas desulfurization process in which elemental sulfur is produced directly during the sorbent regeneration phase. Two concepts were evaluated experimentally. In the first, FeS was regenerated in a H2O-O2 mixture. Large fractions of the sulfur were liberated in elemental form when the H2O-O2 ratio was large. However, the mole percent of elemental sulfur in the product was always quite small (<<1%) and a process based on this concept was judged to be impractical because of the low temperature and high energy requirements associated with condensing the sulfur. The second concept involved desulfurization using CeO2 and regeneration of the sulfided sorbent, Ce2O2S, using SO2 to produce elemental sulfur directly. No significant side reactions were observed and the reaction was found to be quite rapid over the temperature range of 500C to 700C. Elemental sulfur concentrations (as S2) as large as 20 mol% were produced. Limitations associated with the cerium sorbent process are concentrated in the desulfurization phase. High temperature and highly reducing coal gas such as produced in the Shell gasification process are required if high sulfur removal efficiencies are to be achieved. For example, the equilibrium H2S concentration at 800C from a Shell gas in contact with CeO2 is about 300 ppmv, well above the allowable IGCC specification. In this case, a two-stage desulfurization process using CeO2 for bulk H2S removal following by a zinc sorbent polishing step would be required. Under appropriate conditions, however, CeO2 can be reduced to non-stoichiometric CeOn (n<2) which has significantly greater affinity for H2S. Pre-breakthrough H2S concentrations in the range of 1 ppmv to 5 ppmv were measured in sulfidation tests using CeOn at 700C in highly reducing gases, as measured by equilibrium O2 concentration, comparable to the Shell gas. Good sorbent durability was indicated in a
Results using flue gas desulfurization gypsum in soilless substrates for greenhouse crops
Recent availability of Flue Gas Desulfurization gypsum (FGDG) has led to interested in its possible use in horticulture greenhouse production. Three studies were conducted to determine the effects of increasing rates of FGDG on six greenhouse crops. In the first study, substrates (6:1 pine bark:san...
Ultrasound-assisted oxidative desulfurization of liquid fuels and its industrial application.
Wu, Zhilin; Ondruschka, Bernd
2010-08-01
Latest environmental regulations require a very deep desulfurization to meet the ultra-low sulfur diesel (ULSD, 15 ppm sulfur) specifications. Due to the disadvantages of hydrotreating technology on the slashing production conditions, costs and safety as well as environmental protection, the ultrasound-assisted oxidative desulfurization (UAOD) as an alternative technology has been developed. UAOD process selectively oxidizes sulfur in common thiophenes in diesel to sulfoxides and sulfones which can be removed via selective adsorption or extractant. SulphCo has successfully used a 5000 barrel/day mobile "Sonocracking" unit to duplicate on a commercial scale its proprietary process that applies ultrasonics at relatively low temperatures and pressures. The UAOD technology estimate capital costs less than half the cost of a new high-pressure hydrotreater. The physical and chemical mechanisms of UAOD process are illustrated, and the effective factors, such as ultrasonic frequency and power, oxidants, catalysts, phase-transfer agent, extractant and adsorbent, on reaction kinetics and product recovery are discussed in this review. Copyright 2009 Elsevier B.V. All rights reserved.
Deng, Jia-Jia; Pan, Liang-Ming; Chen, De-Qi; Dong, Yu-Quan; Wang, Cheng-Mu; Liu, Hang; Kang, Mei-Qiang
2014-01-01
Aimed at cost saving and pollution reduction, a novel desulfurization wastewater evaporation treatment system (DWETS) for handling wet flue gas desulfurization (WFGD) wastewater of a coal-fired power plant was studied. The system's advantages include simple process, and less investment and space. The feasibility of this system has been proven and the appropriate position and number of nozzles, the spray droplet size and flue gas temperature limitation have been obtained by computational fluid dynamics (CFD) simulation. The simulation results show that a longer duct, smaller diameter and higher flue gas temperature could help to increase the evaporation rate. The optimal DWETS design of Shangdu plant is 100 μm droplet sprayed by two nozzles located at the long duct when the flue gas temperature is 130 °C. Field tests were carried out based on the simulation results. The effects of running DWETS on the downstream devices have been studied. The results show that DWETS has a positive impact on ash removal efficiency and does not have any negative impact on the electrostatic precipitator (ESP), flue gas heat exchanger and WFGD. The pH values of the slurry of WFGD slightly increase when the DWETS is running. The simulation and field test of the DWETS show that it is a feasible future technology for desulfurization wastewater treatment.
Directory of Open Access Journals (Sweden)
Yinke Zhang
2018-01-01
Full Text Available Response surface methodology (RSM was selected to optimize a desulfurization process with metal based ionic liquids ([Bmim]Cl/CoCl2 and potassium monopersulfate (PMS together to remove benzothiophene (BT from octane (simulating oil. The four experimental conditions of PMS dosage, [Bmim]Cl/CoCl2 dosage, temperature, and reaction time were investigated. The results showed that the quadratic relationship was built up between BT removal and four experimental variables with 0.9898 fitting coefficient. The optimal conditions were 1.6 g (20 wt% PMS solution, 3.2 g [Bmim]Cl/CoCl2, 46°C, and 23 min, which were obtained based on RSM and experimental results. Under the optimal condition, predicted sulfur removal rate and experimental sulfur removal rate were 96.7% and 95.4%, respectively. The sequence of four experimental conditions on desulfurization followed the order temperature > time > [Bmim]Cl/CoCl2 dosage > PMS solution dosage.
Zhang, Qi; Gui, Keting; Wang, Xiaobo
2016-02-01
The effects of magnetic fields on improving the mass transfer in flue gas desulfurization using a fluidized bed are investigated in the paper. In this research, the magnetically fluidized bed (MFB) is used as the reactor in which ferromagnetic particles are fluidized with simulated flue gas under the influence of an external magnetic field. Lime slurry is continuously sprayed into the reactor. As a consequence, the desulfurization reaction and the slurry drying process take place simultaneously in the MFB. In this paper, the effects of ferromagnetic particles and external magnetic fields on the desulphurization efficiency are studied and compared with that of quartz particles as the fluidized particles. Experimental results show that the ferromagnetic particles not only act as a platform for lime slurry to precipitate on like quartz particles, but also take part in the desulfurization reaction. The results also show that the specific surface area of ferromagnetic particles after reaction is enlarged as the magnetic intensity increases, and the external magnetic field promotes the oxidation of S(IV), improving the mass transfer between sulphur and its sorbent. Hence, the efficiency of desulphurization under the effects of external magnetic fields is higher than that in general fluidized beds.
Energy Technology Data Exchange (ETDEWEB)
Jha, M.C.; Berggren, M.H.
1989-05-02
AMAX Research & Development Center (AMAX R&D) has been investigating methods for enhancing the reactivity and durability of the zinc ferrite desulfurization sorbent. Zinc ferrite sorbents are intended for use in desulfurization of hot coal gas in integrated gasification combined cycle (IGCC) or molten carbonate fuel cell (MCFC) applications. For the present program, the reactivity of the sorbent may be defined as its sulfur sorption capacity at the breakthrough point and at saturation in a bench-scale, fixed-bed reactor. Durability may be defined as the ability of the sorbent to maintain important physical characteristics such As size, strength, and specific surface area during 10 cycles of sulfidation and oxidation.
The rationalization of desulfurization by on-line analysis
Energy Technology Data Exchange (ETDEWEB)
Murakami, Y; Kohmura, S; Taketomi, H; Matsumura, S; Sasaki, Y
1986-01-01
Nippon Kokan uses the Takahax and Sulfiban processes for the desulfurization of coke oven gas. The authors outline the Sulfiban Process and describe a recently developed system for the on-line determination of H/sub 2/S in coke oven gas, and of CO/sub 2/ and monoethanolamine (MEA) in the wash oil. This new on-line analysis system has proved effective in rationalizing the Sulfiban Process via lower MEA production costs and decreased power consumption. The introduction of a computerized control system is now being studied. 7 figs., 4 tabs.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-01
The {open_quotes}Advanced Flue Gas Desulfurization (AFGD) Demonstration Project{close_quotes} is a $150.5 million cooperative effort between the U.S. Department of Energy and Pure Air, a general partnership of Air Products and Chemicals, Inc. and Mitsubishi Heavy Industries America, Inc. The AFGD process is one of several alternatives to conventional flue gas desulfurization (FGD) being demonstrated under the Department of Energy`s Clean Coal Technology Demonstration Program. The AFGD demonstration project is located at the Northern Indiana Public Service Company`s Bailly Generating Station, about 12 miles northeast of Gary, Indiana.
Oxidative desulfurization of model diesel via dual activation by a protic ionic liquid.
Lü, Hongying; Wang, Shunan; Deng, Changliang; Ren, Wanzhong; Guo, Baocun
2014-08-30
A novel and green carboxylate-anion-based protic ionic liquid (PIL), [Hnmp]HCOO, was prepared through a simple and atom economic neutralization reaction between N-methyl-2-pyrrolidonium (NMP) and formic acids. Both FT-IR spectra and (1)H NMR confirmed its simple salt structure. [Hnmp]HCOO exhibited so high catalytic activity that the dibenzothiophene (DBT) removal reached 99% at 50°C in 3h under conditions of VPIL/Vmodel oil=1:10 and H2O2/DBT (O/S, molar ratio)=5. The catalytic oxidation reactivity of S-compounds was found to be in the order of DBT>4,6-dimethyldibenzothiophene (4,6-DMDBT)>benzothiophene (BT). The investigation on mechanism showed that oxidative desulfurization was realized through dual activation of PIL. Moreover, [Hnmp]HCOO can be recycled for five times with an unnoticeable decrease in desulfurization activity. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Benjamin, G.; Roman, M.; Yamazaki, Y.; Abe, H.; Harano, Y.; Takarada, Y. [Gunma University, Gunma (Japan). Faculty of Engineering
1996-10-28
The effect of reaction temperature and oxygen concentration on the desulfurization and oxidation behavior of ion-exchanged brown coal by Ca as new desulfurizing agent was studied. In experiment, Yallourn coal was used for ion- exchange, and limestone produced in Tochigi prefecture was also used for comparative study. Ca-exchanged brown coal was prepared by agitating coal in Ca(OH)2 slurry for 24 hours. The desulfurization behavior of a desulfurizing agent was obtained by measuring H2S and sulfur compounds in outlet gas of a reactor, and the oxidation behavior by measuring SO2 emission in outlet gas after oxidation reaction. As the experimental result, CaO produced from Ca-exchanged brown coal offered the extremely high activity to desulfurization reaction in a temperature range of 850-950{degree}C as compared with limestone. Although the oxidation behavior was dependent on oxidation temperature and oxygen concentration, CaS obtained from Ca-exchanged brown coal was more rapidly converted to CaSO4 than limestone. 3 refs., 8 figs., 2 tabs.
International Nuclear Information System (INIS)
Shu, Song; Guo, Jia-Xiu; Liu, Xiao-Li; Wang, Xue-Jiao; Yin, Hua-Qiang; Luo, De-Ming
2016-01-01
Graphical abstract: - Highlights: • Fe/NAC-60 exhibits the best desulfurization activity. • Different oscillation time can change surface area and pore volume of catalysts. • Ultrasonic oscillation increases Fe dispersion on carrier and effective pores. • Pore sizes play a crucial role during the SO 2 removal. - Abstract: A series of Fe-loaded activated carbons treated by HNO 3 (Fe/NAC) were prepared by incipient impregnation method with or without ultrasonic assistance and characterized using X-ray diffraction (XRD), Fourier-transform infrared spectroscopy (FTIR), scanning electron microscopy with energy disperse spectroscope (SEM-EDS), transmission electron microscopy (TEM) and N 2 adsorption/desorption. The desulfurization activities were evaluated at a fixed bed reactor under a mixed gas simulated from flue gas. The results showed that desulfurization activity from excellent to poor is as follows: Fe/NAC-60 > Fe/NAC-80 > Fe/NAC-30 > Fe/NAC-15 > Fe/NAC-0 > Fe/NAC-100 > NAC. Fe/NAC-60 exhibits the best desulfurization activity and has breakthrough sulfur capacity of 319 mg/g and breakthrough time of 540 min. The introduction of ultrasonic oscillation does not change the form of Fe oxides on activated carbon but can change the dispersion and relative contents of Fe 3 O 4 . The types of oxygen-containing functional groups have no obvious change for all samples but the texture properties show some differences when they are oscillated for different times. The fresh Fe/NAC-60 has a surface area of 1045 m 2 /g and total pore volume of 0.961 cm 3 /g with micropore volume of 0.437 cm 3 /g and is larger than Fe/NAC-0 (823 m 2 /g, 0.733 and 0.342 cm 3 /g). After desulfurization, surface area and pore volume of all samples decrease significantly, and those of the exhausted Fe/NAC-60 decrease to 233 m 2 /g and 0.481 cm 3 /g, indicating that some byproducts deposit on surface to cover pores. Pore size distribution influences SO 2 adsorption, and fresh Fe/NAC-60 has
Energy Technology Data Exchange (ETDEWEB)
Murakami, T.; Kurita, N.; Naruse, I. [Toyohashi University of Technology, Toyohashi (Japan)
2003-03-01
Desulfurization performance of wasted seashells was found to be over twice as high as that of limestone, which was currently used as a desulfurizer in fluidized bed coal combustors. NaCl-doping into limestone was also found to be effective in improving the desulfurization efficiency. From X-ray diffraction (XRD) analyses of calcined seashell, limestone and NaCl-doped limestone, on the other hand, not only the calcined seashell but also the NaCl-doped limestone had strong peaks of CaO crystal, and those two materials also had high desulfurization activity. This improvement was hypothesized to be due to NaCl causing a change in the crystal structure of CaO. In order to elucidate the effect of NaCl addition on the CaO crystal structure in the incineration of CaCO{sub 3} the change of structures was simulated by means of molecular dynamics simulations of CaO. In the simulation one molecule of NaCl was exchanged into one molecule of CaO. A pair correlation functions and the distances between Ca and O atoms, which were obtained by the simulations, were compared with those from the crystal CaO. NaCl-doping affected the crystalization temperature of CaO. The crystallization temperature increased due to adding a little bit of NaCl. From the result of the pair correlation functions obtained in NaCl-doped CaO, the difference of the potential energy of NaCl from that of CaO seemed to contribute to the crystallization of the bulk of CaO. The simulation and experimental results obtained suggested that NaCl-doping contributed to crystallizing the CaO molecules.
CONVERSION EXTRACTION DESULFURIZATION (CED) PHASE III
Energy Technology Data Exchange (ETDEWEB)
James Boltz
2005-03-01
This project was undertaken to refine the Conversion Extraction Desulfurization (CED) technology to efficiently and economically remove sulfur from diesel fuel to levels below 15-ppm. CED is considered a generic term covering all desulfurization processes that involve oxidation and extraction. The CED process first extracts a fraction of the sulfur from the diesel, then selectively oxidizes the remaining sulfur compounds, and finally extracts these oxidized materials. The Department of Energy (DOE) awarded Petro Star Inc. a contract to fund Phase III of the CED process development. Phase III consisted of testing a continuous-flow process, optimization of the process steps, design of a pilot plant, and completion of a market study for licensing the process. Petro Star and the Degussa Corporation in coordination with Koch Modular Process Systems (KMPS) tested six key process steps in a 7.6-centimeter (cm) (3.0-inch) inside diameter (ID) column at gas oil feed rates of 7.8 to 93.3 liters per hour (l/h) (2.1 to 24.6 gallons per hour). The team verified the technical feasibility with respect to hydraulics for each unit operation tested and successfully demonstrated pre-extraction and solvent recovery distillation. Test operations conducted at KMPS demonstrated that the oxidation reaction converted a maximum of 97% of the thiophenes. The CED Process Development Team demonstrated that CED technology is capable of reducing the sulfur content of light atmospheric gas oil from 5,000-ppm to less than 15-ppm within the laboratory scale. In continuous flow trials, the CED process consistently produced fuel with approximately 20-ppm of sulfur. The process economics study calculated an estimated process cost of $5.70 per product barrel. The Kline Company performed a marketing study to evaluate the possibility of licensing the CED technology. Kline concluded that only 13 refineries harbored opportunity for the CED process. The Kline study and the research team's discussions
Bhasarkar, Jaykumar B; Chakma, Sankar; Moholkar, Vijayanand S
2015-05-01
This paper attempts to discern the physical mechanism of the oxidative desulfurization process simultaneously assisted by ultrasound and phase transfer agent (PTA). With different experimental protocols, an attempt is made to deduce individual beneficial effects of PTA and ultrasound on the oxidative desulfurization system, and also the synergy between the effects of PTA and ultrasound. Effect of PTA is more marked for mechanically stirred system due to mass transfer limitations, while intense emulsification due to ultrasound helps overcome the mass transfer limitations and reduces the extent of enhancement of oxidation by PTA. Despite application of PTA and ultrasound, the intrinsic factors and properties of the reactants such as polarity (and hence partition coefficient) and diffusivity have a crucial effect on the extent of oxidation. The intrinsic reactivity of the oxidant also plays a vital role, as seen from the extent of oxidation achieved with performic acid and peracetic acid. The interfacial transport of oxidant in the form of oxidant-PTA complex reduces the undesired consumption of oxidant by the reducing species formed during transient cavitation in organic medium, which helps effective utilization of oxidant towards desulfurization. Copyright © 2014 Elsevier B.V. All rights reserved.
Bin, Hu; Yang, Yi; Cai, Liang; Yang, Linjun; Roszak, Szczepan
2017-10-09
Desulfurization wastewater evaporation technology is used to enhance the removal of gaseous mercury (Hg) in conventional air pollution control devices (APCDs) for coal-fired power plants. Studies have affirmed that gaseous Hg is oxidized and removed by selective catalytic reduction (SCR), an electrostatic precipitator (ESP) and wet flue gas desulfurization (WFGD) in a coal-fired thermal experiment platform with WFGD wastewater evaporation. Effects of desulfurization wastewater evaporation position, evaporation temperature and chlorine ion concentration on Hg oxidation were studied as well. The Hg 0 oxidation efficiency was increased ranging from 30% to 60%, and the gaseous Hg removal efficiency was 62.16% in APCDs when wastewater evaporated before SCR. However, the Hg 0 oxidation efficiency was 18.99% and the gaseous Hg removal efficiency was 40.19% in APCDs when wastewater evaporated before ESP. The results show that WFGD wastewater evaporation before SCR is beneficial to improve the efficiency of Hg oxidized and removed in APCDs. Because Hg 2+ can be easily removed in ACPDs and WFGD wastewater in power plants is enriched with chlorine ions, this method realizes WFGD wastewater zero discharge and simultaneously enhances Hg removal in APCDs.
Ban, Lili; Liu, Ping; Ma, Cunhua; Dai, Bin
2013-12-01
In this paper, the oxidative desulfurization (ODS) system is directly applied to deal with the catalytic oxidation of sulfur compounds of sulfur-containing model oil by dielectric barrier discharge (DBD) plasma in the presence of air plus an extraction step with the oxidation-treated fuel put over ionic liquid [BMIM]FeCl4 (1-butyl-3-methylimidazolium tetrachloroferrate). This new system exhibited an excellent desulfurization effect. The sulfur content of DBT in diesel oil decreased from 200 ppm to 4.92 ppm (S removal rate up to 97.5%) under the following optimal reaction conditions: air flow rate (ν) of 60 mL/min, amplitude of applied voltage (U) on DBD of 16 kV, input frequency (f) of 79 kHz, catalyst amount (ω) of 1.25 wt%, reaction time (t) of 10 min. Moreover, a high desulfurization rate was obtained during oxidation of benzothiophene (BT) or 4,6-DMDBT (4,6-dimethyl-dibenzothiophene) under the aforementioned conditions. The oxidation reactivity of different S compounds was decreased in the order of DBT, 4,6-DMDBT and BT. The remarkable advantage of the novel ODS system is that the desulfurization condition applies in the presence of air at ambient conditions without peroxides, aqueous solvent or biphasic oil-aqueous solution system.
International Nuclear Information System (INIS)
Ban Lili; Liu Ping; Ma Cunhua; Dai Bin
2013-01-01
In this paper, the oxidative desulfurization (ODS) system is directly applied to deal with the catalytic oxidation of sulfur compounds of sulfur-containing model oil by dielectric barrier discharge (DBD) plasma in the presence of air plus an extraction step with the oxidation-treated fuel put over ionic liquid [BMIM]FeCl 4 (1-butyl-3-methylimidazolium tetrachloroferrate). This new system exhibited an excellent desulfurization effect. The sulfur content of DBT in diesel oil decreased from 200 ppm to 4.92 ppm (S removal rate up to 97.5%) under the following optimal reaction conditions: air flow rate (ν) of 60 mL/min, amplitude of applied voltage (U) on DBD of 16 kV, input frequency (f) of 79 kHz, catalyst amount (ω) of 1.25 wt%, reaction time (t) of 10 min. Moreover, a high desulfurization rate was obtained during oxidation of benzothiophene (BT) or 4,6-DMDBT (4,6-dimethyl-dibenzothiophene) under the aforementioned conditions. The oxidation reactivity of different S compounds was decreased in the order of DBT, 4,6-DMDBT and BT. The remarkable advantage of the novel ODS system is that the desulfurization condition applies in the presence of air at ambient conditions without peroxides, aqueous solvent or biphasic oil-aqueous solution system. (plasma technology)
Garces Trujillo, Hector Fabian
This thesis contains two parts: 1) synthesis and characterization of porous metal oxides that include zinc oxide and a porous mixed-valent manganese oxide with an amorphous structure (AMO) 2) the desulfurization studies for the removal of sulfur compounds. Zinc oxide with different nano-scale morphologies may result in various porosities with different adsorption capabilities. A tunable shape microwave synthesis of ZnO nano-spheres in a co-solvent mixture is presented. The ZnO nano-sphere material is investigated as a desulfurizing sorbent in a fixed bed reactor in the temperature range 200 to 400 °C and compared with ZnO nanorods and platelet-like morphologies. Fresh and sulfided materials were characterized by X-ray diffraction (XRD), BET specific surface area, pore volume, scanning electron microscopy (SEM), X-ray energy dispersive spectroscopy (SEM/EDX), Raman spectroscopy, and thermogravimetric analysis (TGA). The tunable shape microwave synthesis of ZnO presents a high sulfur sorption capacity at temperatures as low as 200 °C which accounts for a three and four fold enhancement over the other preparations presented in this work, and reached 76 % of the theoretical sulfur capacity (TSC) at 300 °C. Another ZnO material with a bimodal micro- and mesopore size distribution investigated as a desulfurizing sorbent presents a sorption capacity that reaches 87% of the theoretical value for desulfurization at 400 °C at breakthrough time. A deactivation model that considers the activity of the solid reactant was used to fit the experimental data. Good agreement between the experimental breakthrough curves and the model predictions are obtained. Manganese oxides are a type of metal oxide materials commonly used in catalytic applications. Little is known about the adsorption capabilities for the removal of sulfur compounds. One of these manganese oxides; amorphous manganese oxide (AMO) is highly promising material for low temperature sorption processes. Amorphous
Desulfurization of Diesel Fuel by Oxidation and Solvent Extraction
Directory of Open Access Journals (Sweden)
Wadood Taher Mohammed
2015-02-01
Full Text Available This research presents a study in ultra-desulfurization of diesel fuel produced from conventional hydro desulfurization process, using oxidation and solvent extraction techniques. Dibenzothiophene (DBT was the organosulfur compound that had been detected in sulfur removal. The oxidation process used hydrogen peroxide as an oxidant and acetic acid as homogeneous catalyst . The solvent extraction process used acetonitrile (ACN and N-methyl – 2 - pyrrolidone (NMP as extractants . Also the effect of five parameters (stirring speed :150 , 250 , 350 , and 450 rpm, temperature (30 , 40 , 45 , and 50 oC, oxidant/simulated diesel fuel ratio (0.5 , 0.75 , 1 , and 1.5 , catalyst/oxidant ratio(0.125,0.25,0.5,and0.75 , and solvent/simulated diesel fuel ratio(0.5,0.6,0.75,and1 were examined as well as solvent type. The results exhibit that the highest removal of sulfur is 98.5% using NMP solvent while it is 95.8% for ACN solvent. The set of conditions that show the highest sulfur removal is: stirring speed of 350 rpm , temperature 50oC , oxidant/simulated diesel fuel ratio 1 , catalyst/oxidant ratio 0.5 , solvent/simulated diesel fuel ratio 1. These best conditions were applied upon real diesel fuel (produced from Al-Dora refinerywith 1000 ppm sulfur content . It was found that sulfur removal was 64.4% using ACN solvent and 75% using NMP solvent.
The Desulfurization of Magnetite Ore by Flotation with a Mixture of Xanthate and Dixanthogen
Directory of Open Access Journals (Sweden)
Jun Yu
2016-07-01
Full Text Available The contamination of sulfur emanating from pyrrhotite in magnetite concentrates has been a problem in iron ore processing. This study utilized froth flotation to float pyrrhotite away from magnetite using collectors of xanthate and dixanthogen. It was found that xanthate or dixanthogen alone could not achieve selective separation between pyrrhotite and magnetite in flotation. A high loss of magnetite was obtained with xanthate, while a low desulfurization degree was obtained with dixanthogen. It was interesting that a high desulfurization ratio was achieved with little loss of magnetite when xanthate was mixed with dixanthogen as the collector. The synergistic effect of the mixed collector on pyrrhotite was studied by electrokinectic studies and FTIR measurements. It was found that xanthate was the anchor on pyrrhotite and determined its selectivity against magnetite, while dixanthogen associated with xanthate, enhancing its hydrophobicity. This study provides new insights into the separation of iron minerals.
Du, Xiaoqing; Yang, Yumeng; Yi, Chenxi; Chen, Yu; Cai, Chao; Zhang, Zhao
2017-02-01
The coaxial arrays of AAO-CeO2 NTs have been successfully galvanostatically deposited on an anode, characterized and adopted as a catalyst for removing organic sulfurs from diesel. The influence of the main electrochemical oxidation factors on the efficiency of desulfurization have also been investigated. The results show that the fabrication process of AAO-CeO2 NTs is accompanied by the formation of a new phase, namely Al3Ce, and the main oxidation products of the diesel are soluble inorganic sulphides, especially Ce2(SO4)3. When compared with dibenzothiophene and 4, 6-dimethyldibenzothiophene, benzothiophene is much more easily removed, with a removal efficiency that reaches 87.2%. Finally, a possible electrochemical oxidation desulfurization pathway for diesel is proposed.
International Nuclear Information System (INIS)
Delfosse, Vanessa; Hugonnet, Jean-Emmanuel; Sougakoff, Wladimir; Mayer, Claudine
2005-01-01
The crystallization of a hypothetical penicillin-binding protein from the archaeon P. abyssi in space group C2 by hanging-drop vapour diffusion is reported. The genome of the hyperthermophilic archaeon Pyrococcus abyssi contains a gene (pab0087) encoding a penicillin-binding protein (PBP) homologue. This sequence consists of 447 residues and shows significant sequence similarity to low-molecular-weight PBPs and class C β-lactamases. The Pab0087 protein was overexpressed, purified and crystallized. Diffraction data from two different crystal forms were collected to 2.7 and 2.0 Å resolution. Both crystals belong to space group C2, with unit-cell parameters a = 160.59, b = 135.74, c = 113.02 Å, β = 117.36° and a = 166.97, b = 131.25, c = 189.39 Å, β = 113.81°, respectively. The asymmetric unit contains four and eight molecules, respectively, with fourfold non-crystallographic symmetry
Flue gas desulfurization gypsum (FGDG) may be a viable low-cost alternative bedding material for broiler production. In order to evaluate FGD gypsum’s viability, three consecutive trials were conducted to determine its influence on live performance (body weight, feed consumption, feed efficiency, an...
BENCH-SCALE DEMONSTRATION OF HOT-GAS DESULFURIZATION TECHNOLOGY
International Nuclear Information System (INIS)
Unknown
1999-01-01
The U.S. Department of Energy (DOE), Federal Energy Technology Center (FETC), is sponsoring research in advanced methods for controlling contaminants in hot coal gasifier gas (coal-derived fuel-gas) streams of integrated gasification combined-cycle (IGCC) power systems. The hot gas cleanup work seeks to eliminate the need for expensive heat recovery equipment, reduce efficiency losses due to quenching, and minimize wastewater treatment costs. Hot-gas desulfurization research has focused on regenerable mixed-metal oxide sorbents that can reduce the sulfur in coal-derived fuel-gas to less than 20 ppmv and can be regenerated in a cyclic manner with air for multicycle operation. Zinc titanate (Zn(sub 2) TiO(sub 4) or ZnTiO(sub 3)), formed by a solid-state reaction of zinc oxide (ZnO) and titanium dioxide (TiO(sub 2)), is currently one of the leading sorbents. Overall chemical reactions with Zn(sub 2) TiO(sub 4) during the desulfurization (sulfidation)-regeneration cycle are shown below: Sulfidation: Zn(sub 2) TiO(sub 4)+ 2H(sub 2)S(yields) 2ZnS+ TiO(sub 2)+ 2H(sub 2)O; Regeneration: 2ZnS+ TiO(sub 2)+ 3O(sub 2)(yields) Zn(sub 2) TiO(sub 4)+ 2SO(sub 2) The sulfidation/regeneration cycle can be carried out in a fixed-bed, moving-bed, or fluidized-bed reactor configuration. The fluidized-bed reactor configuration is most attractive because of several potential advantages including faster kinetics and the ability to handle the highly exothermic regeneration to produce a regeneration offgas containing a constant concentration of SO(sub 2)
Energy Technology Data Exchange (ETDEWEB)
Shu, Song [College of Architecture and Environment, Sichuan University, Chengdu 610065, Sichuan (China); Guo, Jia-Xiu, E-mail: guojiaxiu@scu.edu.cn [College of Architecture and Environment, Sichuan University, Chengdu 610065, Sichuan (China); National Engineering Technology Research Center for Flue Gas Desulfurization, Chengdu 610065, Sichuan (China); Sichuan Provincial Environmental Protection Environmental Catalysis and Materials Engineering Technology Center, Chengdu 610065, Sichuan (China); Liu, Xiao-Li [National Engineering Technology Research Center for Flue Gas Desulfurization, Chengdu 610065, Sichuan (China); Wang, Xue-Jiao [College of Architecture and Environment, Sichuan University, Chengdu 610065, Sichuan (China); Yin, Hua-Qiang [College of Architecture and Environment, Sichuan University, Chengdu 610065, Sichuan (China); National Engineering Technology Research Center for Flue Gas Desulfurization, Chengdu 610065, Sichuan (China); Sichuan Provincial Environmental Protection Environmental Catalysis and Materials Engineering Technology Center, Chengdu 610065, Sichuan (China); Luo, De-Ming [National Engineering Technology Research Center for Flue Gas Desulfurization, Chengdu 610065, Sichuan (China)
2016-01-01
Graphical abstract: - Highlights: • Fe/NAC-60 exhibits the best desulfurization activity. • Different oscillation time can change surface area and pore volume of catalysts. • Ultrasonic oscillation increases Fe dispersion on carrier and effective pores. • Pore sizes play a crucial role during the SO{sub 2} removal. - Abstract: A series of Fe-loaded activated carbons treated by HNO{sub 3} (Fe/NAC) were prepared by incipient impregnation method with or without ultrasonic assistance and characterized using X-ray diffraction (XRD), Fourier-transform infrared spectroscopy (FTIR), scanning electron microscopy with energy disperse spectroscope (SEM-EDS), transmission electron microscopy (TEM) and N{sub 2} adsorption/desorption. The desulfurization activities were evaluated at a fixed bed reactor under a mixed gas simulated from flue gas. The results showed that desulfurization activity from excellent to poor is as follows: Fe/NAC-60 > Fe/NAC-80 > Fe/NAC-30 > Fe/NAC-15 > Fe/NAC-0 > Fe/NAC-100 > NAC. Fe/NAC-60 exhibits the best desulfurization activity and has breakthrough sulfur capacity of 319 mg/g and breakthrough time of 540 min. The introduction of ultrasonic oscillation does not change the form of Fe oxides on activated carbon but can change the dispersion and relative contents of Fe{sub 3}O{sub 4}. The types of oxygen-containing functional groups have no obvious change for all samples but the texture properties show some differences when they are oscillated for different times. The fresh Fe/NAC-60 has a surface area of 1045 m{sup 2}/g and total pore volume of 0.961 cm{sup 3}/g with micropore volume of 0.437 cm{sup 3}/g and is larger than Fe/NAC-0 (823 m{sup 2}/g, 0.733 and 0.342 cm{sup 3}/g). After desulfurization, surface area and pore volume of all samples decrease significantly, and those of the exhausted Fe/NAC-60 decrease to 233 m{sup 2}/g and 0.481 cm{sup 3}/g, indicating that some byproducts deposit on surface to cover pores. Pore size distribution
Efficient Air Desulfurization Catalysts Derived from Pig Manure Liquefaction Char
Directory of Open Access Journals (Sweden)
Rajiv Wallace
2017-11-01
Full Text Available Biochar from the liquefaction of pig manure was used as a precursor of H2S desulfurization adsorbents. In its inorganic matter, it contains marked quantities of calcium, magnesium and iron, which are known as hydrogen sulfide oxidation catalysts. The char was used either as-received or mixed with 10% nanographite. The latter was added to increase both the content of the carbon phase and conductivity. ZnCl2 in two different ratios of char to an activation agent (1:1 and 1:2 was used to create the porosity in the carbon phase. The content of the later was between 18–45%. The activated samples adsorbed 144 mg/g H2S. Sulfur was the predominant product of reactive adsorption. Its deposition in the pore system and blockage of the most active pores ceased the materials’ activity. The presence of the catalytic phase was necessary but not sufficient to guarantee good performance. The developed porosity, which can store oxidation products in the resulting composite, is essential for the good performance of the desulfurization process. The surface of the composite with nanographite showed the highest catalytic activity, similar to that of the commercial Midas® carbon catalyst. The results obtained indicate that a high quality reactive adsorbent/catalyst for H2S removal can be obtained from pig manure liquefaction wastes.
Energy Technology Data Exchange (ETDEWEB)
Ortiz, F.J.G.; Ollero, P. [University of Seville, Seville (Spain)
2008-07-15
This paper has been written to provide a realistic approach to modeling an in-duct desulfurization process and because of the disagreement between the results predicted by published kinetic models of the reaction between hydrated lime and SO{sub 2} at low temperature and the experimental results obtained in pilot plants where this process takes place. Results were obtained from an experimental program carried out in a 3-MWe pilot plant. Additionally, five kinetic models, from the literature, of the reaction of sulfation of Ca(OH){sub 2} at low temperatures were assessed by simulation and indicate that the desulfurization efficiencies predicted by them are clearly lower than those experimentally obtained in our own pilot plant as well as others. Next, a general model was fitted by minimizing the difference between the calculated and the experimental results from the pilot plant, using Matlab{sup TM}. The parameters were reduced as much as possible, to only two. Finally, after implementing this model in a simulation tool of the in-duct sorbent injection process, it was validated and it was shown to yield a realistic approach useful for both analyzing results and aiding in the design of an in-duct desulfurization process.
Cloning, purification and crystallization of a Walker-type Pyrococcus abyssi ATPase family member
International Nuclear Information System (INIS)
Uhring, Muriel; Bey, Gilbert; Lecompte, Odile; Cavarelli, Jean; Moras, Dino; Poch, Olivier
2005-01-01
The Walker-type ATPase PABY2304 of P. abyssi has been cloned, overexpressed, purified and crystallized. X-ray diffraction data from selenomethionine-derivative crystals have been collected to 2.6 Å. The structure has been solved by MAD techniques. Several ATPase proteins play essential roles in the initiation of chromosomal DNA replication in archaea. Walker-type ATPases are defined by their conserved Walker A and B motifs, which are associated with nucleotide binding and ATP hydrolysis. A family of 28 ATPase proteins with non-canonical Walker A sequences has been identified by a bioinformatics study of comparative genomics in Pyrococcus genomes. A high-throughput structural study on P. abyssi has been started in order to establish the structure of these proteins. 16 genes have been cloned and characterized. Six out of the seven soluble constructs were purified in Escherichia coli and one of them, PABY2304, has been crystallized. X-ray diffraction data were collected from selenomethionine-derivative crystals using synchrotron radiation. The crystals belong to the orthorhombic space group C2, with unit-cell parameters a = 79.41, b = 48.63, c = 108.77 Å, and diffract to beyond 2.6 Å resolution
Cloning, purification and crystallization of a Walker-type Pyrococcus abyssi ATPase family member
Energy Technology Data Exchange (ETDEWEB)
Uhring, Muriel; Bey, Gilbert; Lecompte, Odile; Cavarelli, Jean; Moras, Dino; Poch, Olivier, E-mail: poch@igbmc.u-strasbg.fr [Département de Biologie et Génomiques Structurales, UMR 7104, Institut de Génétique et de Biologie Moléculaire et Cellulaire, CNRS/INSERM/ULP Strasbourg, 1 Rue Laurent Fries, 64404 Illkirch (France)
2005-10-01
The Walker-type ATPase PABY2304 of P. abyssi has been cloned, overexpressed, purified and crystallized. X-ray diffraction data from selenomethionine-derivative crystals have been collected to 2.6 Å. The structure has been solved by MAD techniques. Several ATPase proteins play essential roles in the initiation of chromosomal DNA replication in archaea. Walker-type ATPases are defined by their conserved Walker A and B motifs, which are associated with nucleotide binding and ATP hydrolysis. A family of 28 ATPase proteins with non-canonical Walker A sequences has been identified by a bioinformatics study of comparative genomics in Pyrococcus genomes. A high-throughput structural study on P. abyssi has been started in order to establish the structure of these proteins. 16 genes have been cloned and characterized. Six out of the seven soluble constructs were purified in Escherichia coli and one of them, PABY2304, has been crystallized. X-ray diffraction data were collected from selenomethionine-derivative crystals using synchrotron radiation. The crystals belong to the orthorhombic space group C2, with unit-cell parameters a = 79.41, b = 48.63, c = 108.77 Å, and diffract to beyond 2.6 Å resolution.
Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales
Directory of Open Access Journals (Sweden)
Gogarten J Peter
2008-01-01
Full Text Available Abstract Background The mal genes that encode maltose transporters have undergone extensive lateral transfer among ancestors of the archaea Thermococcus litoralis and Pyrococcus furiosus. Bacterial hyperthermophiles of the order Thermotogales live among these archaea and so may have shared in these transfers. The genome sequence of Thermotoga maritima bears evidence of extensive acquisition of archaeal genes, so its ancestors clearly had the capacity to do so. We examined deep phylogenetic relationships among the mal genes of these hyperthermophiles and their close relatives to look for evidence of shared ancestry. Results We demonstrate that the two maltose ATP binding cassette (ABC transporter operons now found in Tc. litoralis and P. furiosus (termed mal and mdx genes, respectively are not closely related to one another. The Tc. litoralis and P. furiosus mal genes are most closely related to bacterial mal genes while their respective mdx genes are archaeal. The genes of the two mal operons in Tt. maritima are not related to genes in either of these archaeal operons. They are highly similar to one another and belong to a phylogenetic lineage that includes mal genes from the enteric bacteria. A unique domain of the enteric MalF membrane spanning proteins found also in these Thermotogales MalF homologs supports their relatively close relationship with these enteric proteins. Analyses of genome sequence data from other Thermotogales species, Fervidobacterium nodosum, Thermosipho melanesiensis, Thermotoga petrophila, Thermotoga lettingae, and Thermotoga neapolitana, revealed a third apparent mal operon, absent from the published genome sequence of Tt. maritima strain MSB8. This third operon, mal3, is more closely related to the Thermococcales' bacteria-derived mal genes than are mal1 and mal2. F. nodosum, Ts. melanesiensis, and Tt. lettingae have only one of the mal1-mal2 paralogs. The mal2 operon from an unknown species of Thermotoga appears to
Ja'fari, Mahsa; Ebrahimi, Seyedeh Leila; Khosravi-Nikou, Mohammad Reza
2018-01-01
Nowadays, a continuously worldwide concern for development of process to produce ultra-low sulfur and nitrogen fuels have been emerged. Typical hydrodesulfurization and hydrodenitrogenation technology deals with important difficulties such as high pressure and temperature operating condition, failure to treat some recalcitrant compounds and limitations to meet the stringent environmental regulations. In contrary an advanced oxidation process that is ultrasound assisted oxidative desulfurization and denitrogenation satisfies latest environmental regulations in much milder conditions with more efficiency. The present work deals with a comprehensive review on findings and development in the ultrasound assisted oxidative desulfurization and denitrogenation (UAOD) during the last decades. The role of individual parameters namely temperature, residence time, ultrasound power and frequency, pH, initial concentration and types of sulfur and nitrogen compounds on the efficiency are described. What's more another treatment properties that is role of phase transfer agent (PTA) and solvents of extraction step, reaction kinetics, mechanism of the ultrasound, fuel properties and recovery in UAOD are reviewed. Finally, the required future works to mature this technology are suggested. Copyright © 2017 Elsevier B.V. All rights reserved.
Potential Agricultural Uses of Flue Gas Desulfurization Gypsum in the Northern Great Plains
Energy Technology Data Exchange (ETDEWEB)
DeSutter, T.M.; Cihacek, L.J. [North Dakota State University, Fargo, ND (United States). Department of Soil Science
2009-07-15
Flue gas desulfurization gypsum (FGDG) is a byproduct from the combustion of coal for electrical energy production. Currently, FGDG is being produced by 15 electrical generating stations in Alabama, Florida, Indiana, Iowa, Kentucky, Ohio, North Carolina, South Carolina, Tennessee, Texas, and Wisconsin. Much of this byproduct is used in the manufacturing of wallboard. The National Network for Use of FGDG in Agriculture was initiated to explore alternative uses of this byproduct. In the northern Great Plains (North Dakota, South Dakota, and Montana), FGDG has the potential to be used as a Ca or S fertilizer, as an acid soil ameliorant, and for reclaiming or mitigating sodium-affected soils. Greater than 1.4 million Mg of FGDG could initially be used in these states for these purposes. Flue gas desulfurization gypsum can be an agriculturally important resource for helping to increase the usefulness of problem soils and to increase crop and rangeland production. Conducting beneficial use audits would increase the public awareness of this product and help identify to coal combustion electrical generating stations the agriculturally beneficial outlets for this byproduct.
Amero, Carlos D; Boomershine, William P; Xu, Yiren; Foster, Mark
2009-01-01
RNase P is the ubiquitous ribonucleoprotein metalloenzyme responsible for cleaving the 5′-leader sequence of precursor tRNAs during their maturation. While the RNA subunit is catalytically active on its own at high monovalent and divalent ion concentration, four proteins subunits are associated with archaeal RNase P activity in vivo: RPP21, RPP29, RPP30 and POP5. These proteins have been shown to function in pairs: RPP21-RPP29 and POP5-RPP30. We have determined the solution structure of RPP21 from the hyperthermophilic archaeon Pyrococcus furiosus (Pfu) using conventional and paramagnetic NMR techniques. Pfu RPP21 in solution consists of an unstructured N-terminus, two alpha helices, a zinc binding motif, and an unstructured C-terminus. Moreover, we have used chemical shift perturbations to characterize the interaction of RPP21 with Pfu RPP29. The data show that the primary contact with RPP29 is localized to the two helices of RPP21. This information represents a fundamental step towards understanding structure-function relationships of the archaeal RNase P holoenzyme. PMID:18922021
Hansen, Connie J.; Wu, Lydia; Fox, Jeffrey D.; Arezi, Bahram; Hogrefe, Holly H.
2011-01-01
Using compartmentalized self-replication (CSR), we evolved a version of Pyrococcus furiosus (Pfu) DNA polymerase that tolerates modification of the γ-phosphate of an incoming nucleotide. A Q484R mutation in α-helix P of the fingers domain, coupled with an unintended translational termination-reinitiation (split) near the finger tip, dramatically improve incorporation of a bulky γ-phosphate-O-linker-dabcyl substituent. Whether synthesized by coupled translation from a bicistronic (−1 frameshift) clone, or reconstituted from separately expressed and purified fragments, split Pfu mutant behaves identically to wild-type DNA polymerase with respect to chromatographic behavior, steady-state kinetic parameters (for dCTP), and PCR performance. Although naturally-occurring splits have been identified previously in the finger tip region of T4 gp43 variants, this is the first time a split (in combination with a point mutation) has been shown to broaden substrate utilization. Moreover, this latest example of a split hyperthermophilic archaeal DNA polymerase further illustrates the modular nature of the Family B DNA polymerase structure. PMID:21062827
Hansen, Connie J; Wu, Lydia; Fox, Jeffrey D; Arezi, Bahram; Hogrefe, Holly H
2011-03-01
Using compartmentalized self-replication (CSR), we evolved a version of Pyrococcus furiosus (Pfu) DNA polymerase that tolerates modification of the γ-phosphate of an incoming nucleotide. A Q484R mutation in α-helix P of the fingers domain, coupled with an unintended translational termination-reinitiation (split) near the finger tip, dramatically improve incorporation of a bulky γ-phosphate-O-linker-dabcyl substituent. Whether synthesized by coupled translation from a bicistronic (-1 frameshift) clone, or reconstituted from separately expressed and purified fragments, split Pfu mutant behaves identically to wild-type DNA polymerase with respect to chromatographic behavior, steady-state kinetic parameters (for dCTP), and PCR performance. Although naturally-occurring splits have been identified previously in the finger tip region of T4 gp43 variants, this is the first time a split (in combination with a point mutation) has been shown to broaden substrate utilization. Moreover, this latest example of a split hyperthermophilic archaeal DNA polymerase further illustrates the modular nature of the Family B DNA polymerase structure.
A conserved MCM single-stranded DNA binding element is essential for replication initiation.
Froelich, Clifford A; Kang, Sukhyun; Epling, Leslie B; Bell, Stephen P; Enemark, Eric J
2014-04-01
The ring-shaped MCM helicase is essential to all phases of DNA replication. The complex loads at replication origins as an inactive double-hexamer encircling duplex DNA. Helicase activation converts this species to two active single hexamers that encircle single-stranded DNA (ssDNA). The molecular details of MCM DNA interactions during these events are unknown. We determined the crystal structure of the Pyrococcus furiosus MCM N-terminal domain hexamer bound to ssDNA and define a conserved MCM-ssDNA binding motif (MSSB). Intriguingly, ssDNA binds the MCM ring interior perpendicular to the central channel with defined polarity. In eukaryotes, the MSSB is conserved in several Mcm2-7 subunits, and MSSB mutant combinations in S. cerevisiae Mcm2-7 are not viable. Mutant Mcm2-7 complexes assemble and are recruited to replication origins, but are defective in helicase loading and activation. Our findings identify an important MCM-ssDNA interaction and suggest it functions during helicase activation to select the strand for translocation. DOI: http://dx.doi.org/10.7554/eLife.01993.001.
Directory of Open Access Journals (Sweden)
Hiroaki Suga
2013-08-01
Full Text Available The random non-standard peptide integrated discovery (RaPID system has proven to be a powerful approach to discover de novo natural product-like macrocyclic peptides that inhibit protein functions. We have recently reported three macrocyclic peptides that bind to Pyrococcus furiosus multidrug and toxic compound extrusion (PfMATE transporter and inhibit the transport function. Moreover, these macrocyclic peptides were successfully employed as cocrystallization ligands of selenomethionine-labeled PfMATE. In this report, we disclose the details of the RaPID selection strategy that led to the identification of these three macrocyclic peptides as well as a fourth macrocyclic peptide, MaD8, which is exclusively discussed in this article. MaD8 was found to bind within the cleft of PfMATE’s extracellular side and blocked the path of organic small molecules being extruded. The results of an ethidium bromide efflux assay confirmed the efflux inhibitory activity of MaD8, whose behavior was similar to that of previously reported MaD5.
Structure of the Cmr2 Subunit of the CRISPR-Cas RNA Silencing Complex
Energy Technology Data Exchange (ETDEWEB)
Cocozaki, Alexis I.; Ramia, Nancy F.; Shao, Yaming; Hale, Caryn R.; Terns, Rebecca M.; Terns, Michael P.; Li, Hong (FSU); (Georgia)
2012-08-10
Cmr2 is the largest and an essential subunit of a CRISPR RNA-Cas protein complex (the Cmr complex) that cleaves foreign RNA to protect prokaryotes from invading genetic elements. Cmr2 is thought to be the catalytic subunit of the effector complex because of its N-terminal HD nuclease domain. Here, however, we report that the HD domain of Cmr2 is not required for cleavage by the complex in vitro. The 2.3 {angstrom} crystal structure of Pyrococcus furiosus Cmr2 (lacking the HD domain) reveals two adenylyl cyclase-like and two {alpha}-helical domains. The adenylyl cyclase-like domains are arranged as in homodimeric adenylyl cyclases and bind ADP and divalent metals. However, mutagenesis studies show that the metal- and ADP-coordinating residues of Cmr2 are also not critical for cleavage by the complex. Our findings suggest that another component provides the catalytic function and that the essential role by Cmr2 does not require the identified ADP- or metal-binding or HD domains in vitro.
Pittalis, Mario; Azzena, Ugo Gavino; Carraro, Massimo; Pisano, Luisa
2013-01-01
Reductive desulfurisation of organic compounds is of importance both in organic synthesis and in industry. Benzo- and dibenzothiophenes are between the most abundant sulphur containing impurities in crude oils, and their desulfurization is a mandatory issue in the production of non polluting fuels. Following our interest in the development of efficient alkali metal-mediated synthetic procedures and alternative protocols for the chemical transformation of widespread environmental contaminants ...
Zhang, Hao; Xu, Xiaobin; Lin, Haifeng; Ud Din, Muhammad Aizaz; Wang, Haiqing; Wang, Xun
2017-09-14
Ultrathin nanocrystals generally provide a remarkable catalytic performance due to their high specific surface area and exposure of certain active sites. However, deactivation caused by growth and gathering limits the catalytic application of ultrathin nanocrystals. Here we report Ag nanocrystal-decorated polyoxometalate (Ag-POM) single-walled nanotubes assembled via a concise, surfactant-free soaking method as a new kind of well-defined core-sheath nanoreactor. The diameter of Ag nanocrystals inside polyoxometalate nanotubes can be controlled via simply adjusting the reactant concentration. Ag-POM provided outstanding oxidative desulfurization (ODS) catalytic performance for aromatic sulfocompounds at room temperature. It was suggested that Ag nanocrystals decorated on the inner surface played a key role in adjusting the electronic distribution and enhancing the catalytic activity. The as-prepared Ag-POM nanotubes are promising candidate catalysts with enhanced performance for practical catalytic applications in the gasoline desulfurization industry.
Applying ACF to desulfurization process from flue gas
International Nuclear Information System (INIS)
Liu Yi; Zhang Zhigang; Tang Qiang; Cao Zidong
2004-01-01
Inasmuch as the status of environmental pollution caused by SO 2 is more and more serious and the policy of environmental protection is executed more and more strictly, desulfurization from flue gas (FGD) is introduced to a wide-spread field of national economy. By a comparison with lime-limestone method, the application of adsorption method in FGD is more effective in desulfurization and more adapted to the situation of our country in respect of its more valuable byproduct. However, the technique of adsorption method is limited by the large amount of adsorbent used. In this paper, activated carbon fiber (ACF) is proposed as a new type of adsorbent to apply in FGD. A series of experiments have been made in order to compare the performances between ACF and granular activated carbon (GAC) which has been mostly used. Experiments show that under the same working conditions ACF's adsorption capacity is 16.6 times as high as that of GAC, mass loss rate is 1/12 of GAC's, desorption efficiency of ACF can reach 99.9%. The theory of micropore adsorption dynamics is adopted to analyze the characteristics of both adsorbents. It is indicated that adsorbability and perfectibility of desorption are tightly related to the distribution of pores and the surface micromechanism of adsorbent surface. The accessibility of pores for specified adsorptive and the effects of capillary condensation are crucial factors to influence the process of FGD. According to the research of different adsorbents, conclusion can be drawn that ACF is a kind of good material with a strong selectivity for SO 2 . Compared with the traditional methods of FGD, the use of ACF can greatly economize the consumption of adsorbent and obviously reduce the introduction of new adsorbent, and at the same time keep down the equipment investment and operating cost. (authors)
Developing clean fuels: Novel techniques for desulfurization
Nehlsen, James P.
The removal of sulfur compounds from petroleum is crucial to producing clean burning fuels. Sulfur compounds poison emission control catalysts and are the source of acid rain. New federal regulations require the removal of sulfur in both gasoline and diesel to very low levels, forcing existing technologies to be pushed into inefficient operating regimes. New technology is required to efficiently produce low sulfur fuels. Two processes for the removal of sulfur compounds from petroleum have been developed: the removal of alkanethiols by heterogeneous reaction with metal oxides; and oxidative desulfurization of sulfides and thiophene by reaction with sulfuric acid. Alkanethiols, common in hydrotreated gasoline, can be selectively removed and recovered from a hydrocarbon stream by heterogeneous reaction with oxides of Pb, Hg(II), and Ba. The choice of reactive metal oxides may be predicted from simple thermodynamic considerations. The reaction is found to be autocatalytic, first order in water, and zero order in thiol in the presence of excess oxide. The thiols are recovered by reactive extraction with dilute oxidizing acid. The potential for using polymer membrane hydrogenation reactors (PEMHRs) to perform hydrogenation reactions such as hydrodesulfurization is explored by hydrogenating ketones and olefins over Pt and Au group metals. The dependence of reaction rate on current density suggests that the first hydrogen addition to the olefin is the rate limiting step, rather than the adsorption of hydrogen, for all of the metals tested. PEMHRs proved unsuccessful in hydrogenating sulfur compounds to perform HDS. For the removal of sulfides, a two-phase reactor is used in which concentrated sulfuric acid oxidizes aromatic and aliphatic sulfides present in a hydrocarbon solvent, generating sulfoxides and other sulfonated species. The polar oxidized species are extracted into the acid phase, effectively desulfurizing the hydrocarbon. A reaction scheme is proposed for this
Directory of Open Access Journals (Sweden)
Peniel Jean Gildo
2018-01-01
Full Text Available Recent technological advancements respond to the call to minimize/eliminate emissions to the atmosphere. However, on the average, fuel oils which is one of the major raw materials, is found to increase in sulfur concentration due to a phenomenon called thermal maturation. As such, a deeper desulfurization process is needed to obtain low/ultra-low sulfur fuel oils. In the present study, the ultrasound assisted oxidative desulfurization (UAOD processes using the H2O2 and HPW-AC oxidizing system applied to simulated fuel (~2800 ppm sulfur in the form of dibenzothiophene, benzothiophene, and thiophene dissolved in toluene, were optimized. After the pre-saturation of the HPW-AC with the simulated fuel, H2O2 was added just before the reaction was commenced under ultrasonic irradiation. After the application of both 2k-factorial design of experiment for screening and Face-Centered Design of Experiment for optimization, it was found that 25.52 wt% of H2O2 concentration, 983.9 mg of catalyst dose, 9.52 mL aqueous phase per 10 mL of the organic phase and 76.36 minutes of ultrasonication time would render 94.74% oxidation of the sulfur compounds in the simulated fuel. After the application of the optimized parameters to kerosene and employing a 4-cycle extraction using acetonitrile, 99% of the original sulfur content were removed from the kerosene using the UAOD optimized parameters. The desulfurization process resulted in a low-sulfur kerosene which retained its basic fuel properties such as density, viscosity and calorific value.
Desulfurization of fuels with ionic liquids by extraction and oxidative extraction processes
Rodríguez Cabo, Borja
2014-01-01
The excessive emission of pollutants to the atmosphere has been a problem during the last few decades due to, among other reasons, the massive use of transports. In order to avoid this problem, many methods are being investigated as an alternative to the classical hydrodesulfurization technique, such as adsorption, biodesulfurization, extraction and oxidation. The extractive desulfurization is one of the most promising alternatives. Moreover, its enhancement with selective oxidation of sulfur...
COMPARISON OF WEST GERMAN AND U.S. FLUE GAS DESULFURIZATION AND SELECTIVE CATALYTIC REDUCTION COSTS
The report documents a comparison of the actual cost retrofitting flue gas desulfurization (FGD) and selective catalytic reduction (SCR) on Federal Republic of German (FRG) boilers to cost estimating procedures used in the U.S. to estimate the retrofit of these controls on U.S. b...
Desulfurization of the exhaust gas with zeolite synthesized from diatomaceous earth
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, M
1975-07-01
Both A type and X type zeolites were prepared from diatomaceous earth and tested for use in flue gas desulfurization. Several diatomaceous earths of known chemical compositions were mixed to obtain a desired molar ratio of silicates, whose maturation was achieved in two steps; room temperature maturation and reflux maturation by heating. If the second maturation was carried out for more than 12 hr, the X type zeolite formation was low. At the best conditions, 80% pure zeolite could be prepared for both types according to their x-ray diffraction spectra. The synthesized x type zeolite adsorbed sulfur dioxide more efficiently than A type zeolite. When a simulated flue gas containing 680 to 840 ppM sulfur dioxide was passed at a flow rate of 9.0 Nl/min through a 250 g zeolite column, the column breaking time (time required for the SO/sub 2/ concentration of the column effluent to reach 10% of the initial SO/sub 2/ concentration) was 5.3 hr, while that for the commercial zeolite and activated carbon was 6.8 hr and 8.0 hr, respectively. If the flue gas contained more than 1% moisture, the adsorbed water reacted with SO/sub 2/ and the zeolite crystal tended to break down. The use of zeolite for flue gas desulfurization was more costly than the use of activated carbon.
Pb(II) removal from aqueous solution by a low-cost adsorbent dry desulfurization slag
Energy Technology Data Exchange (ETDEWEB)
Wu, Qiong; You, Ruirong [College of Materials Science and Engineering, Fuzhou University, New Campus, Minhou, Fujian Province 350108 (China); Clark, Malcolm [Marine Ecology Research Centre, School of Environment, Science and Engineering, Southern Cross University, P.O. Box 157, Lismore, NSW 2480 (Australia); Yu, Yan, E-mail: yuyan_1972@126.com [College of Materials Science and Engineering, Fuzhou University, New Campus, Minhou, Fujian Province 350108 (China)
2014-09-30
Highlights: • Dry desulfurization slag, solid waste, was an efficient adsorbent for lead removal. • The adsorption of Pb{sup 2+} onto dry desulfurization slag was generally monolayer. • The rate limiting step in the adsorption process of Pb{sup 2+} was chemisorption. • Pb{sup 2+} was absorbed onto the surface of the sample adsorbent only. • The adsorbent was low-cost and could be recycled. - Abstract: A collectable and non-sintered material prepared as hollow cylindrical shaped pellet from dry desulfurization slag (FGD ash) and ordinary Portland cement (OPC) for wastewater treatments is tested. The characteristic results of powder X-ray diffraction (XRD) and infrared absorption spectroscopy (IR) show that –OH, CO{sub 3}{sup 2−}, SO{sub 3}{sup 2−} and SO{sub 4}{sup 2−} are the possible functional groups responsible for Pb uptake. Adsorption data indicate that Pb removal is pH dependent and optimal at pH 6, with a very rapid initial removal that reaches equilibrium in about 90 min. A maximum removal of 99.2% is seen for 5 mg/L (pH of 6); higher initial Pb concentrations reduce overall removal efficiencies, but generate higher surface loadings. Adsorption process correlates well with both Langmuir and Freundlich models, although the Langmuir isotherm is more favored, providing a maximum adsorption capacity (Qm) of 130.2 mg/g (13 wt%). Pseudo-second order rate kinetic model best describes the Pb removal, and calculated R{sub L} values between 0 and 1, indicate a favored adsorption process that is chemisorption limited. SEM and EDAX analysis of the surface and fracture surface show that Pb occurs as surface precipitates and that Pb is not distributed to the inner core of the pellet. This study demonstrates that dry FGD ash could be successfully used for wastewater Pb removal.
Enhanced durability and reactivity for zinc ferrite desulfurization sorbent
Energy Technology Data Exchange (ETDEWEB)
Berggren, M.H.; Jha, M.C.
1989-10-01
AMAX Research Development Center (AMAX R D) investigated methods for enhancing the reactivity and durability of zinc ferrite desulfurization sorbents. Zinc ferrite sorbents are intended for use in desulfurization of hot coal gas in integrated gasification combined cycle (IGCC) or molten carbonate fuel cell (MCFC) applications. For this program, the reactivity of the sorbent may be defined as its sulfur sorption capacity at the breakthrough point and at saturation in a bench-scale, fixed-bed reactor. Durability may be defined as the ability of the sorbent to maintain important physical characteristics such as size, strength, and specific surface area during 10 cycles of sulfidation and oxidation. Two base case sorbents, a spherical pellet and a cylindrical extrude used in related METC-sponsored projects, were used to provide a basis for the aimed enhancement in durability and reactivity. Sorbent performance was judged on the basis of physical properties, single particle kinetic studies based on thermogravimetric (TGA) techniques, and multicycle bench-scale testing of sorbents. A sorbent grading system was utilized to quantify the characteristics of the new sorbents prepared during the program. Significant enhancements in both reactivity and durability were achieved for the spherical pellet shape over the base case formulation. Overall improvements to reactivity and durability were also made to the cylindrical extrude shape. The primary variables which were investigated during the program included iron oxide type, zinc oxide:iron oxide ratio, inorganic binder concentration, organic binder concentration, and induration conditions. The effects of some variables were small or inconclusive. Based on TGA studies and bench-scale tests, induration conditions were found to be very significant.
Thermostabilization of desulfurization enzymes from Rhodococcos sp. IGTS8. Final technical report
Energy Technology Data Exchange (ETDEWEB)
John J. Kilbane II
2000-12-15
The objective of this project was to develop thermophilic cultures capable of expressing the desulfurization (dsz) operon of Rhodococcus sp. IGTS8. The approaches taken in this project included the development of plasmid and integrative expression vectors that function well in Thermus thermophilus, the cloning of Rhodococcus dsz genes in Thermus expression vectors, and the isolation of bacterial cultures that express the dsz operon at thermophilic temperatures. This project has resulted in the development of plasmid and integrative expression vectors for use in T. thermophilus. The dsz genes have been expressed at moderately thermophilic temperatures (52 C) in Mycobacterium phlei and at temperatures as high as 72 C in T. thermophilus. The tools and methods developed in this project will be generally useful for the expression of heterologous genes in Thermus. Key developments in the project have been the isolation of a Mycobacterium phlei culture capable of expressing the desulfurization operon at 52 C, development of plasmid and integrative expression vectors for Thermus thermophilus, and the development of a host-vector system based on the malate dehydrogenase gene that allows plasmids to be stably maintained in T. thermophilus and provides a convenient reporter gene for the accurate quantification of gene expression. Publications have been prepared regarding each of these topics; these preprints are included.
International Nuclear Information System (INIS)
Zhang, Shuna; Zhang, Shujuan; Song, Limin; Wu, Xiaoqing; Fang, Sheng
2014-01-01
Graphical abstract: Three-dimensional interconnected nickel phosphide networks with hollow microstructures and desulfurization performance. - Highlights: • Three-dimensional Ni 2 P has been prepared using foam nickel as a template. • The microstructures interconnected and formed sponge-like porous networks. • Three-dimensional Ni 2 P shows superior hydrodesulfurization activity. - Abstract: Three-dimensional microstructured nickel phosphide (Ni 2 P) was fabricated by the reaction between foam nickel (Ni) and phosphorus red. The as-prepared Ni 2 P samples, as interconnected networks, maintained the original mesh structure of foamed nickel. The crystal structure and morphology of the as-synthesized Ni 2 P were characterized by X-ray diffraction, scanning electron microscopy, automatic mercury porosimetry and X-ray photoelectron spectroscopy. The SEM study showed adjacent hollow branches were mutually interconnected to form sponge-like networks. The investigation on pore structure provided detailed information for the hollow microstructures. The growth mechanism for the three-dimensionally structured Ni 2 P was postulated and discussed in detail. To investigate its catalytic properties, SiO 2 supported three-dimensional Ni 2 P was prepared successfully and evaluated for the hydrodesulfurization (HDS) of dibenzothiophene (DBT). DBT molecules were mostly hydrogenated and then desulfurized by Ni 2 P/SiO 2
Chaudhari, Pramod S; Pathare, Sagar P; Akamanchi, Krishnacharaya G
2012-04-20
A systematic exploration of thiophilic ability of o-iodoxybenzoic acid (IBX) for oxidative desulfurization to trigger domino reactions leading to new methodologies for synthesis of different azoles is described. A variety of highly substituted oxadiazoles, thiadiazoles, triazoles, and tetrazoles have been successfully synthesized in good to excellent yields, starting from readily accessible thiosemicarbazides, bis-diarylthiourea, 1,3-disubtituted thiourea, and thioamides. © 2012 American Chemical Society
Shi, Chengxiang; Wang, Wenxuan; Liu, Ni; Xu, Xueyan; Wang, Danhong; Zhang, Minghui; Sun, Pingchuan; Chen, Tiehong
2015-07-21
Hierarchically porous Ti-SBA-2 with high framework Ti content (up to 5 wt%) was firstly synthesized by employing organic mesomorphous complexes of a cationic surfactant (CTAB) and an anionic polyelectrolyte (PAA) as templates. The material exhibited excellent performance in oxidative desulfurization of diesel fuel at low temperature (40 °C or 25 °C) due to the unique hierarchically porous structure and high framework Ti content.
Creze, Christophe; Ligabue, Alessio; Laurent, Sébastien; Lestini, Roxane; Laptenok, Sergey P; Khun, Joelle; Vos, Marten H; Czjzek, Mirjam; Myllykallio, Hannu; Flament, Didier
2012-05-04
Pyrococcus abyssi NucS is the founding member of a new family of structure-specific DNA endonucleases that interact with the replication clamp proliferating cell nuclear antigen (PCNA). Using a combination of small angle x-ray scattering and surface plasmon resonance analyses, we demonstrate the formation of a stable complex in solution, in which one molecule of the PabNucS homodimer binds to the outside surface of the PabPCNA homotrimer. Using fluorescent labels, PCNA is shown to increase the binding affinity of NucS toward single-strand/double-strand junctions on 5' and 3' flaps, as well as to modulate the cleavage specificity on the branched DNA structures. Our results indicate that the presence of a single major contact between the PabNucS and PabPCNA proteins, together with the complex-induced DNA bending, facilitate conformational flexibility required for specific cleavage at the single-strand/double-strand DNA junction.
Creze, Christophe; Ligabue, Alessio; Laurent, Sébastien; Lestini, Roxane; Laptenok, Sergey P.; Khun, Joelle; Vos, Marten H.; Czjzek, Mirjam; Myllykallio, Hannu; Flament, Didier
2012-01-01
Pyrococcus abyssi NucS is the founding member of a new family of structure-specific DNA endonucleases that interact with the replication clamp proliferating cell nuclear antigen (PCNA). Using a combination of small angle x-ray scattering and surface plasmon resonance analyses, we demonstrate the formation of a stable complex in solution, in which one molecule of the PabNucS homodimer binds to the outside surface of the PabPCNA homotrimer. Using fluorescent labels, PCNA is shown to increase the binding affinity of NucS toward single-strand/double-strand junctions on 5′ and 3′ flaps, as well as to modulate the cleavage specificity on the branched DNA structures. Our results indicate that the presence of a single major contact between the PabNucS and PabPCNA proteins, together with the complex-induced DNA bending, facilitate conformational flexibility required for specific cleavage at the single-strand/double-strand DNA junction. PMID:22431731
Directory of Open Access Journals (Sweden)
R. Biernacki
2012-09-01
Full Text Available This article investigates possible use of waste gypsum (synthetic, recovered via flue-gas desulfurization from coal-fired electric powerplants, in foundries. Energy sector, which in Eastern Europe is mostly composed from coal-fired electric power plants, is one of the largestproducers of sulfur dioxide (SO2.In order to protect the environment and reduce the amount of pollution flue-gas desulfurization (FGD is used to remove SO2 fromexhaust flue gases of fossil-fuel power plants. As a result of this process gypsum waste is produced that can be used in practicalapplications.Strength and permeability tests have been made and also in-depth analysis of energy consumption of production process to investigateways of preparing the synthetic gypsum for casting moulds application. This paper also assesses the chemical composition, strength andpermeability of moulds made with synthetic gypsum, in comparison with moulds made with traditional GoldStar XL gypsum and withceramic molds. Moreover examination of structure of synthetic gypsum, the investigations on derivatograph and calculations of energyconsumption during production process of synthetic gypsum in wet flue-gas desulfurization were made.After analysis of gathered data it’s possible to conclude that synthetic gypsum can be used as a material for casting mould. There is nosignificant decrease in key properties, and on the other hand there is many additional benefits including low energy consumption,decreased cost, and decreased environmental impact.
Aerobic desulfurization of biogas by acidic biotrickling filtration in a randomly packed reactor
International Nuclear Information System (INIS)
Montebello, Andrea M.; Mora, Mabel; López, Luis R.; Bezerra, Tercia; Gamisans, Xavier; Lafuente, Javier; Baeza, Mireia; Gabriel, David
2014-01-01
Highlights: • Desulfurization of high loads of H 2 S is feasible by acidic biotrickling filtration. • Robustness of the process is demonstrated in the long-term (550 d). • Biosulfur to sulfate oxidation under H 2 S starvation was successfully performed. • Lower sulfate production found at acidic pH compared to that at neutral pH. • Plastic material is recommended for long-term acidic biotrickling filtration. - Abstract: Biotrickling filters for biogas desulfurization still must prove their stability and robustness in the long run under extreme conditions. Long-term desulfurization of high loads of H 2 S under acidic pH was studied in a lab-scale aerobic biotrickling filter packed with metallic Pall rings. Reference operating conditions at steady-state corresponded to an empty bed residence time (EBRT) of 130 s, H 2 S loading rate of 52 g S–H 2 S m −3 h −1 and pH 2.50–2.75. The EBRT reduction showed that the critical EBRT was 75 s and the maximum EC 100 g S–H 2 S m −3 h −1 . Stepwise increases of the inlet H 2 S concentration up to 10,000 ppm v lead to a maximum EC of 220 g S–H 2 S m −3 h −1 . The H 2 S removal profile along the filter bed indicated that the first third of the filter bed was responsible for 70–80% of the total H 2 S removal. The oxidation rate of solid sulfur accumulated inside the bioreactor during periodical H 2 S starvation episodes was verified under acidic operating conditions. The performance under acidic pH was comparable to that under neutral pH in terms of H 2 S removal capacity. However, bioleaching of the metallic packing used as support and chemical precipitation of sulfide/sulfur salts occurred
Aerobic desulfurization of biogas by acidic biotrickling filtration in a randomly packed reactor
Energy Technology Data Exchange (ETDEWEB)
Montebello, Andrea M.; Mora, Mabel; López, Luis R.; Bezerra, Tercia [Department of Chemical Engineering, School of Engineering, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Gamisans, Xavier [Department of Mining Engineering and Natural Resources, Universitat Politècnica de Catalunya, Bases de Manresa 61-73, 08240 Manresa (Spain); Lafuente, Javier [Department of Chemical Engineering, School of Engineering, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Baeza, Mireia [Department of Chemistry, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Gabriel, David, E-mail: david.gabriel@uab.cat [Department of Chemical Engineering, School of Engineering, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain)
2014-09-15
Highlights: • Desulfurization of high loads of H{sub 2}S is feasible by acidic biotrickling filtration. • Robustness of the process is demonstrated in the long-term (550 d). • Biosulfur to sulfate oxidation under H{sub 2}S starvation was successfully performed. • Lower sulfate production found at acidic pH compared to that at neutral pH. • Plastic material is recommended for long-term acidic biotrickling filtration. - Abstract: Biotrickling filters for biogas desulfurization still must prove their stability and robustness in the long run under extreme conditions. Long-term desulfurization of high loads of H{sub 2}S under acidic pH was studied in a lab-scale aerobic biotrickling filter packed with metallic Pall rings. Reference operating conditions at steady-state corresponded to an empty bed residence time (EBRT) of 130 s, H{sub 2}S loading rate of 52 g S–H{sub 2}S m{sup −3} h{sup −1} and pH 2.50–2.75. The EBRT reduction showed that the critical EBRT was 75 s and the maximum EC 100 g S–H{sub 2}S m{sup −3} h{sup −1}. Stepwise increases of the inlet H{sub 2}S concentration up to 10,000 ppm{sub v} lead to a maximum EC of 220 g S–H{sub 2}S m{sup −3} h{sup −1}. The H{sub 2}S removal profile along the filter bed indicated that the first third of the filter bed was responsible for 70–80% of the total H{sub 2}S removal. The oxidation rate of solid sulfur accumulated inside the bioreactor during periodical H{sub 2}S starvation episodes was verified under acidic operating conditions. The performance under acidic pH was comparable to that under neutral pH in terms of H{sub 2}S removal capacity. However, bioleaching of the metallic packing used as support and chemical precipitation of sulfide/sulfur salts occurred.
Singh, Umesh; Anapagaddi, Ravikiran; Mangal, Saurabh; Padmanabhan, Kuppuswamy Anantha; Singh, Amarendra Kumar
2016-06-01
Ladle furnace is a key unit in which various phenomena such as deoxidation, desulfurization, inclusion removal, and homogenization of alloy composition and temperature take place. Therefore, the processes present in the ladle play an important role in determining the quality of steel. Prediction of flow behavior of the phases present in the ladle furnace is needed to understand the phenomena that take place there and accordingly control the process parameters. In this study, first a mathematical model is developed to analyze the transient three-phase flow present. Argon gas bottom-stirred ladle with off-centered plugs has been used in this study. Volume of fluid method is used in a computational fluid dynamics (CFD) model to capture the behavior of slag, steel, and argon interfaces. The results are validated with data from literature. Eye opening and slag-steel interfacial area are calculated for different operating conditions and are compared with experimental and simulated results cited in literature. Desulfurization rate is then predicted using chemical kinetic equations, interfacial area, calculated from CFD model, and thermodynamic data, obtained from the Thermo-Calc software. Using the model, it is demonstrated that the double plug purging is more suitable than the single plug purging for the same level of total flow. The advantage is more distinct at higher flow rates as it leads higher interfacial area, needed for desulfurization and smaller eye openings (lower oxygen/nitrogen pickup).
GRANULATION AND BRIQUETTING OF SOLID PRODUCTS FROM FLUE GAS DESULFURIZATION
Directory of Open Access Journals (Sweden)
Jan J. Hycnar
2015-11-01
Full Text Available Most flue gas desulfurization products can be characterized by significant solubility in water and dusting in dry state. These characteristics can cause a considerable pollution of air, water, and soil. Among many approaches to utilization of this waste, the process of agglomeration using granulation or briquetting has proved very effective. Using desulfurization products a new material of aggregate characteristics has been acquired, and this material is resistant to water and wind erosion as well as to the conditions of transportation and storage. The paper presents the results of industrial trials granulation and briquetting of calcium desulphurization products. The granulation of a mixture of phosphogypsum used with fly ash (in the share 1:5. The resulting granules characterized by a compressive strength of 41.6 MPa, the damping resistance of 70% and 14.2% abrasion. The granulate was used for the production of cement mix. The produced concrete mortar have a longer setting and hardening time, as compared to the traditional ash and gypsum mortar, and have a higher or comparable flexural and compressive strength during hardening. Briquetting trials made of a product called synthetic gypsum or rea-gypsum both in pure form and with the addition of 5% and 10% of the limestone dust. Briquettes have a high initial strength and resistance to abrasion. The values of these parameters increased after 72 hours of seasoning. It was found that higher hardiness of briquettes with rea-gypsum was obtained with the impact of atmospheric conditions and higher resistance to elution of water-soluble components in comparison to ash briquettes.
The interest in using Flue Gas Desulfurization Gypsum(FGDG) has increased recently. This study evaluates the leaching characteristics of trace elements in "modern" FGDG (produced after fly ash removal) and FGDG-mixed soil (SF) under different environmental conditions using rece...
THE BIOCATALYTIC DESULFURIZATION PROJECT
Energy Technology Data Exchange (ETDEWEB)
Steven E. Bonde; David Nunn
2003-01-01
During the first quarter of the Biological Desulfurization project several activities were pursued. A project kickoff meeting was held at the Diversa facility in San Diego, CA. Activities that were in process before the meeting and begun afterwards by Diversa Corporation and Petro Star Inc. include: Technology transfer in the form of information generated by Enchira to Diversa, the purchase and installation of equipment by Diversa, development of synthetic methods and preparation of organo-sulfur substrates for use in determining enzyme activities, production of extract via Petro Star's CED process, detailed analysis of Petro Star Inc. diesel and CED extract, and several activities in molecular biology. Diversa Corporation, in the area of molecular biology, engaged in several activities in support of the task list of the contract. These included: construction of a genomic library; development and utilization of a sequence-based gene discovery effort; a parallel discovery approach based on functional expression of enzymes with the ability to oxidize organosulfur compounds. Biodesulfurization genes have already been identified and are being sequenced and subcloned for expression in heterologous biological hosts. Diversa has evaluated and adapted assays developed by Enchira used to assess the activities of DBT and DBTO{sub 2} monooxygenases. Finally, Diversa personnel have developed two novel selection/screen strategies for the improvement of biocatalyst strains by directed evolution.
Desulfurization of 2-thiouracil nucleosides: conformational studies of 4-pyrimidinone nucleosides.
Kraszewska, Karina; Kaczyńska, Iwona; Jankowski, Stefan; Karolak-Wojciechowska, Janina; Sochacka, Elzbieta
2011-04-01
4-Pyrimidinone ribofuranoside (H(2)o(4)U) and 4-pyrimidinone 2'-deoxyribofuranoside (dH(2)o(4)U) were synthesized by the oxidative desulfurization of parent 2-thiouracil nucleosides with m-chloroperbenzoic acid. The crystal structures of H(2)o(4)U and dH(2)o(4)U and their conformations in solution were determined and compared with corresponding 2-thiouracil and uracil nucleosides. The absence of a large 2-thiocarbonyl/2-carbonyl group in the nucleobase moiety results in C2'-endo puckering of the ribofuranose ring (S conformer) in the crystal structure of H(2)o(4)U, which is not typical of RNA nucleosides. Interestingly, the hydrogen bonding network in the crystals of dH(2)o(4)U stabilizes the sugar moiety conformation in the C3'-endo form (N conformer), rarely found in DNA nucleosides. In aqueous solution, dH(2)o(4)U reveals a similar population of the C2'-endo conformation (65%) to that of 2'-deoxy-2-thiouridine (62%), while the 62% population of the S conformer for H(2)o(4)U is significantly different from that of the parent 2-thiouridine, for which the N conformer is dominant (71%). Such a difference may be of biological importance, as the desulfurization process of natural tRNA 2-thiouridines may occur under conditions of oxidative stress in the cell and may influence the decoding process. Copyright © 2011 Elsevier Ltd. All rights reserved.
Highly stable and regenerable Mn-based/SBA-15 sorbents for desulfurization of hot coal gas
International Nuclear Information System (INIS)
Zhang, F.M.; Liu, B.S.; Zhang, Y.; Guo, Y.H.; Wan, Z.Y.; Subhan, Fazle
2012-01-01
Highlights: ► A series of mesoporous Cu x Mn y O z /SBA-15 sorbents were fabricated for hot coal gas desulfurization. ► 1Cu9Mn/SBA-15 sorbent with high breakthrough sulfur capacity is high stable and regenerable. ► Utilization of SBA-15 constrained the sintering and pulverization of sorbents. - Abstract: A series of mesoporous xCuyMn/SBA-15 sorbents with different Cu/Mn atomic ratios were prepared by wet impregnation method and their desulfurization performance in hot coal gas was investigated in a fixed-bed quartz reactor in the range of 700–850 °C. The successive nine desulfurization–regeneration cycles at 800 °C revealed that 1Cu9Mn/SBA-15 presented high performance with durable regeneration ability due to the high dispersion of Mn 2 O 3 particles incorporated with a certain amount of copper oxides. The breakthrough sulfur capacity of 1Cu9Mn/SBA-15 observed 800 °C is 13.8 g S/100 g sorbents, which is remarkably higher than these of 40 wt%LaFeO 3 /SBA-15 (4.8 g S/100 g sorbents) and 50 wt%LaFe 2 O x /MCM-41 (5.58 g S/100 g sorbents) used only at 500–550 °C. This suggested that the loading of Mn 2 O 3 active species with high thermal stability to SBA-15 support significantly increased sulfur capacity at relatively higher sulfidation temperature. The fresh and used xCuyMn/SBA-15 sorbents were characterized by means of BET, XRD, XPS, XAES, TG/DSC and HRTEM techniques, confirmed that the structure of the sorbents remained intact before and after hot coal gas desulfurization.
Desulfurization and denitrogenation of coal during multi-stage hydropyrolysis
Energy Technology Data Exchange (ETDEWEB)
Wang, N.; Li, W.; Li, B. [Chinese Academy of Sciences, Taiyuan (China). State Key Lab of Coal Conversion
2001-02-01
The elemental composition of char of high sulfur Hongmiao coal in multi-stage hydropyrolysis (MHyPy) with different heating rates were analysed and compared with that from normal hydropyrolysis (HyPy). The results illustrated that the sulfur removal in MHyPy was greater than that in HyPy, and more sulfur was evolved as the easily recycled gas H{sub 2}S. Similar with the situation of sulfur, more nitrogen transferred to the gas phase easily to be dealt with and the clean char was obtained. During MHyPy the extent of desulfurization and denitrogenation was more remarkable at high rate than that at slow heating rate. 8 refs., 2 figs., 2 tabs.
Increasing draft capability for retrofit flue gas desulfurization systems
International Nuclear Information System (INIS)
Petersen, R.D.; Basel, B.E.; Mosier, R.J.
1992-01-01
The retrofit installation of flue gas desulfurization (FGD) systems results in significantly higher draft losses for existing generating stations. Consequently, the means for increasing draft capability must be included in many FGD retrofit projects. Consideration is given to several alternatives for increasing draft capability. Alternatives are developed for new induced draft (ID) fans to replace the existing ID fans and for new booster fans to supplement the existing ID fans. Both centrifugal and axial fans are evaluated, as are different means of fan volume control. Each alternative is evaluated on the basis of technical merit and economics. Presented are the development of fan alternatives and results of the technical and economic evaluations
International Nuclear Information System (INIS)
Wertz, D.L.; Burns, K.H.; Keeton, R.W.
1995-01-01
The diffractograms of syn-gypsum and of flue gas desulfurization products indicate that CaSO 4 · 2H 2 O is converted to other phase(s) when heated to 100 degrees C. Syn-hannebachite CaSO 3 ·0.5H 2 O is unaffected by similar thermal treatment. 6 refs., 3 figs
Oxidative desulfurization of thiophene on TiO2/ZSM-12 zeolite
Santos,Marília Ramalho Figueiredo dos; Pedrosa,Anne Michelle Garrido; Souza,Marcelo José Barros de
2016-01-01
In this work the hydrothermal synthesis of ZSM-12 zeolite was performed, varying the MTEACl/SiO2 ratio, where the synthesis temperature was 140 ºC and the crystallization time was 144 hours. The catalysts were characterized by XRD, FTIR and TG. TiO2/ZSM-12 catalysts were used with titanium ions concentrations of 5, 10 and 15%. The oxidative desulfurization (ODS) reactions were performed using a model mixture containing n-heptane as solvent and thiophene as sulfur compound, H2O2 as an oxidizin...
Land application uses for dry flue gas desulfurization by-products: Phase 3
Energy Technology Data Exchange (ETDEWEB)
Dick, W.; Bigham, J.; Forster, R.; Hitzhusen, F.; Lal, R.; Stehouwer, R.; Traina, S.; Wolfe, W.; Haefner, R.; Rowe, G.
1999-01-31
New flue gas desulfurization (FGD) scrubbing technologies create a dry, solid by-product material consisting of excess sorbent, reaction product that contains sulfate and sulfite, and coal fly ash. Generally, dry FGD by-products are treated as solid wastes and disposed in landfills. However, landfill sites are becoming scarce and tipping fees are constantly increasing. Provided the environmental impacts are socially and scientifically acceptable, beneficial uses via recycling can provide economic benefits to both the producer and the end user of the FGD. A study titled ''Land Application Uses for Dry Flue Gas Desulfurization By-Products'' was initiated in December, 1990 to develop and demonstrate large volume, beneficial uses of FGD by-products. Phase 1 and Phase 2 reports have been published by the Electric Power Research Institute (EPRI), Palo Alto, CA. Phase 3 objectives were to demonstrate, using field studies, the beneficial uses of FGD by-products (1) as an amendment material on agricultural lands and on abandoned surface coal mine land, (2) as an engineering material for soil stabilization and raid repair, and (3) to assess the environmental and economic impacts of such beneficial uses. Application of dry FGD by-product to three soils in place of agricultural limestone increased alfalfa (Medicago sativa L.) and corn (Zea may L.) yields. No detrimental effects on soil and plant quality were observed.
Li, Fa-tang; Kou, Cheng-guang; Sun, Zhi-min; Hao, Ying-juan; Liu, Rui-hong; Zhao, Di-shun
2012-02-29
A new C5H9NO·SnCl2 coordinated ionic liquid (IL) was prepared by reacting N-methyl-pyrrolidone with anhydrous SnCl2. Desulfurization of dibenzothiophene (DBT) via extraction and oxidation with C5H9NO·SnCl2 IL as extractant, H2O2 and equal mol of CH3COOH as oxidants was investigated. The Nernst partition coefficients k(N) of C5H9NO·SnCl2 IL for the DBT in n-octane was above 5.0, showing its excellent extraction ability. During the oxidative desulfurization process, the optimal molar ratio of H2O2/DBT was six. Sulfur removal of DBT in n-octane was 94.8% in 30 min at 30 °C under the conditions of H2O2/DBT molar ratio of six and V (IL):V (oil)=1:3. Moreover, the sulfur removal increased with increasing temperature because of the high reaction rate constant, low viscosity, and high solubility of dibenzothiophene-sulfone in the IL. The kinetics of oxidative desulfurization of DBT was also investigated, and the apparent activation energy was found to be 32.5 kJ/mol. The IL could be recycled six times without a significant decrease in activity. Copyright © 2011 Elsevier B.V. All rights reserved.
Sujan, Achintya; Yang, Hongyun; Dimick, Paul; Tatarchuk, Bruce J.
2016-05-01
An in-situ fiber optic based technique for direct measurement of capacity utilization of ZnO adsorbent beds by monitoring bed color changes during desulfurization for fuel cell systems is presented. Adsorbents composed of bulk metal oxides (ZnO) and supported metal oxides (ZnO/SiO2 and Cusbnd ZnO/SiO2) for H2S removal at 22 °C are examined. Adsorbent bed utilization at breakthrough is determined by the optical sensor as the maximum derivative of area under UV-vis spectrum from 250 to 800 nm observed as a function of service time. Since the response time of the sensor due to bed color change is close to bed breakthrough time, a series of probes along the bed predicts utilization of the portion of bed prior to H2S breakthrough. The efficacy of the optical sensor is evaluated as a function of inlet H2S concentration, H2S flow rate and desulfurization in presence of CO, CO2 and moisture in feed. A 6 mm optical probe is employed to measure utilization of a 3/16 inch ZnO extrudate bed for H2S removal. It is envisioned that with the application of the optical sensor, desulfurization can be carried out at high adsorbent utilization and low operational costs during on-board miniaturized fuel processing for logistic fuel cell power systems.
Ma, Shuang-Chen; Gao, Li; Ma, Jing-Xiang; Jin, Xin; Yao, Juan-Juan; Zhao, Yi
2012-06-01
This paper describes the research background and chemistry of desulfurization and denitrification technology using microwave irradiation. Microwave-induced catalysis combined with activated carbon adsorption and reduction can reduce nitric oxide to nitrogen and sulfur dioxide to sulfur from flue gas effectively. This paper also highlights the main drawbacks of this technology and discusses future development trends. It is reported that the removal of sulfur dioxide and nitric oxide using microwave irradiation has broad prospects for development in the field of air pollution control.
Energy Technology Data Exchange (ETDEWEB)
NONE
1981-07-01
This questionnaire survey was intended to investigate the actual state of maintenance such as materials used, conditions for use, anti-corrosion measures, and cases and handling of damage, concerning primary apparatus in the direct/indirect desulfurization equipment and the fluidized catalytic crackers, which are owned by each oil refinery and which are analogous to coal liquefaction equipment. The questionnaire was intended for the following equipment and apparatus, with the actual state of their maintenance investigated. 1. Questionnaire concerning maintenance of direct desulfurization (reactor, high temperature separation tank, material furnace tube, reactor exit piping, high temperature heat exchanger, low temperature heat exchanger, and pressure reducing valve), 2. Questionnaire concerning maintenance of indirect desulfurization (reactor, high temperature separation tank, material furnace tube, reactor exit piping, high temperature heat exchanger, low temperature heat exchanger, and pressure reducing valve), 3. Questionnaire concerning maintenance of fluidized catalytic cracker (reactor, regeneration tower, riser pipe, and fractionator bottom pump). The questionnaire this time was distributed to 27 domestic oil companies, with the reply received from 23 of them. The replies were summarized by each type of equipment. Shown at the back of the report were the cases of damage and handling in FCC's and reactors. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
Maass, Danielle; Souza, Antonio Augusto Ulson de; Souza, Selene Maria de Arruda Guelli Ulson de [Universidade Federal de Santa Catarina (UFSC), SC (Brazil)
2012-07-01
For decades the burning of fossil fuels released a lot of pollutants in the atmosphere. Among the most harmful is sulfur dioxide (SO{sub 2}), which reacts with the moisture in the air and turns into sulfuric acid, being the main cause of acid rain. Acid rain is very harmful to animal and plant kingdoms; accelerates the corrosion's processes of buildings and monuments, and causes serious health problems for humans. As a result, many countries have reformed their legislation to require the sale of fuels with very low sulfur content. The existing processes of desulfurization are not capable of removing sulfur so low. Therefore, there has developed a new process called bio desulfurization. In this process, the degradation of sulfur occurs through the action of microorganisms that act as catalysts. The bacterium Rhodococcus erythropolis has emerged as one of the most promising for bio desulfurization because it removes the sulfur without breaking the benzene rings, thereby maintaining the potential energy of the same. Using dibenzothiophene as a model of sulfur compounds, the products of the bio desulfurization process are 2- hydroxybiphenyl and sulfate. In this study we sought to examine the desulfurizing capacity of national Rhodococcus erythropolis strain ATCC4277 in a batch reactor using concentrations of organic phase (n-dodecane) of 20 and 80% (v/v). Rhodococcus erythropolis ATCC4277 was capable of degrading DBT in 93.3 and 98.0% in the presence of 20 and 80% (v/v) of synthetic fuel, respectively. (author)
DEFF Research Database (Denmark)
Qin, Siqiang; Hansen, Brian Brun; Kiil, Søren
2014-01-01
Foaming is a common phenomenon in industrial processes, including wet flue gas desulfurization (FGD) plants. A systemic investigation of the influence of two foaming agents, sodium dodecyl sulphate (SDS) and egg white albumin (protein), and two commercial antifoams on a wet FGD pilot plant...
Warrag, Samah E.E.; Adeyemi, Idowu; Rodriguez, Nerea R.; Nashef, Inas M.; van Sint Annaland, Martin; Kroon, Maaike C.; Peters, Cor J.
2018-01-01
In a previous work, we proved that the deep eutectic solvents (DESs) consisting of mixtures of tetraalkylammonium salts with polyols are promising candidates for oil desulfurization based on the obtained liquid-liquid equilibrium (LLE) data. In this study, the capability of DESs containing other
Two-Phase Phenomena In Wet Flue Gas Desulfurization Process
International Nuclear Information System (INIS)
Minzer, U.; Moses, E.J.; Toren, M.; Blumenfeld, Y.
1998-01-01
In order to reduce sulfur oxides discharge, Israel Electric Corporation (IEC) is building a wet Flue Gas Desulfurization (FGD) facility at Rutenberg B power station. The primary objective of IEC is to minimize the occurrence of stack liquid discharge and avoid the discharge of large droplets, in order to prevent acid rain around the stack. Liquid discharge from the stack is the integrated outcome of two-phase processes, which are discussed in this work. In order to estimate droplets discharge the present investigation employs analytical models, empirical tests, and numerical calculations of two-phase phenomena. The two-phase phenomena are coupled and therefore cannot be investigated separately. The present work concerns the application of Computational Fluid Dynamic (CFD) as an engineering complementary tool in the IEC investigation
Shen, Lijuan; Lei, Ganchang; Fang, Yuanxing; Cao, Yanning; Wang, Xinchen; Jiang, Lilong
2018-03-06
We report the first use of polymeric carbon nitride (CN) for the catalytic selective oxidation of H 2 S. The as-prepared CN with unique ultrathin "nanomeshes" structure exhibits excellent H 2 S conversion and high S selectivity. In particular, the CN nanomesh also displays better durability in the desulfurization reaction than traditional catalysts, such as carbon- and iron-based materials.
Wan, Meng-Wei
Due to the stringent rules requiring ultra-low sulfur content in diesel fuels, it is necessary to develop alternative methods of desulfurization of fossil fuel derived oil, such as diesel. Current technology is not sufficient to solve this problem. Ultrasound applied to oxidative desulfurization which combined three complementary techniques: ultrasonication, phase transfer catalysis (PTC) and transition metal catalyzed oxidation, has accomplished high sulfur removal in a short contact time at ambient temperature and atmospheric pressure. This research has successfully demonstrated that the higher oxidation efficiency of BT to BTO and free of any by-products by using tetraoctylammonium fluoride as phase transfer agent. The oxidation rate of BT to BTO increased with increasing the carbon chain length of QAS cations. Under the same length of carbon chain, the oxidation rate of BT to BTO increased with decreasing the molecular size of QAS anions. Moreover, for diesel fuels containing various levels of sulfur content, UAOD process followed by solvent extraction has demonstrated that the sulfur reduction can reach above 95 % removal efficiency or final sulfur content below 15 ppm in mild condition. For large-scale commercial production, this research has successfully developed and operated a continuous desulfurization unit, which consists of a sonoractor, an RF amplifier, a function generator, a pretreatment tank, and a pipeline system. A single unit only needed 2' x 4' x 1' space for installation. The results indicated that the remarkable 92% removal efficiency for the sulfur in marine logistic diesel, even at a treatment rate as high as 25 lb/hour which is approximately 2 barrels per day. Therefore, this sonoreactor demonstrated the feasibility of large-scale operation even in a relatively small installation with low capital investment and maintenance cost. It also ensures the safety considerations by operating with diluted hydrogen peroxide under ambient temperature
Neubauer, Raphael; Weinlaender, Christof; Kienzl, Norbert; Bitschnau, Brigitte; Schroettner, Hartmuth; Hochenauer, Christoph
2018-05-01
On-board desulfurization is essential to operate fuel-cell-based auxiliary power units (APU) with commercial fuels. In this work, both (i) on-board desulfurization and (ii) on-board regeneration performance of Ag-Al2O3 adsorbent is investigated in a comprehensive manner. The herein investigated regeneration strategy uses hot APU off-gas as the regeneration medium and requires no additional reagents, tanks, nor heat exchangers and thus has remarkable advantages in comparison to state-of-the-art regeneration strategies. The results for (i) show high desulfurization performance of Ag-Al2O3 under all relevant operating conditions and specify the influence of individual operation parameters and the combination of them, which have not yet been quantified. The system integrated regeneration strategy (ii) shows excellent regeneration performance recovering 100% of the initial adsorption capacity for all investigated types of fuels and sulfur heterocycles. Even the adsorption capacity of the most challenging dibenzothiophene in terms of regeneration is restored to 100% over 14 cycles of operation. Subsequent material analyses proved the thermal and chemical stability of all relevant adsorption sites under APU off-gas conditions. To the best of our knowledge, this is the first time 100% regeneration after adsorption of dibenzothiophene is reported over 14 cycles of operation for thermal regeneration in oxidizing atmospheres.
Du, Shuting; Li, Fen; Sun, Qiming; Wang, Ning; Jia, Mingjun; Yu, Jihong
2016-02-25
Hierarchical TS-1 zeolites with uniform intracrystalline mesopores have been successfully synthesized through the hydrothermal method by using the green and cheap surfactant Triton X-100 as the mesoporous template. The resultant materials exhibit remarkably enhanced catalytic activity in oxidative desulfurization reactions compared to the conventional TS-1 zeolite.
Nogueira, Lucie S; Ribeiro, Susana; Granadeiro, Carlos M; Pereira, Eulália; Feio, Gabriel; Cunha-Silva, Luís; Balula, Salete S
2014-07-07
A novel method to prepare silica nano-sized particles incorporating polyoxometalates was developed leading to a new efficient heterogeneous oxidative catalyst. Zinc-substituted polyoxotungstate [PW11Zn(H2O)O39](5-) (PW11Zn) was encapsulated into silica nanoparticles using a cross-linked organic-inorganic core, performed through successive spontaneous reactions in water. The potassium salt of PW11Zn and the composite formed, PW11Zn-APTES@SiO2, were characterized by a myriad of solid-state methods such as FT-IR, FT-Raman, (31)P and (13)C CP/MAS solid-state NMR, elemental analysis and SEM-EDS, confirming the integrity of the PW11Zn structure immobilized in the silica nanoparticles. The new composite has shown to be a versatile catalyst for the oxidation of olefins and also to catalyze the desulfurization of a model oil using H2O2 as the oxidant and acetonitrile as the solvent. The novel composite material was capable of being recycled without significant loss of activity and maintaining its structural stability for consecutive desulfurization and olefin oxidative cycles.
Structure of a hexameric form of RadA recombinase from Methanococcus voltae
International Nuclear Information System (INIS)
Du, Liqin; Luo, Yu
2012-01-01
Hexameric rings of RadA recombinase from M. voltae have been crystallized. Structural comparisons suggest that homologues of RadA tend to form double-ringed assemblies. Archaeal RadA proteins are close homologues of eukaryal Rad51 and DMC1 proteins and are remote homologues of bacterial RecA proteins. For the repair of double-stranded breaks in DNA, these recombinases promote a pivotal strand-exchange reaction between homologous single-stranded and double-stranded DNA substrates. This DNA-repair function also plays a key role in the resistance of cancer cells to chemotherapy and radiotherapy and in the resistance of bacterial cells to antibiotics. A hexameric form of a truncated Methanococcus voltae RadA protein devoid of its small N-terminal domain has been crystallized. The RadA hexamers further assemble into two-ringed assemblies. Similar assemblies can be observed in the crystals of Pyrococcus furiosus RadA and Homo sapiens DMC1. In all of these two-ringed assemblies the DNA-interacting L1 region of each protomer points inward towards the centre, creating a highly positively charged locus. The electrostatic characteristics of the central channels can be utilized in the design of novel recombinase inhibitors
Directory of Open Access Journals (Sweden)
Sarah A. Hensley
2016-02-01
Full Text Available Thermococcus may be an important alternative source of H2 in the hot subseafloor in otherwise low H2 environments such as some hydrothermal vents and oil reservoirs. It may also be useful in industry for rapid agricultural waste treatment and concomitant H2 production. Thermococcus paralvinellae grown at 82°C without sulfur produced up to 5 mmol of H2 L-1 at rates of 5-36 fmol H2 cell-1 h-1 on 0.5% (wt vol-1 maltose, 0.5% (wt vol-1 tryptone, and 0.5% maltose + 0.05% tryptone media. Two potentially inhibiting conditions, the presence of 10 mM acetate and low pH (pH 5 in maltose-only medium, did not significantly affect growth or H2 production. Growth rates, H2 production rates, and cell yields based on H2 production were the same as those for Pyrococcus furiosus grown at 95°C on the same media for comparison. Acetate, butyrate, succinate, isovalerate and formate were also detected as end products. After 100 h, T. paralvinellae produced up to 5 mmol of H2 L-1 of medium when grown on up to 70% (vol vol-1 waste milk from cows undergoing treatment for mastitis with the bacterial antibiotic Ceftiofur and from untreated cows. The amount of H2 produced by T. paralvinellae increased with increasing waste concentrations, but decreased in P. furiosus cultures supplemented with waste milk above 1% concentration. All mesophilic bacteria from the waste milk that grew on Luria Bertani, Sheep’s Blood (selective for Staphylococcus, the typical cause of mastitis, and MacConkey (selective for Gram-negative enteric bacteria agar plates were killed by heat during incubation at 82°C. Ceftiofur, which is heat labile, was below the detection limit following incubation at 82°C. T. paralvinellae also produced up to 6 mmol of H2 L-1 of medium when grown on 0.1-10% (wt vol-1 spent brewery grain while P. furiosus produced < 1 mmol of H2 L-1. Twelve of 13 enzyme activities in T. paralvinellae showed significant (p<0.05 differences across six different growth conditions
Effects of surface acidities of MCM-41 modified with MoO3 on adsorptive desulfurization of gasoline
International Nuclear Information System (INIS)
Shao Xinchao; Zhang Xiaotong; Yu Wenguang; Wu Yuye; Qin Yucai; Sun Zhaolin; Song Lijuan
2012-01-01
Highlights: ► The MoO 3 -MCM-41 samples prepared by spontaneous monolayer dispersion and impregnation with a different MoO 3 filling have been studied. ► The relative concentration of hydroxyl groups present on before and after containing MoO 3 samples was monitored by in situ FTIR to speculate the bonding style of MoO 3 and MCM-41. ► The surface acidities of the MoO 3 -MCM-41 adsorbents were investigated systematically and correlated with the desulfurization performance. - Abstract: A series of MCM-41 samples containing molybdenum oxide as active species in the mesoporous channels loaded by spontaneous monolayer dispersion (SMD) and impregnation (IM) have been prepared and characterized using XRD, N 2 adsorption–desorption analysis, Fourier transform infrared spectroscopy (FTIR) and intelligent gravimetric analyzer (IGA). The relative number of hydroxy on the adsorbents was investigated by in situ FTIR. Surface acidities of the adsorbents were studied by infrared spectroscopy of adsorbed pyridine and correlated with reactivity for adsorptive desulfurization. The IGA technique was employed to investigate adsorption behavior of thiophene and benzene on the adsorbents at 303 K. It is shown that MoO 3 can be highly dispersed up to 0.2 g g −1 in the MCM-41 channels by the SMD strategy with the ordered mesoporous structure of the MoMM samples remaining intact. The ordered mesostructure of MCM-41 is, however, destroyed at higher MoO 3 contents of 0.26 and 0.32 g g −1 with particle sizes of 1.2 nm and 3.6 nm, respectively, observed. For the MoMI(0.2) sample prepared by the IM method, the aggregation of the MoO 3 particles takes place with a particle size of 6.5 nm obtained. The results are also revealed that the dispersion extent of the MoO 3 species is related to the abundant surface hydroxy of MCM-41. The host species and guest species undergo solid-state reaction to form Si-O-Mo bonds in the mixtures which enhance both the Lewis acid and Brönsted acid of
International Nuclear Information System (INIS)
Zhu, Wenshuai; Xu, Yehai; Li, Huaming; Dai, Bilian; Xu, Hui; Wang, Chao; Chao, Yanhong; Liu, Hui
2014-01-01
Three types of TiO 2 were synthesized by a hydrolysis and calcination method. The catalysts were characterized by X-ray powder diffraction (XRD), diffuse reflectance spectrum (DRS), Raman spectra, and X-ray photoelectron spectroscopy (XPS). The XRD and Raman spectra indicated that amorphous TiO 2 was successfully obtained at 100 .deg. C. The results indicated that amorphous TiO 2 achieved the highest efficiency of desulfurization. The photocatalytic oxidation of dibenzothiophene (DBT), benzothiophene (BT), 4,6-dimethyldibenzothiophene (4,6-DMDBT) and dodecanethiol (RSH) in model oil was studied at room temperature (30 .deg. C) with three catalysts. The system contained amorphous TiO 2 , H 2 O 2 , and [Bmim]BF 4 ionic liquid, ultraviolet (UV), which played vitally important roles in the photocatalytic oxidative desulfurization. Especially, the molar ratio of H 2 O 2 and sulfur (O/S) was only 2 : 1, which corresponded to the stoichiometric reaction. The sulfur removal of DBT-containing model oil with amorphous TiO 2 could reach 96.6%, which was apparently superior to a system with anatase TiO 2 (23.6%) or with anatase - rutile TiO 2 (18.2%). The system could be recycled seven times without a signicant decrease in photocatalytic activity
Wu, Peiwen; Zhu, Wenshuai; Chao, Yanhong; Zhang, Jinshui; Zhang, Pengfei; Zhu, Huiyuan; Li, Changfeng; Chen, Zhigang; Li, Huaming; Dai, Sheng
2016-01-04
Hexagonal boron nitride nanosheets (h-BNNs) with rather high specific surface area (SSA) are important two-dimensional layer-structured materials. Here, a solvent-mediated synthesis of h-BNNs revealed a template-free lattice plane control strategy that induced high SSA nanoporous structured h-BNNs with outstanding aerobic oxidative desulfurization performance.
Electrochemical flue gas desulfurization: Reactions in a pyrosulfate-based electrolyte
International Nuclear Information System (INIS)
Scott, K.; Fannon, T.; Winnick, J.
1988-01-01
A new electrolyte has been found suitable for use in an electrochemical membrane cell for flue gas desulfurization (FGD). The electrolyte is primarily K/sub 2/S/sub 2/O/sub 7/ and K/sub 2/SO/sub 4/ with V/sub 2/O/sub 5/ as oxidation enhancer. This electrolyte has a melting point near 300/sup 0/C which is compatible with flue gas exiting the economizer of coal-burning power plants. Standard electrochemical tests have revealed high exchange current densities around 30 mA/cm/sup 2/, in the free electrolyte. Sulfur dioxide is found to be removed from simulated flue gas in a multiple-step process, the first of which is electrochemical reduction of pyrosulfate
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
Efforts are made to develop a technology of using quicklime instead of slaked lime for a reduction in desulfurization cost, based on the technology of the coal ash utilizing dry type desulfurization device operating on coal ash, slaked lime, and gypsum, as hardened by hydration. Activities are conducted in the three fields of (1) basic study, (2) desulfurization agent bench-scale manufacturing test, and (3) study for putting the technology to practical application. In field (1), the basics are studied of the lime slaking process in the manufacture of a dry type desulfurization agent from quicklime, the mechanism is elucidated of the generation of active desulfurization substances, and effective utilization is studied of the desulfurization agent after use. In field (3), conceptual designs are prepared, cost efficiency of desulfurization systems are evaluated, simplified absorption systems are studied, and the trends of dry type desulfurization systems are surveyed. The cost of desulfurization under development is equivalent to that of the wet type method (limestone-gypsum system) when the used desulfurization agent is discarded, and is approximately 60% of the wet type method when the whole amount is effectively utilized. (NEDO)
Liu, B S; Wan, Z Y; Wang, F; Zhan, Y P; Tian, M; Cheung, A S C
2014-02-28
Using a sol-gel method, SmMeOx/MCM-41 or SBA-15 (Me=Fe, Co and Zn) and corresponding unsupported sorbents were prepared. The desulfurization performance of these sorbents was evaluated over a fixed-bed reactor and the effects of reaction temperature, feed and sorbent composition on desulfurization performance were studied. Samarium-based sorbents used to remove H2S from hot coal gas were reported for the first time. The results of successive sulfidation/regeneration cycles revealed that SmFeO3/SBA-15 sorbent was suitable for desulfurization of hot coal gas in the chemical industry. The formation of elemental sulfur during both sulfidation and regeneration processes depended strongly on the catalytic action of Sm2O2S species, which was confirmed for the first time via high sensitive time of flight mass spectrometer (TOF-MS) using 6%vol(18)O2/Ar regeneration gas and can reduce markedly procedural complexity. The sorbents were characterized using N2-adsorption, high-resolution transmission electron microscopy (HRTEM), X-ray diffraction (XRD), temperature-programmed reduction of H2 (H2-TPR), thermogravimetry (TG) and time-of-flight mass spectrometry (TOF-MS) techniques. Copyright © 2014 Elsevier B.V. All rights reserved.
Desulfurization of dibenzothiophene by Corynebacterium sp. strain SY1
International Nuclear Information System (INIS)
Omori, Toshio; Monna, L.; Saiki, Yuko; Kodama, Tohru
1992-01-01
Strain SY1, identified as a Corynebacterium sp., was isolated on the basis of the ability to utilize dibenzothiophene (DBT) as a sole source of sulfur. Strain SY1 could utilize a wide range of organic and inorganic sulfur compounds, such as DBT sulfone, dimethyl sulfide, dimethyl sulfoxide, dimethyl sulfone, CS 2 , FeS 2 , and even elemental sulfur. Strain SY1 metabolized DBT to dibenzothiophene-5-oxide, DBT sulfone, and 2-hydroxybiphenyl, which was subsequently nitrated to produce at least two different hydroxynitrobiphenyls during cultivation. These metabolites were separated by silica gel column chromatography and identified by nuclear magnetic resonance, UV, and mass spectral techniques. Resting cells of SY1 desulfurized toluenesulfonic acid and released sulfite anion. On the basis of these results, a new DBT degradation pathway is proposed
Energy Technology Data Exchange (ETDEWEB)
Souza Costa, Sergio L. de [USIMINAS, Ipatinga, MG (Brazil). Centro de Pesquisa e Desenvolvimento; Figueira, Renato M. [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Escola de Engenharia
1996-12-31
A general criterion for laboratory scale data transposing to industrial practice, based on Navier-Stokes equation is developed. The criterion is a dimensional relation between the rate of energy dissipation, dimensions such as the height and diameter of the reactor and the inertial forces. The criterion was used to predict the evolution of the pig iron desulfurization reaction in torpedo car from results obtained in laboratory scale. The agreement between values predicted from laboratory experiments and data generated from actual industrial desulfurization operation is excellent. (author) 10 refs., 5 figs., 7 tabs.
GE`s worldwide experience with IFO based gypsum producing flue gas desulfurization systems
Energy Technology Data Exchange (ETDEWEB)
Saleem, A. [GE Environmental Systems, Lebanon, PA (United States)
1994-12-31
The In-Situ Forced Oxidation (IFO) process to produce gypsum in a commercial scale flue gas desulfurization (FGD) system was first demonstrated by GE Environmental Systems in 1980 at the Monticello Generating Station of Texas Utilities. Since then, the IFO technology developed and demonstrated by GE has become the industry standard and is used extensively on a world-wide basis to produce both commercial and disposable-grade gypsum. The paper gives an overview of the development, demonstration, commercial design and current status of the IFO technology.
Energy Technology Data Exchange (ETDEWEB)
Haw, Kok-Giap; Bakar, Wan Azelee Wan Abu; Ali, Rusmidah; Chong, Jiunn-Fat [Department of Chemistry, Faculty of Science, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor (Malaysia); Kadir, Abdul Aziz Abdul [Department of Petroleum Engineering, Faculty of Chemical and Natural Resources Engineering, Universiti Teknologi Malaysia, 81310 UTM Skudai, Johor (Malaysia)
2010-09-15
This paper presents the development of granular functionalized-activated carbon as catalysts in the catalytic oxidative desulfurization (Cat-ODS) of commercial Malaysian diesel using hydrogen peroxide as oxidant. Granular functionalized-activated carbon was prepared from oil palm shell using phosphoric acid activation method and carbonized at 500 C and 700 C for 1 h. The activated carbons were characterized using various analytical techniques to study the chemistry underlying the preparation and calcination treatment. Nitrogen adsorption/desorption isotherms exhibited the characteristic of microporous structure with some contribution of mesopore property. The Fourier Transform Infrared Spectroscopy results showed that higher activation temperature leads to fewer surface functional groups due to thermal decomposition. Micrograph from Field Emission Scanning Electron Microscope showed that activation at 700 C creates orderly and well developed pores. Furthermore, X-ray Diffraction patterns revealed that pyrolysis has converted crystalline cellulose structure of oil palm shell to amorphous carbon structure. The influence of the reaction temperature, the oxidation duration, the solvent, and the oxidant/sulfur molar ratio were examined. The rates of the catalytic oxidative desulfurization reaction were found to increase with the temperature, and H{sub 2}O{sub 2}/S molar ratio. Under the best operating condition for the catalytic oxidative desulfurization: temperature 50 C, atmospheric pressure, 0.5 g activated carbon, 3 mol ratio of hydrogen peroxide to sulfur, 2 mol ratio of acetic acid to sulfur, 3 oxidation cycles with 1 h for each cycle using acetonitrile as extraction solvent, the sulfur content in diesel was reduced from 2189 ppm to 190 ppm with 91.3% of total sulfur removed. (author)
International Nuclear Information System (INIS)
Watson, W.K.; Wolsiffer, S.R.; Youmans, J.; Martin, J.E.; Wedig, C.P.
1992-01-01
This paper briefly describes the status of the retrofit wet limestone flue gas desulfurization system (FGDS) project at Indianapolis Power and Light Company (IPL), Petersburg Units 1 and 2. This project was initiated by IPL in response to the Clean Air Act of 1990 and is intended to treat the flue gas from two base load units with a combined capacity of approximately 700 MW gross electrical output. IPL is the owner and operator of the Petersburg Station located in southwestern Indiana. Stone and Webster Engineering Corporation (Stone and Webster) is the Engineer and Constructor for the project. Radian Corporation is a subcontractor to Stone and Webster in the area of flue gas desulfurization (FGD) process. General Electric Environmental Systems, Inc. (GEESI) is the supplier of the FGDS. The project is organized as a team with each company providing services. The supplier of the new stack is scheduled to be selected and join the team in early 1992. Other material suppliers and field contractors will be selected in 1992
Kim, Hyeonjoo; Jeong, Kwang-Eun; Jeong, Soon-Yong; Park, Young-Kwon; Kim, Do Heui; Jeon, Jong-Ki
2011-02-01
We investigated the use of Cs-mesoporous silica catalysts to upgrade a by-product of oxidative desulfurization (ODS). Cs-mesoporous silica catalysts were characterized through N2 adsorption, XRD, CO2-temperature-programmed desorption, and XRF. Cs-mesoporous silica prepared by the direct incorporation method showed higher catalytic performance than a Cs/MCM-41 catalyst by impregnation method for the catalytic decomposition of sulfone compounds produced from ODS process.
Kamlesh Rudreshwar Balinge; Avinash Ganesh Khiratkar; Manikandan Krishnamurthy; Dipesh S. Patle; Cheralathan K. K.; Pundlik Rambhau Bhagat
2016-01-01
Acidic carboxyl functionalized poly(ionic liquid) (CFPIL) has been synthesized and characterized by various techniques like FT-NMR, Fourier transform infrared spectroscopy (FTIR). In this work, deep oxidative desulfurization of model oil (thiophene dissolved in iso-octane) by CFPIL catalyst was carried out in presence of 30 wt% H2O2 solution as an oxidant. The effects of the hydrogen peroxide, amount of CFPIL, temperature-time and recyclability are scrutinized systematically. It was found tha...
Energy Technology Data Exchange (ETDEWEB)
Pieterse, J.A.Z.; Van Eijk, S.; Van Dijk, H.A.J.; Van den Brink, R.W. [Energy research Center of the Netherlands, P.O. Box 1, 1755 ZG Petten (Netherlands)
2011-03-15
Sorption of sulfur components in the liquid phase was used to desulfurize ultra low sulfur diesel (ULSD) to below 1 ppmw S. Several concepts of sorption were considered by using both physisorption and chemisorption materials and conditions. Adsorption assisted by reaction with Ni sorbent was found to be most successful. Using a pre-commercial diesel representing a mature diesel on all aspects except for the absence of fuel stabilizers and bio-diesel, a sulfur breakthrough capacity of 2 mg S/g could be achieved using a Ni-sorbent at an acceptable LHSV of 0.7 h{sup -1} on average. However, successive experiments indicated that the desulfurization capacity depended strongly on the presence of fuel-additive and bio-diesel in commercial ULSD. The presence of the cetane improver 2-ethylhexylnitrate (2EHN) was shown to decrease the sulfur capacity by roughly 50%. The presence of bio-diesel (fatty acid methyl ester, abbreviated to FAME) was shown to completely disable the desulfurization process. This was confirmed by comparing BP Ultimate diesel with FAME (obtained in 2008) and without FAME (obtained in 2006). From this evaluation it turned out that the targeted breakthrough capacity of 1 mg S/g sorbent was within reach for commercial ULSD until late 2006 when adding bio-diesel to ULSD became common practice in Europe. Several attempts to remove the additives prior to desulfurization by using copper loaded zeolites, active carbon and silica gel proved unsuccessful to bring the sulfur adsorption capacity for current diesel to the level observed for 2EHN and FAME-free diesel. It is concluded that sorption in the liquid phase does not yet represent a viable desulfurization technology for ultra-low sulfur diesel.
A pilot-scale field study was carried out to investigate the distribution of Hg and other selected elements in the three potential mitigation pathways, i.e., emission to ambient air, uptake by surface vegetation (i.e., grass), and rainfall infiltration, after flue gas desulfurization (FGD) material ...
Zhou, Qiying; Jiang, Xia; Li, Xi; Jiang, Wenju
2016-09-01
In this study, five kinds of iron ores, limonite, hematite, manganese ore, magnetite and lava rock, were used as the in situ desulfurizers in the anaerobic digestion reactors to investigate their effects on controlling H2S in biogas. The results show that the addition of the five iron ores could significantly control the content of H2S in biogas, with the best performance for limonite. As limonite dosages increase (10-60 g/L), the contents of H2S in biogas were evidently decreased in the digesters with different initial sulfate concentrations (0-1000 mg/L). After the anaerobic digestion, the removed sulfur was mostly deposited on the surface of limonite. A possible mechanism of H2S control in biogas by limonite was proposed preliminarily, including adsorption, FeS precipitation, and Fe (III) oxidation. The results demonstrated that limonite was a promising in situ desulfurizer for controlling H2S in biogas with low cost and high efficiency.
Flue gas desulfurization gypsum (FGDG) from coal-fired power plants is available for agricultural use in many US regions. Broiler litter (BL) provides plant available N, P, and K but may be a source of unwanted arsenic (As), copper (Cu), and zinc (Zn). FGDG provides Ca and S and can reduce runoff lo...
International Nuclear Information System (INIS)
Jalali, Mohammad Reza; Sobati, Mohammad Amin
2017-01-01
Highlights: • Ultrasound-assisted oxidative desulfurization (UAOD) of gas oil was studied. • The influences of the different operating parameters were investigated. • Response surface methodology (RSM) was used to find the best operating parameters. • An accurate correlation was developed for the sulfur removal. • Ultrasound-assisted desulfurization process was compared with conventional process. - Abstract: In the present work, ultrasound assisted oxidative desulfurization (UAOD) of gas oil as the feedstock with sulfur content of 2210 ppmw was investigated using a mixture of hydrogen peroxide and formic acid as the oxidant and catalyst, respectively. The influences of main process variables such as sonication time (2–30 min), oxidation temperature (40–70 °C), hydrogen peroxide to sulfur molar ratio (10–50), formic acid to oxidant molar ratio (2–4), ultrasound power per gas oil volume (5.56–8.89 W/mL), and number of extraction stages (1–4) on the sulfur removal of gas oil were investigated. Response surface methodology (RSM) based on Box–Behnken design (BBD) and single-factor experiments were employed. The best performance of UAOD process for gas oil was achieved at 50 °C of reaction temperature, oxidant to sulfur molar ratio of 46.36, formic acid to oxidant molar ratio of 3.22, sonication time of 19.81 min, and 7.78 W/mL as the ultrasound power per gas oil volume. The sulfur removal of UAOD process was evaluated after oxidation under the abovementioned conditions followed by (a) one stage extraction and (b) four stages extraction using acetonitrile as solvent. The observed sulfur removal was 87 for case (a) and 96.2% for case (b). The UAOD process was also compared with conventional ODS process. Considerable improvement on the sulfur removal was observed specially in lower reaction time in the case of using ultrasound irradiation in comparison with conventional mixing.
International Nuclear Information System (INIS)
Yang, Seung-Tae; Jeong, Kwang-Eun; Jeong, Soon-Yong; Ahn, Wha-Seung
2012-01-01
Graphical abstract: Display Omitted Highlights: ► Meso-TS-1 catalyst was synthesized using a SiO 2 –TiO 2 xerogel with an organosilane precursor. ► Hierarchical pore structure was confirmed by characterization of the materials. ► Catalytic activity was tested using oxidative desulfurization of the model sulfur compounds. ► Meso-TS-1 demonstrated significantly improved catalytic activity than TS-1. -- Abstract: Mesoporous TS-1 (M-TS-1) was synthesized using a hybrid SiO 2 –TiO 2 xerogel combined with an organosilane precursor. Prepared samples were characterized by XRD, UV–vis spectroscopy, SEM, and N 2 adsorption–desorption measurement. M-TS-1, prepared in 2 days, showed high crystallinity and the best textural properties among the samples. The N 2 adsorption–desorption isotherms of M-TS-1 exhibited a hysteresis loop at pressure higher than P/P 0 = 0.4, clearly indicating the existence of mesopores. M-TS-1 has significantly larger mesopore volume (0.48 cm 3 /g) than that of conventional TS-1 (0.07 cm 3 /g), and showed a narrow peak centered at ca. 6.3 nm. In the oxidative desulfurization reaction, M-TS-1 was more active than conventional TS-1 at the same Ti-loading; M-TS-1 produced a dibenzothiophene (DBT) conversion of 96%, whereas conventional TS-1 produced a final DBT conversion of 5.6% after a reaction time of 180 min. Oxidative desulfurization over TS-1 was influenced both by electron density and steric hindrance in the sulfur compounds tested.
Stanienda-Pilecki, Katarzyna
2017-09-01
This article presents the results of studies of Triassic (Muschelkalk) carbonate rock samples of the Terebratula Beds taken from the area of the Polish part of the Germanic Basin. It is the area of Opole Silesia. The rocks were studied in the term of possibility of limestone with magnesium application in desulfurization of flue gases executed in power plants. Characteristic features of especially carbonate phases including magnesium-low-Mg calcite, high-Mg calcite, dolomite and huntite were presented in the article. They were studied to show that the presence of carbonate phases with magnesium, especially high-Mg calcite makes the desulfurization process more effective. Selected rock samples were examined using a microscope with polarized, transmitted light, X-ray diffraction, microprobe measurements and FTIR spectroscopy. The results of studies show a domination of low magnesium calcite in the limestones of the Terebratula Beds. In some samples dolomite and lower amounts of high-Mg calcite occurred. Moreover, huntite was identified. The studies were very important, because carbonate phases like high-Mg calcite and huntite which occurred in rocks of the Triassic Terebratula Beds were not investigated in details by other scientists but they presence in limestone sorbent could influence the effectiveness of desulfurization process.
Marble waste characterization as a desulfurizing slag component for steel
International Nuclear Information System (INIS)
Coleti, J.L.; Grillo, F.F.; Tenorio, J.A.S.; De Oliveira, J.R.
2014-01-01
The current steel market requires from steel plants better quality of its products. As a result, steel plants need to search for improvements and costs reduction in its process. Hence, the residue of marble containing significant quantities of calcium and magnesium carbonates, raw materials of steel refining slag, was characterized in order to replace the conventional lime used. Therefore, it will be possible to reduce the cost and volume of waste produced by the ornamental rock industry. The following methods were applied to test the waste potential: SEM with EDS, x-ray diffraction, x-ray fluorescence (EDX), Thermogravimetry (TG) and analysis of surface area and particle size by the BET method using dispersion leisure. The results indicated the feasibility of waste as raw material in the composition of desulfurizing slags. (author)
Adsorptive desulfurization with CPO-27/MOF-74: an experimental and computational investigation.
Van de Voorde, Ben; Hezinová, Markéta; Lannoeye, Jeroen; Vandekerkhove, Annelies; Marszalek, Bartosz; Gil, Barbara; Beurroies, Isabelle; Nachtigall, Petr; De Vos, Dirk
2015-04-28
By combining experimental adsorption isotherms, microcalorimetric data, infrared spectroscopy and quantum chemical calculations the adsorption behaviour of the CPO-27/MOF-74 series (Ni, Co, Mg, Cu, and Zn) in the desulfurization of fuels is evaluated. The results show a clear influence of the metal ion on the adsorption capacity and affinity for S-heterocyclic compounds, with CPO-27(Ni) being the best performing material both in terms of capacity and affinity. The microcalorimetric data and infrared spectroscopy confirm the high affinity of CPO-27(Ni) for thiophene and similar compounds, while the computational data reveal that the origin of this outstanding adsorption performance is the strong sulfur-metal interaction.
Flue gas desulfurization: Physicochemical and biotechnological approaches
Energy Technology Data Exchange (ETDEWEB)
Pandey, R.A.; Biswas, R.; Chakrabarti, T.; Devotta, S. [National Environmental Engineering Research Institute, Nagpur (India)
2005-07-01
Various flue gas desulfurization processes - physicochemical, biological, and chemobiological - for the reduction of emission of SO{sub 2} with recovery of an economic by-product have been reviewed. The physicochemical processes have been categorized as 'once-through' and 'regenerable.' The prominent once-through technologies include wet and dry scrubbing. The wet scrubbing technologies include wet limestone, lime-inhibited oxidation, limestone forced oxidation, and magnesium-enhanced lime and sodium scrubbing. The dry scrubbing constitutes lime spray drying, furnace sorbent injection, economizer sorbent injection, duct sorbent injection, HYPAS sorbent injection, and circulating fluidized bed treatment process. The regenerable wet and dry processes include the Wellman Lord's process, citrate process, sodium carbonate eutectic process, magnesium oxide process, amine process, aqueous ammonia process, Berglau Forchung's process, and Shell's process. Besides these, the recently developed technologies such as the COBRA process, the OSCAR process, and the emerging biotechnological and chemobiological processes are also discussed. A detailed outline of the chemistry, the advantages and disadvantages, and the future research and development needs for each of these commercially viable processes is also discussed.
Energy Technology Data Exchange (ETDEWEB)
Liu, Hongtao; Han, Kuihua; Niu, Shengli; Lu, Chunmei; Liu, Mengqi; Li, Hui [Shandong Univ., Jinan (China). School of Energy and Power Engineering
2013-07-01
Red mud is a type of solid waste generated during alumina production from bauxite, and how to dispose and utilize red mud in a large scale is yet a question with no satisfied answer. This paper attempts to use red mud as a kind of additive to modify the limestone. The enhancement of the sulfation reaction of limestone by red mud (two kinds of Bayer process red mud and one kind of sintering process red mud) are studied by a tube furnace reactor. The calcination and sulfation process and kinetics are investigated in a thermogravimetric (TG) analyzer. The results show that red mud can effectively improve the desulfurization performance of limestone in the whole temperature range (1,073-1,373K). Sulfur capacity of limestone (means quality of SO{sub 2} which can be retained by 100mg of limestone) can be increased by 25.73, 7.17 and 15.31% while the utilization of calcium can be increased from 39.68 to 64.13%, 60.61 and 61.16% after modified by three kinds of red mud under calcium/metallic element (metallic element described here means all metallic elements which can play a catalytic effect on the sulfation process, including the Na, K, Fe, Ti) ratio being 15, at the temperature of 1,173K. The structure of limestone modified by red mud is interlaced and tridimensional which is conducive to the sulfation reaction. The phase composition analysis measured by XRD of modified limestone sulfated at high temperature shows that there are correspondingly more sulphates for silicate and aluminate complexes of calcium existing in the products. Temperature, calcium/metallic element ratio and particle diameter are important factors as for the sulfation reaction. The optimum results can be obtained as calcium/metallic element ratio being 15. Calcination characteristic of limestone modified by red mud shows a migration to lower temperature direction. The enhancement of sulfation by doping red mud is more pronounced once the product layer has been formed and consequently the promoting
Energy Technology Data Exchange (ETDEWEB)
Shao Xinchao, E-mail: sxc86@yahoo.cn [Key Laboratory of Petrochemical Catalytic Science and Technology, Liaoning ShiHua University, Fushun 113001 (China); Zhang Xiaotong; Yu Wenguang; Wu Yuye [Key Laboratory of Petrochemical Catalytic Science and Technology, Liaoning ShiHua University, Fushun 113001 (China); Qin Yucai [Key Laboratory of Petrochemical Catalytic Science and Technology, Liaoning ShiHua University, Fushun 113001 (China); College of Chemistry and Chemical Engineering, China University of Petroleum (East China), Qingdao, Shandong 257061 (China); Sun Zhaolin [Key Laboratory of Petrochemical Catalytic Science and Technology, Liaoning ShiHua University, Fushun 113001 (China); School of Chemistry and Chemical Engineering, Lanzhou University, Lanzhou 730000 (China); Song Lijuan, E-mail: lsong56@263.net [Key Laboratory of Petrochemical Catalytic Science and Technology, Liaoning ShiHua University, Fushun 113001 (China) and College of Chemistry and Chemical Engineering, China University of Petroleum (East China), Qingdao, Shandong 257061 (China)
2012-12-15
Highlights: Black-Right-Pointing-Pointer The MoO{sub 3}-MCM-41 samples prepared by spontaneous monolayer dispersion and impregnation with a different MoO{sub 3} filling have been studied. Black-Right-Pointing-Pointer The relative concentration of hydroxyl groups present on before and after containing MoO{sub 3} samples was monitored by in situ FTIR to speculate the bonding style of MoO{sub 3} and MCM-41. Black-Right-Pointing-Pointer The surface acidities of the MoO{sub 3}-MCM-41 adsorbents were investigated systematically and correlated with the desulfurization performance. - Abstract: A series of MCM-41 samples containing molybdenum oxide as active species in the mesoporous channels loaded by spontaneous monolayer dispersion (SMD) and impregnation (IM) have been prepared and characterized using XRD, N{sub 2} adsorption-desorption analysis, Fourier transform infrared spectroscopy (FTIR) and intelligent gravimetric analyzer (IGA). The relative number of hydroxy on the adsorbents was investigated by in situ FTIR. Surface acidities of the adsorbents were studied by infrared spectroscopy of adsorbed pyridine and correlated with reactivity for adsorptive desulfurization. The IGA technique was employed to investigate adsorption behavior of thiophene and benzene on the adsorbents at 303 K. It is shown that MoO{sub 3} can be highly dispersed up to 0.2 g g{sup -1} in the MCM-41 channels by the SMD strategy with the ordered mesoporous structure of the MoMM samples remaining intact. The ordered mesostructure of MCM-41 is, however, destroyed at higher MoO{sub 3} contents of 0.26 and 0.32 g g{sup -1} with particle sizes of 1.2 nm and 3.6 nm, respectively, observed. For the MoMI(0.2) sample prepared by the IM method, the aggregation of the MoO{sub 3} particles takes place with a particle size of 6.5 nm obtained. The results are also revealed that the dispersion extent of the MoO{sub 3} species is related to the abundant surface hydroxy of MCM-41. The host species and guest
The Stability of Lubricant Oil Acidity of Biogas Fuelled Engine due to Biogas Desulfurization
Gde Tirta Nindhia, Tjokorda; Wayan Surata, I.; Wardana, Ari
2017-05-01
This research is established for the purpose of the understanding the stability of the acidity of lubricant oil in biogas fuelled engine due to the absence of hydrogen sulfide (H2S). As was recognized that other than Methane (CH4), there are also other gas impurities in the biogas such as carbon dioxide (CO2), hydrogen sulfide (H2S), moisture (H2O) and ammonia (NH3). Due to H2S contents in the biogas fuel, the engine was found failure. This is caused by corrosion in the combustion chamber due to increase of lubricant acidity. To overcome this problem in practical, the lubricant is increased the pH to basic level with the hope will be decrease to normal value after several time use. Other method is by installing pH measurement sensor in the engine lubricant so that when lubricant is known turn to be acid, then lubricant replacement should be done. In this research, the effect of biogas desulfurization down to zero level to the acidity of lubricant oil in the four stroke engine was carried out with the hope that neutral lubrication oil to be available during running the engine. The result indicates that by eliminating H2S due desulfurization process, effect on stability and neutrality of pH lubricant. By this method the engine safety can be obtained without often replacement the lubricant oil.
Energy Technology Data Exchange (ETDEWEB)
Hepworth, M.T.; Slimane, R.B.
1994-11-01
The focus of much current work being performed by the Morgantown Energy Technology Center (METC) of the Department of Energy on hot coal-derived fuel gas desulfurization is in the use of zinc-based sorbents. METC has shown interest in formulating and testing manganese-based pellets as alternative effective sulfur sorbents in the 700 to 1200{degree}C temperature range. To substantiate the potential superiority of Mn-based pellets, a systematic approach toward the evaluation of the desulfurizing power of single-metal sorbents is developed based on thermodynamic considerations. This novel procedure considered several metal-based sorbents and singled out manganese oxide as a prime candidate sorbent capable of being utilized under a wide temperature range, irrespective of the reducing power (determined by CO{sub 2}/CO ratio) of the fuel gas. Then, the thermodynamic feasibility of using Mn-based pellets for the removal of H{sub 2}S from hot-coal derived fuel gases, and the subsequent oxidative regeneration of loaded (sulfided) pellets was established. It was concluded that MnO is the stable form of manganese for virtually all commercially available coal-derived fuel gases. In addition, the objective of reducing the H{sub 2}S concentration below 150 ppMv to satisfy the integrated gasification combined cycle system requirement was shown to be thermodynamically feasible. A novel process is developed for the manufacture of Mn-based spherical pellets which have the desired physical and chemical characteristics required.
Energy Technology Data Exchange (ETDEWEB)
Zhu, Wenshuai; Xu, Yehai; Li, Huaming; Dai, Bilian; Xu, Hui; Wang, Chao; Chao, Yanhong; Liu, Hui [Jiangsu University, Zhenjiang (China)
2014-02-15
Three types of TiO{sub 2} were synthesized by a hydrolysis and calcination method. The catalysts were characterized by X-ray powder diffraction (XRD), diffuse reflectance spectrum (DRS), Raman spectra, and X-ray photoelectron spectroscopy (XPS). The XRD and Raman spectra indicated that amorphous TiO{sub 2} was successfully obtained at 100 .deg. C. The results indicated that amorphous TiO{sub 2} achieved the highest efficiency of desulfurization. The photocatalytic oxidation of dibenzothiophene (DBT), benzothiophene (BT), 4,6-dimethyldibenzothiophene (4,6-DMDBT) and dodecanethiol (RSH) in model oil was studied at room temperature (30 .deg. C) with three catalysts. The system contained amorphous TiO{sub 2}, H{sub 2}O{sub 2}, and [Bmim]BF{sub 4} ionic liquid, ultraviolet (UV), which played vitally important roles in the photocatalytic oxidative desulfurization. Especially, the molar ratio of H{sub 2}O{sub 2} and sulfur (O/S) was only 2 : 1, which corresponded to the stoichiometric reaction. The sulfur removal of DBT-containing model oil with amorphous TiO{sub 2} could reach 96.6%, which was apparently superior to a system with anatase TiO{sub 2} (23.6%) or with anatase - rutile TiO{sub 2} (18.2%). The system could be recycled seven times without a signicant decrease in photocatalytic activity.
International Nuclear Information System (INIS)
Xiao, Jing; Wu, Luoming; Wu, Ying; Liu, Bing; Dai, Lu; Li, Zhong; Xia, Qibin; Xi, Hongxia
2014-01-01
Highlights: • Concerned with the question why ODS catalyst is not effective for real gasoline. • Reported the strong inhibiting effect of gasoline composition on ODS for the 1st time. • ODS reactivity is suggested to be determined by partial charge on S atom of thiophene. • Proposed approaches to improve ODS selectivity for real gasoline desulfurization. - Abstract: This work is concerned with the question of why oxidative desulfurization (ODS) catalyst that show good catalytic performance for ODS of model gasoline thiophenic compounds is not effective for real gasoline. For the first time, the effects of gasoline composition on ODS using a phosphotungstic acid/activated carbon (HPW/AC) catalyst with H 2 O 2 were investigated. ODS of thiophene, one of the most difficult thiophenic compounds to be oxidized, was studied in a model fuel system, where a high thiophene conversion rate of 90% could be reached in 2 h at 90 °C. However, when applying the ODS to a real gasoline, the ODS conversion rate decreased to only 32%, suggesting a strong inhibiting effect of gasoline composition on ODS. The ODS studies in different model fuels suggested that the inhibiting effect can be ascribed to the competitive adsorption and oxidation with the presence of the alkenes and alkylated aromatic hydrocarbons in real gasoline. The active pi-electrons in alkenes and alkyl groups in alkylated aromatic hydrocarbons may react with polyoxoperoxo species or peroxo-metallate complexes formed by phosphotungstic acid–H 2 O 2 interaction. Additionally, it was indicated that the ODS selectivity followed the order of benzothiophene > trimethylthiophene > dimethylthiophene ∼ methylthiophene > thiophene, suggesting the partial charge on the electron-rich sulfur atom may play a decisive role for its oxidation reactivity. To mitigate the inhibiting effect of gasoline composition on ODS, we propose (a) implementation of selective separation–oxidation processes; (b) choice of suitable
Oxidative desulfurization of diesel with TBHP/isobutyl aldehyde/air oxidation system
Energy Technology Data Exchange (ETDEWEB)
Guo, Wei; Wang, Chengyong; Lin, Peng; Lu, Xiaoping [Institute of Sonochemical Engineering, Nanjing University of Technology, Nanjing 210009, Jiangsu (China)
2011-01-15
Oxidative desulfurization of hydrogenation diesel (40 mL) was studied using air as oxidant, tert-butyl hydroperoxide (TBHP) as radical initiator at ambient pressure and moderate temperature in the presence of isobutyl aldehyde. TBHP could accelerate the production of carbonyl radical and its peroxidation. When the molar fraction of TBHP was 5 mmol, the conversion of DBT could reach 96.1% in the present of 20 mmol isobutyl aldehyde and air, which was more than that of 85.5% without initiator. The air was an effective oxidant and acetonitrile was an optimal solvent in this process. The sulfur content of the hydrogenation diesel could be reduced from 403 to 13 ppm (96.8% removed) under the synergistic effect of air, TBHP and isobutyl aldehyde. (author)
The Flakt-Hydro process: flue gas desulfurization by use of seawater
Energy Technology Data Exchange (ETDEWEB)
Xia, W.Z. [ABB China Limited, Shanghai (China)
1999-07-01
ABB's seawater scrubbing process (the Flakt-Hydro process) for flue gas desulfurization has recently triggered interest among power producers because of its simple operating principle and high reliability. The process uses seawater to absorb and neutralize sulfur dioxide in flue gases. The absorbed gas is oxidized and returned to the ocean in the form it originated in the first place, namely as dissolved sulfate salts. The process uses the seawater downstream of the power plant condensers. This paper gives an introduction to the basic principle of the process and presents some of the recent power plant applications, namely at the Paiton Private Power Project; Phase 1 (2 x 670 MWe) in Indonesia and at the Shenzhen West Power Plant, Unit 2 (300 MWe) in China.
Optimisation of Experimental Conditions for Ex-Bed Desulfurization
Energy Technology Data Exchange (ETDEWEB)
Sanchez, J. M.; Ruiz, E.; Otero, J.
2010-12-22
This report compiles the results of the work conducted by CIEMAT for Task 6.3 Sulfur and Nitrogen Compounds Abatement of the FLEXGAS project Near Zero Emission Advanced Fluidized Bed Gasification, which has been carried out with financial support from the Research Fund for Coal and Steel, RFCR-CT-2007-00005. The assignment of CIEMAT in Task 6.3 has dealt with the experimental study of ex-bed desulfurization at high temperature and high pressure. Based on a review of the state of the art, a zinc oxide sorbent was chosen as a promising candidate for bulk sulfur removal in highly reducing gases such as those from coal and waste oxygen gasification or for a polishing stage in low sulfur content gases, which is typically the case in biomass gasification gases. The work accomplished has included the study of the sulfidation and regeneration stages in order to determine successful operating conditions and the assessment of the long term performance of the sorbent over subsequent sulfidation and regeneration cycles. (Author) 36 refs.
Bhadra, Biswa Nath; Song, Ji Yoon; Khan, Nazmul Abedin; Jhung, Sung Hwa
2017-09-13
A new metal-organic framework (MOF) composite consisting of Ti- and Zn-based MOFs (ZIF-8(x)@H 2 N-MIL-125; in brief, ZIF(x)@MOF) was designed and synthesized. The pristine MOF [H 2 N-MIL-125 (MOF)]- and an MOF-composite [ZIF(30)@MOF]-derived mesoporous carbons consisting of TiO 2 nanoparticles were prepared by pyrolysis (named MDC-P and MDC-C, respectively). MDC-C showed a higher surface area, larger pore sizes, and larger mesopore volumes than MDC-P. In addition, the TiO 2 nanoparticles on MDC-C have more uniform shapes and sizes and are smaller than those of MDC-P. The obtained MDC-C and MDC-P [together with MOF, ZIF(30)@MOF, pure/nanocrystalline TiO 2 , and activated carbon] were applied in the oxidative desulfurization reaction of dibenzothiophene in a model fuel. The MDC-C, even with a lower TiO 2 content than that of MDC-P, showed an outstanding catalytic performance, especially with a very low catalyst dose (i.e., a very high quantity of dibenzothiophene was converted per unit weight of the catalyst), fast kinetics (∼3 times faster than that for MDC-P), and a low activation energy (lower than that for any reported catalyst) for the oxidation of dibenzothiophene. The large mesopores of MDC-C and the well-dispersed/small TiO 2 might be the dominant factors for the superior catalytic conversions. The oxidative desulfurization of other sulfur-containing organic compounds with various electron densities was also studied with MDC-C to understand the mechanism of catalysis. Moreover, the MDC-C catalyst can be reused many times in the oxidative desulfurization reaction after a simple washing with acetone. Finally, composing MOFs and subsequent pyrolysis is suggested as an effective way to prepare a catalyst with well-dispersed active sites, large pores, and high mesoporosity.
International Nuclear Information System (INIS)
Tian, Luning; Chen, Hanping; Yang, Haiping; Wang, Xianhua; Zhang, Shihong
2010-01-01
Full text: The emission of SO 2 , CO 2 brings serious harm to the ecological environment, human health and the global climate change. The largest source of SO 2 , CO 2 is the combustion of fossil fuels for power generation. So developing the new technology for controlling pollutants emissions from coal combustion was imperative. Oxygen-enriched combustion technology is such a new technology which can realize CO 2 zero emission, enhance the combustion efficiency and reduce pollutants emission. Due to the high concentration of CO 2 , it has many different aspects in the SO 2 emission and calcium-based desulfurization compare with the conventional combustion. In this article, experiments have been done to investigate the behavior and mechanism of SO 2 emissions and removal in oxygen-enriched combustion. First, in TGA and fixed bed reactor, the SO 2 emission characteristics were investigated under various bed temperature, particle size and O 2 / CO 2 concentration. It was observed that SO 2 released faster and the emission peak was higher than air atmosphere. SO 2 emission concentration increased with the reaction temperature increasing. Simultaneously, the mechanism of SO 2 emission was obtained by analyzing the sulfur compounds in the gas products and solid products in different reaction times. Then, the impacts of reaction temperature, particle size, O 2 / CO 2 concentration and SO 2 concentration etc. on the efficiency of SO 2 removal were analyzed. The phase analysis, pore diameter distribution and microstructure of the solid product were investigated. The experimental results showed that the sulphur capture takes place by direct sulphation reaction at high CO 2 concentration which attributes to light sinter, better porous structure, higher optimal desulfurization temperature and high desulfurization efficiency of calcium-based sorbent. (author)
Investigation on gasoline deep desulfurization for fuel cell applications
International Nuclear Information System (INIS)
Zhang, J.C.; Song, L.F.; Hu, J.Y.; Ong, S.L.; Ng, W.J.; Lee, L.Y.; Wang, Y.H.; Zhao, J.G.; Ma, R.Y.
2005-01-01
The effect of adding some amounts of cerium into Zn-Fe-O/Al 2 O 3 sorbent on its performance of removal of organic sulfur compounds from gasoline by adsorption was studied in this paper. It showed that the ideal compositions for the preparation of Zn-Fe-Ce-O/Al 2 O 3 consisted of 4.54 wt.% ZnO, 2.25 wt.% Fe 2 O 3 and 2.5 wt.% CeO 2 , respectively, shortened as AZFC 0.52 . Further study indicated that this sorbent could be well regenerated at 250 deg. C with gas mixtures containing 6.0 vol.% steam + air and 2400 ml h -1 ml -1 gas space velocity. At those regenerated conditions and 60 deg. C adsorption temperature, the AZFC 0.52 sorbent had better desulfurization stability, which was confirmed by typical characterization results using BET, XRD and SEM apparatus. This implied that the AZFC 0.52 sorbent could be an ideal sorbent for removal of organic sulfur compounds from gasoline
Speciation of Raney Copper Oxide during High-Temperature Desulfurization
International Nuclear Information System (INIS)
Wang, T. C.; Chen, C. Y.; Huang, H.-L.; Wang, H. Paul; Wei Yuling
2007-01-01
Speciation of copper in the Raney copper oxides (R-CuO) during high-temperature desulfurization has been studied by X-ray absorption spectroscopy. The preedge XANES spectra (8975-8979 eV) of R-CuO exhibit a very weak 1s-to-3d transition forbidden by the selection rule in the case of the perfect octahedral symmetry. A shoulder at 8985-8988 eV and an intense band at 8994-9002 eV can be attributed to the 1s-to-4p transition that indicates the existence of the Cu(II) species. The preedge band at 8981-8984 eV can be attributed to the dipole-allowed 1s-to-4p transition of Cu(I), suggesting an existence of Cu2S during sulfurization. An enhanced absorbance at 9003 eV shows that Cu(0) species may be formed in the sulfurized R-CuO. The main copper species in regenerated R-CuO are CuO (96%) and Cu2S (4%)
Grossman, M. J.; Lee, M. K.; Prince, R. C.; Garrett, K. K.; George, G. N.; Pickering, I. J.
1999-01-01
Rhodococcus sp. strain ECRD-1 was evaluated for its ability to desulfurize a 232 to 343°C middle-distillate (diesel range) fraction of Oregon basin (OB) crude oil. OB oil was provided as the sole source of sulfur in batch cultures, and the extent of desulfurization and the chemical fate of the residual sulfur in the oil after treatment were determined. Gas chromatography (GC), flame ionization detection, and GC sulfur chemiluminesce detection analysis were used to qualitatively evaluate the effect of Rhodococcus sp. strain ECRD-1 treatment on the hydrocarbon and sulfur content of the oil, respectively. Total sulfur was determined by combustion of samples and measurement of released sulfur dioxide by infrared absorption. Up to 30% of the total sulfur in the middle distillate cut was removed, and compounds across the entire boiling range of the oil were affected. Sulfur K-edge X-ray absorption-edge spectroscopy was used to examine the chemical state of the sulfur remaining in the treated OB oil. Approximately equal amounts of thiophenic and sulfidic sulfur compounds were removed by ECRD-1 treatment, and over 50% of the sulfur remaining after treatment was in an oxidized form. The presence of partially oxidized sulfur compounds indicates that these compounds were en route to desulfurization. Overall, more than two-thirds of the sulfur had been removed or oxidized by the microbial treatment. PMID:9872778
International Nuclear Information System (INIS)
Shirokane, Michio; Sawano, Yoriko; Miyazono, Ken-ichi; Nagata, Koji; Tanokura, Masaru
2007-01-01
PH1010, a DUF54-family protein from the hyperthermophilic archaeon P. horikoshii OT3, was crystallized and X-ray diffraction data were collected to 1.90 Å resolution. PH1010 from Pyrococcus horikoshii OT3, a member of the archaeal DUF54 family of proteins, was expressed, purified and crystallized. Crystallization was performed by the sitting-drop vapour-diffusion method using PEG 3350 as the precipitant. The crystal diffracted X-rays to 1.90 Å resolution using a synchrotron-radiation source. The space group of the crystal was determined to be P2 1 2 1 2 1 , with unit-cell parameters a = 46.9, b = 49.5, c = 132.7 Å. The crystal contained two PH1010 molecules in the asymmetric unit (V M = 2.4 Å 3 Da −1 ) and had a solvent content of 48%
Accurate placement of substrate RNA by Gar1 in H/ACA RNA-guided pseudouridylation.
Wang, Peng; Yang, Lijiang; Gao, Yi Qin; Zhao, Xin Sheng
2015-09-03
H/ACA RNA-guided ribonucleoprotein particle (RNP), the most complicated RNA pseudouridylase so far known, uses H/ACA guide RNA for substrate capture and four proteins (Cbf5, Nop10, L7Ae and Gar1) for pseudouridylation. Although it was shown that Gar1 not only facilitates the product release, but also enhances the catalytic activity, the chemical role that Gar1 plays in this complicated machinery is largely unknown. Kinetics measurement on Pyrococcus furiosus RNPs at different temperatures making use of fluorescence anisotropy showed that Gar1 reduces the catalytic barrier through affecting the activation entropy instead of enthalpy. Site-directed mutagenesis combined with molecular dynamics simulations demonstrated that V149 in the thumb loop of Cbf5 is critical in placing the target uridine to the right position toward catalytic D85 of Cbf5. The enzyme elegantly aligns the position of uridine in the catalytic site with the help of Gar1. In addition, conversion of uridine to pseudouridine results in a rigid syn configuration of the target nucleotide in the active site and causes Gar1 to pull out the thumb. Both factors guarantee the efficient release of the product. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.
Han, Yingqian; Guo, Wanying; Su, Bingqian; Guo, Yujie; Wang, Jiang; Chu, Beibei; Yang, Guoyu
2018-02-01
Recombinant proteins are commonly expressed in prokaryotic expression systems for large-scale production. The use of genetically engineered affinity and solubility enhancing fusion proteins has increased greatly in recent years, and there now exists a considerable repertoire of these that can be used to enhance the expression, stability, solubility, folding, and purification of their fusion partner. Here, a modified histidine tag (HE) used as an affinity tag was employed together with a truncated maltotriose-binding protein (MBP; consisting of residues 59-433) from Pyrococcus furiosus as a solubility enhancing tag accompanying a tobacco etch virus protease-recognition site for protein expression and purification in Escherichia coli. Various proteins tagged at the N-terminus with HE-MBP(Pyr) were expressed in E. coli BL21(DE3) cells to determine expression and solubility relative to those tagged with His6-MBP or His6-MBP(Pyr). Furthermore, four HE-MBP(Pyr)-fused proteins were purified by immobilized metal affinity chromatography to assess the affinity of HE with immobilized Ni 2+ . Our results showed that HE-MBP(Pyr) represents an attractive fusion protein allowing high levels of soluble expression and purification of recombinant protein in E. coli. Copyright © 2017 Elsevier Inc. All rights reserved.
Hierarchically Ordered Supramolecular Protein-Polymer Composites with Thermoresponsive Properties
Directory of Open Access Journals (Sweden)
Salla Välimäki
2015-05-01
Full Text Available Synthetic macromolecules that can bind and co-assemble with proteins are important for the future development of biohybrid materials. Active systems are further required to create materials that can respond and change their behavior in response to external stimuli. Here we report that stimuli-responsive linear-branched diblock copolymers consisting of a cationic multivalent dendron with a linear thermoresponsive polymer tail at the focal point, can bind and complex Pyrococcus furiosus ferritin protein cages into crystalline arrays. The multivalent dendron structure utilizes cationic spermine units to bind electrostatically on the surface of the negatively charged ferritin cage and the in situ polymerized poly(di(ethylene glycol methyl ether methacrylate linear block enables control with temperature. Cloud point of the final product was determined with dynamic light scattering (DLS, and it was shown to be approximately 31 °C at a concentration of 150 mg/L. Complexation of the polymer binder and apoferritin was studied with DLS, small-angle X-ray scattering, and transmission electron microscopy, which showed the presence of crystalline arrays of ferritin cages with a face-centered cubic (fcc, \\( Fm\\overline{3}m \\ Bravais lattice where lattice parameter a = 18.6 nm. The complexation process was not temperature dependent but the final complexes had thermoresponsive characteristics with negative thermal expansion.
Role of Mn2+ and Compatible Solutes in the Radiation Resistance of Thermophilic Bacteria and Archaea
Directory of Open Access Journals (Sweden)
Kimberly M. Webb
2012-01-01
Full Text Available Radiation-resistant bacteria have garnered a great deal of attention from scientists seeking to expose the mechanisms underlying their incredible survival abilities. Recent analyses showed that the resistance to ionizing radiation (IR in the archaeon Halobacterium salinarum is dependent upon Mn-antioxidant complexes responsible for the scavenging of reactive oxygen species (ROS generated by radiation. Here we examined the role of the compatible solutes trehalose, mannosylglycerate, and di-myo-inositol phosphate in the radiation resistance of aerobic and anaerobic thermophiles. We found that the IR resistance of the thermophilic bacteria Rubrobacter xylanophilus and Rubrobacter radiotolerans was highly correlated to the accumulation of high intracellular concentration of trehalose in association with Mn, supporting the model of Mn2+-dependent ROS scavenging in the aerobes. In contrast, the hyperthermophilic archaea Thermococcus gammatolerans and Pyrococcus furiosus did not contain significant amounts of intracellular Mn, and we found no significant antioxidant activity from mannosylglycerate and di-myo-inositol phosphate in vitro. We therefore propose that the low levels of IR-generated ROS under anaerobic conditions combined with highly constitutively expressed detoxification systems in these anaerobes are key to their radiation resistance and circumvent the need for the accumulation of Mn-antioxidant complexes in the cell.
Webb, Kimberly M; DiRuggiero, Jocelyne
2012-01-01
Radiation-resistant bacteria have garnered a great deal of attention from scientists seeking to expose the mechanisms underlying their incredible survival abilities. Recent analyses showed that the resistance to ionizing radiation (IR) in the archaeon Halobacterium salinarum is dependent upon Mn-antioxidant complexes responsible for the scavenging of reactive oxygen species (ROS) generated by radiation. Here we examined the role of the compatible solutes trehalose, mannosylglycerate, and di-myo-inositol phosphate in the radiation resistance of aerobic and anaerobic thermophiles. We found that the IR resistance of the thermophilic bacteria Rubrobacter xylanophilus and Rubrobacter radiotolerans was highly correlated to the accumulation of high intracellular concentration of trehalose in association with Mn, supporting the model of Mn(2+)-dependent ROS scavenging in the aerobes. In contrast, the hyperthermophilic archaea Thermococcus gammatolerans and Pyrococcus furiosus did not contain significant amounts of intracellular Mn, and we found no significant antioxidant activity from mannosylglycerate and di-myo-inositol phosphate in vitro. We therefore propose that the low levels of IR-generated ROS under anaerobic conditions combined with highly constitutively expressed detoxification systems in these anaerobes are key to their radiation resistance and circumvent the need for the accumulation of Mn-antioxidant complexes in the cell.
Comparative Genomic and Transcriptional Analyses of CRISPR Systems Across the Genus Pyrobaculum
Directory of Open Access Journals (Sweden)
David L Bernick
2012-07-01
Full Text Available Within the domain Archaea, the CRISPR immune system appears to be nearly ubiquitous based on computational genome analyses. Initial studies in bacteria demonstrated that the CRISPR system targets invading plasmid and viral DNA. Recent experiments in the model archaeon Pyrococcus furiosus uncovered a novel RNA-targeting variant of the CRISPR system potentially unique to archaea. Because our understanding of CRISPR system evolution in other archaea is limited, we have taken a comparative genomic and transcriptomic view of the CRISPR arrays across six diverse species within the crenarchaeal genus Pyrobaculum. We present transcriptional data from each of four species in the genus (P. aerophilum, P. islandicum, P. calidifontis, P. arsenaticum, analyzing mature CRISPR-associated small RNA abundance from over 20 arrays. Within the genus, there is remarkable conservation of CRISPR array structure, as well as unique features that are have not been studied in other archaeal systems. These unique features include: a nearly invariant CRISPR promoter, conservation of direct repeat families, the 5' polarity of CRISPR-associated small RNA abundance, and a novel CRISPR-specific association with homologues of nurA and herA. These analyses provide a genus-level evolutionary perspective on archaeal CRISPR systems, broadening our understanding beyond existing non-comparative model systems.
Du, Shuting; Chen, Xiaoxin; Sun, Qiming; Wang, Ning; Jia, Mingjun; Valtchev, Valentin; Yu, Jihong
2016-02-28
Hierarchical TS-1 zeolites with secondary macropores have been successfully prepared by using two different fluoride-containing chemical etching post-treated routes. Hierarchical TS-1 zeolites exhibited a chemical composition similar to that of the parent material and showed remarkably enhanced catalytic activity in oxidative desulfurization reaction.
Energy Technology Data Exchange (ETDEWEB)
Lokanath, Neratur K.; Pampa, Kudigana J.; Kamiya, Toshimi; Kunishima, Naoki, E-mail: kunisima@spring8.or.jp [Advanced Protein Crystallography Research Group, RIKEN SPring-8 Center, Harima Institute, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan)
2007-05-01
A putative UDP-N-acetyl-d-mannosamine dehydrogenase from P. horikoshii OT3 has been crystallized in space group P2{sub 1}, with unit-cell parameters a = 80.28, b = 69.24, c = 83.10 Å, β = 114.4°. X-ray diffraction data have been collected to 1.80 Å resolution. A putative UDP-N-acetyl-d-mannosamine dehydrogenase from Pyrococcus horikoshii OT3, an essential enzyme for polysaccharide biosynthesis, has been overexpressed in Escherichia coli and purified. Crystals were obtained using the oil-microbatch method at 291 K. A native data set extending to 1.8 Å resolution has been collected and processed in space group P2{sub 1}. Assuming the presence of a dimer in the asymmetric unit, the V{sub M} value is calculated to be 2.3 Å{sup 3} Da{sup −1}, which is consistent with the result of a dynamic light-scattering experiment that shows a dimeric state of the protein in solution.
International Nuclear Information System (INIS)
Fukunaga, Ryuya; Ishitani, Ryuichiro; Nureki, Osamu; Yokoyama, Shigeyuki
2004-01-01
The leucyl-tRNA synthetase (LeuRS) from P. horikoshii has been overexpressed in Escherichia coli and purified, and cocrystallizations with each of the tRNA Leu isoacceptors have been attempted. Cocrystals were obtained by the hanging-drop vapour-diffusion method, but only when the tRNA Leu isoacceptor with the anticodon CAA was used. All five tRNA Leu isoacceptors from the archaeon Pyrococcus horikoshii have been transcribed in vitro and purified. The leucyl-tRNA synthetase (LeuRS) from P. horikoshii was overexpressed in Escherichia coli and purified, and cocrystallizations with each of the tRNA Leu isoacceptors were attempted. Cocrystals were obtained by the hanging-drop vapour-diffusion method, but only when the tRNA Leu isoacceptor with the anticodon CAA was used. Electrophoretic analyses revealed that the crystals contain both LeuRS and tRNA Leu , suggesting that they are LeuRS–tRNA Leu complex crystals. A data set diffracting to 3.3 Å resolution was collected from a single crystal at 100 K. The crystal belongs to the orthorhombic space group P2 1 2 1 2, with unit-cell parameters a = 118.18, b = 120.55, c = 231.13 Å. The asymmetric unit is expected to contain two complexes of LeuRS–tRNA Leu , with a corresponding crystal volume per protein weight of 2.9 Å 3 Da −1 and a solvent content of 57.3%
High-Temperature Desulfurization of Heavy Fuel-Derived Reformate Gas Streams for SOFC Applications
Flytzani-Stephanopoulos, Maria; Surgenor, Angela D.
2007-01-01
Desulfurization of the hot reformate gas produced by catalytic partial oxidation or autothermal reforming of heavy fuels, such as JP-8 and jet fuels, is required prior to using the gas in a solid oxide fuel cell (SOFC). Development of suitable sorbent materials involves the identification of sorbents with favorable sulfidation equilibria, good kinetics, and high structural stability and regenerability at the SOFC operating temperatures (650 to 800 C). Over the last two decades, a major barrier to the development of regenerable desulfurization sorbents has been the gradual loss of sorbent performance in cyclic sulfidation and regeneration at such high temperatures. Mixed oxide compositions based on ceria were examined in this work as regenerable sorbents in simulated reformate gas mixtures and temperatures greater than 650 C. Regeneration was carried out with dilute oxygen streams. We have shown that under oxidative regeneration conditions, high regeneration space velocities (greater than 80,000 h(sup -1)) can be used to suppress sulfate formation and shorten the total time required for sorbent regeneration. A major finding of this work is that the surface of ceria and lanthanan sorbents can be sulfided and regenerated completely, independent of the underlying bulk sorbent. This is due to reversible adsorption of H2S on the surface of these sorbents even at temperatures as high as 800 C. La-rich cerium oxide formulations are excellent for application to regenerative H2S removal from reformate gas streams at 650 to 800 C. These results create new opportunities for compact sorber/regenerator reactor designs to meet the requirements of solid oxide fuel cell systems at any scale.
Directory of Open Access Journals (Sweden)
Chang Chin Li, Lee Keat Teong, Subhash Bhatia and Abdul Rahman Mohamed
2012-08-01
Full Text Available An active absorbent for flue gas desulfurization was prepared from coal bottom ash, calcium oxide (CaO and calcium sulfate by hydro-thermal process. The absorbent was examined for its micro-structural properties. The experiments conducted were based on Design Of Experiments (DOE according to 23 factorial design. The effect of various absorbent preparation variables such as ratio of CaO to bottom ash (A, hydration temperature (B and hydration period (C towards the BET (Brunauer-Emmett-Teller specific surface area of the absorbent were studied. At a CaO to bottom ash ratio = 2, hydration temperature = 200 ?C and hydration period = 10 hrs, absorbent with a surface area of 90.1 m2/g was obtained. Based on the analysis of the factorial design, it was concluded that factor A and C as well as the interaction of factors ABC and BC are the significant factors that effect the BET surface area of the absorbent. A linear mathematical model that describes the relation between the independent variables and interaction between variables towards the BET specific surface area of the absorbent was also developed. Analysis of variance (ANOVA showed that the model was significant at 1% level.Key Words: Absorbent, Bottom Ash, Design Of Experiments, Desulfurization, Surface Area.
Xu, Junhua; Zhao, Shen; Chen, Wei; Wang, Miao; Song, Yu-Fei
2012-04-10
Highly efficient, deep desulfurization of model oil containing dibenzothiophene (DBT), benzothiophene (BT), or 4,6-dimethyldibenzothiophene (4,6-DMDBT) has been achieved under mild conditions by using an extraction and catalytic oxidative desulfurization system (ECODS) in which a lanthanide-containing polyoxometalate Na(7)H(2)LnW(10)O(36)⋅32 H(2)O (LnW(10); Ln = Eu, La) acts as catalyst, [bmim]BF(4) (bmim = 1-butyl-3-methylimidazolium) as extractant, and H(2)O(2) as oxidant. Sulfur removal follows the order DBT>4,6-DMDBT>BT at 30 °C. DBT can be completely oxidized to the corresponding sulfone in 25 min under mild conditions, and the LaW(10)/[bmim]BF(4) system could be recycled for ten times with only slight decrease in activity. Thus, LaW(10) in [bmim]BF(4) is one of the most efficient systems for desulfurization using ionic liquids as extractant reported so far. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Integrated Mg/TiO2-ionic liquid system for deep desulfurization
Yin, Yee Cia; Kait, Chong Fai; Fatimah, Hayyiratul; Wilfred, Cecilia
2014-10-01
A series of Mg/TiO2 photocatalysts were prepared using wet impregnation method followed by calcination at 300, 400 and 500°C for 1 h. The photocatalysts were characterized using Thermal Gravimetric Analysis, Fourier-Transform Infrared Spectroscopy, X-Ray Diffraction, and Field Emission Scanning Electron Microscopy. The performance for deep desulfurization was investigated using model oil with 100 ppm sulfur (in the form of dibenzothiophene). The integrated system involves photocatalytic oxidation followed by ionic liquid-extraction processes. The best performing photocatalyst was 0.25wt% Mg loaded on titania calcined at 400°C (0.25Mg400), giving 98.5% conversion of dibenzothiophene to dibenzothiophene sulfone. The highest extraction efficiency of 97.8% was displayed by 1,2-diethylimidazolium diethylphosphate. The overall total sulfur removal was 96.3%.
Integrated Mg/TiO2-ionic liquid system for deep desulfurization
International Nuclear Information System (INIS)
Yin, Yee Cia; Kait, Chong Fai; Fatimah, Hayyiratul; Wilfred, Cecilia
2014-01-01
A series of Mg/TiO 2 photocatalysts were prepared using wet impregnation method followed by calcination at 300, 400 and 500°C for 1 h. The photocatalysts were characterized using Thermal Gravimetric Analysis, Fourier-Transform Infrared Spectroscopy, X-Ray Diffraction, and Field Emission Scanning Electron Microscopy. The performance for deep desulfurization was investigated using model oil with 100 ppm sulfur (in the form of dibenzothiophene). The integrated system involves photocatalytic oxidation followed by ionic liquid-extraction processes. The best performing photocatalyst was 0.25wt% Mg loaded on titania calcined at 400°C (0.25Mg400), giving 98.5% conversion of dibenzothiophene to dibenzothiophene sulfone. The highest extraction efficiency of 97.8% was displayed by 1,2-diethylimidazolium diethylphosphate. The overall total sulfur removal was 96.3%
PET-modified red mud as catalysts for oxidative desulfurization reactions.
do Prado, Nayara T; Heitmann, Ana P; Mansur, Herman S; Mansur, Alexandra A; Oliveira, Luiz C A; de Castro, Cinthia S
2017-07-01
This work describes the synthesis of catalysts based on red mud/polyethylene terephthalate (PET) composites and their subsequent heat treatment under N 2 atmosphere. The materials were characterized by scanning electron microscopy (SEM), temperature programmed reduction (TPR), Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD), thermogravimetric (TG) analysis and N 2 adsorption/desorption. The catalysts were evaluated in the oxidative desulfurization reaction of dibenzothiophene (DBT) in a biphasic system. The results indicated that the PET impregnation on red mud increased the affinity of the catalyst with the nonpolar phase (fuel), in which the contaminant was dissolved, allowing a higher conversion (up to 80%) and selectivity to the corresponding dibenzothiophene sulfone. The sulfone compound is more polar than DBT and diffused into the polar solvent as indicated by the data obtained via gas chromatography-mass spectrometry (GC-MS). Copyright © 2017. Published by Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Shirokane, Michio; Sawano, Yoriko; Miyazono, Ken-ichi; Nagata, Koji; Tanokura, Masaru, E-mail: amtanok@mail.ecc.u-tokyo.ac.jp [Department of Applied Biological Chemistry, Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657 (Japan)
2007-06-01
PH1010, a DUF54-family protein from the hyperthermophilic archaeon P. horikoshii OT3, was crystallized and X-ray diffraction data were collected to 1.90 Å resolution. PH1010 from Pyrococcus horikoshii OT3, a member of the archaeal DUF54 family of proteins, was expressed, purified and crystallized. Crystallization was performed by the sitting-drop vapour-diffusion method using PEG 3350 as the precipitant. The crystal diffracted X-rays to 1.90 Å resolution using a synchrotron-radiation source. The space group of the crystal was determined to be P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 46.9, b = 49.5, c = 132.7 Å. The crystal contained two PH1010 molecules in the asymmetric unit (V{sub M} = 2.4 Å{sup 3} Da{sup −1}) and had a solvent content of 48%.
Application of Two Cobalt-Based Metal-Organic Frameworks as Oxidative Desulfurization Catalysts.
Masoomi, Mohammad Yaser; Bagheri, Minoo; Morsali, Ali
2015-12-07
Two new porous cobalt-based metal-organic frameworks, [Co6(oba)5(OH)2(H2O)2(DMF)4]n · 5DMF (TMU-10) and [Co3(oba)3(O) (Py)0.5] n · 4DMF · Py (TMU-12) have been synthesized by solvothermal method using a nonlinear dicarboxylate ligand. Under mild reaction conditions, these compounds exhibited good catalytic activity and reusability in oxidative desulfurization (ODS) reaction of model oil which was prepared by dissolving dibenzothiophene (DBT) in n-hexane. FT-IR and Mass analysis showed that the main product of DBT oxidation is its corresponding sulfone, which was adsorbed on the surfaces of catalysts. The activation energy was obtained as 13.4 kJ/mol.
Pentelute, Brad L; Kent, Stephen B H
2007-02-15
Increased versatility for the synthesis of proteins and peptides by native chemical ligation requires the ability to ligate at positions other than Cys. Here, we report that Raney nickel can be used under standard conditions for the selective desulfurization of Cys in the presence of Cys(Acm). This simple and practical tactic enables the more common Xaa-Ala junctions to be used as ligation sites for the chemical synthesis of Cys-containing peptides and proteins. [reaction: see text].
Nishino, Kota; Minato, Kohei; Miyazaki, Takahiro; Ogiwara, Yohei; Sakai, Norio
2017-04-07
In this study an InI 3 -TMDS (1,1,3,3-tetramethyldisiloxane) reducing system effectively catalyzed the reductive dithioacetalization of a variety of aromatic and aliphatic carboxylic acids with 1,2-ethanedithiol or 1,3-propanedithiol leading to the one-pot preparation of either 1,3-dithiolane derivatives or a 1,3-dithiane derivative. Also, the intact indium catalyst continuously catalyzed the subsequent oxidative desulfurization of an in situ formed 1,3-dithiolane derivative, which led to the preparation of the corresponding aldehydes.
Energy Technology Data Exchange (ETDEWEB)
Yang, Seung-Tae [Department of Chemical Engineering, Inha University, Incheon 402-751 (Korea, Republic of); Jeong, Kwang-Eun; Jeong, Soon-Yong [Research Center for Green Catalysis, Division of Green Chemistry and Engineering Research, Korea Research Institute of Chemical Technology, P.O. Box 107, 141 Gajeong-ro, Yuseong, Daejeon 305-600 (Korea, Republic of); Ahn, Wha-Seung, E-mail: whasahn@inha.ac.kr [Department of Chemical Engineering, Inha University, Incheon 402-751 (Korea, Republic of)
2012-12-15
Graphical abstract: Display Omitted Highlights: ► Meso-TS-1 catalyst was synthesized using a SiO{sub 2}–TiO{sub 2} xerogel with an organosilane precursor. ► Hierarchical pore structure was confirmed by characterization of the materials. ► Catalytic activity was tested using oxidative desulfurization of the model sulfur compounds. ► Meso-TS-1 demonstrated significantly improved catalytic activity than TS-1. -- Abstract: Mesoporous TS-1 (M-TS-1) was synthesized using a hybrid SiO{sub 2}–TiO{sub 2} xerogel combined with an organosilane precursor. Prepared samples were characterized by XRD, UV–vis spectroscopy, SEM, and N{sub 2} adsorption–desorption measurement. M-TS-1, prepared in 2 days, showed high crystallinity and the best textural properties among the samples. The N{sub 2} adsorption–desorption isotherms of M-TS-1 exhibited a hysteresis loop at pressure higher than P/P{sub 0} = 0.4, clearly indicating the existence of mesopores. M-TS-1 has significantly larger mesopore volume (0.48 cm{sup 3}/g) than that of conventional TS-1 (0.07 cm{sup 3}/g), and showed a narrow peak centered at ca. 6.3 nm. In the oxidative desulfurization reaction, M-TS-1 was more active than conventional TS-1 at the same Ti-loading; M-TS-1 produced a dibenzothiophene (DBT) conversion of 96%, whereas conventional TS-1 produced a final DBT conversion of 5.6% after a reaction time of 180 min. Oxidative desulfurization over TS-1 was influenced both by electron density and steric hindrance in the sulfur compounds tested.
Energy Technology Data Exchange (ETDEWEB)
Xiao, Jing; Wang, Xiaoxing; Chen, Yongsheng; Fujii, Mamoru; Song, Chunshan [SCUT-China; (Penn)
2014-02-13
This study investigates ultra-deep adsorptive desulfurization (ADS) from light-irradiated diesel fuel over supported TiO2–CeO2 adsorbents. A 30-fold higher desulfurization capacity of 95 mL of fuel per gram of adsorbent (mL-F/g-sorb) or 1.143 mg of sulfur per gram of adsorbent (mg-S/g-sorb) was achieved from light-irradiated fuel over the original low-sulfur fuel containing about 15 ppm by weight (ppmw) of sulfur. The sulfur species on spent TiO2–CeO2/MCM-48 adsorbent was identified by sulfur K-edge XANES as sulfones and the adsorption selectivity to different compounds tested in a model fuel decreases in the order of indole > dibenzothiophenesulfone → dibenzothiophene > 4-methyldibenzothiophene > benzothiophene > 4,6-dimethyldibenzothiophene > phenanthrene > 2-methylnaphthalene ~ fluorene > naphthalene. The results suggest that during ADS of light-irradiated fuel, the original sulfur species were chemically transformed to sulfones, resulting in the significant increase in desulfurization capacity. For different supports for TiO2–CeO2 oxides, the ADS capacity increases with a decrease in the point of zero charge (PZC) value; for silica-supported TiO2–CeO2 oxides (the lowest PZC value of 2–4) with different surface areas, the ADS capacity increases monotonically with increasing surface area. The supported TiO2–CeO2/MCM-48 adsorbent can be regenerated using oxidative air treatment. The present study provides an attractive new path to achieve ultraclean fuel more effectively.
Calcio Gaudino, Emanuela; Carnaroglio, Diego; Boffa, Luisa; Cravotto, Giancarlo; Moreira, Elizabeth M; Nunes, Matheus A G; Dressler, Valderi L; Flores, Erico M M
2014-01-01
The oxidative desulfurization/denitrification of liquid fuels has been widely investigated as an alternative or complement to common catalytic hydrorefining. In this process, all oxidation reactions occur in the heterogeneous phase (the oil and the polar phase containing the oxidant) and therefore the optimization of mass and heat transfer is of crucial importance to enhancing the oxidation rate. This goal can be achieved by performing the reaction in suitable ultrasound (US) reactors. In fact, flow and loop US reactors stand out above classic batch US reactors thanks to their greater efficiency and flexibility as well as lower energy consumption. This paper describes an efficient sonochemical oxidation with H2O2/CH3COOH at flow rates ranging from 60 to 800 ml/min of both a model compound, dibenzotiophene (DBT), and of a mild hydro-treated diesel feedstock. Four different commercially available US loop reactors (single and multi-probe) were tested, two of which were developed in the authors' laboratory. Full DBT oxidation and efficient diesel feedstock desulfurization/denitrification were observed after the separation of the polar oxidized S/N-containing compounds (S≤5 ppmw, N≤1 ppmw). Our studies confirm that high-throughput US applications benefit greatly from flow-reactors. Copyright © 2013 Elsevier B.V. All rights reserved.
Producing ammonium sulfate from flue gas desulfurization by-products
Chou, I.-Ming; Bruinius, J.A.; Benig, V.; Chou, S.-F.J.; Carty, R.H.
2005-01-01
Emission control technologies using flue gas desulfurization (FGD) have been widely adopted by utilities burning high-sulfur fuels. However, these technologies require additional equipment, greater operating expenses, and increased costs for landfill disposal of the solid by-products produced. The financial burdens would be reduced if successful high-volume commercial applications of the FGD solid by-products were developed. In this study, the technical feasibility of producing ammonium sulfate from FGD residues by allowing it to react with ammonium carbonate in an aqueous solution was preliminarily assessed. Reaction temperatures of 60, 70, and 80??C and residence times of 4 and 6 hours were tested to determine the optimal conversion condition and final product evaluations. High yields (up to 83%) of ammonium sulfate with up to 99% purity were achieved under relatively mild conditions. The optimal conversion condition was observed at 60??C and a 4-hour residence time. The results of this study indicate the technical feasibility of producing ammonium sulfate fertilizer from an FGD by-product. Copyright ?? Taylor & Francis Inc.
Characterization of the archaeal ribonuclease P proteins from Pyrococcus horikoshii OT3.
Terada, Atsushi; Honda, Takashi; Fukuhara, Hideo; Hada, Kazumasa; Kimura, Makoto
2006-08-01
Ribonuclease P (RNase P) is a ribonucleoprotein complex involved in the processing of the 5'-leader sequence of precursor tRNA (pre-tRNA). Our earlier study revealed that RNase P RNA (pRNA) and five proteins (PhoPop5, PhoRpp38, PhoRpp21, PhoRpp29, and PhoRpp30) in the hyperthermophilic archaeon Pyrococcus horikoshii OT3 reconstituted RNase P activity that exhibits enzymatic properties like those of the authentic enzyme. In present study, we investigated involvement of the individual proteins in RNase P activity. Two particles (R-3Ps), in which pRNA was mixed with three proteins, PhoPop5, PhoRpp30, and PhoRpp38 or PhoPop5, PhoRpp30, and PhoRpp21 showed a detectable RNase P activity, and five reconstituted particles (R-4Ps) composed of pRNA and four proteins exhibited RNase P activity, albeit at reduced level compared to that of the reconstituted particle (R-5P) composed of pRNA and five proteins. Time-course analysis of the RNase P activities of R-4Ps indicated that the R-4Ps lacking PhoPop5, PhoRpp21, or PhoRpp30 had virtually reduced activity, while omission of PhoRpp29 or PhoRpp38 had a slight effect on the activity. The results indicate that the proteins contribute to RNase P activity in order of PhoPop5 > PhoRpp30 > PhoRpp21 > PhoRpp29 > PhoRpp38. It was further found that R-4Ps showed a characteristic Mg2+ ion dependency approximately identical to that of R-5P. However, R-4Ps had optimum temperature of around at 55 degrees C which is lower than 70 degrees C for R-5P. Together, it is suggested that the P. horikoshii RNase P proteins are predominantly involved in optimization of the pRNA conformation, though they are individually dispensable for RNase P activity in vitro.
Simultaneous desulfurization and denitrification of flue gas by electron beam
International Nuclear Information System (INIS)
Baumann, W.; Jordan, S.; Maetzing, H.; Paur, H.R.; Schikarski, W.; Wiens, H.
1987-05-01
The simultaneous desulfurization and denitrification by the irradiation with 300 keV electrons in the presence of stoichiometric amounts of ammonia yields removal efficiencies of more than 90%. NO X -removal efficiencies depend on the absorbed dose, NO X -concentration and NH 3 -stoichiometry. SO 2 -removal proceeds by thermal and radiation induced mechanisms. The efficiency of the SO 2 -removal process is highest for low temperatures and high NH 3 -stoichiometries. By recycling of scrubbed gas into the reaction chamber (multiple irradiation) the efficiency of the process is increased by 50%. The product aerosol has mass median diameters of 2 and NO x removals in the absence of NH 3 are predicted with reasonable accuracy by the computer model. In the presence of NH 3 experimental data show higher SO 2 removal efficiencies than calculated. This is probably due to additional heterogeneous reactions on particles, which are not covered by the computer model. With 119 figs., 86 refs [de
Mohanty, C R; Adapala, Sivaji; Meikap, B C
2009-06-15
Sulfur dioxide and other sulfur compounds are generated as primary pollutants from the major industries such as sulfuric acid plants, cupper smelters, catalytic cracking units, etc. and cause acid rain. To remove the SO(2) from waste flue gas a three-stage counter-current multi-stage fluidized bed adsorber was developed as desulfurization equipment and operated in continuous bubbling fluidization regime for the two-phase system. This paper represents the desulfurization of gas mixtures by chemical sorption of sulfur dioxide on porous granular calcium oxide particles in the reactor at ambient temperature. The advantages of the multi-stage fluidized bed reactor are of high mass transfer and high gas-solid residence time that can enhance the removal of acid gas at low temperature by dry method. Experiments were carried out in the bubbling fluidization regime supported by visual observation. The effects of the operating parameters such as sorbent (lime) flow rate, superficial gas velocity, and the weir height on SO(2) removal efficiency in the multistage fluidized bed are reported. The results have indicated that the removal efficiency of the sulfur dioxide was found to be 65% at high solid flow rate (2.0 kg/h) corresponding to lower gas velocity (0.265 m/s), wier height of 70 mm and SO(2) concentration of 500 ppm at room temperature.
Attapulgite-CeO{sub 2}/MoS{sub 2} ternary nanocomposite for photocatalytic oxidative desulfurization
Energy Technology Data Exchange (ETDEWEB)
Li, Xiazhang, E-mail: lixiazhang509@163.com [Jiangsu Key Laboratory of Advanced Catalytic Materials and Technology, School of Petrochemical Engineering, Changzhou University, Changzhou 213164 (China); Jiangsu Key Laboratory for Environment Functional Materials, Suzhou University of Science and Technology, Suzhou 215009 (China); W.M.Keck Center for Advanced Microscopy and Microanalysis, University of Delaware, Newark, DE 19716 (United States); Zhang, Zuosong [School of Materials Science and Engineering, Changzhou University, Changzhou 213164 (China); Yao, Chao [Jiangsu Key Laboratory of Advanced Catalytic Materials and Technology, School of Petrochemical Engineering, Changzhou University, Changzhou 213164 (China); Lu, Xiaowang [School of Materials Science and Engineering, Changzhou University, Changzhou 213164 (China); Zhao, Xiaobing [School of Materials Science and Engineering, Changzhou University, Changzhou 213164 (China); Jiangsu Key Laboratory for Environment Functional Materials, Suzhou University of Science and Technology, Suzhou 215009 (China); Ni, Chaoying [W.M.Keck Center for Advanced Microscopy and Microanalysis, University of Delaware, Newark, DE 19716 (United States)
2016-02-28
Graphical abstract: - Highlights: • Novel attapulgite(ATP)-CeO{sub 2}/MoS{sub 2} ternary nanocomposites were fabricated. • ATP possessed outstanding adsorption property and enhanced the stability of the network structure. • CeO{sub 2}/MoS{sub 2} couples facilitated the separation of photo-induced electrons and holes. • Mass ratio of CeO{sub 2}/MoS{sub 2} influenced the photocatalytic oxidation desulfurization. - Abstract: Novel attapulgite(ATP)-CeO{sub 2}/MoS{sub 2} ternary nanocomposites were synthesized by microwave assisted assembly method. The structures of the nanocomposites were characterized by XRD, FT-IR, UV–vis, XPS and in situ TEM. The photocatalytic activities of ATP-CeO{sub 2}/MoS{sub 2} composites were investigated by degradating dibenzothiophene (DBT) in gasoline under visible light irradiation. The effect of the mass ratio of CeO{sub 2} to MoS{sub 2} on photocatalytic activity was investigated. The results indicate that the three-dimensional network structure is firmly constructed by ATP skeleton, CeO{sub 2} particles and MoS{sub 2} nanosheet which effectively increase the surface area of the composites and promote the separation of electrons and holes by resulting electronic transmission channels of multi-channel in space. The degradation rate of DBT can reach 95% under 3 h irradiation when the mass ratio of CeO{sub 2}/MoS{sub 2} is 4/10. A plausible mechanism for the photocatalytic oxidative desulfurization of this nanocomposite is put forward.
Energy Technology Data Exchange (ETDEWEB)
Lokanath, Neratur K.; Kunishima, Naoki, E-mail: kunisima@spring8.or.jp [Advanced Protein Crystallography Research Group, RIKEN SPring-8 Center, Harima Institute, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan)
2006-08-01
The archaeal phosphoglycerate mutase PH0037 from P. horikoshii OT3 has been crystallized in space group R32, with unit-cell parameters a = 155.62, c = 230.35 Å. A 2.2 Å resolution data was collected at SPring-8 beamline BL26B1. Phosphoglycerate mutases catalyze the interconversion of 2-phosphoglycerate and 3-phosphoglycerate in glycolysis and gluconeogenesis pathways. The archaeal phosphoglycerate mutase PH0037 from Pyrococcus horikoshii OT3 has been overexpressed in Escherichia coli and purified. Crystals were obtained using the oil-microbatch method at 291 K. A native data set extending to a resolution of 2.2 Å has been collected and processed in space group R32. Assuming the presence of a dimer in the asymmetric unit, the V{sub M} value is calculated to be 3.0 Å{sup 3} Da{sup −1}, consistent with the dynamic light-scattering experiment result, which shows a dimeric state of the protein in solution. Molecular-replacement trials using the crystal structure of Bacilllus stearothermophilus phosphoglycerate mutase as a search model did not provide a satisfactory solution, indicating substantially different structures of these two phophoglycerate mutases.
Design and simulation of a 1.2 MeV electron accelerator used for desulfuration and denitrogenation
International Nuclear Information System (INIS)
Zhou Jun; Zhu Dajun; Liu Shenggang
2005-01-01
This paper presents the structural design and functional analysis of a new kind of 1.2 MeV industrial electron accelerator. PIC (Particle-In-Cell) method is used to simulate this accelerator and to optimize the design, the results show that the optics property of this accelerator has been improved. This electron accelerator is used for desulfuration and denitrogenation in environmental industry. This application purifies flue gases of the thermal power station from Sulphurous oxide and Nitrogen oxide in order to reduce the pollution in the air. (author)
Deep desulfurization of middle distillates. Process adaptation to oil fractions' compositions
Energy Technology Data Exchange (ETDEWEB)
Pedernera, Esteban; Reimert, Rainer; Nguyen, Ngoc Luan; Van Buren, Vincent [Division of Fuel Technology, Universitat Karlsruhe TH, Engler-Bunte-Ring 1, 76131 Karlsruhe (Germany)
2003-04-30
The influence of oil fractions' compositions on the conversion of sulfurous components was investigated in a trickle-bed reactor in laboratory scale. A commercially available NiMo/{gamma}-Al{sub 2}O{sub 3} catalyst was used throughout the investigations. Experimental results including sulfur conversion of different oil fractions and residence time distributions under reacting conditions are presented. The hydrogen consumption is ascribed to the conversion of sulfur and of nitrogen, to the hydrogenation of aromatics and to hydrocracking based on a simulation applying ASPEN Plus. Various configurations of the desulfurization process are evaluated but no advantage is found by separate treatment of individual oil fractions. In addition, experiments were carried out to determine liquid distribution and wetting efficiency in a catalyst bed by using magnetic resonance imaging (MRI) technique.
Integrated Mg/TiO{sub 2}-ionic liquid system for deep desulfurization
Energy Technology Data Exchange (ETDEWEB)
Yin, Yee Cia, E-mail: gabrielle.ciayin@gmail.com [Department of Chemical Engineering, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia); Kait, Chong Fai, E-mail: chongfaikait@petronas.com.my, E-mail: hayyiratulfatimah@yahoo.com, E-mail: cecili@petronas.com.my; Fatimah, Hayyiratul, E-mail: chongfaikait@petronas.com.my, E-mail: hayyiratulfatimah@yahoo.com, E-mail: cecili@petronas.com.my; Wilfred, Cecilia, E-mail: chongfaikait@petronas.com.my, E-mail: hayyiratulfatimah@yahoo.com, E-mail: cecili@petronas.com.my [Department of Fundamental and Applied Sciences, Universiti Teknologi PETRONAS, 31750 Tronoh, Perak (Malaysia)
2014-10-24
A series of Mg/TiO{sub 2} photocatalysts were prepared using wet impregnation method followed by calcination at 300, 400 and 500°C for 1 h. The photocatalysts were characterized using Thermal Gravimetric Analysis, Fourier-Transform Infrared Spectroscopy, X-Ray Diffraction, and Field Emission Scanning Electron Microscopy. The performance for deep desulfurization was investigated using model oil with 100 ppm sulfur (in the form of dibenzothiophene). The integrated system involves photocatalytic oxidation followed by ionic liquid-extraction processes. The best performing photocatalyst was 0.25wt% Mg loaded on titania calcined at 400°C (0.25Mg400), giving 98.5% conversion of dibenzothiophene to dibenzothiophene sulfone. The highest extraction efficiency of 97.8% was displayed by 1,2-diethylimidazolium diethylphosphate. The overall total sulfur removal was 96.3%.
Shibahara, Fumitoshi; Suenami, Aiko; Yoshida, Atsunori; Murai, Toshiaki
2007-06-21
A novel copper-catalyzed oxidative desulfurization reaction of thiocarbonyl compounds, using molecular oxygen as an oxidant and leading to formation of carbonyl compounds, has been developed, and the utility of the process is demonstrated by its application to the preparation of a carbonyl-18O labeled sialic acid derivative.
Eng, Heather; Sharma, Raman; Wolford, Angela; Di, Li; Ruggeri, Roger B; Buckbinder, Leonard; Conn, Edward L; Dalvie, Deepak K; Kalgutkar, Amit S
2016-08-01
N1-Substituted-6-arylthiouracils, represented by compound 1 [6-(2,4-dimethoxyphenyl)-1-(2-hydroxyethyl)-2-thioxo-2,3-dihydropyrimidin-4(1H)-one], are a novel class of selective irreversible inhibitors of human myeloperoxidase. The present account is a summary of our in vitro studies on the facile oxidative desulfurization in compound 1 to a cyclic ether metabolite M1 [5-(2,4-dimethoxyphenyl)-2,3-dihydro-7H-oxazolo[3,2-a]pyrimidin-7-one] in NADPH-supplemented rats (t1/2 [half-life = mean ± S.D.] = 8.6 ± 0.4 minutes) and dog liver microsomes (t1/2 = 11.2 ± 0.4 minutes), but not in human liver microsomes (t1/2 > 120 minutes). The in vitro metabolic instability also manifested in moderate-to-high plasma clearances of the parent compound in rats and dogs with significant concentrations of M1 detected in circulation. Mild heat deactivation of liver microsomes or coincubation with the flavin-containing monooxygenase (FMO) inhibitor imipramine significantly diminished M1 formation. In contrast, oxidative metabolism of compound 1 to M1 was not inhibited by the pan cytochrome P450 inactivator 1-aminobenzotriazole. Incubations with recombinant FMO isoforms (FMO1, FMO3, and FMO5) revealed that FMO1 principally catalyzed the conversion of compound 1 to M1. FMO1 is not expressed in adult human liver, which rationalizes the species difference in oxidative desulfurization. Oxidation by FMO1 followed Michaelis-Menten kinetics with Michaelis-Menten constant, maximum rate of oxidative desulfurization, and intrinsic clearance values of 209 μM, 20.4 nmol/min/mg protein, and 82.7 μl/min/mg protein, respectively. Addition of excess glutathione essentially eliminated the conversion of compound 1 to M1 in NADPH-supplemented rat and dog liver microsomes, which suggests that the initial FMO1-mediated S-oxygenation of compound 1 yields a sulfenic acid intermediate capable of redox cycling to the parent compound in a glutathione-dependent fashion or undergoing further oxidation to a more
Hugenberg, Verena; Wagner, Stefan; Kopka, Klaus; Schober, Otmar; Schäfers, Michael; Haufe, Günter
2010-09-17
Various ω-substituted 1,1-difluoroalkanes are synthesized in good yields from alkyl aryl thioethers by a new oxidative desulfurization-difluorination protocol with the reagents combination of 1,3-dibromo-5,5-dimethylhydantoin (DBH) as an oxidizer and pyridine·9HF (Py·9HF) as a fluoride source. The reaction proceeds via a fluoro-Pummerer-type rearrangement followed by an oxidative desulfurization-fluorination step. Starting from α-fluorinated thioethers, this reaction is promising for (18)F-labeling (τ(1/2) = 110 min) of ligands applicable for positron emission tomography (PET). Using the combination of DBH and carrier-added Py·9H[(18)F]F, an (18)F-labeled difluoride was synthesized from the corresponding α-fluoro thioether with a radiochemical yield of 9%.
On the high-temperature desulfurization of coal gas: The development of a regenerable absorbent
Energy Technology Data Exchange (ETDEWEB)
Van Yperen, Renee
1994-05-18
There is actually no solid absorbent based on bulk metal oxides available that meets the conditions for application in high-temperature desulfurization processes. This research was aimed to develop an absorbent that fulfills all the specifications for employment in hot-gas clean up. Chapter 2 deals with the development of amorphous aluminium phosphate as a support material. The influence of the preparation conditions onto the specific surface area, pore structure, thermal and chemical stability, and acidity of amorphous aluminium phosphate was investigated. The application of iron oxide onto amorphous aluminium phosphate by means of deposition-precipitation from a homogeneous solution is discussed in chapter 3. The influence of amorphous aluminium phosphate onto the stability, activity, and capacity of the iron oxide is described in detail. Chapter 4 surveys the activity and capacity of several active materials in the absorption of hydrogen sulphide. It is shown that the most promising active material is a mixture of iron oxide and molybdenum oxide. In chapter 5 the properties of iron-molybdenum mixed oxide absorbents are discussed. The effect of the iron to molybdenum ratio onto the formation of iron-(III)-sulphates and the stability of the molybdenum compound is examined. Chapter 6 deals with the preparation of iron-molybdenum mixed oxide absorbents by means of impregnation of modified pre-shaped alumina support bodies. In chapter 7 the effect of the hydrogen and carbon monoxide concentration and in chapter 8 the effect of the water concentration in the coal gas on the activity and the capacity of the iron-molybdenum mixed oxide absorbents is described. Regeneration of the loaded absorbents is an important part of the desulfurization process, dealt with in chapter 9. A number of regeneration procedures have been tested. (Abstract Truncated)
Pampa, K J; Lokanath, N K; Girish, T U; Kunishima, N; Rai, V R
2014-10-24
UDP-N-acetyl-d-mannosamine dehydrogenase (UDP-d-ManNAcDH) belongs to UDP-glucose/GDP-mannose dehydrogenase family and catalyzes Uridine-diphospho-N-acetyl-d-mannosamine (UDP-d-ManNAc) to Uridine-diphospho-N-acetyl-d-mannosaminuronic acid (UDP-d-ManNAcA) through twofold oxidation of NAD(+). In order to reveal the structural features of the Pyrococcus horikoshii UDP-d-ManNAcADH, we have determined the crystal structure of the product-bound enzyme by X-ray diffraction to resolution of 1.55Å. The protomer folds into three distinct domains; nucleotide binding domain (NBD), substrate binding domain (SBD) and oligomerization domain (OD, involved in the dimerization). The clear electron density of the UDP-d-ManNAcA is observed and the residues binding are identified for the first time. Crystal structures reveal a tight dimeric polymer chains with product-bound in all the structures. The catalytic residues Cys258 and Lys204 are conserved. The Cys258 acts as catalytic nucleophile and Lys204 as acid/base catalyst. The product is directly interacts with residues Arg211, Thr249, Arg244, Gly255, Arg289, Lys319 and Arg398. In addition, the structural parameters responsible for thermostability and oligomerization of the three dimensional structure are analyzed. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Hasan, Zubair; Jeon, Jaewoo; Jhung, Sung Hwa
2012-01-01
Highlights: ► Oxidative desulfurization was studied with WO x /ZrO 2 calcined at different temp. ► The importance of the phases of zirconia and tungsten oxide was suggested. ► The catalyst was analyzed thoroughly with Raman and XRD techniques. ► The importance of electron density on S was confirmed with the kinetics of oxidation. - Abstract: Oxidative desulfurization (ODS) of model fuel containing benzothiophene (BT) or thiophene (Th) has been carried out with WO x /ZrO 2 catalyst, which was calcined at various temperatures. Based on the conversion of BT in the model fuel, it can be shown that the optimum calcination temperature of WO x /ZrO 2 catalyst is around 700 °C. The most active catalyst is composed of tetragonal zirconia (ZrO 2 ) with well dispersed polyoxotungstate species and it is necessary to minimize the contents of the crystalline WO 3 and monoclinic ZrO 2 for a high BT conversion. The oxidation rate was interpreted with the first-order kinetics, and it demonstrated the importance of electron density since the kinetic constant for BT was higher than that for Th even though the BT is larger than Th in size. A WO x /ZrO 2 catalyst, treated suitably, can be used as a reusable active catalyst in the ODS.
Directory of Open Access Journals (Sweden)
A. Batista Cabrera
1999-01-01
Full Text Available En el siguiente trabajo se describe una tecnología de desulfuracíon del hierro fundido gris, tomando como base el ya conocidométodo de Volianik (1. En este caso se modificaron algunos parámetros del citado método, adecuándolos a las condicionesexistentes en la Empresa de Fundición de Hierro y Acero de Holguín.( E.F. H. A.Como agente desulfurante se empleó carburo de calcio empleado por Volianik. Como agente activador del desulfurante seutilizó aire comprimido seco. El desulfurante con la granulometría apropiada fue introducido en la cazuela con hierro fundido a1460 oC, por medio de un dispositivo diseñado y construido para este fin.Una gráfica con la dependencia entre el tiempo de soplado y el rendimiento fue obtenida. Como resultado se logró estableceruna tecnología de desulfuración que permite disminuir el contenido de azufre en el hierro fundido desde 0,067 hasta 0,0148%para un rendimiento de 78%.Palabras claves: Hierro gris, desul furación, hierro nodular._____________________________________________________________________AbstractA desulfuration technology for gray cast iron is shown based on the well-known Volianik’s desulfuration method. In this casesome of its parameters were modified, for fitting them to the existent conditions in the Empresa de Hierro Fundido y Acero deHolguín (E.F. H. A..As desulfuration agent calcium carbide was used instead of lime, as it is usually employed by Volianik.Dry compressed air was used as activating agent for the calcium carbide. This one, with the proper grain size it was introducedin a ladle containing 160 RG of melted gray iron at 1460 oC, by means of a mixing device designed and constructed by theauthors.A graphic dependence between air compressed blowing time and desulfuration efficiency was obtained.As a result, a desulfuration technology which permits decrease melted gray iron sulfur contain, from 0,067 till 0,0148 %, wasobtained for a yield of 78 %.Key words: Gray iron, desul
Hou, Liang-pei; Zhao, Rong-xiang; Li, Xiu-ping; Gao, Xiao-han
2018-03-01
A series of catalysts of composition X-MoO2/g-C3N4 (X = 0, 0.5, 1, 3, 5 wt.%) were successfully synthesized by calcination of a mixture of (NH4)6Mo7O24·4H2O and g-C3N4. Oxidative desulfurization experiments were conducted using X-MoO2/g-C3N4 as a catalyst, H2O2 as an oxidant, and ionic liquids (ILs) as extraction agents. Catalysts were characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), Fourier-transform infrared (FT-IR), scanning electron microscopy-energy dispersive X-ray spectroscopy (SEM-EDS), and Brunauer-Emmett-Teller analysis (BET). Characterization results suggested that MoO2 was present in the catalyst and its crystallinity improved with increased Mo-loading. The catalysts had a larger specific surface area due to the presence of MoO2 dispersed on g-C3N4. Experimental results showed that 3%-MoO2/g-C3N4 had the highest catalytic activity among all the catalysts tested. A desulfurization rate of 96.0% was achieved under optimal conditions. Through gas chromatography-mass spectrometry (GC-MS) analysis, it was shown that dibenzothoiphene sulfone was the sole product of the oxidation desulfurization reaction. An apparent activation energy of 61.1 kJ/mol was estimated based on Arrhenius equation. The activity of 3%-MoO2/g-C3N4 slightly decreased after six runs. A possible mechanism for the reaction has been proposed.
THE BIOCATALYTIC DESULFURIZATION PROJECT
Energy Technology Data Exchange (ETDEWEB)
Scott Collins; David Nunn
2003-10-01
The analysis of Petro Star diesel sulfur species is complete and a report is attached. Further analytical efforts will concentrate on characterization of diesel fuel, hydrodesulfurized to varying degrees, in order to determine sulfur species that may be problematic to hydrogen treatment and represent potential target substrates for biodesulfurization in a combined HDS-BDS process. Quotes have been received and are being considered for the partial treatment of Petro Star Inc. marine diesel fuel. Direction of research is changing slightly; economic analysis of the hyphenated--BDSHDS, BDS-CED--has shown the highest probability of success to be with a BDS-HDS process where the biodesulfurization precedes hydrodesulfurization. Thus, the microorganisms will be tailored to focus on those compounds that tend to be recalcitrant to hydrodesulfurization and decrease the severity of the hydrodesulfurization step. A separate, detailed justification for this change is being prepared. Research activities have continued in the characterization of the desulfurization enzymes from multiple sources. Genes for all DszA, -B, -C and -D enzymes (and homologs) have been cloned and expressed. Activity determinations, on a variety of substituted benzothiophene and dibenzothiophene substrates, have been carried out and continue. In addition, chemical synthesis efforts have been carried out to generate additional substrates for analytical standards and activity determinations. The generation of a GSSM mutant library of the ''Rhodococcus IGTS8 dszA'' gene has been completed and development of protocols for a high throughput screen to expand substrate specificity are nearing completion. In an effort to obtain improved hosts as biocatalyst, one hundred-thirty ''Rhodococcus'' and related strains are being evaluated for growth characteristics and other criteria deemed important for an optimal biocatalyst strain. We have also begun an effort to generate
International Nuclear Information System (INIS)
Liang, Zhengxing; Zhang, Li; Yang, Zhongqing; Qiang, Tang; Pu, Ge; Ran, Jingyu
2017-01-01
Highlights: • Evaporation and crystallization characteristics of the droplets of desulfurization wastewater. • TGA and DSC methods were used to investigate the evaporation and crystallization processes. • Evaporation and crystallization rates increase with the increase of temperature increasing rate. • Increasing volume of the droplet increases the evaporation rate, but decreases the crystallization rate. • Structure of the crystals changes significantly when the temperature increasing rate and the volume of the droplet change. - Abstract: Relationship between evaporation and crystallization characteristics of a droplet of desulfurization wastewater from a coal-fired power plant and some operating conditions was studied experimentally using a thermogravimetric analyzer (TGA) with differential scanning calorimetry (DSC) function and a scanning electron microscope (SEM). The results shows that, between 15 °C/min and 45 °C/min, a higher temperature increasing rate leads to higher evaporation and crystallization rates. The increment in the evaporation rate, caused by the same increment of temperature increasing rate, is larger, when the temperature increasing rate is lower. In addition, the final temperatures, ranging from 90 °C to 150 °C, have little impact on the evaporation and crystallization rates of the 0.5 μL droplet. Ultimately, for the droplets, ranging from 0.2 μL to 2.5 μL, evaporation rate increases with increasing volumes of the droplets, but the crystallization rate decreases. From the SEM results, it can be observed that the quantity of cracks on the surface of the crystals also declines with the increase in volumes. Furthermore, the Stefan flow becomes a significant and unneglectable factor in order to decrease the evaporation rate at the end of the evaporation period.
Recovery of SO2 and MgO from By-Products of MgO Wet Flue Gas Desulfurization.
Yan, Liyun; Lu, Xiaofeng; Wang, Quanhai; Guo, Qiang
2014-11-01
An industrial demonstration unit using natural gas as a heat source was built to calcine the by-products of MgO wet flue gas desulfurization from power plants; influencing factors on the SO 2 content in calciner gas were comprehensively analyzed; and an advantageous recycling condition of MgO and SO 2 from by-products was summarized. Results showed that the SO 2 content in the calciner gas was increased by more than 10 times under a lower excess air coefficient, a higher feed rate, a lower crystal water in by-products, and a higher feed port position. For the tests conducted under the excess air coefficient above and below one, the effect of the furnace temperature on the SO 2 content in the calciner gas was reversed. Results of activity analysis indicate that particles of MgO generated under the calcination temperature of 900-1,000°C had a high activity. In contrast, due to the slight sintering, MgO generated under the calcination temperature of 1,100°C had a low activity. To recycle SO 2 as well as MgO, a temperature range of 900-927°C for TE103 is proposed. These studies will prompt the desulfurization market diversification, reduce the sulfur's dependence on imports for making sulfuric acid, be meaningful to balance the usage of the natural resource in China, and be regarded as a reference for the development of this technology for other similar developing countries.
Yu, Hao; Chen, Chuan; Ma, Jincai; Liu, Wenzong; Zhou, Jizhong; Lee, Duu-Jong; Ren, Nanqi; Wang, Aijie
2014-07-01
The elemental sulfur (S°) recovery was evaluated in the presence of nitrate in two development models of simultaneous desulfurization and denitrification (SDD) process. At the loading rates of 0.9 kg S/(m³·day) for sulfide and 0.4 kg N/(m³·day) for nitrate, S° conversion rate was 91.1% in denitrifying sulfide removal (DSR) model which was higher than in integrated simultaneous desulfurization and denitrification (ISDD) model (25.6%). A comprehensive analysis of functional diversity, structure and metabolic potential of microbial communities was examined in two models by using functional gene array (GeoChip 2.0). GeoChip data indicated that diversity indices, community structure, and abundance of functional genes were distinct between two models. Diversity indices (Simpson's diversity index (1/D) and Shannon-Weaver index (H')) of all detected genes showed that with elevated influent loading rate, the functional diversity decreased in ISDD model but increased in DSR model. In contrast to ISDD model, the overall abundance of dsr genes was lower in DSR model, while some functional genes targeting from nitrate-reducing sulfide-oxidizing bacteria (NR-SOB), such as Thiobacillus denitrificans, Sulfurimonas denitrificans, and Paracoccus pantotrophus were more abundant in DSR model which were highly associated with the change of S(0) conversion rate obtained in two models. The results obtained in this study provide additional insights into the microbial metabolic mechanisms involved in ISDD and DSR models, which in turn will improve the overall performance of SDD process. Copyright © 2014. Published by Elsevier B.V.
International Nuclear Information System (INIS)
Wang, Xiaoying; Akasaka, Ryogo; Takemoto, Chie; Morita, Satoshi; Yamaguchi, Machiko; Terada, Takaho; Shirozu, Mikako; Yokoyama, Shigeyuki; Chen, Shilin; Si, Shuyi; Xie, Yong
2011-01-01
A hyperthermophilic adenylosuccinate synthetase from P. horikoshii OT3, which is 90–120 amino acids shorter than those from the vast majority of organisms, was expressed, purified and crystallized and X-ray diffraction data were collected to 2.5 Å resolution. Adenylosuccinate synthetase (AdSS) is a ubiquitous enzyme that catalyzes the first committed step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP) in the purine-biosynthetic pathway. Although AdSS from the vast majority of organisms is 430–457 amino acids in length, AdSS sequences isolated from thermophilic archaea are 90–120 amino acids shorter. In this study, crystallographic studies of a short AdSS sequence from Pyrococcus horikoshii OT3 (PhAdSS) were performed in order to reveal the unusual structure of AdSS from thermophilic archaea. Crystals of PhAdSS were obtained by the microbatch-under-oil method and X-ray diffraction data were collected to 2.50 Å resolution. The crystal belonged to the trigonal space group P3 2 12, with unit-cell parameters a = b = 57.2, c = 107.9 Å. There was one molecule per asymmetric unit, giving a Matthews coefficient of 2.17 Å 3 Da −1 and an approximate solvent content of 43%. In contrast, the results of native polyacrylamide gel electrophoresis and analytical ultracentrifugation showed that the recombinant PhAdSS formed a dimer in solution
Bai, Mindi; Zhang, Zhitao; Bai, Mindong
2012-09-18
In the present study, simultaneous flue gas desulfurization and denitrification are achieved with ·OH radicals generated from O(2)(+) reacting with water vapor in a duct. The O(2)(+) ions are generated by a strong ionization dielectric barrier discharge and then injected into the duct. Compared with conventional gas discharge treatment, the present method does not need a plasma reaction reactor, additional catalysts, reductants, or oxidants. The main recovered products are the liquids H(2)SO(4) and HNO(3), which can be used in many processes. Removal rates of 97% for NO and 82% for SO(2) are obtained under the following optimal experimental conditions: molar ratio of reactive oxygen species (O(2)(+), O(3)) to SO(2) and NO, 5; inlet flue gas temperature, 65 °C; reaction time, 0.94 s; and H(2)O volume fraction, 8%. Production of O(2)(+) and the plasma reaction mechanisms are discussed, and the recovered acid is characterized. The experimental results show that the present method performs better for denitrification than for desulfurization. Compared with conventional air discharge flue gas treatments, the present method has lower initial investment and operating costs, and the equipment is more compact.
Liu, Chao-Li; Hackley, Keith C.; Coleman, D.D.; Kruse, C.W.
1987-01-01
A method using stable isotope ratio analysis to monitor the reactivity of sulfur forms in coal during thermal and chemical desulfurization processes has been developed at the Illinois State Geological Survey. The method is based upon the fact that a significant difference exists in some coals between the 34S/32S ratios of the pyritic and organic sulfur. A screening method for determining the suitability of coal samples for use in isotope ratio analysis is described. Making these special coals available from coal sample programs would assist research groups in sorting out the complex sulfur chemistry which accompanies thermal and chemical processing of high sulfur coals. ?? 1987.
Wynne, Samantha A.; Pinheiro, Vitor B.; Holliger, Philipp; Leslie, Andrew G. W.
2013-01-01
Thermophilic DNA polymerases of the polB family are of great importance in biotechnological applications including high-fidelity PCR. Of particular interest is the relative promiscuity of engineered versions of the exo- form of polymerases from the Thermo- and Pyrococcales families towards non-canonical substrates, which enables key advances in Next-generation sequencing. Despite this there is a paucity of structural information to guide further engineering of this group of polymerases. Here we report two structures, of the apo form and of a binary complex of a previously described variant (E10) of Pyrococcus furiosus (Pfu) polymerase with an ability to fully replace dCTP with Cyanine dye-labeled dCTP (Cy3-dCTP or Cy5-dCTP) in PCR and synthesise highly fluorescent “CyDNA” densely decorated with cyanine dye heterocycles. The apo form of Pfu-E10 closely matches reported apo form structures of wild-type Pfu. In contrast, the binary complex (in the replicative state with a duplex DNA oligonucleotide) reveals a closing movement of the thumb domain, increasing the contact surface with the nascent DNA duplex strand. Modelling based on the binary complex suggests how bulky fluorophores may be accommodated during processive synthesis and has aided the identification of residues important for the synthesis of unnatural nucleic acid polymers. PMID:23940661
Directory of Open Access Journals (Sweden)
Ayalew Ligaba-Osena
2018-02-01
Full Text Available To address national and global low-carbon fuel targets, there is great interest in alternative plant species such as cassava (Manihot esculenta, which are high-yielding, resilient, and are easily converted to fuels using the existing technology. In this study the genes encoding hyperthermophilic archaeal starch-hydrolyzing enzymes, α-amylase and amylopullulanase from Pyrococcus furiosus and glucoamylase from Sulfolobus solfataricus, together with the gene encoding a modified ADP-glucose pyrophosphorylase (glgC from Escherichia coli, were simultaneously expressed in cassava roots to enhance starch accumulation and its subsequent hydrolysis to sugar. A total of 13 multigene expressing transgenic lines were generated and characterized phenotypically and genotypically. Gene expression analysis using quantitative RT-PCR showed that the microbial genes are expressed in the transgenic roots. Multigene-expressing transgenic lines produced up to 60% more storage root yield than the non-transgenic control, likely due to glgC expression. Total protein extracted from the transgenic roots showed up to 10-fold higher starch-degrading activity in vitro than the protein extracted from the non-transgenic control. Interestingly, transgenic tubers released threefold more glucose than the non-transgenic control when incubated at 85°C for 21-h without exogenous application of thermostable enzymes, suggesting that the archaeal enzymes produced in planta maintain their activity and thermostability.
Catalytic oxidative desulfurization of liquid hydrocarbon fuels using air
Sundararaman, Ramanathan
Conventional approaches to oxidative desulfurization of liquid hydrocarbons involve use of high-purity, expensive water soluble peroxide for oxidation of sulfur compounds followed by post-treatment for removal of oxidized sulfones by extraction. Both are associated with higher cost due to handling, storage of oxidants and yield loss with extraction and water separation, making the whole process more expensive. This thesis explores an oxidative desulfurization process using air as an oxidant followed by catalytic decomposition of sulfones thereby eliminating the aforementioned issues. Oxidation of sulfur compounds was realized by a two step process in which peroxides were first generated in-situ by catalytic air oxidation, followed by catalytic oxidation of S compounds using the peroxides generated in-situ completing the two step approach. By this technique it was feasible to oxidize over 90% of sulfur compounds present in real jet (520 ppmw S) and diesel (41 ppmw S) fuels. Screening of bulk and supported CuO based catalysts for peroxide generation using model aromatic compound representing diesel fuel showed that bulk CuO catalyst was more effective in producing peroxides with high yield and selectivity. Testing of three real diesel fuels obtained from different sources for air oxidation over bulk CuO catalyst showed different level of effectiveness for generating peroxides in-situ which was consistent with air oxidation of representative model aromatic compounds. Peroxides generated in-situ was then used as an oxidant to oxidize sulfur compounds present in the fuel over MoO3/SiO2 catalyst. 81% selectivity of peroxides for oxidation of sulfur compounds was observed on MoO3/SiO2 catalyst at 40 °C and under similar conditions MoO3/Al2O3 gave only 41% selectivity. This difference in selectivity might be related to the difference in the nature of active sites of MoO3 on SiO2 and Al2O 3 supports as suggested by H2-TPR and XRD analyses. Testing of supported and bulk Mg
Yu, Fengli; Wang, Rui
2013-11-05
Three heteropolyanion substituted hydrotalcite-like compounds (HPA-HTLcs) including Mg₉Al₃(OH)₂₄[PW₁₂O₄₀](MgAl-PW₁₂), Mg₉Al₃(OH)₂₄[PMo₁₂O₄₀] (MgAl-PMo₁₂) and Mg₁₂Al₄(OH)₃₂[SiW₁₂O₄₀] (MgAl-SiW₁₂), were synthesized, characterized and used as catalysts for the oxidative desulfurization of simulated oil (dibenzothiophene, DBT, in n-octane). MgAl-PMo₁₂ was identified as an effective catalyst for the oxidative removal of DBT under very mild conditions of atmospheric pressure and 60 °C in a biphasic system using hydrogen peroxide as oxidant and acetonitrile as extractant. The conversion of DBT was nearly 100%. As a result, because of the influence of the electron density and the space steric hindrance, the oxidation reactivity of the different sulfur compounds in simulated oil followed the order DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT) > benzothiophene (BT) > thiophene (TH). When the reaction is finished, the catalysts can be recovered from the acetonitrile phase by filtration. The recovered MgAl-PMo₁₂ retains nearly the same catalytic activity as the fresh material. Moreover, MgAl-PMo₁₂ was found to exhibit an ideal catalytic activity in the oxidative desulfurization of real diesel resulting in a total remaining sulfur content of 9.12 ppm(w).
Directory of Open Access Journals (Sweden)
Rui Wang
2013-11-01
Full Text Available Three heteropolyanion substituted hydrotalcite-like compounds (HPA-HTLcs including Mg9Al3(OH24[PW12O40](MgAl-PW12, Mg9Al3(OH24[PMo12O40] (MgAl-PMo12 and Mg12Al4(OH32[SiW12O40] (MgAl-SiW12, were synthesized, characterized and used as catalysts for the oxidative desulfurization of simulated oil (dibenzothiophene, DBT, in n-octane. MgAl-PMo12 was identified as an effective catalyst for the oxidative removal of DBT under very mild conditions of atmospheric pressure and 60 °C in a biphasic system using hydrogen peroxide as oxidant and acetonitrile as extractant. The conversion of DBT was nearly 100%. As a result, because of the influence of the electron density and the space steric hindrance, the oxidation reactivity of the different sulfur compounds in simulated oil followed the order DBT > 4,6-dimethyldibenzothiophene (4,6-DMDBT > benzothiophene (BT > thiophene (TH. When the reaction is finished, the catalysts can be recovered from the acetonitrile phase by filtration. The recovered MgAl-PMo12 retains nearly the same catalytic activity as the fresh material. Moreover, MgAl-PMo12 was found to exhibit an ideal catalytic activity in the oxidative desulfurization of real diesel resulting in a total remaining sulfur content of 9.12 ppm(w.
Preparation of WO3/g-C3N4 composites and their application in oxidative desulfurization
Zhao, Rongxiang; Li, Xiuping; Su, Jianxun; Gao, Xiaohan
2017-01-01
WO3/graphitic carbon nitride (g-C3N4) composites were successfully synthesized through direct calcining of a mixture of WO3 and g-C3N4 at 400 °C for 2 h. The WO3 was prepared by calcination of phosphotungstic acid at 550 °C for 4 h, and the g-C3N4 was obtained by calcination of melamine at 520 °C for 4 h. The WO3/g-C3N4 composites were characterized by X-ray diffraction (XRD), Scanning electron microscopy (SEM), Fourier-transform infrared spectroscopy (FT-IR), and Brunner-Emmett-Teller analysis (BET). The WO3/g-C3N4 composites exhibited stronger XRD peaks of WO3 and g-C3N4 than the WO3 and pure g-C3N4. In addition, two WO3 peaks at 25.7° and 26.6° emerged for the 36% -WO3/g-C3N4 composite. This finding indicated that WO3 was highly dispersed on the surface of the g-C3N4 nanosheets and interacted with the nanosheets, which resulted in the appearance of (012) and (022) planes of WO3. The WO3/g-C3N4 composite also exhibited a larger specific surface area and higher degree of crystallization than WO3 or pure g-C3N4, which resulted in high catalytic activity of the catalyst. Desulfurization experiments demonstrated that the desulfurization rate of dibenzothiophene (DBT) in model oil reached 91.2% under optimal conditions. Moreover, the activity of the catalyst was not significantly decreased after five recycles.
International Nuclear Information System (INIS)
Wang Bo; Zhu Jianpeng; Ma Hongzhu
2009-01-01
Thiophene, due to its poison, together with its combustion products which causes air pollution and highly toxic characteristic itself, attracted more and more attention to remove from gasoline and some high concentration systems. As the purpose of achieving the novel method of de-thiophene assisted by SO 4 2- /ZrO 2 (SZ), three reactions about thiophene in different atmosphere at room temperature and atmospheric pressure were investigated. SO 4 2- /ZrO 2 catalyst were synthesized and characterized by X-ray photoelectron spectroscopy (XPS), Fourier transformation infrared spectroscopy (FT-IR), X-ray diffraction (XRD) and scanning electron microscope (SEM). The products were detected by gas chromatography-mass spectrometry (GC-MS). XP spectra show that ozone-catalyst system (SZO) have two forms of sulfur element (S 6+ and S 2- ) on the catalyst surface, which distinguished from that of air-catalyst system (SZA) and blank-catalyst system (SZB) (S 6+ ). And the results of GC-MS exhibited that some new compounds has been produced under this extremely mild condition. Especially, many kinds of sulfur compounds containing oxygen, that is easier to be extracted by oxidative desulfurization (ODS), have been detected in the SZA-1.5 h and SZB-3 h system. In addition, some long chain hydrocarbons have also been detected. While in SZO-0.5 h system, only long chain hydrocarbons were found. The results show that total efficiency of desulfurization from thiophene with ozone near to 100% can be obtained with the SO 4 2- /ZrO 2 catalytic oxidation reaction
DEFF Research Database (Denmark)
Khoshnevisan, Benyamin; Tsapekos, Panagiotis; Alfaro, Natalia
2017-01-01
The production of biogas from sulfate-rich materials under anaerobic digestion results in the formation of hydrogen sulfide (H2S). The recommended level of H2S in the produced biogas for direct combustion purposes is in the range of 0.02 to 0.05% w/w (200 to 500 ppm), therefore, desulfurization i...
Institute of Scientific and Technical Information of China (English)
Wang Danhong; Zhang Jianyong; Liu Ni; Zhao Xin; Zhang Minghui
2014-01-01
A novel method for obtaining spherical MoO2 nanoparticles and SiO2-Al2O3 supported MoO2 by hydrothermal reduction of Mo (VI) species was studied. The obtained MoO2 catalysts show very high catalytic activity in the oxidative desulfurization (ODS) process. The effect of hydrothermal temperature and crystallization temperature on ODS activity was investigated. The ODS activity of supported MoO2 catalysts with various MoO2 contents were also investigated. The mecha-nism for formation of MoO2 involving oxalic acid was proposed.
Wang, Xu-Sheng; Huang, Yuan-Biao; Lin, Zu-Jin; Cao, Rong
2014-08-21
Highly dispersed Keggin-type phosphotungstic acid (H3PW12O40, PTA) encapsulated in the mesocages of amine-functionalized metal-organic frameworks MIL-101(Cr)-NH2 has been prepared by an anion-exchange method. PTA anions (PW12O40(3-)) are stabilized in the mesocages via the electrostatic interaction with amino groups of the MIL-101(Cr)-NH2. The obtained catalyst (denoted PTA@MIL-101(Cr)-NH2) exhibits high catalytic activity in the extractive and catalytic oxidative desulfurization (ECODS) system under mild conditions. Moreover, it can be easily recovered and recycled several times without leaching and loss of activity.
International Nuclear Information System (INIS)
He Tongqi; Chinese Academy of Sciences, Shanghai; Hu Wei; Sun Guangkui; Shi Weiguo; Li Minxi; Zhang Yutian; Pu Gengqiang
2007-01-01
Recently, the pollution caused by industrial exhaust gas, especially, the air pollution and acid rain resulting from the sulfur of exhaust gas, is increasingly drawing people's attention. The flue gas desulfurization by electron beam produced by high-power electron accelerator has the characteristics of high efficiency and non-secondary contamination. As one of the most pivotal part of accelerator, the service lifetime of this extraction window directly effects the stable operation of the device. In this paper, a brief review is given to summarize the advantages, material selecting, structure, replacing, maintaining of the extraction window of high-power electron accelerator developed by SINAP. (authors)
Research improvement in Zn-based sorbent for hot gas desulfurization
Energy Technology Data Exchange (ETDEWEB)
X. Bu; Y. Ying; C. Zhang; W. Peng [China Coal Research Institute (CCRI), Beijing (China). Beijing Research Institute of Coal Chemistry
2005-07-01
Two Zn-based sorbents, named as L-991 and L-992, used for hot gas desulfurization were developed. The L-992, which was prepared by changing the Zn/Ti ratio and adding a certain proportion of Cu and Mn metal oxide, acquired better performance than L-991. The suitable desulfurisation temperature was 600-700{sup o}C for the L-991 and 600-800{sup o}C for the L-992. The sulfur capacity was about 16 g/100 g and 19-21 g/100 g of L-991 and L-992 respectively. After 17 multi-cycles sulfidation/regeneration tests, the sulfur capacity of the L-991 decreased greatly, while that of the L-992 still remained at 17 g/100 g. Both the sorbents showed orderly crystalline orientation and the particle size did not change. Sulfidation and regeneration tests were done both on lab micro-fixed bed reactor and SMOVEN equipment. During the continuous tests, the H{sub 2}S concentration can be reduced from about 10 g/m{sup 3} to less than 20 mg/m{sup 3}, the H{sub 2}S removal efficiency being {gt} 99%. 14 refs., 9 figs., 2 tabs.
Sulfur transformations related to revegetation of flue gas desulfurization sludge disposal sites
Energy Technology Data Exchange (ETDEWEB)
Barlas, S.A.; Artiola, J.F.; Salo, L.F.; Goodrich-Mahoney, J.W. [University of Arizona, Tucson, AZ (United States). Dept. of Soil, Water and Environmental Sciences
1999-10-01
This study investigated factors controlling redox conditions in flue gas desulfurization (FGD) sludge and identified ways to minimize the production of phytotoxic reduced sulfur species at FGD sludge disposal sites. The oxidation of reduced FGD sludge (Eh-385 mV) appears to be a two-step process mostly controlled by water content. Eighty percent of total sulfide in reduced sludge was oxidized within 20 h of exposure to air with constant water evaporation. When organic carbon (OC) was added to saturated oxidized sludge, the Eh dropped exponentially. Sulfate reduction began at an Eh of about -75 mV and reached a maximum at -265 to -320 mV. Water content, degree of mixing, concentration of OC, and temperature control the rate and extent of reduction of FGD sludge. This suggests that water saturation and OC inputs to revegetated disposal sites should be controlled, especially during warm temperatures, to prevent production of phytotoxic levels of sulfides.
Reactive Adsorption Desulfurization by Nanocrystalline ZnO/Zeolite A Molecular Sieves
Directory of Open Access Journals (Sweden)
Nada Sadoon Ahmedzeki
2017-09-01
Full Text Available Nanocrystalline ZnO/Zeolite type A composite was prepared by simple method of operation by . the precipitation of zinc oxide and loading on zeolite 5A in one step. Characterization was made by X-ray diffraction (XRD, X-ray fluorescence(XRF, N2 adsorption- desorption for BET surface area, and Atomic force microscopy (AFM. Results showed that zinc oxide was loaded on zeolite as noticed by the characteristic peaks and was of nano scale having an average diameter of 88.57nm. The percentage loading of ZnO on zeolite A was 28.37% and the surface area was 222m2/g. The activity of the prepared catalyst was examined in the desulfurization of double hydrogenated diesel fuel. The process was investigated in a controlled autoclave with temperature range studied 100220 oC. Results indicated an oxidation of thiophenic compounds on the surface of the catalyst coupled with adsorption. About 35% reduction was obtained and the capacity was 10.56 mg S/g catalyst.
Medvedev, Kirill E; Alemasov, Nikolay A; Vorobjev, Yuri N; Boldyreva, Elena V; Kolchanov, Nikolay A; Afonnikov, Dmitry A
2014-10-15
The identification of the mechanisms of adaptation of protein structures to extreme environmental conditions is a challenging task of structural biology. We performed molecular dynamics (MD) simulations of the Nip7 protein involved in RNA processing from the shallow-water (P. furiosus) and the deep-water (P. abyssi) marine hyperthermophylic archaea at different temperatures (300 and 373 K) and pressures (0.1, 50 and 100 MPa). The aim was to disclose similarities and differences between the deep- and shallow-sea protein models at different temperatures and pressures. The current results demonstrate that the 3D models of the two proteins at all the examined values of pressures and temperatures are compact, stable and similar to the known crystal structure of the P. abyssi Nip7. The structural deviations and fluctuations in the polypeptide chain during the MD simulations were the most pronounced in the loop regions, their magnitude being larger for the C-terminal domain in both proteins. A number of highly mobile segments the protein globule presumably involved in protein-protein interactions were identified. Regions of the polypeptide chain with significant difference in conformational dynamics between the deep- and shallow-water proteins were identified. The results of our analysis demonstrated that in the examined ranges of temperatures and pressures, increase in temperature has a stronger effect on change in the dynamic properties of the protein globule than the increase in pressure. The conformational changes of both the deep- and shallow-sea protein models under increasing temperature and pressure are non-uniform. Our current results indicate that amino acid substitutions between shallow- and deep-water proteins only slightly affect overall stability of two proteins. Rather, they may affect the interactions of the Nip7 protein with its protein or RNA partners.
Evidences for CYP3A4 autoactivation in the desulfuration of dimethoate by the human liver.
Buratti, Franca M; Testai, Emanuela
2007-11-20
Dimethoate (DIM) is an organophosphorothionate (OPT) pesticide used worldwide as a systemic insecticide and acaricide. It is characterized by low-to-moderate acute mammalian toxicity; similarly to the other OPT pesticides, its mode of action is mediated by the inhibition of acetylcholinesterase (AChE), exerted by its toxic metabolite dimethoate-oxon or omethoate (OME), which is also used as a direct acting pesticide. Human hepatic DIM bioactivation to the toxic metabolite OME has been characterized by using c-DNA expressed human CYPs and human liver microsomes (HLM) also in the presence of CYP-specific chemical inhibitors, with a method based on AChE inhibition. The obtained kinetic parameters and AChE IC(50) have been compared with those previously obtained with other OPTs, indicating a lower efficiency in DIM desulfuration reaction and a lower potency in inhibiting AChE. Results showed that, similarly to the other OPTs tested so far, at low DIM concentration OME formation is mainly catalysed by CYP1A2, while the role of 3A4 is relevant at high DIM levels. Differently from the other OPTs, DIM desulfuration reaction showed an atypical kinetic profile, likely due to CYP3A4 autoactivation. The sigmoidicity degree of the activity curve increased with the level of CYP3A4 in HLM or disappeared in the presence of a CYP3A4 chemical inhibitor. This atypical kinetic behaviour can be considered one of the possible explanations for the recent findings that among patients hospitalized following OPT intoxication, DIM ingestion gave different symptoms and more severe poisoning (23.1% of fatal cases versus total) than chlorpyrifos (8% of deaths), which has a lower LD(50) value. Since DIM-poisoned patients poorly responded to pralidoxime, the possibility to use CYP3A4 inhibitors could be considered as a complementary treatment.
Energy Technology Data Exchange (ETDEWEB)
Tang, Ling; Luo, Guangqing; Kang, Lihua; Zhu, Mingyuan; Dai, Bin [Shihezi University, Shihezi (China)
2013-02-15
To effectively reduce the sulfur content in model fuel, [Bmim]PW/HMS catalyst was synthesized through impregnating the hexagonal mesoporous silica (HMS) support by phosphotungstic acid (HPW) and ionic liquid [Bmim] HSO{sub 4}. Physical structure characterizations of the catalysts showed that HMS retained mesoporous structure, and [Bmim] PW was well dispersed on the support of HMS. The catalytic activity of the [Bmim]PW/HMS was evaluated in the oxidative desulfurization process, and the optimal reaction conditions including loading of the catalysts, reaction temperature, catalyst amount, O/S (H{sub 2}O{sub 2}/sulfur) molar ratio and agitation speed were investigated. Under the optimal reaction conditions, the conversion of benzothiophene (BT), dibenzothiophene (DBT) and 4, 6-dimethyldibenzothiophene (4, 6-DMDBT) could reach 79%, 98%, 88%, respectively.
International Nuclear Information System (INIS)
Tang, Ling; Luo, Guangqing; Kang, Lihua; Zhu, Mingyuan; Dai, Bin
2013-01-01
To effectively reduce the sulfur content in model fuel, [Bmim]PW/HMS catalyst was synthesized through impregnating the hexagonal mesoporous silica (HMS) support by phosphotungstic acid (HPW) and ionic liquid [Bmim] HSO 4 . Physical structure characterizations of the catalysts showed that HMS retained mesoporous structure, and [Bmim] PW was well dispersed on the support of HMS. The catalytic activity of the [Bmim]PW/HMS was evaluated in the oxidative desulfurization process, and the optimal reaction conditions including loading of the catalysts, reaction temperature, catalyst amount, O/S (H 2 O 2 /sulfur) molar ratio and agitation speed were investigated. Under the optimal reaction conditions, the conversion of benzothiophene (BT), dibenzothiophene (DBT) and 4, 6-dimethyldibenzothiophene (4, 6-DMDBT) could reach 79%, 98%, 88%, respectively
Wang, Bo; Zhu, Jianpeng; Ma, Hongzhu
2009-05-15
Thiophene, due to its poison, together with its combustion products which causes air pollution and highly toxic characteristic itself, attracted more and more attention to remove from gasoline and some high concentration systems. As the purpose of achieving the novel method of de-thiophene assisted by SO(4)(2-)/ZrO(2) (SZ), three reactions about thiophene in different atmosphere at room temperature and atmospheric pressure were investigated. SO(4)(2-)/ZrO(2) catalyst were synthesized and characterized by X-ray photoelectron spectroscopy (XPS), Fourier transformation infrared spectroscopy (FT-IR), X-ray diffraction (XRD) and scanning electron microscope (SEM). The products were detected by gas chromatography-mass spectrometry (GC-MS). XP spectra show that ozone-catalyst system (SZO) have two forms of sulfur element (S(6+) and S(2-)) on the catalyst surface, which distinguished from that of air-catalyst system (SZA) and blank-catalyst system (SZB) (S(6+)). And the results of GC-MS exhibited that some new compounds has been produced under this extremely mild condition. Especially, many kinds of sulfur compounds containing oxygen, that is easier to be extracted by oxidative desulfurization (ODS), have been detected in the SZA-1.5h and SZB-3h system. In addition, some long chain hydrocarbons have also been detected. While in SZO-0.5h system, only long chain hydrocarbons were found. The results show that total efficiency of desulfurization from thiophene with ozone near to 100% can be obtained with the SO(4)(2-)/ZrO(2) catalytic oxidation reaction.
Desulfurization of petroleum induced by ionization radiation: benzothiophene behavior
International Nuclear Information System (INIS)
Andrade, Luana S.; Calvo, Wilson A.P.; Duarte, Celina L.
2013-01-01
Hydrodesulfurization (HDS) is currently the most common method used by refineries; this removes significantly sulfur compounds from petroleum fractions, however, is not highly effective for removing thiophene compounds such as benzothiophene, and generates high costs for the oil industry. Another factor, are the environmental laws, which over the years has become increasingly strict, especially regarding the sulfur content. This compound cause incalculable damage both to the industry and to the environment. Therefore new methods for petroleum desulfurization should be studied in order to minimize the impacts that these compounds cause. In the present study it was used ionizing radiation, a promising method of advanced oxidation in reducing sulfur compounds. The analysis were performed after purge and trap concentration of samples, followed by gas chromatography-mass spectrometry (GC-MS). Then benzothiophene samples with the same concentration from 27 mg.L -1 to 139 mg.L -1 were irradiated with different absorbed doses of radiation ranging from 1 kGy to 20 kGy in gamma irradiator Cobalt-60, Gammacell. These samples were analyzed by the same procedure used for the calibration curve, and the removals of benzothiophene after ionizing radiation treatment were calculated. It was observed that at higher doses there was a greater degradation of this compound and the formation of fragments, such as 1,2-dimethylbenzene and toluene, which may be removed by simple processes. (author)
Shibahara, Fumitoshi; Kitagawa, Asumi; Yamaguchi, Eiji; Murai, Toshiaki
2006-11-23
Iodine-mediated, oxidative desulfurization promoted cyclization of N-2-pyridylmethyl thioamides serves as an efficient and versatile method for the preparation of 2-azaindolizines (imidazo[1,5-a]pyridines) and rare 2-azaindolizine sulfur-bridged dimers. The 2-azaindolizines prepared in this manner are readily converted to a variety of fluorescent compounds by using transition-metal-catalyzed cross-coupling reactions. [reaction: see text].
Lin, Haiying; Peng, Jingji; Yuan, Dongxing; Lu, Bingyan; Lin, Kunning; Huang, Shuyuan
2016-07-01
Seawater flue gas desulfurization (SFGD) systems are commonly used to remove acidic SO2 from the flue gas with alkaline seawater in many coastal coal-fired power plants in China. However, large amount of mercury (Hg) originated from coal is also transferred into seawater during the desulfurization (De-SO2) process. This research investigated Hg isotopes in seawater discharged from a coastal plant equipped with a SFGD system for the first time. Suspended particles of inorganic minerals, carbon residuals and sulfides are enriched in heavy Hg isotopes during the De-SO2 process. δ(202)Hg of particulate mercury (PHg) gradually decreased from -0.30‰ to -1.53‰ in study sea area as the distance from the point of discharge increased. The results revealed that physical mixing of contaminated De-SO2 seawater and uncontaminated fresh seawater caused a change in isotopic composition of PHg isotopes in the discharging area; and suggested that both De-SO2 seawater and local background contributed to PHg. The impacted sea area predicted with isotopic tracing technique was much larger than that resulted from a simple comparison of pollutant concentration. It was the first attempt to apply mercury isotopic composition signatures with two-component mixing model to trace the mercury pollution and its influence in seawater. The results could be beneficial to the coal-fired plants with SFGD systems to assess and control Hg pollution in sea area. Copyright © 2016 Elsevier Ltd. All rights reserved.
Economic assessment of advanced flue gas desulfurization processes. Final report
Energy Technology Data Exchange (ETDEWEB)
Bierman, G. R.; May, E. H.; Mirabelli, R. E.; Pow, C. N.; Scardino, C.; Wan, E. I.
1981-09-01
This report presents the results of a project sponsored by the Morgantown Energy Technology Center (METC). The purpose of the study was to perform an economic and market assessment of advanced flue gas desulfurization (FGD) processes for application to coal-fired electric utility plants. The time period considered in the study is 1981 through 1990, and costs are reported in 1980 dollars. The task was divided into the following four subtasks: (1) determine the factors affecting FGD cost evaluations; (2) select FGD processes to be cost-analyzed; (3) define the future electric utility FGD system market; and (4) perform cost analyses for the selected FGD processes. The study was initiated in September 1979, and separate reports were prepared for the first two subtasks. The results of the latter two subtasks appear only in this final reprot, since the end-date of those subtasks coincided with the end-date of the overall task. The Subtask 1 report, Criteria and Methods for Performing FGD Cost Evaluations, was completed in October 1980. A slightly modified and condensed version of that report appears as appendix B to this report. The Subtask 2 report, FGD Candidate Process Selection, was completed in January 1981, and the principal outputs of that subtask appear in Appendices C and D to this report.
Ultra-deep desulfurization via reactive adsorption on peroxophosphomolybdate/agarose hybrids.
Xu, Jian; Li, Huacheng; Wang, Shengtian; Luo, Fang; Liu, Yunyu; Wang, Xiaohong; Jiang, Zijiang
2014-09-01
A catalyst system composed of peroxophosphomolybdates as catalytic center and agarose as matrix material had been designed. The [C16H33N(CH3)3]3[PO4{MoO(O2)2}4]/agarose (C16PMo(O2)2/agarose) hybrid was found to be active for oxidation desulfurization (ODS) of dibenzothiophene (DBT) or real fuel into corresponding sulfone by H2O2 as an oxidant, while the sulfur content could be reduced to 5ppm. The higher activity comes from its components including [PO4{MoO(O2)2}4] catalytic sites, the hydrophobic quaternary ammonium cation affinity to low polarity substrates, and agarose matrix affinity to H2O2 and sulfone. During the oxidative reaction, the mass transfer resistance between H2O2 and organic sulfurs could be decreased and the reaction rate could increase by the assistance of agarose and hydrophobic tails of [C16H33N(CH3)3]3[PO4{MoO(O2)2}4]. Meanwhile, the oxidative products could be adsorbed by agarose matrix to give clean fuel avoiding the post-treatment. In addition, the hybrid was easily regenerated to be reused. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Ezzat Rafiee
2017-12-01
Full Text Available A novel heterogeneous nanocatalyst H3PW12O40/TiO2/g-C3N4 (PW/TiO2/CN was successfully synthesized by immobilization of PW on TiO2/CN nanocomposite, and characterized by SEM, BET, FT-IR, XRD, EDX, TEM and ICP. Catalytic performance of the as-prepared catalyst was investigated for the selective oxidation of sulfides to sulfoxides and sulfones in the presence of H2O2 as oxidant with good conversion and high selectivity. The main factors influencing the ability for selective oxidation of sulfides were studied, including reaction temperature, amounts of the catalyst, H2O2 and type of the reaction solvent. Catalytic oxidation of the different model oils containing dibenzothiophene (DBT, benzothiophene (BT and thiophene (T into corresponding sulfone was also studied. Effects of different extractive solvents, aromatics, alkenes and nitrogen compounds on the oxidative desulfurization processes (ODS were also studied. In addition, reducing the level of sulfur content in real oil was investigated. The recyclability of the PW/TiO2/CN nanocatalyst for various cycles without a significant loss of activity was proved. The heterogeneity of the as-prepared catalyst was confirmed by leaching tests. Keywords: Graphitic carbon nitride, Extraction, Tetrabutyl titanate, Heteropoly acid, Oxidative desulfurization, Oil
Hao, Xiu-Li; Ma, Yuan-Yuan; Zang, Hong-Ying; Wang, Yong-Hui; Li, Yang-Guang; Wang, En-Bo
2015-02-23
A new cationic triazole-based metal-organic framework encapsulating Keggin-type polyoxometalates, with the molecular formula [Co(BBPTZ)3][HPMo12O40]⋅24 H2O [compound 1; BBPTZ = 4,4'-bis(1,2,4-triazol-1-ylmethyl)biphenyl] is hydrothermally synthesized and characterized by elemental analysis, IR spectroscopy, thermogravimetric analysis, powder X-ray diffraction, and single-crystal X-ray diffraction. The structure of compound 1 contains a non-interpenetrated 3D CdSO4 (cds)-type framework with two types of channels that are interconnected with each other; straight channels that are occupied by the Keggin-type POM anions, and wavelike channels that contain lattice water molecules. The catalytic activity of compound 1 in the oxidative desulfurization reaction indicates that it is not only an effective and size-selective heterogeneous catalyst, but it also exhibits distinct structural stability in the catalytic reaction system. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Wang, S.J.; Chen, C.H.; Xu, X.C.; Li, Y.J. [Tsing Hua University, Beijing (China). Ministry of Education
2008-01-15
In this study, flue gas desulfurization (FGD) byproducts are used to ameliorate alkali soil. The average application rates for soils with low exchangeable sodium percentage (ESP), mid ESP, and high ESP are 20.9, 30.6, and 59.3 Mg ha{sup -1} respectively. The experimental results obtained for 3 consecutive years reveal that the emergence ratios and yields of the crops were 1.1-7.6 times and 1.1-13.9 times those of the untreated control, respectively. The concentrations of Cr, Pb, Cd, As, and Hg in the treated soils are far below the background values stipulated by the Environmental Quality Standard for Soils (GB 15618-1995). Their concentrations in the seeds of corn and alfalfa grown in the treated soils are far below the tolerance limits regulated by National Food Standards of China. The results of this research demonstrate that the amelioration of alkali soils using FGD byproducts is promising.
Savitskii, D. P.; Stanishevskii, Ya. M.
2018-01-01
Thin films of copper(I) sulfide (Cu2S) are synthesized on a copper substrate by exposing it to vapor-phase sulfur-containing products resulting from the hydrothermal desulfurization of brown coal. The synthesized 0.1-mm-thick films have grain sizes in the range of 10‒20 μm, electrical resistivity ρ = 0.92 Ω cm at T = 300 K, and bang gap E g = 1.91 eV. The roughness of the films, in terms of the arithmetic mean deviation of the assessed profile, is R a = 2.46 μm.
Directory of Open Access Journals (Sweden)
Nancy F. Ramia
2014-12-01
Full Text Available Summary: The Cmr complex is the multisubunit effector complex of the type III-B clustered regularly interspaced short palindromic repeats (CRISPR-Cas immune system. The Cmr complex recognizes a target RNA through base pairing with the integral CRISPR RNA (crRNA and cleaves the target at multiple regularly spaced locations within the complementary region. To understand the molecular basis of the function of this complex, we have assembled information from electron microscopic and X-ray crystallographic structural studies and mutagenesis of a complete Pyrococcus furiosus Cmr complex. Our findings reveal that four helically packed Cmr4 subunits, which make up the backbone of the Cmr complex, act as a platform to support crRNA binding and target RNA cleavage. Interestingly, we found a hook-like structural feature associated with Cmr4 that is likely the site of target RNA binding and cleavage. Our results also elucidate analogies in the mechanisms of crRNA and target molecule binding by the distinct Cmr type III-A and Cascade type I-E complexes. : Ramia et al. show that the helical core of the type III-B Cmr CRISPR-Cas effector complex, made up of multiple Cmr4 subunits, forms the platform for a corresponding number of cleavages of the target RNA. Comparison with the type I-E Cascade structure reveals strikingly similar mechanisms of crRNA and target binding.
Genomic Characterization of Methanomicrobiales Reveals Three Classes of Methanogens
Energy Technology Data Exchange (ETDEWEB)
Anderson, Iain; Ulrich, Luke E.; Lupa, Boguslaw; Susanti, Dwi; Porat, Iris; Hooper, Sean D.; Lykidis, Athanasios; Sieprawska-Lupa, Magdalena; Dharmarajan, Lakshmi; Goltsman, Eugene; Lapidus, Alla; Saunders, Elizabeth; Han, Cliff; Land, Miriam; Lucas, Susan; Mukhopadhyay, Biswarup; Whitman, William B.; Woese, Carl; Bristow, James; Kyrpides, Nikos
2009-05-01
Methanomicrobiales is the least studied order of methanogens. While these organisms appear to be more closely related to the Methanosarcinales in ribosomal-based phylogenetic analyses, they are metabolically more similar to Class I methanogens. In order to improve our understanding of this lineage, we have completely sequenced the genomes of two members of this order, Methanocorpusculum labreanum Z and Methanoculleus marisnigri JR1, and compared them with the genome of a third, Methanospirillum hungatei JF-1. Similar to Class I methanogens, Methanomicrobiales use a partial reductive citric acid cycle for 2-oxoglutarate biosynthesis, and they have the Eha energy-converting hydrogenase. In common with Methanosarcinales, Methanomicrobiales possess the Ech hydrogenase and at least some of them may couple formylmethanofuran formation and heterodisulfide reduction to transmembrane ion gradients. Uniquely, M. labreanum and M. hungatei contain hydrogenases similar to the Pyrococcus furiosus Mbh hydrogenase, and all three Methanomicrobiales have anti-sigma factor and anti-anti-sigma factor regulatory proteins not found in other methanogens. Phylogenetic analysis based on seven core proteins of methanogenesis and cofactor biosynthesis places the Methanomicrobiales equidistant from Class I methanogens and Methanosarcinales. Our results indicate that Methanomicrobiales, rather than being similar to Class I methanogens or Methanomicrobiales, share some features of both and have some unique properties. We find that there are three distinct classes of methanogens: the Class I methanogens, the Methanomicrobiales (Class II), and the Methanosarcinales (Class III).
Bicarbonate-induced activation of H₂O₂ for metal-free oxidative desulfurization.
Bokare, Alok D; Choi, Wonyong
2016-03-05
Efficient oxidative desulfurization (ODS) of model oil containing dibenzothiophene (DBT) and aromatic thiophenic derivatives has been achieved at room temperature using hydrogen peroxide activation by inorganic bicarbonate (HCO3(-)). Using in-situ formation of peroxymonocarbonate as oxidant, the transformation of main model substrate DBT to corresponding DBT-sulfone was easily accomplished in biphasic reaction conditions. In the presence of water-acetonitrile polar phase, increasing the water content upto 50% decreased the extraction capacity more than 3 times, but ∼ 90% DBT oxidation was still achieved. The oxidizing capacity of bicarbonate catalyst was maintained during repeated ODS cycles, but DBT removal efficiency was critically dependent on the extraction capacity of the polar phase. Under heterogeneous reaction conditions, bicarbonate-modified ion-exchange resin achieved similar ODS activity compared to the homogeneous catalytic system. Additionally, the efficient formation of peroxymonocarbonate using gaseous CO2 precursor in alkaline conditions was also utilized for DBT oxidation. The present study proposes the NaHCO3/H2O2 catalytic system as an efficient and cheap metal-free alternative for the oxidative removal of aromatic sulfur compounds from fuel oil. Copyright © 2015 Elsevier B.V. All rights reserved.
Industrial application of gasoline aromatization and desulfurization technology in Hohhot refinery
Directory of Open Access Journals (Sweden)
Li Zixia
2017-01-01
Full Text Available Gasoline aromatization and desulfurization (GARDES technology is extensively used in refineries of Petrochina, aiming to produce high quality ultraclean fluid catalytic cracking (FCC gasoline. This article introduces the industrial application results on the hydrodesulfurization unit of the Hohhot refinery, which plays an important role in guiding next round gasoline upgrading. The characteristics and the principle of GARDES technology were elaborated by analyzing the distribution of sulfur and hydrocarbon compounds in the feed and product. The analysis results proved that the presence of broad ranged sulfur types in the feed can be removed at different stages. Olefin can be decreased by saturation and conversion into i-paraffins and aromatics. The sulfur content of the blend product can be limited under 10 mg/kg, showing GARDES technology has excellent sulfur removal ability. The olefin reduction can also satisfy the ever-increasing severe requirement about the olefin limitation, while the loss of research octane number (RON can be minimized to an acceptable level. Furthermore, according to the demand of gasoline upgrading, GARDES technology has great flexibility by adjusting operation condition without any further investment, which brings more economic benefits for refinery.
LIFAC flue gas desulfurization process an alternative SO{sub 2} control strategy
Energy Technology Data Exchange (ETDEWEB)
Patel, J.G. [Tampella Power Corp., Atlanta, GA (United States); Vilala, J. [Tampella Power Inc., Tampere (Finland)
1995-12-01
This paper discusses the results from two recently completed LIFAC flue gas desulfurization plants - 300 MW Shand lignite powered station owned by Saskatchewan Power Corporation and 60 MW Whitewater Valley high sulfur coal fired station owned by Richmond Powerand Light. LIFACis a dry FGD process in which limestone is injected into the upper regions of the boiler furnace and an activation reactor is used to humidify the unreacted limestone to achieve additional sulfur capture. The performance in both plants indicates that 70 to 80% sulfur is removed at a Ca/S ratio of 2. Cost performance data from these plants has shown that LI FAC both on construction cost and $/ton SO{sub 2} removed basis is very cost competitive compared to other SO{sub 2} control technologies. The Richmond plant has been realized under the auspices of the U.S. Department of Energy`s Clean Coal Technology program. The Shand plant is the first commercial installation in North America. The paper also discusses highlights of operating and maintenance experience, availability and handling of the solid waste product.
Yu, Fengli; Wang, Rui
2013-01-01
Three heteropolyanion substituted hydrotalcite-like compounds (HPA-HTLcs) including Mg9Al3(OH)24[PW12O40](MgAl-PW12), Mg9Al3(OH)24[PMo12O40] (MgAl-PMo12) and Mg12Al4(OH)32[SiW12O40] (MgAl-SiW12), were synthesized, characterized and used as catalysts for the oxidative desulfurization of simulated oil (dibenzothiophene, DBT, in n-octane). MgAl-PMo12 was identified as an effective catalyst for the oxidative removal of DBT under very mild conditions of atmospheric pressure and 60 °C in a biphasic...
Energy Technology Data Exchange (ETDEWEB)
Chugh, Y.P.; Dutta, D.; Esling, S. [and others
1995-10-01
On September 30, 1993, the U.S. Department of Energy-Morgantown Energy Technology Center (DOE-METC) and Southern Illinois University at Carbondale (SIUC) entered into a cooperative research agreement entitled {open_quotes}Management of Dry Flue Gas Desulfurization By-Products in Underground Mines{close_quotes} (DE-FC21-93MC30252). Under the agreement Southern Illinois University at Carbondale will develop and demonstrate several technologies for the placement of coal combustion residues (CCBs) in abandoned coal mines, and will assess the environmental impact of such underground CCB placement. This report describes progress in the following areas: environmental characterization, mix development and geotechnical characterization, material handling and system economics, underground placement, and field demonstration.
Energy Technology Data Exchange (ETDEWEB)
1994-08-01
The goal of this project is to demonstrate that, by combining state-of-the-art technology, highly efficient plant operation and maintenance capabilities and by-product gypsum sales, significant reductions of SO{sub 2} emissions can be achieved at approximately one-half the life cycle cost of a conventional Flue Gas Desulfurization (FGD) system. Further, this emission reduction is achieved without generating solid waste and while minimizing liquid wastewater effluent. Basically, this project entails the design, construction and operation of a nominal 600 MWe AFGD facility to remove SO{sub 2} from coal-fired power plant flue gas at the Northern Indiana Public Service Company`s Bailly Generating Station.
International Nuclear Information System (INIS)
Rutledge, C.K.; Wolsiffer, S.R.; Gray, S.M.; Martin, J.E.; Wedig, C.P.
1992-01-01
This paper presents a brief description of the status of the retrofit wet limestone flue gas desulfurization system project at Indianapolis Power ampersand Light Company (IPL) Petersburg Units 1 and 2. This project was initiated by IPL in response to the Clean Air Act of 1990 and is intended to treat the flue gas from two base load units with a combined capacity of approximately 700 MW gross electrical output
Directory of Open Access Journals (Sweden)
Zhen Li
2016-11-01
Full Text Available Deep-sea hydrothermal vent environments are characterized by high hydrostatic pressure and sharp temperature and chemical gradients. Horizontal gene transfer is thought to play an important role in the microbial adaptation to such an extreme environment. In this study, a 21.4-kb DNA fragment was identified as a genomic island, designated PYG1, in the genomic sequence of the piezophilic hyperthermophile Pyrococcus yayanosii. According to the sequence alignment and functional annotation, the genes in PYG1 could tentatively be divided into five modules, with functions related to mobility, DNA repair, metabolic processes and the toxin-antitoxin system. Integrase can mediate the site-specific integration and excision of PYG1 in the chromosome of P. yayanosii A1. Gene replacement of PYG1 with a SimR cassette was successful. The growth of the mutant strain ∆PYG1 was compared with its parent strain P. yayanosii A2 under various stress conditions, including different pH, salinity, temperature and hydrostatic pressure. The ∆PYG1 mutant strain showed reduced growth when grown at 100 °C, while the biomass of ∆PYG1 increased significantly when cultured at 80 MPa. Differential expression of the genes in module Ⅲ of PYG1 was observed under different temperature and pressure conditions. This study demonstrates the first example of an archaeal integrative genomic island that could affect the adaptation of the hyperthermophilic piezophile P. yayanosii to high temperature and high hydrostatic pressure.
Wang, Hanlu; Xu, Mingsheng; Zhou, Rujin
2017-02-01
The dual role of the ionic liquid 1-butyl-3-methyl-imidazolium trifluoroacetic acid ([C 4 mim]TFA) as an extractant for thiophene (TH) and a catalyst for the oxidation of TH was explored at the molecular level by performing density functional theory (DFT) calculations. The calculated interaction energies demonstrated why [C 4 mim]TFA is a better extractant for thiophene sulfone (THO 2 ) than for TH. Two pathways were proposed for the oxidation of TH to THO 2 with [C 4 mim]TFA acting as a catalyst. In the dominant pathway, a peracid is formed which then oxidizes TH to the sulfoxide and sulfones. The presence of [C 4 mim]TFA was found to greatly reduce the barrier to the oxidative desulfurization (ODS) of TH using H 2 O 2 as an oxidant. Graphical Abstract Possible reaction mechanisms of TH with the aid of [C4mim]TFAᅟ.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
To suppress the emission of environmental pollutants from coal utilization in China and to contribute to stable security of Japan`s energy, demonstration of clean coal technology and consolidation of diffusion base to be introduced into China have been promoted. Demonstration program for diffusing simplified desulfurizers has been promoted. For accelerating the achievement, experts of desulfurizers were delegated to Weifang Chemical Industry Works, to support the program. Exhaust gas is introduced from boiler via water spray dust remover, suction fan and centralized stack into absorption tower of the simplified wet-type desulfurizer. In the ascending process, the exhaust gas contacts with absorbent, to remove SO2 and dust. The absorbent is blasted up through the spray nozzle. The absorbent is oxidized by the air into sulfate ion in the liquid chamber at the lower part of tower, and neutralized by hydrated lime to form gypsum. Through the continuous operation for two years, understandings were remarkably increased. However, good treatment of the tax system is required for further diffusion. Though there are no problems for ordinary start and stop, emergency operation is insufficient. There are some problems in the maintenance due to the delay of finding failures. 16 figs., 1 tab.
Jie He
2004-01-01
To understand the potential impacts of China's accession to WTO in her new de-sulfur policy (gradual reduction of 10% of annual SO2 emission by 2005 with respect to that of 2000), we construct a CGE model in which SO2 emission is directly linked to energy input consumption in production. The model equally considers the substitution possibility between energies of different SO2 effluent ratio by including energy as traditional production factor as labor and capital in the constant elasticity o...
Czech Academy of Sciences Publication Activity Database
Planeta, Josef; Karásek, Pavel; Roth, Michal
2006-01-01
Roč. 8, č. 1 (2006), s. 70-77 ISSN 1463-9262 R&D Projects: GA AV ČR IAA4031301 Institutional research plan: CEZ:AV0Z40310501 Keywords : ionic liquid * diesel fuel desulfurization * supercritical carbon dioxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.192, year: 2006
Revegetation of flue gas desulfurization sludge pond disposal sites
International Nuclear Information System (INIS)
Artiola, J.F.
1994-12-01
A comprehensive search of published literature was conducted to summarize research undertaken to date on revegetation of flue gas desulfurization (FGD) waste disposal ponds. A review of the physical and chemical properties of FGD sludges and wastes with similar characteristics is also included in order to determine the advantages and limitations of FGD sludge for plant growth. No specific guidelines have been developed for the revegetation of FGD sludge disposal sites. Survey studies showed that the wide-ranging composition of FGD wastes was determined primarily by the sulfur dioxide and other flue gas scrubbing processes used at powerplants. Sulfate rich (>90%CaSO 4 ) FGD sludges are physically and chemically more stable, and thus more amenable to revegetation. Because of lack of macronutrients and extremely limited microbial activity, FBD sludge ponds presented a poor plant growth environment without amendment. Studies showed the natural process of inoculation of the FGD sludge with soil microbes that promote plant growth be can after disposal but proceeded slowly. Revegetation studies reviewed showed that FGD sludges amended with soils supported a wider variety of plant species better and longer than abandoned FGD ponds. Two major types of plants have been successful in revegetation of FGD waste ponds and similar wastes: salt-tolerant plants and aquatic plants. A comprehensive list of plant species with potential for regetation of FGD sludge disposal pond sites is presented along with successful revegetation techniques
Energy Technology Data Exchange (ETDEWEB)
Hasan, Zubair; Jeon, Jaewoo [Department of Chemistry and Green-Nano Materials Research Center, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Jhung, Sung Hwa, E-mail: sung@knu.ac.kr [Department of Chemistry and Green-Nano Materials Research Center, Kyungpook National University, Daegu 702-701 (Korea, Republic of)
2012-02-29
Highlights: Black-Right-Pointing-Pointer Oxidative desulfurization was studied with WO{sub x}/ZrO{sub 2} calcined at different temp. Black-Right-Pointing-Pointer The importance of the phases of zirconia and tungsten oxide was suggested. Black-Right-Pointing-Pointer The catalyst was analyzed thoroughly with Raman and XRD techniques. Black-Right-Pointing-Pointer The importance of electron density on S was confirmed with the kinetics of oxidation. - Abstract: Oxidative desulfurization (ODS) of model fuel containing benzothiophene (BT) or thiophene (Th) has been carried out with WO{sub x}/ZrO{sub 2} catalyst, which was calcined at various temperatures. Based on the conversion of BT in the model fuel, it can be shown that the optimum calcination temperature of WO{sub x}/ZrO{sub 2} catalyst is around 700 Degree-Sign C. The most active catalyst is composed of tetragonal zirconia (ZrO{sub 2}) with well dispersed polyoxotungstate species and it is necessary to minimize the contents of the crystalline WO{sub 3} and monoclinic ZrO{sub 2} for a high BT conversion. The oxidation rate was interpreted with the first-order kinetics, and it demonstrated the importance of electron density since the kinetic constant for BT was higher than that for Th even though the BT is larger than Th in size. A WO{sub x}/ZrO{sub 2} catalyst, treated suitably, can be used as a reusable active catalyst in the ODS.
Fundamental studies of desulfurization processes: reaction of methanethiol on ZnO and Cs/ZnO
Dvorak, Joseph; Jirsak, Tomas; Rodriguez, José A.
2001-05-01
The reaction of methanethiol on ZnO and Cs promoted ZnO surfaces has been studied with synchrotron based photoemission and thermal desorption spectroscopy. On ZnO, methanethiol undergoes selective reaction to produce carbon monoxide (37-58%), methane (23-38%), formaldehyde (12-15%), ethane (1-11%), and a mixture of ethylene and acetylene (3-13%). At low temperatures (cleavage occurs to yield methyl intermediate and atomic S. Carbon is removed from the surface as gaseous products above 500 K, and atomic sulfur remains bound to the zinc sites of the surface. Submonolayer amounts of cesium do not have a significant promotional effect on C-S bond cleavage, whereas Cs multilayers are found to significantly lower the activation barrier for C-S bond cleavage. This study illustrates the chemistry associated with the desulfurization of thiols on a catalytically relevant oxide surface.
Energy Technology Data Exchange (ETDEWEB)
Tingmei Tang; Jiang Xu; Rongjie Lu; Jingjing Wo; Xinhua Xu [Zhejiang University, Hangzhou (China). Department of Environmental Engineering
2010-12-15
Secondary atmospheric pollutions may result from wet flue gas desulfurization (FGD) systems caused by the reduction of Hg{sup 2+} to Hg{sup 0}. The present study employed three agents: Na{sub 2}S, 2,4,6-trimercaptotiazine, trisodium salt nonahydrate (TMT) and sodium dithiocarbamate (DTCR) to precipitate aqueous Hg{sup 2+} in simulated desulfurization solutions. The effects of the precipitator's dosing quantity, the initial pH value, the reaction temperature, the concentrations of Cl{sup -} and other metal ions (e.g. Cu{sup 2+} and Pb{sup 2+}) on Hg{sup 2+} removal were studied. A linear relationship was observed between Hg{sup 2+} removal efficiency and the increasing precipitator's doses along with initial pH. The addition of chloride and metal ions impaired the Hg{sup 2+} removal from solutions due to the complexation of Cl{sup -} and Hg{sup 2+} as well as the chelating competition between Hg{sup 2+} and other metal ions. Based on a comprehensive comparison of the treatment effects, DTCR was found to be the most effective precipitating agent. Moreover, all the precipitating agents were potent enough to inhibit Hg{sup 2+} reduction as well as Hg{sup 0} re-emission from FGD liquors. More than 90% Hg{sup 2+} was captured by precipitating agents while Hg{sup 2+} reduction efficiency decreased from 54% to just less than 3%. The additives could efficiently control the secondary Hg{sup 0} pollution from FGD liquors. 21 refs., 6 figs.
Zaid, Hayyiratul Fatimah Mohd; Kait, Chong Fai; Mutalib, Mohamed Ibrahim Abdul
2014-10-01
Photocatalyts TiO2 doped with Cu, Fe and Cu-Fe metal at different calcination temperature and duration were successfully prepared and characterized. Photocatalytic oxidative desulfurization of model oil containing dibenzothiophene as the sulfur compound (100 ppm) using the prepared photocatalyst was investigated. The photocatalyst calcined at 500°C and duration of 1 h showed the best performance.
International Nuclear Information System (INIS)
Zhuang, Jiang Zhou; Jin, Xiao Yin; Shen, Xian Lin; Tan, Jun Jun; Nie, Long Hui; Xiang, Jian; Hu, Bing
2015-01-01
A series of catalysts, ionic liquid-modified SBA-15 (denoted ILSBA) doped with H 5 PMo 10 V 2 O 40 (HPMoV 2 ) have been synthesized and characterized by XRD, FT-IR, 1 H NMR, TG-DTA, and TEM. The catalyst was used for the removal of dibenzothiophene (DBT) in model oil combined with hydrogen peroxide (the oxidant) and acetonitrile (the phase-transfer agent). It was observed that the sulfur content of DBT can be reduced from 500 to 2 ppm by adjusting the amount of catalyst, the reaction temperatures and the reaction time. Besides, the catalyst activity for different sulfur compounds showed a huge difference which may be mainly affected by the electron densities of sulfur atom. Moreover, the catalyst can be recycled seven times without a significant loss in activity, which could be ascribed to the strong electrostatic interaction between ILSBA and HPMoV 2 . In addition, a postulated mechanism was proposed to reveal the oxidative desulfurization process
Energy Technology Data Exchange (ETDEWEB)
Flores Velazquez, Roberto; Rodas Grapain, Arturo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)
2008-07-01
In the present work, the oxidative desulfurization of fuel oils assisted by ultrasound was analyzed. It was studied the effect of hydrogen peroxide concentration, the fuel oil to aqueous solution volumetric ratio, and type of catalyst. The Fenton-like catalysts studied were ferric chloride and copper sulfate. [Spanish] En esta investigacion se analiza la desulfuracion oxidativa de combustoleo asistida con ultrasonido. Tambien se estudia el efecto de la concentracion de peroxido de hidrogeno (H{sub 2}O{sub 2}), la relacion volumetrica combustoleo/solucion acuosa y el tipo de catalizador. Los catalizadores tipo Fenton que se estudiaron fueron el cloruro ferrico (FeCl{sub 3}) y el sulfato de cobre (CuSO{sub 4}).
Attapulgite-CeO2/MoS2 ternary nanocomposite for photocatalytic oxidative desulfurization
Li, Xiazhang; Zhang, Zuosong; Yao, Chao; Lu, Xiaowang; Zhao, Xiaobing; Ni, Chaoying
2016-02-01
Novel attapulgite(ATP)-CeO2/MoS2 ternary nanocomposites were synthesized by microwave assisted assembly method. The structures of the nanocomposites were characterized by XRD, FT-IR, UV-vis, XPS and in situ TEM. The photocatalytic activities of ATP-CeO2/MoS2 composites were investigated by degradating dibenzothiophene (DBT) in gasoline under visible light irradiation. The effect of the mass ratio of CeO2 to MoS2 on photocatalytic activity was investigated. The results indicate that the three-dimensional network structure is firmly constructed by ATP skeleton, CeO2 particles and MoS2 nanosheet which effectively increase the surface area of the composites and promote the separation of electrons and holes by resulting electronic transmission channels of multi-channel in space. The degradation rate of DBT can reach 95% under 3 h irradiation when the mass ratio of CeO2/MoS2 is 4/10. A plausible mechanism for the photocatalytic oxidative desulfurization of this nanocomposite is put forward.
Desulfurization reaction of high sulfur content flue gas treated by electron beam
International Nuclear Information System (INIS)
Hirosawa, Shojiro; Suzuki, Ryoji; Aoki, Shinji; Kojima, Takuji; Hashimoto, Shoji
2002-01-01
Experiments of flue gas treatment by electron beam were carried out, using simulated ligniteburning flue gas containing SO 2 (5500 ppm), NO (390 ppm) and H 2 O (22%). Removal efficiency of SO 2 was more than 90% at a dose of 1-2 kGy. It shows applicability of electron beam for treatment of lignite-burning flue gas. Another removal reaction besides the radiation-induced radical reaction and the thermal reaction occurring without irradiation was suggested by the facts that removal of SO 2 by the radical reaction is only a few hundreds of ppm and the removal amounts by thermal reaction under irradiation is lower than a half of total desulfurization. The mechanism similar to thermal reaction was proposed, assuming simultaneous uptake reaction of SO 2 and NH 3 on the surface of liquid aerosol. It was suggested that ammonium nitrate having deliquescence relative humidity (DRH) of 60% at 25 deg C plays an important role in producing liquid aerosols. Decrease of DRH of ammonium nitrate with elevating temperature and with formation of double salt of ammonium sulfate results in enhancement of formation of liquid aerosols. (author)
Simulation of the operation of an industrial wet flue gas desulfurization system
International Nuclear Information System (INIS)
Kallinikos, L.E.; Farsari, E.I.; Spartinos, D.N.; Papayannakos, N.G.
2010-01-01
In this work the simulation of a wet flue gas desulfurization (FGD) unit with spray tower of a power plant is presented, aiming at an efficient follow-up and the optimization of the FGD system operation. The dynamic model developed to simulate the performance of the system has been validated with operation data collected over a long period of time. All the partaking physical and chemical processes like the limestone dissolution, the crystallization of calcium sulfite and gypsum and the oxidation of sulfite ions have been taken into account for the development of the simulation model while the gas absorption by the liquid droplets was based on the two-film theory. The effect of the mean diameter of the slurry droplets on the performance of the system was examined, as it was used as an index factor of the normal operation of the system. The operation limits of the system were investigated on the basis of the model developed. It is concluded that the model is capable of simulating the system for significantly different SO 2 loads and that the absorption rate of SO 2 is strongly affected by the liquid dispersion in the tower. (author)
Kawakami, Ryushi; Ohmori, Taketo; Sakuraba, Haruhiko; Ohshima, Toshihisa
2015-08-01
To date, there have been few reports analyzing the amino acid requirement for growth of hyperthermophilic archaea. We here found that the hyperthermophilic archaeon Pyrococcus horikoshii OT-3 requires Thr, Leu, Val, Phe, Tyr, Trp, His and Arg in the medium for growth, and shows slow growth in medium lacking Met or Ile. This largely corresponds to the presence, or absence, of genes related to amino acid biosynthesis in its genome, though there are exceptions. The amino acid requirements were dramatically lost by addition of D-isomers of Met, Leu, Val, allo-Ile, Phe, Tyr, Trp and Arg. Tracer analysis using (14)C-labeled D-Trp showed that D-Trp in the medium was used as a protein component in the cells, suggesting the presence of D-amino acid metabolic enzymes. Pyridoxal 5'-phosphate (PLP)-dependent racemase activity toward Met, Leu and Phe was detected in crude extract of P. horikoshii and was enhanced in cells grown in the medium supplemented with D-amino acids, especially D-allo-Ile. The gene encoding the racemase was narrowed down to one open reading frame on the basis of enzyme purification from P. horikoshii cells, and the recombinant enzyme exhibited PLP-dependent racemase activity toward several amino acids, including Met, Leu and Phe, but not Pro, Asp or Glu. This is the first report showing the presence in a hyperthermophilic archaeon of a PLP-dependent amino acid racemase with broad substrate specificity that is likely responsible for utilization of D-amino acids for growth.
Energy Technology Data Exchange (ETDEWEB)
Pampa, K.J., E-mail: sagarikakj@gmail.com [Department of Studies in Microbiology, University of Mysore, Mysore 570 006 (India); Lokanath, N.K. [Department of Studies in Physics, University of Mysore, Mysore 570 006 (India); Girish, T.U. [Department of General Surgery, JSS Medical College and Hospital, JSS University, Mysore 570 015 (India); Kunishima, N. [Advanced Protein Crystallography Research Group, RIKEN SPring-8 Center, Harima Institute, Hyogo 679-5148 (Japan); Rai, V.R. [Department of Studies in Microbiology, University of Mysore, Mysore 570 006 (India)
2014-10-24
Highlights: • Determined the structure of UDP-D-ManNAcADH to a resolution of 1.55 Å. • First complex structure of PhUDP-D-ManNAcADH with UDP-D-ManMAcA. • The monomeric structure consists of three distinct domains. • Cys258 acting as catalytic nucleophilic and Lys204 acts as acid/base catalyst. • Oligomeric state plays an important role for the catalytic function. - Abstract: UDP-N-acetyl-D-mannosamine dehydrogenase (UDP-D-ManNAcDH) belongs to UDP-glucose/GDP-mannose dehydrogenase family and catalyzes Uridine-diphospho-N-acetyl-D-mannosamine (UDP-D-ManNAc) to Uridine-diphospho-N-acetyl-D-mannosaminuronic acid (UDP-D-ManNAcA) through twofold oxidation of NAD{sup +}. In order to reveal the structural features of the Pyrococcus horikoshii UDP-D-ManNAcADH, we have determined the crystal structure of the product-bound enzyme by X-ray diffraction to resolution of 1.55 Å. The protomer folds into three distinct domains; nucleotide binding domain (NBD), substrate binding domain (SBD) and oligomerization domain (OD, involved in the dimerization). The clear electron density of the UDP-D-ManNAcA is observed and the residues binding are identified for the first time. Crystal structures reveal a tight dimeric polymer chains with product-bound in all the structures. The catalytic residues Cys258 and Lys204 are conserved. The Cys258 acts as catalytic nucleophile and Lys204 as acid/base catalyst. The product is directly interacts with residues Arg211, Thr249, Arg244, Gly255, Arg289, Lys319 and Arg398. In addition, the structural parameters responsible for thermostability and oligomerization of the three dimensional structure are analyzed.
Directory of Open Access Journals (Sweden)
Tiantian Su
2018-02-01
Full Text Available Dibenzothiophene (DBT and their derivatives, accounting for the major part of the sulfur components in crude oil, make one of the most significant pollution sources. The DBT sulfone monooxygenase BdsA, one of the key enzymes in the “4S” desulfurization pathway, catalyzes the oxidation of DBT sulfone to 2′-hydroxybiphenyl 2-sulfonic acid (HBPSi. Here, we determined the crystal structure of BdsA from Bacillus subtilis WU-S2B, at the resolution of 2.2 Å, and the structure of the BdsA-FMN complex at 2.4 Å. BdsA and the BdsA-FMN complex exist as tetramers. DBT sulfone was placed into the active site by molecular docking. Seven residues (Phe12, His20, Phe56, Phe246, Val248, His316, and Val372 are found to be involved in the binding of DBT sulfone. The importance of these residues is supported by the study of the catalytic activity of the active site variants. Structural analysis and enzyme activity assay confirmed the importance of the right position and orientation of FMN and DBT sulfone, as well as the involvement of Ser139 as a nucleophile in catalysis. This work combined with our previous structure of DszC provides a systematic structural basis for the development of engineered desulfurization enzymes with higher efficiency and stability.
Zaid, Hayyiratul Fatimah Mohd; Kait, Chong Fai; Mutalib, Mohamed Ibrahim Abdul
2016-11-01
A series of metal doped TiO2 namely Fe/TiO2, Cu/TiO2 and Cu-Fe/TiO2 were synthesized and characterized, to be used as a photocatalyst in the integrated photooxidative extractive deep desulfurization for model oil (dodecane) and diesel fuel. The order of the photocatalytic activity was Cu-Fe/TiO2 followed by Cu/TiO2 and then Fe/TiO2. Cu-Fe/TiO2 was an effective photocatalyst for sulfur conversion at ambient atmospheric pressure. Hydrogen peroxide was used as the source of oxidant and eutectic-based ionic liquid as the extractant. Sulfur conversion in model oil reached 100%. Removal of sulfur from model oil was done by two times extraction with a removal of 97.06% in the first run and 2.94% in the second run.
Chen, Liming; Stehouwer, Richard; Tong, Xiaogang; Kost, Dave; Bigham, Jerry M; Dick, Warren A
2015-09-01
Abandoned coal-mined lands are a worldwide concern due to their potential negative environmental impacts, including erosion and development of acid mine drainage. A field study investigated the use of a dry flue gas desulfurization product for reclamation of abandoned coal mined land in USA. Treatments included flue gas desulfurization product at a rate of 280 Mg ha(-1) (FGD), FGD at the same rate plus 112 Mg ha(-1) yard waste compost (FGD/C), and conventional reclamation that included 20 cm of re-soil material plus 157 Mg ha(-1) of agricultural limestone (SOIL). A grass-legume sward was planted after treatment applications. Chemical properties of surface runoff and tile water (collected from a depth of 1.2m below the ground surface) were measured over both short-term (1-4 yr) and long-term (14-20 yr) periods following reclamation. The pH of surface runoff water was increased from approximately 3, and then sustained at 7 or higher by all treatments for up to 20 yr, and the pH of tile flow water was also increased and sustained above 5 for 20 yr. Compared with SOIL, concentrations of Ca, S and B in surface runoff and tile flow water were generally increased by the treatments with FGD product in both short- and long-term measurements and concentrations of the trace elements were generally not statistically increased in surface runoff and tile flow water over the 20-yr period. However, concentrations of As, Ba, Cr and Hg were occasionally elevated. These results suggest the use of FGD product for remediating acidic surface coal mined sites can provide effective, long-term reclamation. Copyright © 2015. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Kobayashi, Makoto; Akiho, Hiroyuki
2016-01-01
Highlights: • Power plant with semi-closed gas turbine and O_2–CO_2 coal gasifier was studied. • Dry gas sulfur removal sorbent was improved for durability to carbon deposition. • The improved sorbent showed very low amount of deposited carbon during operation. • The sorbent is regenerable to be used repeatedly in the cyclic operation. • The sorbent exhibited high sulfur-removal performance in the cyclic operation. - Abstract: The dry sulfur-removal process is essential to provide suitable syngas treatment for the oxy-fuel integrated gasification combined cycle power generation plant. It is required that the dry sulfur-removal process to be durable to the carbon deposition due to syngas containing high concentration of carbon monoxide in addition to achieve sufficient performance for sulfur removal. Zinc ferrite sorbent is the most promising candidate for the dry sulfur-removal process. The sorbent was improved to enhance durability to the carbon deposition by modifying preparation. The improved sorbent was prepared from sulfates as the raw materials of zinc ferrite, while the former sorbent was using nitrates as the raw materials. The improved sorbent as well as the former sorbent were evaluated on the performance and carbon deposition tendency in oxy-fuel syngas condition in a fixed bed reactor at elevated pressure and temperature. The results expressed that the improved sorbent has higher desulfurization performance and durability to carbon deposition in the condition expected for cyclic operation of the sulfur-removal process in comparison with the former sorbent. The improved sorbent possessed the superior desulfurization performance as well as the capability for inhibit carbon deposition in the oxy-fuel syngas conditions. The results confirmed the enhanced feasibility of the dry sulfur-removal process by utilizing the improved sorbent.
International Nuclear Information System (INIS)
Arce, Alberto; Francisco, Maria; Soto, Ana
2010-01-01
Suitability of a pyridinium ionic liquid as a solvent in desulfurization has been analyzed. (Liquid + liquid) equilibria for ternary systems composed by 1-hexyl-3,5-dimethyl pyridinium {bis[trifluoromethylsulfonyl]imide, thiophene, and three hydrocarbons representative of fuel (n-heptane, 2,2,4 trimethylpentane, and toluene) have been determined at T = 298.15 K and atmospheric pressure. High solubility of thiophene in the ionic liquid and also of toluene have been found, being this solvent practically immiscible with 2,2,4 trimethylpentane and heptane. Equilibrium data of these systems have been well correlated with UNIQUAC equations finding the highest deviations for the ternary system involving toluene. NRTL model drove to worse results being considered as not suitable model to correlate the experimental results.
José da Silva, Márcio; Faria dos Santos, Lidiane
2013-01-01
A novel process was developed for oxidative desulfurization (ODS) in the absence of a phase transfer catalyst (PTC) using only Keggin heteropolyacids and their aluminum salts as catalysts. Reactions were performed in biphasic mixtures of isooctane/acetonitrile, with dibenzothiophene (DBT) as a model sulfur compound and hydrogen peroxide as the oxidant. Remarkably, only the AlPMo12O40-catalyzed reactions resulted in complete oxidation of DBT into DBT sulfone, which was totally extracted by ace...
International Nuclear Information System (INIS)
Eisch, J.J.; Im, K.R.
1979-01-01
The ease of interaction of Ni(0) complexes with organic substrates has been shown to depend upon both the ligands on nickel and the solvent. The presence of α,α'-bipyridyl with the Ni(0) complex and the alkyne led to the isolation of a nickelacyclopropene, an observation in accord with the recently proposed metallocyclic pathway for the Ni(0)-catalyzed trimerization of alkynes. Allylic and benzylic ethers and epoxides have been observed to undergo oxidative insertion of Ni(0) into their C-O bonds with solvent (TMEDA > THF (tetrahydrofuran) > Et 2 O > C 6 H 6 ) and ligand (Et 3 P (tripthyl phosphine) > Ph 3 P (triphenyl phosphine); α,α'-bipy > COD) effects consistent with an electron-transfer attack by Ni(0). With such sulfur heterocycles as dibenzothiophene, phenoxathiin, phenothiazine, and thianthrene, a 1:1 admixture of (COD) 2 Ni with α,α'-bipyridyl gave as the principal product the desulfurized, ring-contracted cyclic product
Directory of Open Access Journals (Sweden)
Ezzat Rafiee
2016-10-01
Full Text Available Abstract 12-Tungstophosphoric acid (PW supported on KSF montmorillonite, PW/KSF, was used as catalyst for deep oxidative desulfurization (ODS of mixed thiophenic compounds in model oil and crude oil under mild conditions using hydrogen peroxide (H2O2 as an oxidizing agent. A one-factor-at-a-time method was applied for optimizing the parameters such as temperature, reaction time, amount of catalyst, type of extractant and oxidant-to-sulfur compounds (S-compounds molar ratio. The corresponding products can be easily removed from the model oil by using ethanol as the best extractant. The results showed high catalytic activity of PW/KSF in the oxidative removal of dibenzothiophene (DBT and mixed thiophenic model oil under atmospheric pressure at 75 °C in a biphasic system. To investigate the oxidation and adsorption effects of crude oil composition on ODS, the effects of cyclohexene, 1,7-octadiene and o-xylene with different concentrations were studied.
Preparation of WO3/g-C3N4 composites and their application in oxidative desulfurization
International Nuclear Information System (INIS)
Zhao, Rongxiang; Li, Xiuping; Su, Jianxun; Gao, Xiaohan
2017-01-01
Highlights: • The WO 3 /g-C 3 N 4 was successfully synthesized through simple calcination. • The process is simple and the cost raw materials is cheap. • The WO 3 /g-C 3 N 4 firstly applied to ODS. • The desulpurization rate of WO 3 /g-C 3 N 4 may attach to 91.2%. • Five recycles of WO 3 /g-C 3 N 4 still attach to 89.5% due to heterogeneous catalysis. - Abstract: WO 3 /graphitic carbon nitride (g-C 3 N 4 ) composites were successfully synthesized through direct calcining of a mixture of WO 3 and g-C 3 N 4 at 400 °C for 2 h. The WO 3 was prepared by calcination of phosphotungstic acid at 550 °C for 4 h, and the g-C 3 N 4 was obtained by calcination of melamine at 520 °C for 4 h. The WO 3 /g-C 3 N 4 composites were characterized by X-ray diffraction (XRD), Scanning electron microscopy (SEM), Fourier-transform infrared spectroscopy (FT-IR), and Brunner−Emmett−Teller analysis (BET). The WO 3 /g-C 3 N 4 composites exhibited stronger XRD peaks of WO 3 and g-C 3 N 4 than the WO 3 and pure g-C 3 N 4 . In addition, two WO 3 peaks at 25.7° and 26.6° emerged for the 36% −WO 3 /g-C 3 N 4 composite. This finding indicated that WO 3 was highly dispersed on the surface of the g-C 3 N 4 nanosheets and interacted with the nanosheets, which resulted in the appearance of (012) and (022) planes of WO 3 . The WO 3 /g-C 3 N 4 composite also exhibited a larger specific surface area and higher degree of crystallization than WO 3 or pure g-C 3 N 4 , which resulted in high catalytic activity of the catalyst. Desulfurization experiments demonstrated that the desulfurization rate of dibenzothiophene (DBT) in model oil reached 91.2% under optimal conditions. Moreover, the activity of the catalyst was not significantly decreased after five recycles.
Energy Technology Data Exchange (ETDEWEB)
Zhuang, Jiang Zhou; Jin, Xiao Yin; Shen, Xian Lin; Tan, Jun Jun; Nie, Long Hui; Xiang, Jian; Hu, Bing [Dept. of chool of Chemistry and Chemical Engineering, Hubei University of Technology, Wuhan (China)
2015-07-15
A series of catalysts, ionic liquid-modified SBA-15 (denoted ILSBA) doped with H{sub 5}PMo{sub 10}V{sub 2}O{sub 40} (HPMoV{sub 2}) have been synthesized and characterized by XRD, FT-IR, {sup 1}H NMR, TG-DTA, and TEM. The catalyst was used for the removal of dibenzothiophene (DBT) in model oil combined with hydrogen peroxide (the oxidant) and acetonitrile (the phase-transfer agent). It was observed that the sulfur content of DBT can be reduced from 500 to 2 ppm by adjusting the amount of catalyst, the reaction temperatures and the reaction time. Besides, the catalyst activity for different sulfur compounds showed a huge difference which may be mainly affected by the electron densities of sulfur atom. Moreover, the catalyst can be recycled seven times without a significant loss in activity, which could be ascribed to the strong electrostatic interaction between ILSBA and HPMoV{sub 2}. In addition, a postulated mechanism was proposed to reveal the oxidative desulfurization process.
Structural analysis of β-glucosidase mutants derived from a hyperthermophilic tetrameric structure
International Nuclear Information System (INIS)
Nakabayashi, Makoto; Kataoka, Misumi; Mishima, Yumiko; Maeno, Yuka; Ishikawa, Kazuhiko
2014-01-01
Substitutive mutations that convert a tetrameric β-glucosidase into a dimeric state lead to improvement of its crystal quality. β-Glucosidase from Pyrococcus furiosus (BGLPf) is a hyperthermophilic tetrameric enzyme which can degrade cellooligosaccharides to glucose under hyperthermophilic conditions and thus holds promise for the saccharification of lignocellulosic biomass at high temperature. Prior to the production of large amounts of this enzyme, detailed information regarding the oligomeric structure of the enzyme is required. Several crystals of BGLPf have been prepared over the past ten years, but its crystal structure had not been solved until recently. In 2011, the first crystal structure of BGLPf was solved and a model was constructed at somewhat low resolution (2.35 Å). In order to obtain more detailed structural data on BGLPf, the relationship between its tetrameric structure and the quality of the crystal was re-examined. A dimeric form of BGLPf was constructed and its crystal structure was solved at a resolution of 1.70 Å using protein-engineering methods. Furthermore, using the high-resolution crystal structural data for the dimeric form, a monomeric form of BGLPf was constructed which retained the intrinsic activity of the tetrameric form. The thermostability of BGLPf is affected by its oligomeric structure. Here, the biophysical and biochemical properties of engineered dimeric and monomeric BGLPfs are reported, which are promising prototype models to apply to the saccharification reaction. Furthermore, details regarding the oligomeric structures of BGLPf and the reasons why the mutations yielded improved crystal structures are discussed
Angers, M; Cloutier, J F; Castonguay, A; Drouin, R
2001-08-15
Ligation-Mediated Polymerase Chain Reaction (LMPCR) is the most sensitive sequencing technique available to map single-stranded DNA breaks at the nucleotide level of resolution using genomic DNA. LMPCR has been adapted to map DNA damage and reveal DNA-protein interactions inside living cells. However, the sequence context (GC content), the global break frequency and the current combination of DNA polymerases used in LMPCR affect the quality of the results. In this study, we developed and optimized an LMPCR protocol adapted for Pyrococcus furiosus exo(-) DNA polymerase (Pfu exo(-)). The relative efficiency of Pfu exo(-) was compared to T7-modified DNA polymerase (Sequenase 2.0) at the primer extension step and to Thermus aquaticus DNA polymerase (Taq) at the PCR amplification step of LMPCR. At all break frequencies tested, Pfu exo(-) proved to be more efficient than Sequenase 2.0. During both primer extension and PCR amplification steps, the ratio of DNA molecules per unit of DNA polymerase was the main determinant of the efficiency of Pfu exo(-), while the efficiency of Taq was less affected by this ratio. Substitution of NaCl for KCl in the PCR reaction buffer of Taq strikingly improved the efficiency of the DNA polymerase. Pfu exo(-) was clearly more efficient than Taq to specifically amplify extremely GC-rich genomic DNA sequences. Our results show that a combination of Pfu exo(-) at the primer extension step and Taq at the PCR amplification step is ideal for in vivo DNA analysis and DNA damage mapping using LMPCR.
Energy Technology Data Exchange (ETDEWEB)
Anderson, iain J.; Dharmarajan, Lakshmi; Rodriguez, Jason; Hooper, Sean; Porat, Iris; Ulrich, Luke E.; Elkins, James G.; Mavromatis, Kostas; Sun, Hui; Land, Miriam; Lapidus, Alla; Lucas, Susan; Barry, Kerrie; Huber, Harald; Zhulin, Igor B.; Whitman, William B.; Mukhopadhyay, Biswarup; Woese, Carl; Bristow, James; Kyrpides, Nikos
2008-09-05
Staphylothermus marinus is an anaerobic, sulfur-reducing peptide fermenter of the archaeal phylum Crenarchaeota. It is the third heterotrophic, obligate sulfur reducing crenarchaeote to be sequenced and provides an opportunity for comparative analysis of the three genomes. The 1.57 Mbp genome of the hyperthermophilic crenarchaeote Staphylothermus marinus has been completely sequenced. The main energy generating pathways likely involve 2-oxoacid:ferredoxin oxidoreductases and ADP-forming acetyl-CoA synthases. S. marinus possesses several enzymes not present in other crenarchaeotes including a sodium ion-translocating decarboxylase likely to be involved in amino acid degradation. S. marinus lacks sulfur-reducing enzymes present in the other two sulfur-reducing crenarchaeotes that have been sequenced - Thermofilum pendens and Hyperthermus butylicus. Instead it has three operons similar to the mbh and mbx operons of Pyrococcus furiosus, which may play a role in sulfur reduction and/or hydrogen production. The two marine organisms, S. marinus and H. butylicus, possess more sodium-dependent transporters than T. pendens and use symporters for potassium uptake while T. pendens uses an ATP-dependent potassium transporter. T. pendens has adapted to a nutrient-rich environment while H. butylicus is adapted to a nutrient-poor environment, and S. marinus lies between these two extremes. The three heterotrophic sulfur-reducing crenarchaeotes have adapted to their habitats, terrestrial vs. marine, via their transporter content, and they have also adapted to environments with differing levels of nutrients. Despite the fact that they all use sulfur as an electron acceptor, they are likely to have different pathways for sulfur reduction.
Increasing the production of desulfurizing biocatalysts by means of fed - batch culture
International Nuclear Information System (INIS)
Berdugo, C I; Mena, J A; Acero, J R; Mogollon, L
2001-01-01
Over the past years, environmental regulations have driven a lot of effort for the development of new technologies for the upgrading of fossil fuels. Biotechnology offers an alternative way to process fossil fuels by means of a biodesulfurization technology where the production of the biocatalyst is one of the key topics. Traditionally, the production is carried out in batch culture where the maximum cellular concentration is restricted by inherent limitations of the culture type and the microorganism growth rate. This work addresses the production of two desulfurizing microorganisms: Rhodococcus erythropolis IGTS8 and gordona rubropertinctus ICP172 using fed-batch culture. Fed-batch cultures were conducted in a 12 L fermentor using ICP 4 medium containing glucose and DMSO as carbon and sulfur sources. As a result, cell concentration was increased 1.5 and 3 times with fed-batch cultures using constant and exponential flow respectively, achieving a maximum cell concentration of 7.3 g DCW/L of biocatalyst igts8 and 12.85 gGDCW/L of the new biocatalyst ICP172. Both biocatalysts presented biodesulfurization activity in a spiked matrix DBT/HXD and in diesel matrix with the detection of 2-HBP which is the end-product of DBT degradation pathway
Energy Technology Data Exchange (ETDEWEB)
Wang, Lei; Zhao, Liang, E-mail: liangzhao@cup.edu.cn; Xu, Chunming; Wang, Yuxian; Gao, Jinsen
2017-03-31
Highlights: • Electronic characteristics determined adsorption characteristics of transition metals. • Cobalt has the similar adsorption ability of thiophene as nickel. • Adsorption capacity of Cr and Mo was extremely fierce, while Cu has the potential ability for adsorbing thiophene. • The preference adsorption site for thiophene was hollow site on all the seven surface. - Abstract: To explore characteristics of active metals for reactive adsorption desulfurization (RADS) technology, the adsorption of thiophene on M (100) (M = Cr, Mo, Co, Ni, Cu, Au, and Ag) surfaces was systematically studied by density functional theory with vdW correction (DFT + D3). We found that, in all case, the most stable molecular adsorption site was the hollow site and adsorptive capabilities of thiophene followed the order: Cr > Mo > Co ≈ Ni > Cu > Au ≈ Ag. By analyzing the nature of binding between thiophene and corresponding metals and the electronic structure of metals, the excessive activities of Cr and Mo were found to have a negative regeneration, the passive activities of Au and Ag were found to have an inactive adsorption for RADS adsorbent alone, while Ni and Co have appropriate characteristics as the active metals for RADS, followed by Cu.
Desulfurization of coal by pyrolysis and hydropyrolysis with addition of KOH/NaOH
Energy Technology Data Exchange (ETDEWEB)
Quanrun Liu; Haoquan Hu; Shengwei Zhu; Qiang Zhou; Wenying Li; Xianyong Wei; Kechang Xie [Dalian University of Technology, Dalian (China). Institute of Coal Chemical Engineering
2005-08-01
In this paper, a two-step desulfurization process for high-sulfur coal was investigated. Two Chinese coals with the addition of 10 wt % potassium hydroxide or sodium hydroxide were pyrolyzed under an atmosphere of nitrogen or hydrogen in a fixed-bed reactor at 600{sup o}C, and then the obtained chars were washed with hot water. The results indicated that, without the addition of an alkali component, the sulfur removal of these two coals by pyrolysis and hydropyrolysis is {approximately}40%-50% and the sulfur content of chars is reduced only slightly, in comparison with the original coals; with the addition of 10 wt % potassium hydroxide or sodium hydroxide into the original coals and the chars being washed with hot water, the sulfur removal is {approximately}70%-80% and the sulfur content in chars is reduced dramatically. The combustion behavior of chars was also investigated, using thermogravimetric analysis. The results showed that those chars that had an added alkali component and were subjected to water-washing were more reactive and can be burned more easily than those without added alkali, which was also confirmed by a kinetics analysis of char combustion. 21 refs., 3 figs., 6 tabs.
Siriwardane, Ranjani V.; Poston, James A.
1993-05-01
Characterization of copper oxides, iron oxides, and zinc copper ferrite desulfurization sorbents was performed by X-ray photoelectron spectroscopy and scanning electron microscopy/energy-dispersive spectroscopy at temperatures of 298 to 823 K. Analysis of copper oxides indicated that the satellite structure of the Cu22p region was absent in the Cu(I) state but was present in the Cu(II) state. Reduction of CuO at room temperature was observed when the ion gauge was placed close to the sample. The satellite structure was absent in all the copper oxides at 823 K in vacuum. Differentiation of the oxidation state of copper utilizing both Cu(L 3M 4,5M 4,5) X-ray-induced Auger lines and Cu2p satellite structure, indicated that the copper in zinc copper ferrite was in the + 1 oxidation state at 823 K. This + 1 state of copper was not significantly changed after exposure to H 2, CO, and H 2O. There was an increase in Cu/Zn ratio and a decrease in Fe/Zn ratio on the surface of zinc copper ferrite at 823 K compared to that at room temperature. These conditions of copper offered the best sulfidation equilibrium for the zinc copper ferrite desulfurization sorbent. Analysis of iron oxides indicated that there was some reduction of both Fe 2O 3 and FeO at 823K. The iron in zinc copper ferrite was similar to that of Fe 2O 3 at room temperature but there was some reduction of this Fe(III) state to Fe(II) at 823 K. This reduction was more enhanced in the presence of H 2 and CO. Reduction to Fe(II) may not be desirable for the lifetime of the sorbent.
Preparation And Characterization of Cu-Fe/ TiO2 Photocatalyst for Visible Light Deep Desulfurization
International Nuclear Information System (INIS)
Hayyiratul Fatimah Mohd Zaid; Kait, C.F.; Mohamed Ibrahim Abdul Mutalib
2016-01-01
A photooxidative system for deep desulfurization of model diesel fuel was explored. Nanoparticles of anatase titania (TiO 2 ) were synthesized via sol-gel hydrothermal method. The TiO 2 was further modified with bimetallic Cu-Fe using wet-impregnation method followed by calcination process in order to extend the activity region of the photocatalyst to visible-light. A series of bimetallic 2.2 wt % Cu-Fe/ TiO 2 photocatalysts with different Cu:Fe mass compositions were characterized for their physical, chemical and optical properties using X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), high resolution transmission electron microscopy (HRTEM), diffuse reflectance UV-visible spectroscopy (DR-UV-Vis), Fourier Transform Infrared Spectroscopy (FTIR) and Brunauer-Emmet-Teller (BET) surface area analysis. The performance of the photocatalysts was evaluated for photooxidation of dibenzothiophene (DBT) as the sulfur species from model oil in the presence of hydrogen peroxide, H 2 O 2 under 500 W visible light illumination. The highest sulfur conversion of 82.36 % was observed for photocatalyst with 10:1Cu:Fe mass composition. (author)
Hugenberg, Verena; Fröhlich, Roland; Haufe, Günter
2010-12-21
An oxidative desulfurization-fluorination protocol has been used to synthesize (2S)-2-(difluoromethyl)-N-tosylpyrrolidine (6a) and (2S)-2-(trifluoromethyl)-N-tosylpyrrolidine (7a) from the (2S)-prolinol-derived (2S)-2-(4-chlorophenylthiomethyl)-N-tosylpyrrolidine (9) or (2S)-2-(dithian-2-yl)-N-tosylpyrrolidine (5). Efforts to prepare 3,3-difluoroalanine similarly from an N-protected S-aryl-cysteine ester 17 gave only traces of the target compound 18. Instead, an unique N-(α,α-difluorobenzyl)-N-α',α'-dibromoglycine ester 19 was formed by an unprecedented sequence of reaction steps. A plausible mechanism is suggested involving a sulfur-assisted deoxygenation-difluorination of an imino oxygen and a haloform reaction like carbon-carbon bond fission as key-steps. Efforts to prepare (2S)-2-(fluoromethyl)-N-tosylpyrrolidine (12) from (2S)-N-tosylprolinol (3) by treatment with Fluolead™ (1-tert-butyl-4-trifluorosulfanyl-3,5-dimethylbenzene) gave only 5% of the target compound, but 95% of (3R)-3-fluoro-N-tosylpiperidine (11a) by ring enlargement.
Influence of surface phenomena in oxidative desulfurization with WOx/ZrO2 catalysts
Torres-García, E.; Canizal, G.; Velumani, S.; Ramírez-Verduzco, L. F.; Murrieta-Guevara, F.; Ascencio, J. A.
2004-12-01
Oil refinery related catalysis, particularly hydro desulfurization is viewed as a mature technology, but still we view that more efforts have to be made to boost the efficiency of the existing catalysts. So in this article we report the use of WOx/ZrO2 catalysts for the oxidation of dibenzothiophene (DBT) as a more effective material in nanometer scales. The WOx/ZrO2 samples were prepared by solid impregnation of ZrO2-x(OH)2x with ammonium metatungstate solution maintaining the pH at 10. Detailed structural and surface morphological analyses were carried out using Raman spectroscopy and Atomic force microscopy. In order to understand the catalytic activity which is largely influenced by the surface morphology, an interpretation based on the experimental results is given. The results showed an important correlation between the catalytic efficiency with the morphology of the surface which is identified as arrays of planes with steps of around 10 nm with the structures showing faceting with a preferential angle of 90°. It was established that when the number of W atoms in the surface increase the catalytic efficiency also increases. Thus we conclude that the material efficiency as a catalyst is directly related with the surface structure.
Yang, Huawei; Jiang, Bin; Sun, Yongli; Zhang, Luhong; Huang, Zhaohe; Sun, Zhaoning; Yang, Na
2017-07-05
In this work, the simple preparation of novel polymer supported polyoxometallates (POMs) catalysts has been reported. Soluble task-specific cross-linked poly (ionic liquid) (PIL) was prepared with N,N-dimethyl-dodecyl-(4-vinylbenzyl) ammonium chloride and divinylbenzene as co-monomers. The as-prepared cationic PILs were assembled with different commercial POMs to form the interlinked mesoporous catalysts, and the formation mechanism was provided. The catalytic oxidation activities of the catalysts were closely related to the formation pathway of their corresponding peroxide active species. The catalyst with H 2 W 12 O 42 10- as counterion, which exhibited the best activity in the oxidation of benzothiophene (BT) and dibenzothiophene (DBT) to sulfones in model oil with hydrogen peroxide (H 2 O 2 , 30wt%) as oxidant, was characterized by different techniques and systematically studied for its sulfur removal performance. As for the oxidative desulfurization of a real diesel, it was observed that almost all of the original sulfur compounds could be completely converted, and the catalyst could be reused for at least eight cycles without noticeable changes in both catalytic activity and chemical structure. In the end, a catalytic mechanism was put forward with the assistant of Raman analysis. Copyright © 2017 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Lima, Marco Antonio; Tenorio, Jorge Alberto Soares [Sao Paulo Univ., SP (Brazil). Escola Politecnica
1996-12-31
The sulfur withdrawal from liquid iron to compatible levels in steels plant processes capability is an important task of high quality rolled products fabrication. Mixture of lime forms a family of desulfurization agent frequently used, mainly their lower cost if injected in iron to reach not so lower levels of desulfurization. The use of this desulfurization agents produces approximately 7.0 Kg/t of slag, that results between 10 to 30 Kg/t of total slag. This slag interacts with the refractory lining of torpedo car, normally high alumina. In the present case it was analyzed an interaction between a slag formed by the use of the agent plus a blast furnace slag with a high alumina tar bonded lining. Isopleths of Ca O-Si O{sub 2}-Al{sub 2} O{sub 3} equilibrium diagram were constructed to represent the slag-refractory interaction. The results show that the use of the agent formed by lime and aluminium by-product is more deleterious to studied lining, what confirm the observations carried out in industrial plant. (author) 11 refs., 9 figs., 3 tabs.
ORF Sequence: NC_003413 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yrococcus furiosus DSM 3638] MKVLWIKEINAKDIKVSPRPVWKCRTCPMYGKRPSCPPHVPEWKEGKALVSSYEKALLVKFEIDTEHFENEKREVLRWLLNKEKELFREGYYYALALFPGNCNLCEECSFEKSRVCVAPHLVRPSIDAIGIELTSITDINFNERVLYGLILMY
Directory of Open Access Journals (Sweden)
Renjun Ruan
2017-02-01
Full Text Available In this study, micro-oxygen was integrated into a rusty scrap iron (RSI-loaded anaerobic digester. Under an optimal RSI dosage of 20 g/L, increasing O2 levels were added stepwise in seven stages in a semi-continuous experiment. Results showed the average methane yield was 306 mL/g COD (chemical oxygen demand, and the hydrogen sulphide (H2S concentration was 1933 ppmv with RSI addition. O2 addition induced the microbial oxidation of sulphide by stimulating sulfur-oxidizing bacteria and chemical corrosion of iron, which promoted the generation of FeS and Fe2S3. In the 6th phase of the semi-continuous test, deep desulfurization was achieved without negatively impacting system performance. Average methane yield was 301.1 mL/g COD, and H2S concentration was 75 ppmv. Sulfur mass balance was described, with 84.0%, 11.90% and 0.21% of sulfur present in solid, liquid and gaseous phases, respectively. The Polymerase Chain Reaction-Denaturing Gradient Gel Electrophoresis (PCR-DGGE analysis revealed that RSI addition could enrich the diversity of hydrogenotrophic methanogens and iron-reducing bacteria to benefit methanogenesis and organic mineralization, and impoverish the methanotroph (Methylocella silvestris to reduce the consumption of methane. Micro-oxygen supplementation could enhance the diversity of iron-oxidizing bacteria arising from the improvement of Fe(II release rate and enrich the sulphur-oxidising bacteria to achieved desulfurization. These results demonstrated that RSI addition in combination with micro-oxygenation represents a promising method for simultaneously controlling biogas H2S concentration and improving digestion performance.
Directory of Open Access Journals (Sweden)
Risfidian Mohadi
2016-03-01
Full Text Available Catalyst (NH46[b-P2W18O62]/Ta has been synthesized by simple wet impregnation at 30-40 °C under atmospheric conditions using Dawson type polyoxometalate (NH46[b-P2W18O62] and tantalum. The catalyst was characterized by FTIR spectrophotometer, XRD, SEM, and N2 adsorption desorption methods. FTIR spectrum of (NH46[b-P2W18O62]/Ta showed that Dawson type polyoxometalate (NH46[b-P2W18O62] and Ta was successfully impregnated which was indicated by vibration spectrum at wavenumber of 900-1100 cm-1 for polyoxometalate and 550 cm-1 for Ta. The surface area of the (NH46[b-P2W18O62]/Ta after impregnation was higher than (NH46[b-P2W18O62]•nH2O and its morphology was found to be uniform. The catalytic activity of (NH46[b-P2W18O62]/Ta toward desulfurization of dibenzothiophene was three times higher than the original catalyst of (NH46[b-P2W18O62]•nH2O without impregnation. The catalytic regeneration test of catalyst (NH46[b-P2W18O62]/Ta showed that the catalytic activity for first regeneration of catalyst has similar catalytic activity with the fresh catalyst without loss of catalytic activity indicated by almost similar percent conversion.
Evaluation of revegetation techniques of a saline flue gas desulfurization sludge pond
Energy Technology Data Exchange (ETDEWEB)
Salo, L.F.; Artiola, J.F.; Goodrich-Mahoney, J.W. [University of Arizona, Tucson, AZ (United States). Renewable National Resources
1999-01-01
Codisposal of flue gas desulfurization (FGD) sludge with low-volume generating station waste simplifies disposal but creates a saline, high boron (B) waste that may be difficult to revegetate after site closure. Studies on a delta of waste material in a codisposal pond at the coal-fired Coronado Generating Station in eastern Arizona evaluated management techniques, amendments, and plants for revegetating this material. One study investigated leaching and ridging techniques and a second evaluated amendment with manure, wood shavings, and fly ash, Four salt-tolerant grass species and four saltbushes (A triplex spp,) were evaluated in the two studies. Criteria for success were high survival rates and growth, as measured by grass height and shrub height x width. Leaching salts and B from the waste was not necessary for establishment and growth of transplanted shrubs and grasses. Ridging was not a successful technique, due to limited moisture and high levels of salinity and B on these structures. Gardner saltbush (A, gardneri (Moq.) D, Dietr.) and a fourwing saltbush (A. canescens (Pursh) Nutt,) accession from the site were the most successful shrubs and alkali sactonn (Sporobolus airoides (Torr,) Torr. `Saltalk`) was the most successful grass at this disposal pond. Amendment with manure, wood shavings, or fly ash did not increase plant survival. Growth of grasses was improved with all amendments and was greatest with manure, but growth of shrubs was not improved with any amendment. 33 refs., 8 tabs.
International Nuclear Information System (INIS)
König, C.F.J.; Nachtegaal, M.; Seemann, M.; Clemens, F.; Garderen, N. van; Biollaz, S.M.A.; Schildhauer, T.J.
2014-01-01
Highlights: • Mn sorbents remove H 2 S from hot syngas in chemical looping desulfurization process. • State of Mn followed by in situ X-ray absorption spectroscopy and mass spectrometry. • Two-step mechanism explains the formation of SO 2 under reducing conditions. - Abstract: Cleaning of producer gas from biomass gasification is required for further processing, e.g. to avoid catalyst poisoning in subsequent conversion steps. High-temperature gas cleaning, of which sulfur removal is an important part, is a promising way to improve the overall efficiency of biomass conversion. In a high temperature “chemical looping desulfurization” process, a sorbent material, here manganese oxide, is cycled between producer gas from the gasifier to remove sulfur species, and an oxidizing atmosphere, in which the sulfur species are released as SO 2 . Alternatively, the use of such material as reactive bed material could be integrated into an allothermal dual fluidized bed gasifier. In a laboratory reactor, we subjected manganese-based materials to a periodically changing gas atmosphere, simulating a “chemical looping desulfurization” reactor. The “fuel reactor” gas contained H 2 , CO, CH 4 and H 2 S, similar as in the producer gas, and the “oxidizing reactor” contained diluted O 2 . Mass spectrometry showed that most of the H 2 S is taken up by the sample in the “fuel reactor” part, while also some unwanted SO 2 is generated in the “fuel reactor” part. Most of the sulfur is released in the oxidizing reactor. Simultaneous in situ X-ray absorption spectroscopy (XAS) of the Mn materials during different stages of the chemical looping desulfurization process showed that the initial Mn 3 O 4 is transformed in the presence of H 2 S to MnS via a MnO intermediate in the fuel reactor. Oxygen from the reduction of Mn 3 O 4 oxidizes some H 2 S to the undesired SO 2 in the fuel reactor. Upon exposure to O 2 , MnS is again oxidized to Mn 3 O 4 via MnO, releasing SO
Geochemical Constraints on Archaeal Diversity in the Vulcano Hydrothermal System
Rogers, K. L.; Amend, J. P.
2006-12-01
The shallow marine hydrothermal system of Vulcano, Italy hosts a wide diversity of cultured thermophilic Archaea, including Palaeococcus helgesonii, Archaeoglobus fulgidus, and Pyrococcus furiosus, to name a few. However, recent studies have revealed a plethora of uncultured archaeal lineages in the Vulcano system. For example, a 16S rRNA gene survey of an onshore geothermal well identified a diverse archaeal community including deeply-branching uncultured Crenarchaeota, Korarchaeota, and Euryarchaeota. Additionally, culture-independent hybridization techniques suggested that Archaea account for nearly half of the microbial community in the Vulcano system. Furthermore, geochemical characterization of fluids revealed numerous lithotrophic and heterotrophic exergonic reactions that could support as yet uncultured organisms. Archaeal diversity throughout the Vulcano hydrothermal system was investigated using 16S rRNA gene surveys at five submarine vents and an onshore sediment seep. Overall, archaeal diversity was higher (10 groups) at submarine vents with moderate temperatures (59°C) compared with higher temperature (94°C) vents (4 groups). Archaeal communities at the moderately thermal vents were dominated by Thermococcales and also contained Archaeoglobales, Thermoproteales, and uncultured archaea among the Korarchaeota, Marine Group I, and the Deep-sea Hydrothermal Vent Euryarchaeota (DHVE). Fluid composition also affects the microbial community structure. At two high-temperature sites variations in archaeal diversity can be attributed to differences in iron and hydrogen concentrations, and pH. Comparing sites with similar temperature and pH conditions suggests that the presence of Desulfurococcales is limited to sites at which metabolic energy yields exceed 10 kJ per mole of electrons transferred. The Vulcano hydrothermal system hosts diverse archaeal communities, containing both cultured and uncultured species, whose distribution appears to be constrained by
Chen, Wen-Yi; Xu, Yiren; Cho, I-Ming; Oruganti, Sri Vidya; Foster, Mark P.; Gopalan, Venkat
2011-01-01
RNase P is a ribonucleoprotein (RNP) complex that utilizes a Mg2+-dependent RNA catalyst to cleave the 5′-leader of precursor tRNAs (pre-tRNAs) and generate mature tRNAs. The bacterial RNase P protein (RPP) aids RNase P RNA (RPR) catalysis by promoting substrate binding, Mg2+ coordination, and product release. Archaeal RNase P comprises an RPR and at least four RPPs, which have eukaryal homologs and function as two binary complexes (POP5•RPP30 and RPP21•RPP29). In this study, we employed a previously characterized substrate-enzyme conjugate [pre-tRNATyr-Methanocaldococcus jannaschii (Mja) RPR] to investigate the functional role of a universally conserved uridine in a bulge-helix structure in archaeal RPRs. Deletion of this bulged uridine resulted in an 80-fold decrease in the self-cleavage rate of pre-tRNATyr-MjaΔU RPR compared to the wildtype, and this defect was partially ameliorated upon addition of either RPP pair. The catalytic defect in the archaeal mutant RPR mirrors that reported in a bacterial RPR and highlights a parallel in their active sites. Furthermore, an N-terminal deletion mutant of Pyrococcus furiosus (Pfu) RPP29 that is defective in assembling with its binary partner RPP21, as assessed by isothermal titration calorimetry and NMR spectroscopy, is functional when reconstituted with the cognate Pfu RPR. Collectively, these results indicate that archaeal RPPs are able to compensate for structural defects in their cognate RPR and vice-versa, and provide striking examples of the cooperative subunit interactions critical for driving archaeal RNase P towards its functional conformation. (236 words) PMID:21683084
Gardberg, Anna S; Del Castillo, Alexis Rae; Weiss, Kevin L; Meilleur, Flora; Blakeley, Matthew P; Myles, Dean A A
2010-05-01
The locations of H atoms in biological structures can be difficult to determine using X-ray diffraction methods. Neutron diffraction offers a relatively greater scattering magnitude from H and D atoms. Here, 1.65 A resolution neutron diffraction studies of fully perdeuterated and selectively CH(3)-protonated perdeuterated crystals of Pyrococcus furiosus rubredoxin (D-rubredoxin and HD-rubredoxin, respectively) at room temperature (RT) are described, as well as 1.1 A resolution X-ray diffraction studies of the same protein at both RT and 100 K. The two techniques are quantitatively compared in terms of their power to directly provide atomic positions for D atoms and analyze the role played by atomic thermal motion by computing the sigma level at the D-atom coordinate in simulated-annealing composite D-OMIT maps. It is shown that 1.65 A resolution RT neutron data for perdeuterated rubredoxin are approximately 8 times more likely overall to provide high-confidence positions for D atoms than 1.1 A resolution X-ray data at 100 K or RT. At or above the 1.0sigma level, the joint X-ray/neutron (XN) structures define 342/378 (90%) and 291/365 (80%) of the D-atom positions for D-rubredoxin and HD-rubredoxin, respectively. The X-ray-only 1.1 A resolution 100 K structures determine only 19/388 (5%) and 8/388 (2%) of the D-atom positions above the 1.0sigma level for D-rubredoxin and HD-rubredoxin, respectively. Furthermore, the improved model obtained from joint XN refinement yielded improved electron-density maps, permitting the location of more D atoms than electron-density maps from models refined against X-ray data only.
Energy Technology Data Exchange (ETDEWEB)
1932-12-21
A process is described of desulfurizing, dephenelating, and cracking the dry pitch obtained by dry distillation of lignite, bituminous shale, asphaltic rocks, and peat and fossil coals, that is characterized by the raw material being distilled in a retort together with calcium oxide, the vapors escaping from the still being compelled to pass through a catalyst tube containing calcium oxide mixed with other metallic oxide, the catalyst being helped by suitable heating to a temperature higher than that of the retort mentioned. For the purpose of lessening the quantity of phenolic groups contained in the raw tar to eliminate a great part of the sulfur belonging to the thiophenols and hydrogen sulfide without removing the organic radical to which they are attached, to accomplish a pyrogenic dissociation at the temperature of distillation of the pitch by means of using bone acid (phosphoric) to obtain a greater yield of light hydrocarbon from heavy hydrocarbons. Another purpose is the elimination of sulfur and thiophene and whatever neutral sulfur is contained in the primary pitch, by means of iron sulfate and copper in the anhydrous state or by means of other sulfates whose metals have the ability to form sulfides with sulfur.
Burt, Christopher D; Cabrera, Miguel L; Rothrock, Michael J; Kissel, D E
2017-08-01
A major concern of the broiler industry is the volatilization of ammonia (NH3) from the mixture of bedding material and broiler excretion that covers the floor of broiler houses. Gypsum has been proposed as a litter amendment to reduce NH3 volatilization, but reports of NH3 abatement vary among studies and the mechanism responsible for decreasing NH3 volatilization is not well understood. The goal of this study was to evaluate the effect of adding 20 or 40% flue-gas desulfurization gypsum (FGDG) to broiler litter on pH, electrical conductivity (EC), water potential, urea-degrading bacteria abundance, NH3 and carbon dioxide (CO2) evolution, and nitrogen (N) mineralization in several 21-d experiments. The addition of FGDG to broiler litter increased EC by 24 to 33% (P mineralization by 10 to 11% (P = 0.0001) as compared to litters not amended with FGDG. Furthermore, the addition of FGDG to broiler litter decreased NH3 volatilization by 18 to 28% (P litter pH values compared to un-amended litter (P litter with 20% FGDG can decrease NH3 volatilization and increase the fertlizer value of broiler litter. © 2017 Poultry Science Association Inc.
Energy Technology Data Exchange (ETDEWEB)
Salo, L.F.; Artiola, J.F.; Goodrich-Mahoney, J.W. [University of Arizona, Tuscon, AZ (United States). Dept. of Soil, Water and Environmental Science
1997-07-01
Codisposing low-volume wastes from electrical generating stations with flue gas desulfurization (FGD) scrubber sludge simplifies waste disposal but produces a saline waste that presents unique challenges to revegetation. This greenhouse study identified plants and amendments for revegetating a saline FGD sludge disposal pond in eastern Arizona. Survival and growth of 16 sown accessions plus two vegetatively propagated accessions of inland saltgrass were investigated in saline FGD sludge. Amendments used included two soils from the disposal site, Claysprings gravelly clay and Sheppard sand, composted steer manure, and N-P-K fertilizers. Sols and manure were added at 2:1 sludge/amendment (v/v). Plants were irrigated with a 1:1 mixture of disposal pond water and untreated well water. One accession of inland saltgrass, two cultivars of tall wheatgrass, Altai wildrye tall fescue and alkali sacaton show promise for revegetating saline FGD sludge disposal sites. Survival rates were the same in unamended sludge and in sludge amended with the clay soil or with N-P-K fertilizer. Plant dry matter produced was the same in unamended sludge and in sludge amended with either of the soils or with N-P-K. Although survival rates were significantly lower with manure than with any other amendment, growth was significantly greater by all measurements, due to the high fertility of this treatment. 34 refs., 5 tabs.
Azam Akbari; Mohammadreza Omidkhah; Jafar Toufighi Darian
2012-01-01
The mesoporous MoO3/γ-Al2O3 catalyst was prepared by incipient wetness impregnation method aiming to investigate the effect of drying method and molybdenum content on the catalyst property and performance towards the oxidation of benzothiophene (BT), dibenzothiophene (DBT) and 4,6-dimethyle dibenzothiophene (4,6-DMDBT) with H2O2 for deep oxidative desulfurization of diesel fuel. The catalyst was characterized by XRD, BET, BJH and SEM method. The catalyst with 10wt.% and 1...