Diagnosis of Pentatrichomonas hominis from domestic cats in Southeastern Brazil

Directory of Open Access Journals (Sweden)

Caroline S. dos Santos

2015-12-01

Full Text Available ABSTRACT. dos Santos C.S., McIntosh D., Berto B.P., de Jesus V.L.T., da Rocha C.N.C., Fernandes J.I., Scott F.B. & Lopes C.W.G. Diagnosis of Pentatrichomonas hominis from domestic cats in Southeastern Brazil. [Diagnóstico de Pentatrichomonas hominis em gatos no sudeste do Brasil.] Revista Brasileira de Medicina Veterinária, 37(Supl.1:25-31, 2015. Curso de Pós-Graduação em Ci- ências Veterinárias, Anexo 1, Instituto de Veterinária, Universidade Federal Rural do Rio de Janeiro, BR-465 Km 7, Campus Seropédica, RJ 23897-970, Brasil. E-mail: carolinespitz@yahoo.com.br The parabasalid flagellate Tritrichomonas foetus is recognized as the causative agent of large bowel diarrhea in domestic cats. A second species of parabasalid flagellate Pentatrichomonas hominis, has also been reported in association with domestic cats, albeit almost exclusively as a commensal organism. However, there is growing evidence to suggest that P. hominis may also be involved in feline gastro-intestinal disorders including diarrhea and that the incidence of infection with P. hominis may have been underestimated due to it being misidentified as T. foetus. The aim of the current study was to establish the basis for routine morphological identification of P. hominis employing light microscopy and to apply the methodology to the examination of cases of diarrhea in a laboratory population of Brazilian domestic cats (n =39. A detailed morphological description of P. hominis isolated from 11 cats with diarrhea was produced and molecular analyses were performed in support of the morphological data and to demonstrate the absence of T. foetus in infected cats. All animals with diarrhea were demonstrated to be infected solely with P. hominis. The findings of the current study provide a straight forward and validated method for the differential diagnosis of P. hominis and contribute to the on-going debate surrounding the pathogenic potential of this parabasalid flagellate.

Cardiothoracic Transplant Recipient Mycoplasma hominis: An Uncommon Infection with Probable Donor Transmission

Directory of Open Access Journals (Sweden)

Rahul Sampath

2017-05-01

Full Text Available The role of infection with Mycoplasma hominis following cardiothoracic organ transplantation and its source of transmission have not been well-defined. Here, we identify and describe infection with M. hominis in patients following cardiothoracic organ transplantation after reviewing all cardiothoracic transplantations performed at our center between 1998 and July 2015. We found seven previously unreported cases of M. hominis culture positive infection all of whom presented with pleuritis, surgical site infection, and/or mediastinitis. PCR was used to establish the diagnosis in four cases. In two instances, paired single lung transplant recipients manifested infection, and in one of these pairs, isolates were indistinguishable by multilocus sequence typing (MLST. To investigate the prevalence of M. hominis in the lower respiratory tract, we tested 178 bronchoalveolar lavage (BAL fluids collected from immunocompromised subjects for M. hominis by PCR; all were negative. Review of the literature revealed an additional 15 cases of M. hominis in lung transplant recipients, most with similar clinical presentations to our cases. We recommend that M. hominis should be considered in post-cardiothoracic transplant infections presenting with pleuritis, surgical site infection, or mediastinitis. M. hominis PCR may facilitate early diagnosis and prompt therapy. Evaluation for possible donor transmission should be considered.

Cardiobacterium hominis and Cardiobacterium valvarum

DEFF Research Database (Denmark)

Bonavent, Tina Bennett; Nielsen, Xiaohui Chen; Kristensen, Kjeld Skødebjerg

2016-01-01

Introduction: Cardiobacterium hominis and Cardiobacterium valvarum are well known, though rare, etiologic agents of infective endocarditis. Cardiac devices are increasingly implanted. Case Reports: Two cases of infective episodes in pacemaker (PM) treated patients with respectively C. hominis and C...

Clinical significance and taxonomy of Actinobacillus hominis

DEFF Research Database (Denmark)

Friis-Møller, Alice; Christensen, J J; Fussing, V

2001-01-01

Clinical findings in 36 immunosuppressed patients with lower respiratory tract infection or bacteremia with Actinobacillus hominis are described. Animal contact was only recorded for three patients; nine patients died despite appropriate antimicrobial treatment. Although infections with this micr......Clinical findings in 36 immunosuppressed patients with lower respiratory tract infection or bacteremia with Actinobacillus hominis are described. Animal contact was only recorded for three patients; nine patients died despite appropriate antimicrobial treatment. Although infections...

Molecular characterization and epidemiological investigation of Cryptosporidium hominis IkA18G1 and C. hominis monkey genotype IiA17, two unusual subtypes diagnosed in Swedish patients.

Science.gov (United States)

Lebbad, Marianne; Winiecka-Krusnell, Jadwiga; Insulander, Mona; Beser, Jessica

2018-05-01

Cryptosporidium hominis is considered a strictly human-adapted species, and it is only occasionally diagnosed in animals. However, two variants, C. hominis monkey genotype and C. hominis Ik, were originally described in non-human hosts, monkeys and horses, respectively. During a Swedish national Cryptosporidium study, where all samples were analyzed at the small subunit rRNA and the 60 kDa (gp60) glycoprotein loci, we identified two patients infected with C. hominis monkey genotype (subtype IiA17) and two infected with C. hominis subtype IkA18G1. The isolates were further analyzed at the actin and the 70 kDa heat shock protein loci, and these analyses showed that these two subtype families are closely related to each other and to human-adapted C. hominis as well as to Cryptosporidium cuniculus. The two patients with C. hominis monkey genotype infection (a father and son) had visited a monkey farm in Thailand prior to infection, while the two cases with C. hominis Ik were unrelated, both probably infected in Sweden. This is the first time that a monkey genotype infection in humans has been related to contact with monkeys and where the gp60 subtype was identified. It is also the first time that human infection caused by C. hominis subtype Ik is described. Even though we were not able to detect any parasites in the animal samples, zoonotic transmission cannot be ruled out in any of these cases because both subtype families are regarded as animal adapted. Copyright © 2018 Elsevier Inc. All rights reserved.

Rapid PCR Detection of Mycoplasma hominis, Ureaplasma urealyticum, and Ureaplasma parvum

OpenAIRE

Scott A. Cunningham; Jayawant N. Mandrekar; Jon E. Rosenblatt; Robin Patel

2013-01-01

Objective. We compared laboratory developed real-time PCR assays for detection of Mycoplasma hominis and for detection and differentiation of Ureaplasma urealyticum and parvum to culture using genitourinary specimens submitted for M. hominis and Ureaplasma culture. Methods. 283 genitourinary specimens received in the clinical bacteriology laboratory for M. hominis and Ureaplasma species culture were evaluated. Nucleic acids were extracted using the Total Nucleic Acid Kit on the MagNA Pure 2.0...

The Mycoplasma hominis vaa gene displays a mosaic gene structure

DEFF Research Database (Denmark)

Boesen, Thomas; Emmersen, Jeppe M. G.; Jensen, Lise T.

1998-01-01

Mycoplasma hominis contains a variable adherence-associated (vaa) gene. To classify variants of the vaa genes, we examined 42 M. hominis isolated by PCR, DNA sequencing and immunoblotting. This uncovered the existence of five gene categories. Comparison of the gene types revealed a modular...

Common occurrence of Cryptosporidium hominis in horses and donkeys.

Science.gov (United States)

Jian, Fuchun; Liu, Aiqin; Wang, Rongjun; Zhang, Sumei; Qi, Meng; Zhao, Wei; Shi, Yadong; Wang, Jianling; Wei, Jiujian; Zhang, Longxian; Xiao, Lihua

2016-09-01

Extensive genetic variation is observed within the genus Cryptosporidium and the distribution of Cryptosporidium species/genotypes in humans and animals appears to vary by geography and host species. To better understand the genetic diversity of Cryptosporidium spp. in horses and donkeys, we characterized five horse-derived and 82 donkey-derived Cryptosporidium isolates from five provinces or autonomous regions (Sichuan, Gansu, Henan, Inner Mongolia and Shandong) in China at the species/genotype and subtype levels. Three Cryptosporidium species/genotypes were identified based on the analysis of the SSU rRNA gene, including Cryptosporidium parvum (n=22), the Cryptosporidium horse genotype (n=4), and Cryptosporidium hominis (n=61). The identification of C. hominis was confirmed by sequence analysis of the HSP70 and actin genes. Subtyping using sequence analysis of the 60kDa glycoprotein gene identified 21 C. parvum isolates as subtype IIdA19G1, the four horse genotype isolates as subtypes VIaA15G4 (n=2) and VIaA11G3 (n=2), and the 61 C. hominis isolates as IkA16G1 (n=59) and IkA16 (n=2). The common finding of C. hominis reaffirms the heterogeneity of Cryptosporidium spp. in horses and donkeys and is possibly a reflection of endemic transmission of C. hominis in these animals. Data of the study suggest that horses and donkeys as companion animals may potentially transmit Cryptosporidium infections to humans. Copyright © 2016 Elsevier B.V. All rights reserved.

The Case Report of Trigger Finger Improved with Hominis Placenta Pharmacopuncture Treatment

Directory of Open Access Journals (Sweden)

Jeong-Won Kim

2010-12-01

Full Text Available Objectives : The Purpose of this study is to investigate and report the effectiveness of Hominis Placenta using Pharmacopuncture treatment for trigger finger. Methods : 3 Patients are admitted at Dept. of Oriental Rehabilitation, Bu-Chun Jaseng Oriental Medicine Hospital, diagnosed as Trigger finger and treated with Hominis Placenta Pharmacopuncture. Each cases are measured and assessed by Quinnell's classification of triggering and VAS (Visual Analogue Scale scores. Results : 3 Patients of trigger finger have a different kind of cause and fingers lesion they have, but nodules are not significantly found up, so we could classify all of 3 patients to diffuse type. After treatment of Hominis placenta Pharmacopuncture, spontaneous pain and tenderness, grades of triggering are decreased significantly. We would expect that Hominis placenta Pharmacopuncture has a effect on degenerative diseases of diffuse type's tendon sheath. Conclusions : Trigger finger is generally divided into two stages, inflammatory and degenerative stage, and when degenerative stage, Hominis placenta pharmacopuncture appears to be effective.

Development of real-time PCR for detection of Mycoplasma hominis

DEFF Research Database (Denmark)

Baczynska, A.; Svenstrup, Helle Friis; Fedder, J.

2004-01-01

BACKGROUND: Mycoplasma hominis is associated with pelvic inflammatory disease, bacterial vaginosis, post partum fever, sepsis and infections of the central nervous system often leading to serious conditions. Association with development of female infertility has also been suggested, but different....... Information on bacterial load in genital swabs can be obtained. The assay allowed detection of M. hominis in a closed system reducing the risk of contamination by amplicon carry-over......., glyceraldehyde-3-phosphate dehydrogenase (gap), as a target. RESULTS: Real-time PCR was optimized to detect 10 copies of M. hominis PG21 genomic DNA. A fluorescence signal was measured for all 20 other M. hominis isolates, and melting curves analysis showed variations in the melting temperature in agreement...

Serological differentiation of microsporidia with special reference to Trachipleistophora hominis

Directory of Open Access Journals (Sweden)

Cheney S.A.

2001-06-01

Full Text Available Myositis is a common clinical syndrome in advanced stages of AIDS. Trachipleistophora hominis (phylum Microspora has been detected in several cases of painful, immobilising myositis in AIDS patients. Enzyme linked immunosorbent assays (ELISAs and Western blotting of protein profiles separated by SDS PAGE were used to determine whether this species could be detected and differentiated by serology. Sixteen microsporidia, including several species known to infect man and species infecting fish, crustaceans and a mosquito, were used as antigen. Each species had a unique profile of SDS PAGE-separated proteins. In Western blots, mouse antiserum, raised to T. hominis and selected for its high ELISA specificity, bound to antigens ranging from less than 25 kDa to greater than 250 kDa with major bands at 39-44 kDa and 98-150 kDa on T. hominis protein profiles. The serum also recognised some high molecular weight antigens in the profiles of Vavraia culicis, Heterosporis anguillarum, and three species of Pleistophora but none in the remaining genera examined. It was concluded that ELISA and Western blotting could be used to detect and differentiate T. hominis in muscle biopsy tissue from patients with myositis. However, sera from T. hominis infected patients in the terminal stages of AIDS would not be useful for detection of infections because of a sharp decline in antibody level.

A comparison between hominy chop and defatted maize germ meal ...

African Journals Online (AJOL)

Defatted maize germ meal (DMG) is arbitrarily rated at a lower economic value than maize meal or hominy chop (HC). Five treatments with 15 steers each were fed different inclusion levels of DMG (0%, 25%, 50%, 75% and 100%), replacing hominy chop during the fattening period. Slaughter data were collected for carcass ...

Subacute Bacterial Endocarditis Caused by Cardiobacterium hominis: A Case Report

Directory of Open Access Journals (Sweden)

Davie Wong

2015-01-01

Full Text Available Cardiobacterium hominis, a member of the HACEK group of organisms, is an uncommon but important cause of subacute bacterial endocarditis. First-line therapy is a third-generation cephalosporin due to rare beta-lactamase production. The authors report a case involving endovascular infection due to C hominis that initially tested resistant to third-generation cephalosporins using an antibiotic gradient strip susceptibility method (nitrocephin negative, but later proved to be susceptible using broth microdilution reference methods (a ‘major’ error. There are limited studies to guide susceptibility testing and interpretive breakpoints for C hominis in the medical literature, and the present case illustrates some of the issues that may arise when performing susceptibility testing for fastidious organisms in the clinical microbiology laboratory.

Homo homini : [luuletused] / Valeria Ränik

Index Scriptorium Estoniae

Ränik, Valeria, 1964-

2004-01-01

Sisu: Homo homini ; "Tegelikult on täiuslik kõik..." ; Mõned kõned ; "Vihmadest lekib lagi..." ; "Sündisid siia, et maksta maksu..." ; "Mingis kohas, mingil ajal..." ; "Emajõgi, Amme jõgi..." ; Kaktus ; Eraelamus ; "Minevikule vesi peale..."

Microbiological and molecular characterization of Staphylococcus hominis isolates from blood.

Directory of Open Access Journals (Sweden)

Soraya Mendoza-Olazarán

Full Text Available BACKGROUND: Among Coagulase-Negative Staphylococci (CoNS, Staphylococcus hominis represents the third most common organism recoverable from the blood of immunocompromised patients. The aim of this study was to characterize biofilm formation, antibiotic resistance, define the SCCmec (Staphylococcal Chromosomal Cassette mec type, and genetic relatedness of clinical S. hominis isolates. METHODOLOGY: S. hominis blood isolates (n = 21 were screened for biofilm formation using crystal violet staining. Methicillin resistance was evaluated using the cefoxitin disk test and the mecA gene was detected by PCR. Antibiotic resistance was determined by the broth microdilution method. Genetic relatedness was determined by pulsed-field gel electrophoresis (PFGE and SCCmec typed by multiplex PCR using two different methodologies described for Staphylococcus aureus. RESULTS: Of the S. hominis isolates screened, 47.6% (10/21 were categorized as strong biofilm producers and 23.8% (5/21 as weak producers. Furthermore, 81% (17/21 of the isolates were methicillin resistant and mecA gene carriers. Resistance to ampicillin, erythromycin, and trimethoprim was observed in >70% of isolates screened. Each isolate showed a different PFGE macrorestriction pattern with similarity ranging between 0-95%. Among mecA-positive isolates, 14 (82% harbored a non-typeable SCCmec type: eight isolates were not positive for any ccr complex; four contained the mec complex A ccrAB1 and ccrC, one isolate contained mec complex A, ccrAB4 and ccrC, and one isolate contained the mec complex A, ccrAB1, ccrAB4, and ccrC. Two isolates harbored the association: mec complex A and ccrAB1. Only one strain was typeable as SCCmec III. CONCLUSIONS: The S. hominis isolates analyzed were variable biofilm producers had a high prevalence of methicillin resistance and resistance to other antibiotics, and high genetic diversity. The results of this study strongly suggested that S. hominis isolates harbor

Hematoma and abscess formation caused by Mycoplasma hominis following cesarean section

Science.gov (United States)

Koshiba, Hisato; Koshiba, Akemi; Daimon, Yasushi; Noguchi, Toshifumi; Iwasaku, Kazuhiro; Kitawaki, Jo

2011-01-01

Mycoplasma species cannot be identified by routine bacteriological culture methods and are resistant to common antimicrobial agents. Mycoplasma hominis usually colonizes the lower urogenital tract and causes pyelonephritis, pelvic inflammatory disease, chorioamnionitis, rupture of fetal membranes, preterm labor, postpartum fever, postabortal fever, and neonatal infection. This organism is highly prevalent in cervicovaginal cultures of sexually active women. M. hominis, M. genitalis, Ureaplasma urealyticum, and U. parvum may invade and infect placental and fetal tissues, leading to adverse pregnancy outcomes. M. hominis occasionally causes nongenitourinary infection of the blood, wounds, central nervous system, joints, or respiratory tract. We present a case of a 27-year-old woman who developed abdominal wound hematoma and abscess after cesarean section. The wound was drained, but her high fever persisted, in spite of antibiotic treatment using flomoxef sodium and imipenem·cilastatin sodium. Because the exudate exhibited M. hominis growth in an anaerobic environment, we administered the quinolone ciprofloxacin. This therapy resolved her fever, and her white blood cell count and C-reactive protein level diminished to the normal ranges. To our knowledge, there are four published articles regarding the isolation of M. hominis from postcesarean incisions. Based on the current study and the literature, infection by this pathogen may cause hematoma formation with or without abscess after cesarean section or in immunosuppressed postoperative patients. In such cases, physicians may need to suspect Mycoplasma infection and initiate appropriate antibacterial treatment as soon as possible in order to avoid persistent fever. PMID:21339933

Bad math in Linnaeus' Philosophia Botanica.

Science.gov (United States)

Podani, János; Szilágyi, András

2016-09-01

In Philosophia Botanica (1751), Carolus Linnaeus (1707-1778) presented a calculation of the number of plant genera that may be distinguished based on his taxonomic concepts. In order to derive that number, he relied upon the organs of fructification, which represent the flower and the fruit, by selecting over 30 elements from them, and then assuming that each could vary by four dimensions. However, while Linnaeus was good in counting stamens and pistils, he and many of his followers who edited or translated Philosophia Botanica were less careful, basing their calculations of the number of possible genera on flawed assumptions, or even introducing basic arithmetic errors. Furthermore, although mathematics was quite advanced in the eighteenth century, the gap between combinatorial and botanical thinking was too deep, preventing Linnaeus to seek a reasonable solution to the problem he raised. The authors demonstrate this by a historical analysis of 15 editions of Philosophia Botanica, plus many references to it, and conclude that the desired number almost always appeared in error during the past 265 years. The German botanist J. G. Gleditsch (1714-1786) was the most successful with respect to Linnaeus' original intention. Elementary mathematics demonstrates that if Linnaeus' assumptions were taken seriously, then the possible number of genera would be astronomical. The practice he followed in Genera Plantarum (1754) shows, however, that the fructification dimensions served as a universal set for Linnaeus from which he chose only the relevant ones for describing a particular genus empirically. Based on the corrections and modifications implemented in reworked editions, we suggest an evolutionary network for the historical and modern versions or translations of Philosophia Botanica.

Association of Mycoplasma hominis and Ureaplasma urealyticum with some indicators of nonspecific vaginitis.

Science.gov (United States)

Cedillo-Ramírez, L; Gil, C; Zago, I; Yáñez, A; Giono, S

2000-01-01

The purpose of this study was to determine the isolation rates of Mycoplasma hominis and Ureaplasma urealyticum from three populations of women and also to relate the presence of these microorganisms with some indicators of nonspecific vaginitis. Three hundred vaginal swabs were taken from delivery, pregnant and control (not pregnant) women. Cultures were done in E broth supplemented with arginine or urea. M. hominis was isolated in 5% at delivery, 12% from pregnant and 5% from control women and U. urealyticum was isolated in 21%, 31% and 28% respectively. There was statistical difference in the isolation rate of M. hominis in pregnant women respect to the other groups. Both microorganisms were more frequently isolated in women with acid vaginal pH, amine-like odor in KOH test, clue cells and leucorrhea. M. hominis was isolated in 17% and U. urealyticum in 52% from women with nonspecific vaginitis. M. hominis was isolated in 2% and U. urealyticum in 13% from women without nonspecific vaginitis. Although the presence of clue cells and amine-like odor in KOH test have relationship with Gardnerella vaginalis, these tests could also suggest the presence of these mycoplasmas.

[Clinical and epidemiological characteristics of blastocystis hominis].

Science.gov (United States)

Trabelsi, Sonia; Ali, Ichraf Ben Haj; Khaled, Samira

2010-03-01

Blastocystis hominis is an intestinal parasite known since long. It is cosmopolitan and lives in the colon. It is still the subject of controversy regarding its pathogenicity and possibly opportunistic character. We exhibit in this article the results obtained for 4 years on the epidemiological, clinical and biological character and opportunistic Blastocystis hominis, often overlooked in the examination of parasitological laboratories city. This is a retrospective study of 3257 stool examination (PSE), performed in the Mycology Laboratory of Parasitology of the Charles Nicolle Hospital in Tunis over a period of 4 years (January 2005-December 2008). Detection of Blastocystis hominis has been made by microscopic examination of samples by direct examination and concentration. Blastocystis was found in 7.27% of cases and 48.5% in men. Endolimax nanus is the parasite most frequently associated with Blastocystis (40.4% of cases). The port was symptomatic in 72.1% of cases, diarrhea is the symptom most often found (27.7%). There is a seasonal distribution; in fact, it is more frequently diagnosed in summer and autumn. The absence of gravity and the saprophytic nature of this infection do not lead to an indication for treatment even among profoundly immunosuppressed individuals. Only the persistence of clinical disorders associated with the detection of the parasite and in the absence of other micro-organisms and intestinal parasites justifies the treatement. Metronidazole is the molecule used conventionally.

Stress exacerbates infectivity and pathogenicity of Blastocystis hominis: in vitro and in vivo evidences.

Directory of Open Access Journals (Sweden)

Samudi Chandramathi

Full Text Available BACKGROUND: Stress alters the oxidant-antioxidant state and immune cell responses which disrupts its function to combat infection. Blastocystis hominis, a common intestinal protozoan has been reported to be opportunistic in immunocompromised patients namely cancer. B. hominis infectivity in other altered immune system conditions especially stress is unknown. We aimed to demonstrate the stress effects towards the susceptibility and pathogenicity of B. hominis infection. METHODS/FINDINGS: Three-week-old Wistar rats were divided into four groups: (acontrol; (bstress-induced; (cB. hominis infected; (dstress-induced with B. hominis infection; (n = 20 respectively. Stress was induced for an hour daily (30 days using a Belly Dancer Shaker. Weight gain was monitored, stool samples were collected for B. hominis screening and blood for the determination of differential count, levels of immunoglobulin, oxidative damage, and peripheral blood mononuclear cell (PBMC proliferation upon induction with solubilized antigen of B. hominis (Blasto-Ag. Group (b exhibited the highest level of weight gain. Group (d had higher levels of parasite cyst count in stools, serum IgE, oxidized protein and lipid compared to the group (c. Levels of monocyte and antioxidant in group (d were decreased and their PBMCs showed highest inhibition of proliferation level when exposed to Blasto-Ag. Monocyte level in Group (b showed insignificant difference compared to group (a but was significantly lower compared to group (c. Antioxidant levels in group (c were generally lower compared to group (a and (b. Inhibition level exhibited by Blasto-Ag treated PBMCs of group (c was higher compared to group (a and (b. CONCLUSION: The pathogenicity and augmentation of B. hominis infection is enhanced when stress is present. Lifestyles today are becoming increasingly stressed and the present findings suggest that the parasite which has been reported to be one of the most common organisms seen in

Isolate resistance of Blastocystis hominis to metronidazole.

Science.gov (United States)

Haresh, K; Suresh, K; Khairul Anus, A; Saminathan, S

1999-04-01

Isolates of Blastocystis hominis from infected immigrant workers from Indonesia, Bangladesh and infected individuals from Singapore and Malaysia were assessed for growth pattern and degree of resistance to different concentrations of metronidazole. Viability of the cells was assessed using eosin-brillian cresyl blue which stained viable cells green and nonviable cells red. The Bangladeshi and Singaporean isolates were nonviable even at the lowest concentration of 0.01 mg/ml, whereas 40% of the initial inoculum of parasites from the Indonesian isolate at day one were still viable in cultures with 1.0 mg/ml metronidazole. The study shows that isolates of B. hominis of different geographical origin have different levels of resistance to metronidazole. The search for more effective drugs to eliminate th parasite appears inevitable, especially since surviving parasites from metronidazole cultures show greater ability to multiply in subcultures than controls.

External ophthalmomyiasis by Oestrus ovis: A case report from Davangere

Directory of Open Access Journals (Sweden)

Sridhar Rao

2018-01-01

Full Text Available External ophthalmomyiasis is an infestation of the eye with larvae of Dermatobia hominis or Oestrus ovis (sheep bot fly. We describe a case of ophthalmomyiasis in a 38-year-old male, who presented with ocular foreign body sensation, redness, pain, and watering of the eye. The causative larvae were removed and sent to the laboratory for identification. By studying morphological features, it was identified as the first instar larvae of O. ovis. The patient was put on topical and oral antibiotics but was lost to follow-up. This is probably the first report from this part of Karnataka.

Sterols of Pneumocystis carinii hominis organisms isolated from human lungs

DEFF Research Database (Denmark)

Kaneshiro, E S; Amit, Z; Chandra, Jan Suresh

1999-01-01

in conjunction with analyses of chemically synthesized authentic standards. The sterol composition of isolated P. carinii hominis organisms has yet to be reported. If P. carinii from animal models is to be used for identifying potential drug targets and for developing chemotherapeutic approaches to clear human...... infections, it is important to determine whether the 24-alkylsterols of organisms found in rats are also present in organisms in humans. In the present study, sterol analyses of P. carinii hominis organisms isolated from cryopreserved human P. carinii-infected lungs and from bronchoalveolar lavage fluid were...

Significance of Blastocystis hominis in patients referred for ...

African Journals Online (AJOL)

Administrator

Objective: To determine the prevalence and related clinical manifestation of B. hominis infection in patients referred for bacteriological ... with a worldwide distribution. However ... abdominal pain and peripheral blood eosinophilia. However ...

The Effects of the Hominis Placenta Herbal acupuncture on Sleep pattern disturbance

Directory of Open Access Journals (Sweden)

Youn Hyoun-min

2005-02-01

Full Text Available Objective : This study has been designed and performed to identify the effects of Hominis Placenta herbal acupuncture which is usually used in reducing sleep pattern disturbances. Methods : The study subjects studied included 48 patients who were admitted in hospital located in Pusan, and they were classified into 2 groups : 25 patients in the experimental group who injected Hominis Placenta herbal acupuncture and 23 patients in the control group who were treated by acupuncture. The both group injected on GB20, GB12 and HT7 for 5 days without medicine. The sleep pattern disturbance score was measured by using 15 questions according to Korean Sleep Scale A(Oh, Jin Joo. Song, Mi Soon. Kim, Shin Mi. 1998. Results & conclusions : The sleep pattern disturbance score of the experimental group who injected Hominis Placenta herbal acupuncture was significantly lower than that of the control group. (t= 7.00 p= .00 These results provided that Hominis Placenta herbal acupuncture of GB20, GB12 and HT7 was effective for relieving sleep pattern disturbances, it is need more sample's number and more treatmentt's duration.

Mycoplasma hominis: an incidental but significant finding by routine bacteriological culture

DEFF Research Database (Denmark)

Gertsen, Jan Berg; Schønheyder, Henrik Carl

2009-01-01

bacteriological culture during a 4-year period. Methods: Dpt. of Clinical Microbiology, Aalborg Hospital serves a population of 0.5 mio. Aerobic bacteriologic cultures are routinely carried out on 5% horse blood agar and chocolate agar (SSI Diagnostika, DK) at 35 °C in 5% CO2. The finding of translucent, pinpoint...... not respond to surgical drainage of the abscesses (if present) and prolonged empirical intravenous therapy with a β-lactam antibiotic and metronidazole (median 9 days). The tentative diagnosis of M. hominis prompted a change of antibiotic therapy to either moxifloxacin or clindamycin which was followed...... by resolution of symptoms and normalisation of CRP (median 9 days). Conclusion: M. hominis is a rare finding by prolonged incubation of conventional blood agar. A pathogenic role of M. hominis was supported by the lack of clinical response to surgical drainage and prolonged empirical antibiotic therapy...

Co-infection by Tritrichomonas foetus and Pentatrichomonas hominis in asymptomatic cats

Directory of Open Access Journals (Sweden)

Caroline Spitz dos Santos

2015-12-01

Full Text Available Abstract: Tritrichomonas foetus, a parasite well known for its significance as a venereally transmitted pathogen in cattle, has been identified as a cause of chronic large bowel diarrhea in domestic cats in many countries of the world. In Brazil, several studies on the diagnosis of bovine trichomoniasis have been performed, but until now, no study was made regarding feline trichomoniasis. Thus, this is the first study to report the occurrence of T. foetus and Pentatrichomonas hominis in cats using morphological and molecular analysis. Feces from 77 cats were examined, four of which (5.2% were positive for the presence of parabasalids. Morphological analysis of stained smears revealed piriform trophozoites showing the three anterior flagella, elongated nucleus and axostyle ending abruptly in fillet, characteristic of T. foetus. In scanning and transmission electron microscopy, identification characters similar to those previously reported for T. foetus were observed. The cultures containing trophozoites were submitted for molecular analysis, which resulted positive for T. foetus DNA using specific primers (TFR3 and TFR4, and all samples were positive and subjected to sequencing in which they showed 99.7-100% similarity with another isolate sequencing of T. foetus (JX960422. Although no trophozoite with consistent morphology of P. hominis has been visualized in the samples, differential diagnosis was performed using specific primers for P. hominis (TH3 and TH5 amplicon. In three of the four samples (3.89% sequencing revealed 100% similarity when compared with another sequence of P. hominis deposited in Genbank (KC623939. Therefore, the present study revealed through the diagnostic techniques employed the simultaneous infection by T. foetus and P. hominis in the feces of cats. However, it was necessary to use more than one technique for the diagnosis of the co-infection. These results demonstrate the importance of a correct diagnosis to allow an

Molecular detection of Chlamydia Trachomatis and Mycoplasma Hominis in endometriosis lesions

Directory of Open Access Journals (Sweden)

F. Azizvakili

2016-12-01

Full Text Available Background: Retrograde of menstrual blood into the peritoneal cavity is one of the accepted theories for initiation of endometriosis although indicated that other factors are involved in pathogenesis. Investigation of infectious agents is important in this regard. Objective: To investigate the presence of bacterial infections; Chlamydia trachomatis and Mycoplasma Hominis as risk factors in endometriosis lesions. Methods: This case-control study was conducted in Sarem Hospital in 2014. DNA was extracted from 90 paraffin-embedded blocks included 40 endometriosis tissue samples, 23 samples of endometrial tissue from the same patients and 27 samples of endometrial tissue of the patients without endometriosis, and molecular analysis were performed using polymerase chain reaction. Results were analyzed by Fisher Exact Test and McNemar Test. Findings: Chlamydia trachomatis infection was seen in 11 (27.5% endometriosis tissue, 3 (13% normal tissue from patients and 10 (37% in patient without endometriosis. Mycoplasma hominis was diagnosed in 11 (27.5% endometriosis tissue, 7 (30.4% of normal tissue from patients and one patient without endometriosis (3.7%. These differences show significant relations between infection with Mycoplasma hominis and endometriosis. Conclusion: The findings of this study did not show significant association between Chlamydia trachomatis infections and endometriosis. However; it seems Mycoplasma hominis infection can increase the risk of endometriosis incidence.

Molecular design of Mycoplasma hominis Vaa adhesin

DEFF Research Database (Denmark)

Boesen, Thomas; Fedosova, Natalya U.; Kjeldgaard, Morten

2001-01-01

The variable adherence-associated (Vaa) adhesin of the opportunistic human pathogen Mycoplasma hominis is a surface-exposed, membrane-associated protein involved in the attachment of the bacterium to host cells. The molecular masses of recombinant 1 and 2 cassette forms of the protein determined...

Neonate with Mycoplasma hominis meningoencephalitis given moxifloxacin

NARCIS (Netherlands)

Wildenbeest, Joanne G.; Said, Ines; Jaeger, Bregje; van Hest, Reinier M.; van de Beek, Diederik; Pajkrt, Dasja

2016-01-01

Mycoplasma hominis is a commensal organism in the genitourinary tract that can cause life-threatening CNS infections in neonates after intrauterine infection or through vertical transmission during birth. We present a case of an 11-day-old neonate presenting with fever and supporting laboratory

Pentatrichomonas hominis: prevalence and molecular characterization in humans, dogs, and monkeys in Northern China.

Science.gov (United States)

Li, Wen-Chao; Ying, Meng; Gong, Peng-Tao; Li, Jian-Hua; Yang, Ju; Li, He; Zhang, Xi-Chen

2016-02-01

Pentatrichomonas hominis is an anaerobic amitochondrial flagellated protist that primarily colonizes the large intestines of a number of species, including cats, dogs, nonhuman primates, and humans. The prevalence of this parasite in dogs, monkeys, and humans is, however, poorly understood. In this study, a total of 362 fecal samples including 252 dogs, 60 monkeys, and 50 humans from northern China were collected for an epidemiological survey of P. hominis infection.The average prevalence of P. hominis infection determined by nested PCR was 27.38% (69/252), 4.00% (2/50), and 46.67% (28/60) in dogs, humans, and monkeys, respectively. The prevalence was significantly higher in 6-month-old dogs (41.53%) and children (7.69%) than in older dogs (14.39%) and adults (0%) (P dogs, monkeys, and humans, especially in children and young dogs. Given the infection prevalence, P. hominis may pose a risk of zoonotic and anthroponotic transmission.

Meningitis in a Chinese adult patient caused by Mycoplasma hominis: a rare infection and literature review

OpenAIRE

Zhou, Menglan; Wang, Peng; Chen, Sharon; Du, Bin; Du, Jinlong; Wang, Fengdan; Xiao, Meng; Kong, Fanrong; Xu, Yingchun

2016-01-01

Background Mycoplasma hominis, a well known cause of neonatal infection, has been reported as a pathogen in urogenital infections in adults; however, central nervous system (CNS) infections are rare. We report here the first case of M. hominis meningitis in China, post neurosurgical treatment for an intracerebral haemorrhage in a 71-year-old male. Case presentation We describe a 71-year-old man who developed M. hominis meningitis after neurosurgical treatment and was successfully treated with...

Biological Activities of Hominis Placenta Herbal Acupuncture prepared by Hydrochloric Acid Hydrolysis

Directory of Open Access Journals (Sweden)

Geun-young Seo

2010-06-01

Full Text Available Reactive Oxygen Species(ROS are continuously produced at a high rate as a by-product of aerobic metabolism. Since tissue damage by free radical increases with age, the reactive oxygen species(ROS such as hydrogen peroxide(H2O2, nitric oxide(NO. Several lines of evidence provided that ROS appears to cause to develop aging-related various diseases such as cancer, arthritis, cardiovascular disease. In this study, we have conducted to investigate the biological activities of Hominis Placenta Herbal Acupuncture by measuring total polyphenol content, DPPH radical scavenging, ABTS radical scavenging, Superoxide dismutase(SOD-like activity, Nitrite scavenging ability in vitro. The total polyphenol contents of Hominis Placenta Herbal Acupuncture was 24.6㎖/㎖. Elctron donation ability on DPPH was 49.4%. The 2,2'-azinobis-3-ehtlbezothiazoline-6-sulfonic acid radical decolorization (ABTS was 50.01%, similar to the DPPH free radical scavenging. The superoxide dismutase (SOD-like activities of hominis placenta herbal acupuncture was 50.876%. The nitrite scavenging abilities at pH 1.5, pH 3.0, pH 6.0 were 52.8%, 29.4%, 15.4%, respectively; these abilities decreased as pH increased. We conclude that Hominis Placenta Herbal Acupuncture may be useful as potential sources of antioxidant.

Mycoplasma hominis: an incidental but significant finding by routine bacteriological culture

DEFF Research Database (Denmark)

Gertsen, Jan Berg; Schønheyder, Henrik Carl

2009-01-01

Objectives: M. hominis is part of the normal mucosal flora and is primarily associated with infections in the genitourinary tract. Most infections occur following delivery or genitourinary instrumentation, but are also seen in immunocompromised patients. We present 4 cases diagnosed by routine ba...... Serum Institut, Copenhagen (by courtesy to Jørgen Skov). Results: The four patients were immunocompetent women (23-56 years of age) without significant comorbidity (Table). In all patients M. hominis were obtained in pure culture. At the time of diagnosis three patients had abscesses...

Epidemiological investigation and antimicrobial susceptibility analysis of ureaplasma species and Mycoplasma hominis in outpatients with genital manifestations.

Science.gov (United States)

Song, Tiejun; Ye, Aiqing; Xie, Xinyou; Huang, Jun; Ruan, Zhi; Kong, Yingying; Song, Jingjuan; Wang, Yue; Chen, Jiangzhong; Zhang, Jun

2014-09-01

The aim of this study was to assess the prevalence and drug resistance of Ureaplasma species and Mycoplasma hominis in outpatients with genital manifestation from 2005 to 2013 in Hangzhou, China. A total of 2689 female and 2336 male patients with various genital symptoms were included in this study. Species identification and antimicrobial susceptibility test were performed by using the mycoplasma IST-2 kit. The prevalence rate of Ureaplasma species was 39.9%, M hominis was 1.2% in female patients, and the coinfection rate was 13.4%; while in males, the prevalence rate of Ureaplasma species was 18.8%, M hominis was 0.4%, and the coinfection rate was 2.9%. Moreover, significantly high positive rates for mycoplasmas (Ureaplasma species M hominis) and were found in 16–20-year-old females (65.2%) and males (27.3%). Ureaplasma species and M hominis displayed relatively lower resistance rates (Ureaplasma species to quinolones (ofloxacin and ciprofloxacin) were much higher (>50%) and increased significantly from 2005 to 2013. Our study indicates that high positive rates of Ureaplasma species and M hominis were found in young outpatients with genital symptoms, and monitoring the local drug resistance is critical for prevention of the occurrence of resistant strains.

Cloning, sequencing and variability analysis of the gap gene from Mycoplasma hominis

DEFF Research Database (Denmark)

Mygind, Tina; Jacobsen, Iben Søgaard; Melkova, Renata

2000-01-01

The gap gene encodes the glycolytic enzyme glyceraldehyde 3-phosphate dehydrogenase (GAPDH). The gene was cloned and sequenced from the Mycoplasma hominis type strain PG21(T). The intraspecies variability was investigated by inspection of restriction fragment length polymorphism (RFLP) patterns...... after polymerase chain reaction (PCR) amplification of the gap gene from 15 strains and furthermore by sequencing of part of the gene in eight strains. The M. hominis gap gene was found to vary more than the Escherichia coli counterpart, but the variation at nucleotide level gave rise to only a few...... amino acid substitutions. To verify that the gene was expressed in M. hominis, a polyclonal antibody was produced and tested against whole cell protein from 15 strains. The enzyme was expressed in all strains investigated as a 36-kDa protein. All strains except type strain PG21(T) showed reaction...

An infant case with hydrocephalus as the initial manifestation of Mycoplasma hominis-associated meningitis.

Science.gov (United States)

Taku, Keisuke; Hoshina, Takayuki; Haro, Kaoru; Ichikawa, Shun; Kinjo, Tadamune; Takahashi, Mayu; Akiba, Daisuke; Fukuda, Kazumasa; Kusuhara, Koichi

2017-10-01

We report an infant with hydrocephalus as the initial manifestation of Mycoplasma hominis-associated meningitis, who recovered without appropriate antimicrobial treatment. The analysis of the 16S rRNA gene by polymerase chain reaction amplification using universal primers and pathogen-specific primers was useful for the diagnosis and the investigation of serial detection status of the pathogen. This method may be helpful for the assessment of the frequency and the prediction of severity in M. hominis-associated central nervous system infection in infants, and investigating the association between M. hominis and the development of hydrocephalus. Copyright © 2017 Japanese Society of Chemotherapy and The Japanese Association for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

Genetic Passive Immunization with Adenoviral Vector Expressing Chimeric Nanobody-Fc Molecules as Therapy for Genital Infection Caused by Mycoplasma hominis.

Directory of Open Access Journals (Sweden)

Daria A Burmistrova

Full Text Available Developing pathogen-specific recombinant antibody fragments (especially nanobodies is a very promising strategy for the treatment of infectious disease. Nanobodies have great potential for gene therapy application due to their single-gene nature. Historically, Mycoplasma hominis has not been considered pathogenic bacteria due to the lack of acute infection and partially due to multiple studies demonstrating high frequency of isolation of M. hominis samples from asymptomatic patients. However, recent studies on the role of latent M. hominis infection in oncologic transformation, especially prostate cancer, and reports that M. hominis infects Trichomonas and confers antibiotic resistance to Trichomonas, have generated new interest in this field. In the present study we have generated specific nanobody against M. hominis (aMh, for which the identified target is the ABC-transporter substrate-binding protein. aMh exhibits specific antibacterial action against M. hominis. In an attempt to improve the therapeutic properties, we have developed the adenoviral vector-based gene therapy approach for passive immunization with nanobodies against M. hominis. For better penetration into the mucous layer of the genital tract, we fused aMh with the Fc-fragment of IgG. Application of this comprehensive approach with a single systemic administration of recombinant adenovirus expressing aMh-Fc demonstrated both prophylactic and therapeutic effects in a mouse model of genital M. hominis infection.

Bibliographie der Flussperlmuschel Margaritifera Margaritifera (Linnaeus, 1758) [Mollusca: Pelecypoda

NARCIS (Netherlands)

Jungbluth, J.H.; Coomans, H.E.; Grohs, H.

1985-01-01

Bibliography of the freshwater Pearlmussel Margaritifera margaritifera (Linnaeus, 1758) [Mollusca: Pelecypoda] The freshwater pearlmussel, described by Linnaeus as Mya margaritifera is one of the most important molluscs existing. It belongs with only a few congeneric fossil and recent species to the

Genetic recombination and Cryptosporidium hominis virulent subtype IbA10G2.

Science.gov (United States)

Li, Na; Xiao, Lihua; Cama, Vitaliano A; Ortega, Ynes; Gilman, Robert H; Guo, Meijin; Feng, Yaoyu

2013-10-01

Little is known about the emergence and spread of virulent subtypes of Cryptosporidium hominis, the predominant species responsible for human cryptosporidiosis. We conducted sequence analyses of 32 genetic loci of 53 C. hominis specimens isolated from a longitudinally followed cohort of children living in a small community. We identified by linkage disequilibrium and recombination analyses only limited genetic recombination, which occurred exclusively within the 60-kDa glycoprotein gene subtype IbA10G2, a predominant subtype for outbreaks in industrialized nations and a virulent subtype in the study community. Intensive transmission of virulent subtype IbA10G2 in the study area might have resulted in genetic recombination with other subtypes. Moreover, we identified selection for IbA10G2 at a 129-kb region around the 60-kDa glycoprotein gene in chromosome 6. These findings improve our understanding of the origin and evolution of C. hominis subtypes and the spread of virulent subtypes.

Ureaplasma species and Mycoplasma hominis in cervical fluid of pregnancies complicated by preterm prelabor rupture of membranes.

Science.gov (United States)

Musilova, Ivana; Pliskova, Lenka; Kutova, Radka; Hornychova, Helena; Jacobsson, Bo; Kacerovsky, Marian

2016-01-01

To evaluate Ureaplasma species and Mycoplasma hominis DNA in the cervical fluid and their association with microbial invasion of the amniotic cavity (MIAC) and/or histological chorioamnionitis (HCA) in pregnancies complicated by preterm prelabor rupture of membranes (PPROM). A prospective study of 68 women with singleton pregnancies complicated by PPROM between 24(0/7) and 36(6/7) weeks was conducted. Cervical fluid and amniotic fluid were collected from all women at the time of admission. The Ureaplasma species and Mycoplasma hominis DNA in the cervical fluid were identified using specific real-time PCR. Ureaplasma species and Mycoplasma hominis DNA were identified in 59% (40/69) of the cervical fluid samples. Women with the presence of Ureaplasma species DNA with and without Mycoplasma hominis DNA in the cervical fluid had a higher rate of MIAC alone [35% (14/40) versus 11% (3/28); p = 0.02] and a higher rate of the presence of both MIAC and HCA [30% (12/40) versus 4% (1/28); p = 0.01] than women without Ureaplasma species and Mycoplasma hominis DNA in the cervical fluid. The presence of Ureaplasma species DNA with and without Mycoplasma hominis DNA in the cervical fluid is associated with a higher risk of MIAC or MIAC and HCA together in pregnancies complicated by PPROM.

[Pyomyositis, sacroiliitis and spondylodiscitis caused by Staphylococcus hominis in a immunocompetent woman].

Science.gov (United States)

Gómez Rodríguez, N; Durán Muñoz, O

2006-12-01

In absence of risk factors, osteoarticular infections by coagulase-negative staphylococci are very infrequent. We described the case of a immunocompetent 73-year-old-woman that suffered pyomyositis, left sacroiliitis and spondylodiscitis involving the first and second thoracic vertebrae by Staphylococcus hominis. This multifocal infection occurred five-weeks after intramuscular administration of NSAI for treatment of low back pain associated with a herniated disc L4-L5. This is the first know case of a multifocal muscle skeletal infection by Staphylococcus hominis in a patient immunocompetent.

Meningitis in a Chinese adult patient caused by Mycoplasma hominis: a rare infection and literature review.

Science.gov (United States)

Zhou, Menglan; Wang, Peng; Chen, Sharon; Du, Bin; Du, Jinlong; Wang, Fengdan; Xiao, Meng; Kong, Fanrong; Xu, Yingchun

2016-10-12

Mycoplasma hominis, a well known cause of neonatal infection, has been reported as a pathogen in urogenital infections in adults; however, central nervous system (CNS) infections are rare. We report here the first case of M. hominis meningitis in China, post neurosurgical treatment for an intracerebral haemorrhage in a 71-year-old male. We describe a 71-year-old man who developed M. hominis meningitis after neurosurgical treatment and was successfully treated with combined azithromycin and minocycline therapy of 2 weeks duration, despite delayed treatment because the Gram stain of cerebrospinal fluid (CSF) yielded no visible organisms. The diagnosis required 16S rDNA sequencing analysis of the cultured isolate from CSF. Literature review of M. hominis CNS infections yielded 19 cases (13 instances of brain abscess, 3 of meningitis, 1 spinal cord abscess and 1 subdural empyema each). Delay in diagnosis and initial treatment failure was evident in all cases. With appropriate microbiological testing, antibiotic therapy (ranging from 5 days to 12 weeks) and often, multiple surgical interventions, almost all the patients improved immediately. Both our patient findings and the literature review, highlighted the pathogenic potential of M. hominis together with the challenges prompted by rare infectious diseases in particular for developing countries laboratories with limited diagnostic resources.

Linnaeus in Uppsala, Sweden.

Science.gov (United States)

Cohen, Paul; Cohen, Brenda

1997-01-01

Presents a brief life history of Carl Linnaeus, a professor of medicine and botany in Uppsala, Sweden. Highlights his work in developing a classification system for plants and animals, and his botanical lectures and demonstrations. (JRH)

Emergence of Cryptosporidium hominis Monkey Genotype II and Novel Subtype Family Ik in the Squirrel Monkey (Saimiri sciureus) in China.

Science.gov (United States)

Liu, Xuehan; Xie, Na; Li, Wei; Zhou, Ziyao; Zhong, Zhijun; Shen, Liuhong; Cao, Suizhong; Yu, Xingming; Hu, Yanchuan; Chen, Weigang; Peng, Gangneng

2015-01-01

A single Cryptosporidium isolate from a squirrel monkey with no clinical symptoms was obtained from a zoo in Ya'an city, China, and was genotyped by PCR amplification and DNA sequencing of the small-subunit ribosomal RNA (SSU rRNA), 70-kDa heat shock protein (HSP70), Cryptosporidium oocyst wall protein, and actin genes. This multilocus genetic characterization determined that the isolate was Cryptosporidium hominis, but carried 2, 10, and 6 nucleotide differences in the SSU rRNA, HSP70, and actin loci, respectively, which is comparable to the variations at these loci between C. hominis and the previously reported monkey genotype (2, 3, and 3 nucleotide differences). Phylogenetic studies, based on neighbor-joining and maximum likelihood methods, showed that the isolate identified in the current study had a distinctly discordant taxonomic status, distinct from known C. hominis and also from the monkey genotype, with respect to the three loci. Restriction fragment length polymorphisms of the SSU rRNA gene obtained from this study were similar to those of known C. hominis but clearly differentiated from the monkey genotype. Further subtyping was performed by sequence analysis of the gene encoding the 60-kDa glycoprotein (gp60). Maximum homology of only 88.3% to C. hominis subtype IdA10G4 was observed for the current isolate, and phylogenetic analysis demonstrated that this particular isolate belonged to a novel C. hominis subtype family, IkA7G4. This study is the first to report C. hominis infection in the squirrel monkey and, based on the observed genetic characteristics, confirms a new C. hominis genotype, monkey genotype II. Thus, these results provide novel insights into genotypic variation in C. hominis.

Cloning, sequencing and variability analysis of the gap gene from Mycoplasma hominis

DEFF Research Database (Denmark)

Mygind, Tina; Jacobsen, Iben Søgaard; Melkova, Renata

2000-01-01

The gap gene encodes the glycolytic enzyme glyceraldehyde 3-phosphate dehydrogenase (GAPDH). The gene was cloned and sequenced from the Mycoplasma hominis type strain PG21(T). The intraspecies variability was investigated by inspection of restriction fragment length polymorphism (RFLP) patterns...... after polymerase chain reaction (PCR) amplification of the gap gene from 15 strains and furthermore by sequencing of part of the gene in eight strains. The M. hominis gap gene was found to vary more than the Escherichia coli counterpart, but the variation at nucleotide level gave rise to only a few...

Prevalence and antimicrobial susceptibility of Ureaplasma species and Mycoplasma hominis in Greek female outpatients, 2012-2016.

Science.gov (United States)

Maraki, Sofia; Mavromanolaki, Viktoria Eirini; Nioti, Eleni; Stafylaki, Dimitra; Minadakis, George

2017-11-28

Mycoplasma hominis and Ureaplasma species are opportunistic pathogens associated with urogenital infections, complications during pregnancy and postpartum infections. Appropriate empirical antimicrobial treatment is necessary to achieve an optimal therapeutic outcome. This study evaluated the prevalence and the antimicrobial susceptibility of Mycoplasma hominis and Ureaplasma spp. isolated from 1,008 endocervical samples of outpatients in Crete, Greece, during a five-year period (2012-2016), using the commercially available Mycoview kit (Zeakon diagnostics, France). Ureaplasma spp. was isolated from 116 patients (11.5%), M. hominis from 6 (0.6%), while coinfection with both mycoplasmas was demonstrated in 17 (1.7%). All Ureaplasma strains were susceptible to josamycin and doxycycline. Doxycycline, minocycline and ofloxacin were the most potent antibiotics against M. hominis. Docycycline was proved the most active and is still the drug of choice for the treatment of genital mycoplasma infections. Local surveillance to monitor changes in antimicrobial susceptibilities is necessary to guide treatment strategies.

The infection of Mycoplasma hominis after total knee replacement: Case report and literature review

Directory of Open Access Journals (Sweden)

Hong-Jiu Qiu

2017-08-01

Full Text Available The Mycoplasma hominis infection is a rare postoperative complication after joint replacement. Based on our knowledge, there were only two cases reported by Korea all over the world currently. A case of postoperative Mycoplasma hominis infection after total knee replacement in our hospital was reported in this article. It was confirmed through mass spectrometer and Mycoplasma cultivation and treated by the first stage debridement, polyethylene insert replacement, and then drainage and irrigation combined with sensitive antibiotics after the operation. We observed that the C reactive protein (CRP level correlates with the development of disease, while the erythrocyte sedimentation rate (ESR remains at a high level, indicating the relevance between the Mycoplasma hominis infection caused by knee joint replacement and CRP. This study aims to report the case and review relevant literature.

Mycoplasma hominis and Mycoplasma genitalium in the Vaginal Microbiota and Persistent High-Risk Human Papillomavirus Infection

Directory of Open Access Journals (Sweden)

Sally N. Adebamowo

2017-06-01

Full Text Available BackgroundRecent studies have suggested that the vaginal microenvironment plays a role in persistence of high-risk human papillomavirus (hrHPV infection and thus cervical carcinogenesis. Furthermore, it has been shown that some mycoplasmas are efficient methylators and may facilitate carcinogenesis through methylation of hrHPV and cervical somatic cells. We examined associations between prevalence and persistence of Mycoplasma spp. in the vaginal microbiota, and prevalent as well as persistent hrHPV infections.MethodsWe examined 194 Nigerian women who were tested for hrHPV infection using SPF25/LiPA10 and we identified Mycoplasma genitalium and Mycoplasma hominis in their vaginal microbiota established by sequencing the V3–V4 hypervariable regions of the 16S rRNA gene. We defined the prevalence of M. genitalium, M. hominis, and hrHPV based on positive result of baseline tests, while persistence was defined as positive results from two consecutive tests. We used exact logistic regression models to estimate associations between Mycoplasma spp. and hrHPV infections.ResultsThe mean (SD age of the study participants was 38 (8 years, 71% were HIV positive, 30% M. genitalium positive, 45% M. hominis positive, and 40% hrHPV positive at baseline. At follow-up, 16% of the women remained positive for M. genitalium, 30% for M. hominis, and 31% for hrHPV. There was a significant association between persistent M. hominis and persistent hrHPV (OR 8.78, 95% CI 1.49–51.6, p 0.01. Women who were positive for HIV and had persistent M. hominis had threefold increase in the odds of having persistent hrHPV infection (OR 3.28, 95% CI 1.31–8.74, p 0.008, compared to women who were negative for both.ConclusionWe found significant association between persistent M. hominis in the vaginal microbiota and persistent hrHPV in this study, but we could not rule out reverse causation. Our findings need to be replicated in larger, longitudinal studies and if confirmed

Symbiotic Association with Mycoplasma hominis Can Influence Growth Rate, ATP Production, Cytolysis and Inflammatory Response of Trichomonas vaginalis

Science.gov (United States)

Margarita, Valentina; Rappelli, Paola; Dessì, Daniele; Pintus, Gianfranco; Hirt, Robert P.; Fiori, Pier L.

2016-01-01

The symbiosis between the parasitic protist Trichomonas vaginalis and the opportunistic bacterium Mycoplasma hominis is the only one currently described involving two obligate human mucosal symbionts with pathogenic capabilities that can cause independent diseases in the same anatomical site: the lower urogenital tract. Although several aspects of this intriguing microbial partnership have been investigated, many questions on the influence of this symbiosis on the parasite pathobiology still remain unanswered. Here, we examined with in vitro cultures how M. hominis could influence the pathobiology of T. vaginalis by investigating the influence of M. hominis on parasite replication rate, haemolytic activity and ATP production. By comparing isogenic mycoplasma-free T. vaginalis and parasites stably associated with M. hominis we could demonstrate that the latter show a higher replication rate, increased haemolytic activity and are able to produce larger amounts of ATP. In addition, we demonstrated in a T. vaginalis-macrophage co-culture system that M. hominis could modulate an aspect of the innate immuno-response to T. vaginalis infections by influencing the production of nitric oxide (NO) by human macrophages, with the parasite-bacteria symbiosis outcompeting the human cells for the key substrate arginine. These results support a model in which the symbiosis between T. vaginalis and M. hominis influences host-microbes interactions to the benefit of both microbial partners during infections and to the detriment of their host. PMID:27379081

LINNAEUS: A species name identification system for biomedical literature

Directory of Open Access Journals (Sweden)

Nenadic Goran

2010-02-01

Full Text Available Abstract Background The task of recognizing and identifying species names in biomedical literature has recently been regarded as critical for a number of applications in text and data mining, including gene name recognition, species-specific document retrieval, and semantic enrichment of biomedical articles. Results In this paper we describe an open-source species name recognition and normalization software system, LINNAEUS, and evaluate its performance relative to several automatically generated biomedical corpora, as well as a novel corpus of full-text documents manually annotated for species mentions. LINNAEUS uses a dictionary-based approach (implemented as an efficient deterministic finite-state automaton to identify species names and a set of heuristics to resolve ambiguous mentions. When compared against our manually annotated corpus, LINNAEUS performs with 94% recall and 97% precision at the mention level, and 98% recall and 90% precision at the document level. Our system successfully solves the problem of disambiguating uncertain species mentions, with 97% of all mentions in PubMed Central full-text documents resolved to unambiguous NCBI taxonomy identifiers. Conclusions LINNAEUS is an open source, stand-alone software system capable of recognizing and normalizing species name mentions with speed and accuracy, and can therefore be integrated into a range of bioinformatics and text-mining applications. The software and manually annotated corpus can be downloaded freely at http://linnaeus.sourceforge.net/.

High rates of double-stranded RNA viruses and Mycoplasma hominis in Trichomonas vaginalis clinical isolates in South Brazil.

Science.gov (United States)

da Luz Becker, Débora; dos Santos, Odelta; Frasson, Amanda Piccoli; de Vargas Rigo, Graziela; Macedo, Alexandre José; Tasca, Tiana

2015-08-01

Trichomonas vaginalis is the etiological agent of trichomoniasis, the most common non-viral sexually transmitted disease (STD) in world, with 276.4 million new cases each year. T. vaginalis can be naturally infected with Mycoplasma hominis and Trichomonasvirus species. This study aimed to evaluate the prevalence of T. vaginalis infected with four distinct T. vaginalis viruses (TVVs) and M. hominis among isolates from patients in Porto Alegre city, South Brazil. An additional goal of this study was to investigate whether there is association between metronidazole resistance and the presence of M. hominis during TVV infection. The RNA expression level of the pyruvate ferredoxin oxidoreductase (PFOR) gene was also evaluated among metronidazole-resistant and metronidazole-sensitive T. vaginalis isolates. A total of 530 urine samples were evaluated, and 5.7% samples were positive for T. vaginalis infection. Among them, 4.51% were isolated from female patients and 1.12% were from male patients. Remarkably, the prevalence rates of M. hominis and TVV-positive T. vaginalis isolates were 56.7% and 90%, respectively. Most of the T. vaginalis isolates were metronidazole-sensitive (86.7%), and only four isolates (13.3%) were resistant. There is no statistically significant association between infection by M. hominis and infection by TVVs. Our results refute the hypothesis that the presence of the M. hominis and TVVs is enough to confer metronidazole resistance to T. vaginalis isolates. Additionally, the role of PFOR RNA expression levels in metronidazole resistance as the main mechanism of resistance to metronidazole could not be established. This study is the first report of the T. vaginalis infection by M. hominis and TVVs in a large collection of isolates from South Brazil. Copyright © 2015 Elsevier B.V. All rights reserved.

[Frequency and in vitro susceptibility antiparasitic of Blastocystis hominis from patients admitted to the Hospital Regional Lambayeque, Peru].

Science.gov (United States)

Silva-Díaz, Heber; Flores-Esqueche, Lorena; Llatas-Cancino, Dunalia; Guevara Vásquez, Génesis; Silva-García, Teresa

2016-01-01

To describe the frequency and antiparasitic in vitro susceptibility of Blastocystis hominis in patients admitted to theHospital Regional Lambayeque, Peru. A cross-sectional study was conducted from January to August 2015 at 313 patients of all ages. B. hominis detection was performed on serial fecal samples by direct microscopic examination and microculture in modified Locke solution. The in vitro susceptibility testing against the drug metronidazole, nitazoxanide, trimethoprim-sulfamethoxazole and erythromycin was performed in 24 strains of B. hominis, which grew up (microculture method) in 10 double concentrations of each antimicrobial (from 256 ug/ml to 0.5 ug/mL) plus a control. 46.3% (145/313) of the sample had B. hominis, also the age between 12 to 17 years and 60 years was associated with higher frequency of parasites (OR: 2.93 and 2.62). The minimum inhibitory concentration (MIC) 90 of metronidazole and nitazoxanide was 3.19 ug/mL and 11.19 ug/ml, respectively, whereas the MIC 90 of trimethoprim-sulfamethoxazole and erythromycin were above 256 ug/mL. B. hominis occurs in high frequency in patients admitted to the Hospital Regional in Lambayeque, proving to be an important problem of public health in the region. Also B. hominis isolated from these patients were shown to be susceptible in vitro to low concentrations of metronidazole and nitazoxanide so they could be chosen for treatment of this parasite.

The use of enzyme-linked immunosorbent assay for detection of Mycoplasma hominis antibodies in infertile women serum samples

DEFF Research Database (Denmark)

Baczynska, Agata; Friis Svenstrup, Helle; Fedder, Jens

2005-01-01

BACKGROUND: Besides Chlamydiae trachomatis and Mycoplasma genitalium, Mycoplasma hominis may also cause infertility due to damage of the Fallopian tubes. Therefore serum samples from infertile women were analyzed for antibodies to M. hominis. METHODS: Sera from 304 infertile women were investigat...

Clinical efficacy of Saccharomyces boulardii or metronidazole in symptomatic children with Blastocystis hominis infection.

Science.gov (United States)

Dinleyici, Ener Cagri; Eren, Makbule; Dogan, Nihal; Reyhanioglu, Serap; Yargic, Zeynel Abidin; Vandenplas, Yvan

2011-03-01

Although many Blastocystis infections remain asymptomatic, recent data suggest it also causes frequent symptoms. Therapy should be limited to patients with persistent symptoms and a complete workup for alternative etiologies. The goal of this study was to compare the natural evolution (no treatment) to the efficacy of Saccharomyces boulardii (S. boulardii) or metronidazole for the duration of diarrhea and the duration of colonization in children with gastrointestinal symptoms and positive stool examination for Blastocystis hominis. This randomized single-blinded clinical trial included children presenting with gastrointestinal symptoms (abdominal pain, diarrhea, nausea-vomiting, flatulence) more than 2 weeks and confirmed B. hominis by stool examination (B. hominis cysts in the stool with microscopic examination of the fresh stool). The primary end points were clinical evaluation and result of microscopic stool examination at day 15. Secondary end points were the same end points at day 30. Randomization was performed by alternating inclusion: group A, S. boulardii (250 mg twice a day, Reflor®) during 10 days; group B, metronidazole (30 mg/kg twice daily) for 10 days; group C, no treatment. At day 15 and 30 after inclusion, the patients were re-evaluated, and stool samples were examined microscopically. On day 15, children that were still symptomatic and/or were still B. hominis-infected in group C were treated with metronidazole for 10 days. There was no statistically significant difference between the three study groups for age, gender, and the presence of diarrhea and abdominal pain. On day 15, clinical cure was observed in 77.7% in group A (n, 18); in 66.6% in group B (n, 15); and 40% in group C (n:15) (p boulardii has potential beneficial effects in B. hominis infection (symptoms, presence of parasites). These findings challenge the actual guidelines.

Antigenic and genomic homogeneity of successive Mycoplasma hominis isolates

DEFF Research Database (Denmark)

Jensen, Lise Torp; Thorsen, P; Møller, B

1998-01-01

Sixty Mycoplasma hominis isolates were obtained from the cervices of pregnant women and from the ears or pharynges of their newborn babies. The isolates were examined by SDS-PAGE and pulsed-field gel electrophoresis. Antigenic and genomic profiles were obtained for 16 series with two or more...

[Standardization of Blastocystis hominis diagnosis using different staining techniques].

Science.gov (United States)

Eymael, Dayane; Schuh, Graziela Maria; Tavares, Rejane Giacomelli

2010-01-01

The present study was carried out from March to May 2008, with the aim of evaluating the effectiveness of different techniques for diagnosing Blastocystis hominis in a sample of the population attended at the Biomedicine Laboratory of Feevale University, Novo Hamburgo, Rio Grande do Sul. On hundred feces samples from children and adults were evaluated. After collection, the samples were subjected to the techniques of spontaneous sedimentation (HPJ), sedimentation in formalin-ether (Ritchie) and staining by means of Gram and May-Grünwald-Giemsa (MGG). The presence of Blastocystis hominis was observed in 40 samples, when staining techniques were used (MGG and Gram), while sedimentation techniques were less efficient (32 positive samples using the Ritchie technique and 20 positive samples using the HPJ technique). Our results demonstrate that HPJ was less efficient than the other methods, thus indicating the need to include laboratory techniques that enable parasite identification on a routine basis.

Electrophoretic analysis of proteins from Mycoplasma hominis strains detected by SDS-PAGE, two-dimensional gel electrophoresis and immunoblotting

DEFF Research Database (Denmark)

Andersen, H; Birkelund, Svend; Christiansen, Gunna

1987-01-01

The proteins of 14 strains of Mycoplasma hominis were compared by SDS-PAGE in gradient gels, by two-dimensional (2D) gel electrophoresis of extracts of 35S-labelled cells and by immunoblot analysis of cell proteins. The strains examined included the M. hominis type strain PG21 and 13 others...... isolated variously from genital tract, mouth, blood, upper urinary tract and a wound. These 14 strains shared 76-99% of proteins in SDS-gradient gel analysis and 41-72% in the 2D gels. As expected, the immunoblot analysis likewise revealed the existence of an extensive common protein pattern in M. hominis...

Life on arginine for Mycoplasma hominis: clues from its minimal genome and comparison with other human urogenital mycoplasmas.

Directory of Open Access Journals (Sweden)

Sabine Pereyre

2009-10-01

Full Text Available Mycoplasma hominis is an opportunistic human mycoplasma. Two other pathogenic human species, M. genitalium and Ureaplasma parvum, reside within the same natural niche as M. hominis: the urogenital tract. These three species have overlapping, but distinct, pathogenic roles. They have minimal genomes and, thus, reduced metabolic capabilities characterized by distinct energy-generating pathways. Analysis of the M. hominis PG21 genome sequence revealed that it is the second smallest genome among self-replicating free living organisms (665,445 bp, 537 coding sequences (CDSs. Five clusters of genes were predicted to have undergone horizontal gene transfer (HGT between M. hominis and the phylogenetically distant U. parvum species. We reconstructed M. hominis metabolic pathways from the predicted genes, with particular emphasis on energy-generating pathways. The Embden-Meyerhoff-Parnas pathway was incomplete, with a single enzyme absent. We identified the three proteins constituting the arginine dihydrolase pathway. This pathway was found essential to promote growth in vivo. The predicted presence of dimethylarginine dimethylaminohydrolase suggested that arginine catabolism is more complex than initially described. This enzyme may have been acquired by HGT from non-mollicute bacteria. Comparison of the three minimal mollicute genomes showed that 247 CDSs were common to all three genomes, whereas 220 CDSs were specific to M. hominis, 172 CDSs were specific to M. genitalium, and 280 CDSs were specific to U. parvum. Within these species-specific genes, two major sets of genes could be identified: one including genes involved in various energy-generating pathways, depending on the energy source used (glucose, urea, or arginine and another involved in cytadherence and virulence. Therefore, a minimal mycoplasma cell, not including cytadherence and virulence-related genes, could be envisaged containing a core genome (247 genes, plus a set of genes required for

Analysis of a Mycoplasma hominis membrane protein, P120

DEFF Research Database (Denmark)

Christiansen, Gunna; Mathiesen, SL; Nyvold, Charlotte Guldborg

1994-01-01

The monoclonal antibody mAb 26.7D generated against a clinical isolate of Mycoplasma hominis 7488 was shown to react with a surface-exposed epitope on a 120-kDa protein (P120). The gene encoding the protein was cloned and sequenced, and the transcriptional start point was determined by primer...

Carl Linnaeus: pictures and propaganda.

Science.gov (United States)

Fara, Patricia

2003-03-01

How do scientists become famous? Carl Linnaeus was an expert at self-promotion who used portraits to gain patronage and consolidate his reputation. His sexualized classification system was hugely controversial, yet his successors celebrated him as a great hero of botany.

Seasonal Variation and Frequency Distribution of Ectoparasites in Crossbreed Cattle in Southeastern Brazil

Directory of Open Access Journals (Sweden)

Maria do Socorro Ferraz da Costa

2014-01-01

Full Text Available The aims of this study were to evaluate the seasonal variation and frequency distribution of Rhipicephalus (Boophilus microplus, Haematobia irritans, and Dermatobia hominis on crossbred heifers under field conditions in the northeast of Minas Gerais state, southeastern Brazil. From November 2007 to September 2009 (23 months, 40 heifers aged 16.6±2.4 months were divided into groups A (1/4 Holstein × 3/4 Gir and B (1/2 Holstein × 1/2 Gir and had the monthly infestation estimated along with the climatic conditions. The mean maximum and minimum temperatures were 28.5 and 19°C, respectively. The ectoparasites were present on animals in all months of the year. The levels of ticks on the animals were low (3.0±0.2 ticks/animal, with the highest density in midwinter. The temperature was the climatic factor that most influenced the tick levels. The population of H. irritans (13.9±0.3 flies/animal and D. hominis (1.5±0.2 larvae/animal on heifers was more influenced by rainfall and exhibited two population peaks during the year. 1/2 Holstein heifers harbored significantly more H. irritans and D. hominis than 1/4 Holstein heifers. The results are discussed considering the most appropriate periods to apply ectoparasiticides and the genetic make-up of the animals.

Seasonal Variation and Frequency Distribution of Ectoparasites in Crossbreed Cattle in Southeastern Brazil

Science.gov (United States)

Ferraz da Costa, Maria do Socorro; Guimarães, Marcos Pezzi; Lima, Walter dos Santos; Ferraz da Costa, Ana Julia; Facury Filho, Elias Jorge; Araujo, Ricardo Nascimento

2014-01-01

The aims of this study were to evaluate the seasonal variation and frequency distribution of Rhipicephalus (Boophilus) microplus, Haematobia irritans, and Dermatobia hominis on crossbred heifers under field conditions in the northeast of Minas Gerais state, southeastern Brazil. From November 2007 to September 2009 (23 months), 40 heifers aged 16.6 ± 2.4 months were divided into groups A (1/4 Holstein × 3/4 Gir) and B (1/2 Holstein × 1/2 Gir) and had the monthly infestation estimated along with the climatic conditions. The mean maximum and minimum temperatures were 28.5 and 19°C, respectively. The ectoparasites were present on animals in all months of the year. The levels of ticks on the animals were low (3.0 ± 0.2 ticks/animal), with the highest density in midwinter. The temperature was the climatic factor that most influenced the tick levels. The population of H. irritans (13.9 ± 0.3 flies/animal) and D. hominis (1.5 ± 0.2 larvae/animal) on heifers was more influenced by rainfall and exhibited two population peaks during the year. 1/2 Holstein heifers harbored significantly more H. irritans and D. hominis than 1/4 Holstein heifers. The results are discussed considering the most appropriate periods to apply ectoparasiticides and the genetic make-up of the animals. PMID:26464941

Relevant prevalence of Mycoplasma hominis and Ureaplasma urealyticum serogroups in HIV-1 infected men without urethritis symptoms

Directory of Open Access Journals (Sweden)

CORDOVA Caio Mauricio Mendes

2000-01-01

Full Text Available M. hominis and U. urealyticum are the better-known mycoplasma species pathogenic to the human genitourinary tract, causing mainly urethritis, bacterial vaginosis and pregnancy complications. In HIV-infected patients, the prevalence and role of these species is still not well known. The aim of this work was to determinate the prevalence of these species in this group of male patients (HIV group, in comparison to a group of men with clinical symptoms of urethritis (STD group. M. hominis was isolated from 7.5% patients (8/106 and U. urealyticum from 18.9% patients (20/106 from the HIV group, being among these 62.5% and 85% in significant concentrations, respectively. In the STD group these rates were 0.9% (1/110 for M. hominis and 13.6% (15/110 for U. urealyticum, being 100% and 93.3% in significant concentrations, respectively. We could demonstrate infection rates by these mycoplasma species in the HIV group as high as the one found in the STD one, what may indicate the occurrence of opportunistic infections in our population. This fact is discussed here because in immunosuppressed patients, specially M. hominis has been reported causing severe infections, even systemically.

Complete Genome Sequence of Mycoplasma hominis Strain Sprott (ATCC 33131), Isolated from a Patient with Nongonococcal Urethritis.

Science.gov (United States)

Calcutt, Michael J; Foecking, Mark F

2015-07-09

Presented here is the complete and annotated genome sequence of Mycoplasma hominis Sprott (ATCC 33131). The chromosome comprises 695,214 bp, which is approximately 30 kb larger than the syntenic genome of M. hominis PG21(T). Tetracycline resistance of strain Sprott is most probably conferred by the tetM determinant, harbored on a mosaic transposon-like structure. Copyright © 2015 Calcutt and Foecking.

Interaction of Mycoplasma hominis PG21 with Human Dendritic Cells: Interleukin-23-Inducing Mycoplasmal Lipoproteins and Inflammasome Activation of the Cell.

Science.gov (United States)

Goret, J; Béven, L; Faustin, B; Contin-Bordes, C; Le Roy, C; Claverol, S; Renaudin, H; Bébéar, C; Pereyre, S

2017-08-01

Mycoplasma hominis lacks a cell wall, and lipoproteins anchored to the extracellular side of the plasma membrane are in direct contact with the host components. A Triton X-114 extract of M. hominis enriched with lipoproteins was shown to stimulate the production of interleukin-23 (IL-23) by human dendritic cells (hDCs). The inflammasome activation of the host cell has never been reported upon M. hominis infection. We studied here the interaction between M. hominis PG21 and hDCs by analyzing both the inflammation-inducing mycoplasmal lipoproteins and the inflammasome activation of the host cell. IL-23-inducing lipoproteins were determined using a sequential extraction strategy with two nondenaturing detergents, Sarkosyl and Triton X-114, followed by SDS-PAGE separation and mass spectrometry identification. The activation of the hDC inflammasome was assessed using PCR array and enzyme-linked immunosorbent assay (ELISA). We defined a list of 24 lipoproteins that could induce the secretion of IL-23 by hDCs, 5 with a molecular mass between 20 and 35 kDa and 19 with a molecular mass between 40 and 100 kDa. Among them, lipoprotein MHO_4720 was identified as potentially bioactive, and a synthetic lipopeptide corresponding to the N-terminal part of the lipoprotein was subsequently shown to induce IL-23 release by hDCs. Regarding the hDC innate immune response, inflammasome activation with caspase-dependent production of IL-1β was observed. After 24 h of coincubation of hDCs with M. homini s, downregulation of the NLRP3-encoding gene and of the adaptor PYCARD-encoding gene was noticed. Overall, this study provides insight into both protagonists of the interaction of M. hominis and hDCs. IMPORTANCE Mycoplasma hominis is a human urogenital pathogen involved in gynecologic and opportunistic infections. M. hominis lacks a cell wall, and its membrane contains many lipoproteins that are anchored to the extracellular side of the plasma membrane. In the present study, we focused on

Two crystal structures of dihydrofolate reductase-thymidylate synthase from Cryptosporidium hominis reveal protein–ligand interactions including a structural basis for observed antifolate resistance

Energy Technology Data Exchange (ETDEWEB)

Anderson, Amy C., E-mail: aca@dartmouth.edu [Dartmouth College, Department of Chemistry, Burke Laboratories, Hanover, NH 03755 (United States)

2005-03-01

An analysis of the protein–ligand interactions in two crystal structures of DHFR-TS from C. hominis reveals a possible structural basis for observed antifolate resistance in C. hominis DHFR. A comparison with the structure of human DHFR reveals residue substitutions that may be exploited for the design of species-selective inhibitors. Cryptosporidium hominis is a protozoan parasite that causes acute gastrointestinal illness. There are no effective therapies for cryptosporidiosis, highlighting the need for new drug-lead discovery. An analysis of the protein–ligand interactions in two crystal structures of dihydrofolate reductase-thymidylate synthase (DHFR-TS) from C. hominis, determined at 2.8 and 2.87 Å resolution, reveals that the interactions of residues Ile29, Thr58 and Cys113 in the active site of C. hominis DHFR provide a possible structural basis for the observed antifolate resistance. A comparison with the structure of human DHFR reveals active-site differences that may be exploited for the design of species-selective inhibitors.

Incidence of myiasis in Panama during the eradication of Cochliomyia hominivorax (Coquerel 1858, Diptera: Calliphoridae (2002-2005

Directory of Open Access Journals (Sweden)

Sergio E Bermúdez

2007-09-01

Full Text Available We present the results of a study on myiasis in Panama during the first years of a Cochliomyia hominivorax eradication program (1998-2005, with the aim of investigating the behavior of the flies that produce myiasis in animals and human beings. The hosts that registered positive for myiasis were cattle (46.4%, dogs (15.3%, humans (14.7%, birds (12%, pigs (6%, horses (4%, and sheep (1%. Six fly species caused myiasis: Dermatobia hominis (58%, Phaenicia spp. (20%, Cochliomyia macellaria (19%, Chrysomya rufifacies (0.4%, and maggots of unidentified species belonging to the Sarcophagidae (3% and Muscidae (0.3%. With the Dubois index, was no evidence that the absence of C. hominivorax allowed an increase in the cases of facultative myiasis.

Microbial load of umbilical cord blood Ureaplasma species and Mycoplasma hominis in preterm prelabor rupture of membranes.

Science.gov (United States)

Kacerovsky, Marian; Pliskova, Lenka; Menon, Ramkumar; Kutova, Radka; Musilova, Ivana; Maly, Jan; Andrys, Ctirad

2014-11-01

To evaluate Ureaplasma species and M. hominis DNA in the umbilical cord blood and its correlation with its microbial load in the amniotic fluid, as a measure of microbial burden in fetal inflammatory response and neonatal outcome in pregnancies complicated by preterm prelabor rupture of membranes (pPROM). A retrospective study of 158 women with singleton pregnancies complicated by pPROM between 24(0/7) and 36(6/7) weeks was conducted. Amniotic fluid was obtained from all women by transabdominal amniocentesis, and umbilical cord blood was obtained by venipuncture from umbilical cords immediately after the delivery of the neonates. The Ureaplasma species and M. hominis DNA was quantitated using absolute quantification techniques. Ureaplasma species and M. hominis DNA was identified in 9% of the umbilical cord blood samples. No correlation between the amniotic fluid and umbilical cord blood microbial load was observed. The presence of Ureaplasma species and M. hominis DNA in the umbilical cord blood had no impact on short-term neonatal morbidity. A high microbial load of genital mycoplasma Ureaplasma species DNA in the umbilical cord in pregnancies complicated by pPROM is not associated with a high fetal inflammatory response and is therefore not associated with serious neonatal morbidity.

Comparative genomic analysis reveals occurrence of genetic recombination in virulent Cryptosporidium hominis subtypes and telomeric gene duplications in Cryptosporidium parvum.

Science.gov (United States)

Guo, Yaqiong; Tang, Kevin; Rowe, Lori A; Li, Na; Roellig, Dawn M; Knipe, Kristine; Frace, Michael; Yang, Chunfu; Feng, Yaoyu; Xiao, Lihua

2015-04-18

Cryptosporidium hominis is a dominant species for human cryptosporidiosis. Within the species, IbA10G2 is the most virulent subtype responsible for all C. hominis-associated outbreaks in Europe and Australia, and is a dominant outbreak subtype in the United States. In recent yearsIaA28R4 is becoming a major new subtype in the United States. In this study, we sequenced the genomes of two field specimens from each of the two subtypes and conducted a comparative genomic analysis of the obtained sequences with those from the only fully sequenced Cryptosporidium parvum genome. Altogether, 8.59-9.05 Mb of Cryptosporidium sequences in 45-767 assembled contigs were obtained from the four specimens, representing 94.36-99.47% coverage of the expected genome. These genomes had complete synteny in gene organization and 96.86-97.0% and 99.72-99.83% nucleotide sequence similarities to the published genomes of C. parvum and C. hominis, respectively. Several major insertions and deletions were seen between C. hominis and C. parvum genomes, involving mostly members of multicopy gene families near telomeres. The four C. hominis genomes were highly similar to each other and divergent from the reference IaA25R3 genome in some highly polymorphic regions. Major sequence differences among the four specimens sequenced in this study were in the 5' and 3' ends of chromosome 6 and the gp60 region, largely the result of genetic recombination. The sequence similarity among specimens of the two dominant outbreak subtypes and genetic recombination in chromosome 6, especially around the putative virulence determinant gp60 region, suggest that genetic recombination plays a potential role in the emergence of hyper-transmissible C. hominis subtypes. The high sequence conservation between C. parvum and C. hominis genomes and significant differences in copy numbers of MEDLE family secreted proteins and insulinase-like proteases indicate that telomeric gene duplications could potentially contribute to

Cryptosporidium y blastocistis hominis como agentes patógenos en el síndrome diarréico

Directory of Open Access Journals (Sweden)

Ligia I. Moncada

1989-12-01

Full Text Available En una comunidad de escasos recursos de Bogotá se tomaron muestras de heces de niños menores de diez años con diarrea y de niños sin diarrea. Las muestras del grupo de estudio y del grupo control resultaron negativas para el Cryptosporidium. Se encontraron positivas para Blastocistis hominis 17 muestras del grupo de estudio (8.3%. y 5 del grupo control (10.4%. Los síntomas predominantes fueron fiebre, dolor abdominal y pérdida del apetito. El B. hominis se asoció con la Escherichia coli, Salmonella campylobacter, E. histiolytica, Giardia lamblia, Ascaris lumbricoides y rotavírus. No se confirmó el papel que en los últimos años se le atribuye al Cryptosporidium y al B. hominis como agentes productores de diarrea.

Sobre o lectótipo de Papilio bixae Linnaeus e a designação do lectótipo de Papilio proteus Linnaeus (Lepidoptera, Hesperiidae

Directory of Open Access Journals (Sweden)

Olaf H. H. Mielke

1989-01-01

Full Text Available The lectotype of Papilo bixae Linnaeus, designated by Hemming (1964 based on the figure of Merian (1705, was found in the Wiesbaden Museum, and here with considered as such. It corresponds to Pyrrhopyge phidias bixae; Evans (1951. Two syntypes of Papilo proteus Linnaeus, 1758, were also found in the same Museum and one of them was selected as lectotype. These lectotypes are figured for the first time.

Complete Genome Sequence of the Human Gut Symbiont Roseburia hominis

DEFF Research Database (Denmark)

Travis, Anthony J.; Kelly, Denise; Flint, Harry J

2015-01-01

We report here the complete genome sequence of the human gut symbiont Roseburia hominis A2-183(T) (= DSM 16839(T) = NCIMB 14029(T)), isolated from human feces. The genome is represented by a 3,592,125-bp chromosome with 3,405 coding sequences. A number of potential functions contributing to host...

The Mycoplasma hominis P120 membrane protein contains a 216 amino acid hypervariable domain that is recognized by the human humoral immune response

DEFF Research Database (Denmark)

Nyvold, Charlotte Guldborg; Birkelund, Svend; Christiansen, Gunna

1997-01-01

In the antigenically heterogeneous species Mycoplasma hominis a monoclonal antibody, mAb 26.7D, was previously found to recognize a 120 kDa polypeptide from M. hominis 7488. This antibody did not react with the type strain PG21. The homologous gene from M. hominis PG21 was cloned and sequenced an...... response. Such a variable domain may be important in evasion of the host's immune response, and thus aid survival of the micro-organism....

Host Cell Responses to Persistent Mycoplasmas - Different Stages in Infection of HeLa Cells with Mycoplasma hominis

Science.gov (United States)

Hopfe, Miriam; Deenen, René; Degrandi, Daniel; Köhrer, Karl; Henrich, Birgit

2013-01-01

Mycoplasma hominis is a facultative human pathogen primarily associated with bacterial vaginosis and pelvic inflammatory disease, but it is also able to spread to other sites, leading to arthritis or, in neonates, meningitis. With a minimal set of 537 annotated genes, M. hominis is the second smallest self-replicating mycoplasma and thus an ideal model organism for studying the effects of an infectious agent on its host more closely. M. hominis adherence, colonisation and invasion of HeLa cells were characterised in a time-course study using scanning electron microscopy, confocal microscopy and microarray-based analysis of the HeLa cell transcriptome. At 4 h post infection, cytoadherence of M. hominis to the HeLa cell surface was accompanied by differential regulation of 723 host genes (>2 fold change in expression). Genes associated with immune responses and signal transduction pathways were mainly affected and components involved in cell-cycle regulation, growth and death were highly upregulated. At 48 h post infection, when mycoplasma invasion started, 1588 host genes were differentially expressed and expression of genes for lysosome-specific proteins associated with bacterial lysis was detected. In a chronically infected HeLa cell line (2 weeks), the proportion of intracellular mycoplasmas reached a maximum of 10% and M. hominis-filled protrusions of the host cell membrane were seen by confocal microscopy, suggesting exocytotic dissemination. Of the 1972 regulated host genes, components of the ECM-receptor interaction pathway and phagosome-related integrins were markedly increased. The immune response was quite different to that at the beginning of infection, with a prominent induction of IL1B gene expression, affecting pathways of MAPK signalling, and genes connected with cytokine-cytokine interactions and apoptosis. These data show for the first time the complex, time-dependent reaction of the host directed at mycoplasmal clearance and the counter measures of

Microbiological and molecular characterization of human clinical isolates of Staphylococcus cohnii, Staphylococcus hominis, and Staphylococcus sciuri.

Science.gov (United States)

Garza-González, Elvira; Morfin-Otero, Rayo; Martínez-Vázquez, Manuel A; Gonzalez-Diaz, Esteban; González-Santiago, Omar; Rodríguez-Noriega, Eduardo

2011-12-01

The incidence of coagulase-negative staphylococci reported as causative agents of nosocomial infections has risen in the last decade. The aim of this study was to characterize biofilm formation, antibiotic resistance, SCCmec type, and genetic relatedness in clinical isolates of Staphylococcus cohnii, Staphylococcus hominis, and Staphylococcus sciuri recovered from humans. Clinically relevant isolates of S. cohnii (n = 15), S. hominis (n = 9), and S. sciuri (n = 6), were collected from patients. Biofilm formation was evaluated using crystal violet staining, drug susceptibility was assessed using the broth microdilution method, and methicillin resistance was measured using the cefoxitin disk test. SCCmec was typed using 2 different methodologies, and genetic relatedness was determined by pulsed-field gel electrophoresis (PFGE). Sixty percent (9/15) of S. cohnii, 33% (3/9) of S. hominis, and 50% (3/6) of S. sciuri isolates were categorized as weak producers of biofilm. None of the isolates were resistant to vancomycin or linezolid. All 3 species showed a high resistance (> 66%) to ampicillin, levofloxacin, erythromycin, and ceftriaxone, and the majority of the isolates were methicillin-resistant. PFGE revealed that the S. cohnii isolates comprised 1 dominant clone. The S. cohnii, S. hominis, and S. sciuri isolates analyzed in this study showed a high methicillin resistance and resistance to other antimicrobials. The results of this study strongly suggest that coagulase-negative staphylococci harbour new SCCmec elements. We report the first case of a clone of S. cohnii associated with human disease.

Erradicação ou manejo integrado das miíases neotropicais das Américas? Eradication or integrated managment of neotropical myiases of the Americas?

Directory of Open Access Journals (Sweden)

Gonzalo E. Moya Borja

2003-09-01

Full Text Available A erradicação da bicheira, Cochliomyia hominivorax dos EUA, da América Central e do Norte da África tornou-se uma realidade criando e liberando machos estéreis. Por que nos não decidimos também erradicar este inseto da América do Sul? Antes de tomar uma atitude corajosa, nós discutiremos neste trabalho as razões científicas, ecológicas e econômicas. O berne, Dermatobia hominis não tem sido erradicado de nenhum pais, devido a que não dispomos de técnicas para sua criação massal em dietas artificiais. Estão faltando também estudos sobre a dispersão, comportamento sexual e sítios de agregação dos adultos no campo. Devido a que as miíases continuarão sendo controladas basicamente com inseticidas, recomendações para manejar a resistência aos inseticidas e estudos sobre métodos alternativos são discutidos visando um Manejo Integrado do berne e da bicheira com fundamentos ecológicos.The eradication of the screwworm, Cochliomyia hominivorax, from USA, Central America and the North of Africa has been achieved by rearing and releasing sterile males. Why we do not decide to eradicate this insect from the southamerican countries too? In this paper the scientific, ecological and economic reasons before taking such a courageous decision are discussed. The human botfly, Dermatobia hominis, has not been eradicated from any country, because there is so far no technique available for mass production in artificial diets. Studies on dispersion, sexual behavior and aggregation sites of the adults in the field are also not known. Why the neotropical myiases will continue to be treated basically with chemicals, recommendations for insecticide resistance management and studies on alternative methods are discussed trying to apply in the future an ecologically based pest management of the screwworm and the human botfly.

Dermatobia hominis misdiagnosed as abscesses in a traveler returning from Brazil to Denmark

DEFF Research Database (Denmark)

Olsen, Jonas; Nejsum, Peter; Jemec, Gregor Borut Ernst

2017-01-01

We present the case of a 62-year-old woman that consulted us for two boil-like lesions on her thighs after returning from a trip to São Paulo, Brazil, where she had swum in a freshwater lake. After consulting three specialist doctors and undergoing two antibiotic treatments, she was diagnosed wit...

Gastrodiscoides hominis infection in a Nigerian- case report | Dada ...

African Journals Online (AJOL)

Il s'agit d'un rapport d'un cas d'un enfant Nigerian âgé de sept ans qui s'est présenté atteints des traits de la sous alimentation et de l'anénue également atteint des gastrodiscoides hominis et ascaris lumbricoides. A la suite de la clairance des vers on a remarqué une enorme amélioration dans le statut de la santé de cet ...

[Usefulness of conventional polymerase chain reaction for the detection of Mycoplasma hominis, Ureaplasma spp. and Trichomonas vaginalis in female outpatient's genital samples].

Science.gov (United States)

Alarcón, Gonzalo; Barraza, Gabriela; Vera, Andrea; Wozniak, Aniela; García, Patricia

2016-02-01

Trichomonas vaginalis, Mycoplasma hominis and Ureaplasma spp. are microorganisms responsible for genitourinary and pregnancy pathologies. Nucleic acid amplification methods have shown several advantages, but have not been widely studied for the detection of these microorganisms. To implement a conventional polymerase chain reaction (PCR) for the detection of the microorganisms and to compare its results versus the methods currently used at our laboratory. 91 available samples were processed by PCR, culture (M. hominis y Ureaplasma spp.) and wet mount (T vaginalis). Results were compared and statistically analyzed by kappa agreement test. 85, 80 and 87 samples resulted in agreement for the detection of M. hominis, Ureaplasma spp. y T. vaginalis, respectively. For M. hominis and Ureaplasma spp., agreement was substantial, whereas for T. vaginalis it was moderate, however, for the latter, PCR detected more cases than wet mount. We recommend the implementation of PCR for detection of T. vaginalis whereas culture kit is still a useful method for the other microorganisms.

Detection of Tritrichomonas foetus and Pentatrichomonas hominis in intestinal tissue specimens of cats by chromogenic in situ hybridization.

Science.gov (United States)

Mostegl, Meike M; Wetscher, Andreas; Richter, Barbara; Nedorost, Nora; Dinhopl, Nora; Weissenböck, Herbert

2012-02-10

In this retrospective study 102 cats were analyzed for the presence of trichomonads in intestinal tissue sections using chromogenic in situ hybridization (CISH). Two intestinal trichomonad species are described in cats: Pentatrichomonas hominis and Tritrichomonas foetus. While P. hominis is considered a mere commensal, T. foetus has been found to be the causative agent of feline large-bowel diarrhea. For the detection of both agents within intestinal tissue CISH assays using three different probes were performed. In the first CISH run a probe specific for all relevant members of the order Trichomonadida (OT probe) was used. In a second CISH run all positive samples were further examined on three consecutive tissue sections using the OT probe, a probe specific for the family of Tritrichomonadidae (Tritri probe) and a newly designed probe specifically detecting P. hominis (Penta hom probe). In total, four of the 102 cats were found to be positive with the OT probe. Thereof, one cat gave a positive reaction with the P. hominis probe and three cats were positive with the T. foetus probe. All Trichomonas-positive cats were pure-bred and between 8 and 32 weeks of age. In one cat positive for T. foetus large amounts of parasites were found in the gut lumen and invading the intestinal mucosa. The species of the detected trichomonads were confirmed by polymerase chain reaction and nucleotide sequencing of a part of the 18S ribosomal RNA gene. In this study, the usefulness of CISH to detect intestinal trichomonads within feline tissue samples was shown. Additionally, the specific detection of P. hominis using CISH was established. Generally, it was shown that CISH is well suited for detection and differentiation of trichomonosis in retrospective studies using tissue samples. Copyright © 2011 Elsevier B.V. All rights reserved.

[Cutaneous myiasis--a vacation souvenir].

Science.gov (United States)

Frieling, U; Nashan, D; Metze, D

1999-03-01

Cutaneous myiasis is a temporary infestation of the skin with fly larvae. Travelling to subtropical areas accounts for a higher risk and increasing incidence in Europeans. In Middle- and South American myiasis is mainly caused by the botfly (Dermatobia hominis). Blood-suckling arthropods, usually mosquitoes, transmit the larvae of the botfly via phoresis, a unique mechanism of egg deposition. In Africa cutaneous myiasis is mostly due to the tumbu fly (Cordylobia anthropophaga). Infection with the tumbu fly larvae occurs after direct contact with the eggs that are often deposited in clothes and towels. Clinically an abscess-like lesion develops. Creeping sensations of movement under the skin are occasionally described. Following hatching, spontaneous healing can normally be expected, although extraction of the larvae is recommended to prevent abscess formation and superinfection.

Freqüência de infecção pelo Mycoplasma hominis e Ureaplasma urealyticum em mulheres inférteis e relação com repercussões clínicas Frequency of infection with Mycoplasma hominis and Ureaplasma urealyticum in infertile women and clinical repercussions

Directory of Open Access Journals (Sweden)

Ivan Araujo Penna

2005-02-01

Full Text Available OBJETIVOS: determinar a freqüência de infecção pelo Mycoplasma hominis e Ureaplasma urealyticum e relacioná-la a variáveis clínicas de mulheres inférteis. MÉTODOS: estudo transversal com 322 pacientes inférteis submetidas à coleta de swab endocervical para pesquisa de Mycoplasma hominis e Ureaplasma urealyticum, de outubro de 2002 a maio de 2004. Todas as pacientes foram submetidas a protocolo básico de investigação clínica e laboratorial da infertilidade. Como controle, utilizou-se série histórica de 51 mulheres não gestantes, previamente pesquisadas quanto aos agentes infecciosos estudados. RESULTADOS: a freqüência de infecção pelo Mycoplasma hominis e Ureaplasma urealyticum foi de 4,9% nas pacientes inférteis e 13,8% no grupo controle. Entre as pacientes inférteis observou-se relação entre a presença dos dois patógenos e alterações no resultado da histerossalpingografia (OR: 3,20; IC 95%: 1,05-9,73, presença de dispareunia (OR: 10,72; IC 95%: 3,21-35,77 e corrimento vaginal (OR: 8,5; IC 95%: 2,83-26,02, além de cultura endocervical positiva para Escherichia coli (OR: 16,09; IC 95%: 4,95-52,25. CONCLUSÃO: a taxa de infecção pelo Mycoplasma hominis e Ureaplasma urealyticum é baixa em pacientes inférteis e está associada a seqüelas reprodutivas tardias.PURPOSE: to determine the frequency of Mycoplasma hominis and Ureaplasma urealyticum infection, and relate it to the associated clinical variables of infertile women. METHODS: transversal study involving 322 infertile women, submitted to collection of endocervix swab for research of Mycoplasma hominis and Ureaplasma urealyticum infecction, from October 2002 to May 2004. All patients were submitted to a basic infertility investigation protocol. As control, a historical series of 51 non-pregnant women previously investigated as for the studied infectious agents, was used. RESULTS: the frequency of Mycoplasma hominis and Ureaplasma urealyticum infection was 4

Prevalence and antibiotic susceptibility of Mycoplasma hominis and Ureaplasma urealyticum in genital samples collected over 6 years at a Serbian university hospital

Directory of Open Access Journals (Sweden)

Dusan Skiljevic

2016-01-01

Full Text Available Background: Mycoplasma hominis and Ureaplasma urealyticum are implicated in a wide array of infectious diseases in adults and children. Since some species have innate or acquired resistance to certain types of antibiotics, antibiotic susceptibility testing of mycoplasma isolated from the urogenital tract assumes increasing importance. Aims: To evaluate the prevalence and antibiotic susceptibility of M. hominis and U. urealyticum in genital samples collected between 2007 and 2012. Methods: Three hundred and seventy three patients presenting with symptoms of sexually transmitted diseases, infertility or risky sexual behaviour, who had not taken antibiotics in the previous 6 weeks and had ≥10 WBC per high power field on genital smears were studied. Urethral samples were taken in men and endocervical samples in women. The mycoplasma IST-2 kit was used for organism identification and for testing susceptibility to doxycycline, josamycin, ofloxacin, erythromycin, tetracycline, ciprofloxacin, azithromycin, clarithromycin and pristinamycin. Results: U. urealyticum was isolated from 42 patients and M. hominis from 11 patients. From 9.8% of isolates, both organisms were grown. All M. hominis isolates were resistant to tetracycline, clarithromycin and erythromycin while U. urealyticum was highly resistant to clarithromycin (94.6%, tetracycline (86.5%, ciprofloxacin (83.8% and erythromycin (83.8%. M. hominis was sensitive to doxycycline (83.3% and ofloxacin (66.7% while most U. urealyticum strains were sensitive to doxycycline (94.6%. Limitations: Inability of the commercial kit used in the study to detect other potentially pathogenic urogenital mycoplasmas (Ureaplasma parvum, Mycoplasma genitalium. Conclusion: There is significant resistance of U. urealyticum and M. hominis to tetracycline and macrolides. The most active tetracycline for genital mycoplasmas was found to be doxycycline, which continues to be the drug of first choice.

Enhancing Jatropha curcas (Linnaeus) Cultivation and Seed Yield ...

African Journals Online (AJOL)

Enhancing Jatropha curcas (Linnaeus) Cultivation and Seed Yield among ... Journal of Agricultural Research and Development ... Jatropha curcas yields substantial quantity of seed oil and is growing in importance as a source of biodiesel.

Effect of a Mycoplasma hominis-like Mycoplasma on the infection of HEp-2 cells by the TW-183 strain of Chlamydia pneumoniae.

Science.gov (United States)

Castilla, E A; Wadowsky, R M

2000-02-01

We isolated a Mycoplasma hominis-like mycoplasma from a stock culture of Chlamydia pneumoniae TW-183 obtained from the American Type Culture Collection and eradicated the contaminant by treating the stock suspension with a nonionic detergent, Igepal CA-630. The M. hominis-like mycoplasma neither inhibits nor enhances the infectivity of C. pneumoniae for HEp-2 cells.

Effect of a Mycoplasma hominis-Like Mycoplasma on the Infection of HEp-2 Cells by the TW-183 Strain of Chlamydia pneumoniae

OpenAIRE

Castilla, Elias A.; Wadowsky, Robert M.

2000-01-01

We isolated a Mycoplasma hominis-like mycoplasma from a stock culture of Chlamydia pneumoniae TW-183 obtained from the American Type Culture Collection and eradicated the contaminant by treating the stock suspension with a nonionic detergent, Igepal CA-630. The M. hominis-like mycoplasma neither inhibits nor enhances the infectivity of C. pneumoniae for HEp-2 cells.

Presencia de Blastocystis Hominis como agente causal de enfermedades gatrointestinales en la comuna 7 (Gaira del Distrito de Santa Marta

Directory of Open Access Journals (Sweden)

Sonja Liliana Lozano Socarras

2013-10-01

Full Text Available La Blastocystis hominis es un protozoo que causa cuadros diarreicos. Es altamente prevalente en poblaciones que no cuentan con servicios adecuados de higiene, alcantarillado y salud pública. La infección con Blastocystis hominis frecuentemente concomita con otros enteropatógenos de reconocida patogenicidad, además se ha reportado como parásito oportunista en pacientes con VIII SIDA. El objetivo del presente estudio es determinar la presencia de Blastocystis hominis en pacientes de consulta externa con síntomas asociados a enfermedades gastrointestinales, en la comuna 7 del distrito de Santa Marta, Colombia, durante el mes de Enero a Diciembre de 2004. El método de diagnóstico utilizado fue examen coproparasitológico seriado y el número de pacientes analiza-dos fue de 291. Los resultados muestran una alta presencia de Blastocystis hominken pacientes con enfermedad diarreica residentes en Gaira. Un alto porcentaje de la población parasitada (62,6% presento como único agente causal de la enfermedad diarreica al Blastocystis hominis lo que sugiere la presencia de otras enfermedades que pueden involucrar un compromiso inmunológico, el efecto será una respuesta inmune débil contra el parásito.

Chronic diarrhea caused by Blastocystis hominis and Cryptosporidium sp. in immunocompetent patient-a case report

Science.gov (United States)

Andriyani, Y.; Rozi, M. F.; Saragih, R. H.; Darlan, D. M.

2018-03-01

Blastocystis hominis and Cryptosporidium sp. are commonly associated with immunocompromised patients. Severe clinical manifestation can be produced by this organism. It varies according to immune status, and subtype of this organism. Unfortunately, we found an immunocompetent patient with chronic diarrhea caused by this organism. A 38- year old male was admitted to Adam Malik General Hospital because of watery diarrhea since four days ago. Administration of fluid replacement was done to this patient, but the frequency of diarrhea did not decrease. Loperamide as anti-spasmodic was also given in each episode of diarrhea. Surprisingly, fecal smear examination revealed that this patient positive for Blastocystis hominis and Cryptosporidium sp. Thus, diarrhea was resolved for four days without giving any anti-parasitic drugs to the patient.

Characteristics of Factors of Protozoa Blastocystis hominis Persistence.

Science.gov (United States)

Potaturkina-Nesterova, N I; Il'ina, N A; Bugero, N V; Nesterov, A S

2016-10-01

Persistence activity manifested in the expression of anti-lysozyme, anti-lactoferrin, and antihistone factors promoting inactivation of natural anti-infection resistance factors in the body was revealed in Blastocystis hominis protozoa. Activities of these factors were ranged. The frequency of these factors in clinical isolates of blastocyst decreased in the following order: anti-lactoferrin activity (84.5±3.7%)→anti-lysozyme activity (64.8±5.7%)→anti-histone activity (48.1±2.3%). In healthy humans, the corresponding parameters were 7.3±1.3, 5.3±0.9, and 3.3±0.4%, respectively (pprotozoa.

Antimicrobial susceptibility patterns of Ureaplasma species and Mycoplasma hominis in pregnant women.

Science.gov (United States)

Redelinghuys, Mathys J; Ehlers, Marthie M; Dreyer, Andries W; Lombaard, Hennie A; Kock, Marleen M

2014-03-28

Genital mycoplasmas colonise up to 80% of sexually mature women and may invade the amniotic cavity during pregnancy and cause complications. Tetracyclines and fluoroquinolones are contraindicated in pregnancy and erythromycin is often used to treat patients. However, increasing resistance to common antimicrobial agents is widely reported. The purpose of this study was to investigate antimicrobial susceptibility patterns of genital mycoplasmas in pregnant women. Self-collected vaginal swabs were obtained from 96 pregnant women attending an antenatal clinic in Gauteng, South Africa. Specimens were screened with the Mycofast Revolution assay for the presence of Ureaplasma species and Mycoplasma hominis. The antimicrobial susceptibility to levofloxacin, moxifloxacin, erythromycin, clindamycin and tetracycline were determined at various breakpoints. A multiplex polymerase chain reaction assay was used to speciate Ureaplasma positive specimens as either U. parvum or U. urealyticum. Seventy-six percent (73/96) of specimens contained Ureaplasma spp., while 39.7% (29/73) of Ureaplasma positive specimens were also positive for M. hominis. Susceptibilities of Ureaplasma spp. to levofloxacin and moxifloxacin were 59% (26/44) and 98% (43/44) respectively. Mixed isolates (Ureaplasma species and M. hominis) were highly resistant to erythromycin and tetracycline (both 97% resistance). Resistance of Ureaplasma spp. to erythromycin was 80% (35/44) and tetracycline resistance was detected in 73% (32/44) of Ureaplasma spp. Speciation indicated that U. parvum was the predominant Ureaplasma spp. conferring antimicrobial resistance. Treatment options for genital mycoplasma infections are becoming limited. More elaborative studies are needed to elucidate the diverse antimicrobial susceptibility patterns found in this study when compared to similar studies. To prevent complications in pregnant women, the foetus and the neonate, routine screening for the presence of genital mycoplasmas is

Resistência contra ectoparasitas em bovinos da raça Crioula Lageana e meio-sangue Angus avaliada em condições naturais

Directory of Open Access Journals (Sweden)

Cristina P. Cardoso

2014-02-01

Full Text Available Este trabalho foi desenvolvido com o objetivo de avaliar a resistência aos ectoparasitas em bovinos jovens da raça Crioula Lageana e meio-sangue Angus em condições naturais. Foram utilizados 10 machos castrados em cada grupo, recém desmamados (6-8 meses e mantidos sob as mesmas condições de manejo, em pastagens cultivadas de inverno e verão, no município de Monte Castelo - SC, sofrendo infestação natural por ectoparasitas. A cada 28 dias, fêmeas de carrapatos (Rhipicephalus (Boophilus microplus com tamanho acima de 4 mm foram quantificadas nos dois lados do corpo de cada animal, bem como os nódulos com larvas de Dermatobia hominis. A espessura da capa do pelame foi também avaliada a cada coleta e os animais foram classificados quanto à coloração do pelame. Os animais da raça Crioula Lageana foram mais resistentes às infestações por D. hominis e R. microplus. Não houve diferença entre a disposição de carrapatos e bernes conforme os lados direito e esquerdo dos animais. Os animais de pelagem escura albergaram a maior porcentagem de ectoparasitas nos grupos avaliados.

Prueba de susceptibilidad antiparasitaria in vitro para Blastocystis hominis, Entamoeba histolytica-E. dispar, Balantidium coli

Directory of Open Access Journals (Sweden)

Rito Zerpa Larrauri

2012-01-01

Full Text Available Antecedentes: Pruebas de susceptibilidad antiparasitaria in vitro para Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli, así como el cultivo para protozoarios intestinales, han sido publicados escasamente en la literatura médica. En nuestro medio aún no se ha comunicado pruebas de susceptibilidad in vitro para los parásitos mencionados. Objetivos: Plantear una alternativa de prueba de susceptibilidad antiparasitaria in vitro y conocer su resistencia frente a los antimicrobianos. Diseño: Estudio prospectivo, descriptivo. Instituciones: Instituto de Medicina Tropical "Daniel Alcides Carrión", Universidad Nacional Mayor de San Marcos, e Instituto Especializado de Salud del Niño, Lima, Perú. Material biológico: Cultivos de Blastocystis hominis, Entamoeba histolytica-E. dispar y Balantidium coli frente a cinco antimicrobianos. Métodos: Se trabajó con 64 cultivos de Blastocystis hominis, 16 de Entamoeba histolytica-dispar y 16 de Balantidium coli, frente a cinco antimicrobianos: metronidazol, cotrimoxazol, tetraciclina, furazolidona y ciprofloxacina. Las cepas de B. hominis, E. histolytica-E. dispar fueron cultivadas en el medio de Pavlova modificado, de 500 muestras de heces de niños con diagnóstico de parasitosis intestinal y las de B. coli de heces de cerdo. Las pruebas de susceptibilidad in vitro se realizaron con el método de microcultivos en el medio de Pavlova modificado, en pocitos con 200 uL del medio sin antiparasitarios (control y con antiparasitarios en 10 concentraciones, desde 128 ug/mL hasta 0,25 ug/mL; luego de incubación a 36º C por 48 horas, la lectura por examen microscópico directo comparó el desarrollo en el medio control con el desarrollo en los pocitos conteniendo los antimicrobianos. Principales medidas de resultados: Concentración inhibitoria mínima (CIM. Resultados: Se encontró para B. hominis, con metronidazol CIM 90: 64 ug/mL y CIM 50: 2 ug/mL; para E. histolytica-E. dispar con

The Effect of Hominis Placenta Herbal Acupuncture on Bell's palsy

Directory of Open Access Journals (Sweden)

Yun Jeong-hun

2000-07-01

Full Text Available This report was done to observe the effect of Hominis placenta herbal acupuncture on Bell's palsy. The study group comprised 16 patients who arrived at Woo-suk university oriental hospital from January, 1999 till January, 2000 for Bell's palsy. All patients were divided into two group. One was herbal acupunture group, and the other was control group. Acupunture group was done herbal acupuncture therapy on the facial acupuncture points. Followings are achievement and a term of each group. In herbal acupuncture group, 100% motor recovery was 7 case, 75% was 1 case, and 25% motor recovery term was 7.38±5.21 days, 50% was 11.00±6.16 days, 75% was 15.13±9.55 days, 100% was 23.14±7.97 days. In control group, 100% motor recovery was 4 case, 75% was 2 case, 25% below was 2 case and 25% motor recovery term was 11.17±4.96days, 50% was 18.17±6.82 days, 75% was 29.50±6.95 days, 100% was 44.00±11.49 days. The above results indicate that Hominis placenta herbal acupuncture is a useful effect on Bell's palsy. thus, continuous herbal acupunture study will be needed for more clinical application on Bell' palsy.

Survival and infectivity of Sarcoptes scabiei var. canis and var. hominis.

Science.gov (United States)

Arlian, L G; Runyan, R A; Achar, S; Estes, S A

1984-08-01

Sarcoptes scabiei var. canis served as a suitable model for the study of S. scabiei var. hominis survival. S. scabiei var. canis and var. hominis mites were found to survive off the host for 24 to 36 hours at room conditions (21 degrees C and 40% to 80% relative humidity [RH]), and the canine variety survived 19 days at 10 degrees C and 97% RH. Female mites survived decidedly longer than male mites at comparable conditions. Generally, higher RH values and lower temperatures favored survival, whereas higher temperature and lower RH led to early death. Most canine scabies mites that were held off the host for 36 hours at 75% RH and 22 degrees to 24 degrees C remained infective and penetrated when returned to the host. Live mites of the human variety that were recovered from bed linen slept on by infested patients would also penetrate a host after being held off a host for 96 hours in alternating 12-hour periods of room conditions and refrigeration. Penetration required less than 30 minutes for all life stages of both varieties, and it was accomplished by a mite secretion that dissolved the host tissue. Dislodged mites, particularly those in close proximity to the source, can be a likely source of infestation.

Effect of Hominis placenta Pharmacopuncture on the Dysmenorrhea (A Pilot study, Single blind, Randomized, Controlled Clinical Trial

Directory of Open Access Journals (Sweden)

Su-Min Kim

2008-09-01

Full Text Available Objective : This study was designed to evaluate the effect of Hominis placenta Pharmacopuncture treatment on Dysmenorrhea of Women. Methods : 49 subjects who were suffering from dysmenorrhea volunteered to answer the MMP(Measure of Menstrual Pain and MSSL(Menstrual Symptom Severity List questionnaire. They were divided into two groups, a Hominis placenta Pharmacopuncture treatment group(Experiment al group, n=25 and a Normal Saline(N/S treatment group(Control group, n=24. The two groups were injected on the CV4, S36, Sp9 and Sp6 acupuncture point. They were treated totally five times depending on the individual menstruation cycles. The scores of MMP and MSSL were measured overall three times before and after the menstruation cycle. The collected data were analyzed as paired t-test, independent t-test using SPSS 12.0 WIN Program. Results : As a result of the evaluation by MMP and MSSL, a significant improvement on dysmenorrhea was made in the two groups(p<0.05, and both scores of Experiment group were decreased more than Control group. But there was no significant difference between the two groups. Conclusions : The Hominis placenta Pharmacopuncture treatment and the Normal Saline treatment were effective in decreasing the symptom of Dysmenorrhea.

A high-affinity human monoclonal IgM antibody reacting with multiple strains of Mycoplasma hominis

DEFF Research Database (Denmark)

Moller, SA; Birkelund, Svend; Borrebaeck, CA

1990-01-01

Human monoclonal antibodies were produced against Mycoplasma hominis by in vitro immunization of peripheral blood lymphocytes from a healthy seropositive donor using low amounts of antigen (5 ng/ml). The immune B lymphocytes were subsequently immortalized by Epstein-Barr virus transformation...

Fatal nosocomial meningitis caused by Mycoplasma hominis in an adult patient: case report and review of the literature

Directory of Open Access Journals (Sweden)

Sophie Reissier

2016-07-01

Full Text Available Meningitis due to Mycoplasma hominis in adults is rarely described, with only three cases having been reported to date. A case of fatal meningitis in a 39-year-old patient after a neurosurgical procedure for a subarachnoid haemorrhage is reported herein. Identification and treatment were significantly delayed because of the rarity of the aetiology and difficulty identifying this organism with the routinely used conventional methods, such as Gram staining and agar growth on standard agar plates. Clinical procedures and the treatment of ‘culture-negative’ central nervous system infections is a real challenge for clinical microbiologists and clinicians, and M. hominis has to be considered as a potential, although very uncommon, pathogen.

Co-infections with Ureaplasma parvum, Mycoplasma hominis and Chlamydia trachomatis in a human immunodeficiency virus positive woman with vaginal discharge.

Science.gov (United States)

Ghosh, Arnab; Rawre, Jyoti; Khanna, Neena; Dhawan, Benu

2013-01-01

A 30-year-old human immunodeficiency virus (HIV)-1 infected woman presented with vaginal discharge and associated vulval irritation. The vaginal swabs tested positive for Ureaplasma parvum and Mycoplasma hominis by both culture and polymerase chain reaction (PCR). The specimen also tested positive for Chlamydia trachomatis deoxyribonucleic acid (DNA) by cryptic plasmid and omp1 gene PCR assays. The patient was successfully treated with azithromycin based on the antibiotic susceptibility testing results of U. parvum and M. hominis by microbroth dilution. Since sexually transmitted infections enhance the transmission of HIV, HIV-positive patients should be screened routinely for these pathogens.

Topography of the medullar cone in the giant anteater (Myrmecophaga tridactyla Linnaeus, 1758

OpenAIRE

Lucas de Assis Ribeiro; Tharlianne Alici M. de Souza; Priscilla Rosa Q. Ribeiro; Lázaro A. dos Santos; Daniela Cristina de O. Silva; Frederico O. Carneiro e Silva; Roseâmely Angélica C. Barros; Renata Graciele Zanon

2015-01-01

ABSTRACT. Ribeiro L.A., Souza T.A.M., Ribeiro P.R.Q., Santos L.A., Silva D.C.O., Carneiro e Silva F.O., Barros R.A.C. & Zanon R.G. [Topography of the medullar cone in the giant anteater (Myrmecophaga tridactyla Linnaeus, 1758.] Topografia do cone medular do Tamanduá-bandeira (Myrmecophaga tridactyla Linnaeus, 1758). Revista Brasileira de Medicina Veterinária, 37(4):353-358, 2015. Programa de Pós-Graduação em Ciências Veterinárias e Zootecnia, Faculdade de Medicina Veterinária, Universidade Fe...

PCR-Múltiple para el diagnóstico de Mycoplasma genitalium, Mycoplasma hominis, Ureaplasma parvum y Ureaplasma urealyticum

Directory of Open Access Journals (Sweden)

Nadia Rodríguez-Preval

2007-04-01

Full Text Available Mycoplasma genitalium, Mycoplasma hominis, Ureaplasma parvum y Ureaplasma urealyticum son especies relacionadas con enfermedades del tracto genitourinario, y particularmente con la uretritis no gonocócica (UNG en el hombre. Los cultivos de estos microorganismos resultan complicados, por lo que las técnicas moleculares, principalmente la reacción en cadena de la polimerasa (PCR, se han convertido en el principal método de detección de estos organismos. Objetivo: Implementar un método molecular basado en tecnología de genes para el diagnóstico de estas cuatro especies de micoplasmas genitales, aplicándolo en muestras clínicas de pacientes con UNG. Material y métodos: Se crearon las condiciones para un PCR-Múltiple para identificar estas especies empleando como muestra ADN de referencia, utilizando los juegos de cebadores complementarios a fragmentos de los genes de la proteína adhesiva de M. genitalium (MgPa, ARN ribosomal 16S de M. hominis, región espaciadora entre los genes del ARN ribosomal 16S y 23S de U. parvum, y de la región espaciadora adyacente al gen de la ureasa y específico para U. urealyticum, siendo un método específico y sensible. Resultados: Al analizar 34 muestras de exudado uretral, 27 correspondieron a la clase Mollicutes, obteniéndose 14,8% de positividad a M. genitalium, 18,5% a M. hominis, 11,1% a U. urealyticum y 3,7%. a U. parvum. Con este trabajo se realizó por primera vez el diagnóstico de M. genitalium, M. hominis, U. parvum y U. urealyticum en muestras uretrales de pacientes cubanos. Conclusión: Se recomienda incluir el diagnóstico de estas especies en un mayor número de pacientes cubanos con síntomas uretrales, para validar el método propuesto y conocer la relación de estos microorganismos con la UNG.

A Non-Proteinaceious Toxin from the Venomous Spines of the Lionfish Pterois Volitans (Linnaeus)

Science.gov (United States)

1985-01-01

Spines of the Lionfish Pterois Volitans (Linnaeus) 6. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(a) S. CONTRACT OR GRANT NUMBER(&) Nair, M.S.R. Cheung, P...and Identify by block number) Tinon Lionfish , Non-Proteinaceous Toxin, Ichthyotoxin 20. A9ST’ACT ? ( mt.e ,vmM N , mid ify by block nusmber) "!;The...COMMUNICATIONS A NON-PROTEINACEOUS TOXIN FROM THE VENOMOUS SPINES OF THE LIONFISH PTEROIS VOLITANS (LINNAEUS) 2 20 M. S. R. NAIR,’ PAUL CHEUNG, INA

PCR Research of Mycoplasma hominis in Trichomonas vaginalis Cells of Sichuan Province%四川地区阴道毛滴虫内人型支原体的PCR检测

Institute of Scientific and Technical Information of China (English)

朱晓燕; 王雅静; 毕世樑; 张仁刚

2009-01-01

20 isolates of Trichomonas vaginalis were collected from clinical patients in hospital. After pure cultivation, genomic DNA of T. vaginalis was extracted. A pair of specific 16S rDNA primers was designed based on the sequence of Mycoplasma hominis. M. hominis in T. vaginalis cells were detected by PCR. Altogether 20 isolates of T. vaginalis were collected, 13 out of 20 T. vaginalis isolates harboured M. hominis, and the symbiosis ratio between T. vaginalis and M. hominis was up to 65%. It suggested that the symbiotic relationship between T. vaginalis and M. hominis occurred commonly in Sichuan, China.%从临床上分离获得20株阴道毛滴虫虫株,经纯化培养后,提取基因组DNA.以人型支原体16S rDNA序列设计特异性引物,利用PCR技术检测阴道毛滴虫内的人型支原体,结果有13株为人型支原体阳性,感染率为65%,表明阴道毛滴虫与人型支原体的共生关系在中国四川具有普遍性.

An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico

Directory of Open Access Journals (Sweden)

Alejandro Salinas-Castro

2014-09-01

Full Text Available An unusual food plant for Cydia pomonella (Linnaeus (Lepidoptera, Tortricidae in Mexico. Larvae of Cydia pomonella (Linnaeus, 1758 were discovered on floral cones of Magnolia schiedeana (Schltdl, 1864 near the natural reserve of La Martinica, Veracruz, México. Magnolia represents an unusual host for this moth species, which is known throughout the world as the "codling moth", a serious pest of fruits of Rosaceae, especially apples. The larvae were identified using taxonomic keys, and identification was corroborated using molecular markers. Further sampling resulted in no additional larvae, hence, the observation was probably that of an ovipositional error by the female, and M. schiedeana is not at risk of attack by this important moth pest.

In vitro antimicrobial activities of cinnamon bark oil, anethole, carvacrol, eugenol and guaiazulene against Mycoplasma hominis clinical isolates.

Science.gov (United States)

Sleha, Radek; Mosio, Petra; Vydrzalova, Marketa; Jantovska, Alexandra; Bostikova, Vanda; Mazurova, Jaroslava

2014-06-01

The aim of this study was to evaluate the antimicrobial effects of five natural substances against 50 clinical isolates of Mycoplasma hominis. The in vitro activity of selected natural compounds, cinnamon bark oil, anethole, carvacrol, eugenol and guaiazulene, was investigated against 50 M. hominis isolates cultivated from cervical swabs by the broth dilution method. All showed valuable antimicrobial activity against the tested isolates. Oil from the bark of Cinnamomum zeylanicum (MBC90 = 500 µg/mL) however was found to be the most effective. Carvacrol (MBC90 = 600 µg/mL) and eugenol (MBC90 = 1000 µg/mL) also possessed strong antimycoplasmal activity. The results indicate that cinnamon bark oil, carvacrol and eugenol have strong antimycoplasmal activity and the potential for use as antimicrobial agents in the treatment of mycoplasmal infections.

First record of Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae in Brazil

Directory of Open Access Journals (Sweden)

Ubirajara R. Martins

2015-03-01

Full Text Available Molorchus minor minor (Linnaeus (Coleoptera, Cerambycidae is recorded for the first time in Brazil (Bahia. It was originally described from Europe and is currently widely distributed in that continent and Asia.

Cryptosporidiosis outbreak in a child day-care center caused by an unusual Cryptosporidium hominis subtype.

Science.gov (United States)

Goñi, Pilar; Almagro-Nievas, Diego; Cieloszyk, Joanna; Lóbez, Silvia; Navarro-Marí, José María; Gutiérrez-Fernández, José

2015-12-01

This work describes the genetic characterization of Cryptosporidium and Giardia involved in an outbreak in a nursery school in Granada, Spain, that affected seven children under the age of 4. Nucleic acids were extracted from the seven stool samples positive to Cryptosporidium or Giardia by microscopy and/or immunochromatography. The species and subtypes of Cryptosporidium were identified by PCR-RFLP and PCR of the SSUrRNA and gp60 genes, respectively. The assemblages of Giardia duodenalis isolates were characterized by PCR of the tpi gene. PCR products were sequenced and analyzed. All of the isolates were positive for Cryptosporidium hominis. Five of them belonged to subtype IaA11R2, one to subtype IbA10G2R2, and the other could not be identified. Three of these samples were positive for G. duodenalis by PCR, two belonging to the assemblage A, and the other one to assemblage B. This is the first report of Cryptosporidium hominis subtype IaA11R2 as a cause of an outbreak in Europe where subtype IbA10G2R2 is the most frequently identified. In the case of Giardia, an outbreak could not be confirmed because of the low number of positive samples and the low genetic variability of the amplified fragments for assemblage A of tpi gene. A new subtype, of Cryptosporidium hominis named IaA11R2, has been described as a cause of an outbreak in a nursery school in Granada, Spain. However an outbreak of giardiasis could not be confirmed. Copyright © 2015 Elsevier España, S.L.U. y Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

"The rate of Chlamydia Trachomatis, Mycoplasma Hominis and Ureaplasma Urealyticum in females with habitual abortion and its comparison with control group "

Directory of Open Access Journals (Sweden)

Salari MH

2002-06-01

Full Text Available Females abortion is one of the most important sequela of genital infection with chlamydia trachomatis, Mycoplasma hominis and Ureaplasma urealyticum.In this study frequency of Chlamydia trachomatis, Mycoplasma hominis and Ureaplasma urealyticum was studied in 125 females with habitual abortion by direct and indirect immunofluorescence tests and culture method and compared with 250 normal population. The results obtained were as follow: Mycoplasma hominis was isolated from 18 (14.4% females with habitual abortion and 18 (7.2% normal population (P=0.0139. Ureaplasma urealyticum was isolated from 39(31.2% females with habitual aboration and 48 (19.2% normal population (P=0.0045. Chlamydia trachomatis was detected by direct immunofluorescence test in 9 (7.2% of cases and 2 (0.8% of control groups (P=0.0002. the antibody titer against D-K serotypes of Chlamydia trachomatis was also measured. The valuable titer of antibody (>1/16 was detected in 15 (12% of cases and 8 (3.2% of control groups (P=0.0004.The results show that chlamydia trachomatis and Ureaplasma urealyticum may be responsible for some cases of abortion.

Regulatory effects of Tenebrio molitor Linnaeus on immunological ...

African Journals Online (AJOL)

This paper describes the results of experiments to test the effect of the larvae of Tenebrio molitor Linnaeus on the immune systems of mice. Mice were given a decoction of T. molitor in water at doses of 1.87, 3.75 and 7.50 g/kg/d for four weeks, after which their immune function was studied. The results indicate that T. molitor ...

Clio pyramidata Linnaeus, 1767 forma convexa (Boas, 1886) (Mollusca, Pteropoda)

NARCIS (Netherlands)

Spoel, van der S.

1973-01-01

The pelagic fauna of the Red Sea shows special variation induced by its isolated character (Van der Spoel, 1971). Clio pyramidata from the Red Sea is usually incorrectly referred to as the tropical forma lanceolata (Lesueur, 1813) or the typical forma pyramidata Linnaeus, 1767. Some large samples

Selection of Mycoplasma hominis PG21 deletion mutants by cultivation in the presence of monoclonal antibody 552

DEFF Research Database (Denmark)

Jensen, L T; Ladefoged, S; Birkelund, S

1995-01-01

characterized. The mutants showed deletions of a various number of repeats. The deletions were accompanied by a decrease in size of the proteins. With increasing size of deletions, agglutination and growth inhibition by MAb 552 became less pronounced. Spontaneous aggregation of the mutant M. hominis cells...

Clinical significance of asymptomatic urogenital Mycoplasma hominis and Ureaplasma urealyticum in relation to seminal fluid parameters among infertile Jordanian males

Directory of Open Access Journals (Sweden)

Hala I. Al-Daghistani

2010-01-01

Conclusion: The differences in the occurrence of M. hominis were statistically insignificant among infertility and control groups, but it was significant for U. urealyticum (p=0.046. M. hominis occurs more frequently in the semen of infertile-varicose male and normal seminal fluid quality. It seems to have no adverse effects on sperm motility but it might decline the fertility potential in such cases. U. urealyticum on the other hand have no clear significant impacts on sperm motility. The mean values for sperm motility, concentrations, and viscosity were not affected by the presence of the two species. Despite the significant presence of Ureaplasma among infertility, further studies were needed to clarify their potential effect on semen quality and infertility status.

Lesões da mosca dos chifres (Haematobia irritans Linnaeus,1758 na pele de bovinos e impacto na indústria do couro Lesions of the horn fly (Haematobia irritans Linnaeus, 1758 on the bovine skin and their impact in leather industry

Directory of Open Access Journals (Sweden)

Luciana Viero da Silva

2002-12-01

,09% tipo "C". Após a aplicação de pastas especiais por profissionais especializados evidenciou-se que as áreas afetadas pela mosca dos chifres onde se observara um grande numero de lesões passaram a ter um aspecto homogêneo e sem marcas. Deve-se salientar que estes couros, mesmo provenientes de animais tratados apresentavam lesões características de outros parasitas como Dermatobia hominis e Boophilus microplus e também lesões provavelmente adquiridas durante o processamento no frigorífico. Estes resultados sugerem que a mosca dos chifres não representa um fator econômico importante para a industria do couro.Twenty two male 2- year- old Ibagé bovines at the beginning of the experiment were selected. They were divided into two groups of 11 bovines each. One group was treated with insecticide at 14 days intervals and the other remained as control. After that the animals were slaughtered and the respective leather sent to the tannery where they were tanned and evaluated in two stages, the Wet-Blue (leather treated in chromium, still humid and bluish and the total tanning. Animals weight, carcasses weight and dressing percentage were recorded and there was no correlation between infestation by the horn fly and those parameters. At slaughter, samples of the flank areas and the back of the animals were collected and processed for histology studies, which revealed the presence of a perivascular inflammatory infiltration with eosinophils and few mononuclear cells (lymphocytes and plasma cells at the superficial dermis in which 16 out of 19 samples (84.21% were mild in 2 out of 19 samples (10.52% were moderate and in 1 out of 19 samples (5. 26% was marked. In the tanning phase called as Wet-blue, the classification of the leathers was as follows: 8 out 22 (36.36% type "A", 10 out of 22 (45.45% type "B", and"4 out of 22 (18.18% type "C. At this point in the group of animals treated with insecticide the areas commonly parasited by the horn fly (flanks and back a few

Refinement of the karyological aspects of Psidium guineense (Swartz, 1788): a comparison with Psidium guajava (Linnaeus, 1753)

OpenAIRE

Marques, Anelise Machado; Tuler, Am?lia Carlos; Carvalho, Carlos Roberto; Carrijo, Tatiana Tavares; Ferreira, Marcia Flores da Silva; Clarindo, Wellington Ronildo

2016-01-01

Abstract Euploidy plays an important role in the evolution and diversification of Psidium Linnaeus, 1753. However, few data about the nuclear DNA content, chromosome characterization (morphometry and class) and molecular markers have been reported for this genus. In this context, the present study aims to shed light on the genome of Psidium guineense Swartz, 1788, comparing it with Psidium guajava Linnaeus, 1753. Using flow cytometry, the nuclear 2C value of Psidium guineense was 2C = 1.85 pi...

Linnaeus' restless system: translation as textual engineering in eighteenth-century botany.

Science.gov (United States)

Dietz, Bettina

2016-04-01

In this essay, translations of Linnaeus' Systema naturae into various European languages will be placed into the context of successively expanded editions of Linnaeus' writings. The ambition and intention of most translators was not only to make the Systema naturae accessible for practical botanical use by a wider readership, but also to supplement and correct it, and thus to shape it. By recruiting more users, translations made a significant contribution to keeping the Systema up to date and thus maintaining its practical value for decades. The need to incorporate countless additions and corrections into an existing text, to document their provenance, to identify inconsistencies, and to refer to relevant observations, descriptions, and illustrations in the botanical literature all helped to develop and refine techniques of textual montage. This form of textual engineering, becoming increasingly complex with each translation cycle, shaped the external appearance of new editions of the Systema, and reflected the modular architecture of a botanical system designed for expansion.

The mortality of Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae induced by powdered plants

Directory of Open Access Journals (Sweden)

Kłyś Małgorzata

2015-01-01

Full Text Available The aim of this study was to investigate whether powdered plants of different species namely: peppermint Mentha piperita (L. (Lamiaceae, wormwood Artemisia absinthium (L. (Asteraceae, common sage Salvia officinalis (L. (Lamiaceae, allspice Pimenta dioica (Linnaeus et Merrill (Myrtaceae and common garlic Allium sativum (L. (Amaryllidaceae, added to semolina using concentrations of 1.23, 3.61, and 5.88%, influence the mortality rate in the saw-toothed grain beetle Oryzaephilus surinamensis Linnaeus, 1758 (Coleoptera: Silvanidae. Experiments were conducted in a laboratory at 28°C and relative humidity 60±5%. At the concentration of 1.23%, allspice seeds caused the highest mortality amongst the saw-toothed grain beetle. When concentrations of 3.61 and 5.88% were used, sage, peppermint and wormwood caused the highest statistically significant mortality of O. surinamensis

Eighteenth century classification of mental illness: Linnaeus, de Sauvages, Vogel, and Cullen.

Science.gov (United States)

Munsche, Heather; Whitaker, Harry A

2012-12-01

Classification was an important aspect of the 17th and 18th century development of Western science, epitomized by Linnaeus's 1735 Systema Naturae (Nature's System), in which he divided each kingdom of nature into classes, orders, and species. Linnaeus, a physician in addition to being a renowned taxonomist, endeavored to classify all known human diseases, largely on the basis of symptoms, in his 1759 Genera Morborum (Varieties of Diseases). We focus on his classification of mental disorders, a large subset of the Genera Morborum. We compare and contrast the Linnaean system with François Boissier de Sauvages's 1772 Nosologie méthodique (A Systematic Nosology) and Rudolph Augustin Vogel's 1764 Generum Morborum (Varieties of Diseases). We consider the impact of these nosologies on William Cullen's (1769/1800) Nosology, a popular system of disease classification that persisted through much of the 19th century.

Carolus Linnaeus and the Edible Dormouse

Directory of Open Access Journals (Sweden)

Carlo Violani

1995-05-01

Full Text Available Abstract Carolus Linnaeus was totally unacquainted with the Edible Dormouse Myoxus glis (L., a species not found in Sweden: while describing Mus Rattus in the 10th Edition of the "Systema Naturae" (1758, the Swedish naturalist confessed his ignorance concerning the "Glis" of the ancients and suggested that it might have been the marmot or the hamster. Thanks to written information received from his correspondent in Slovenia, Giovanni Antonio Scopoli, Linnaeus was able to include the new species Sciurus Glis in his 12th Edition of the "Systema Naturae" (1766, reporting almost verbatim a summary of Scopoli's description of the rodent. Scopoli's letter is still preserved in the Library of the Linnean Society of London. The Linnean type locality "Habitat in Europa australi" for the Edible Dormouse Myoxus glis glis must therefore be restricted to "Southern Carniola, Slovenia", contra "Germany" as stated, for instance, by Miller (1912, Toschi (1965, Corbet (1978 and Storch (1978. A new name is required for the continental European form, for which M. glis germanicus ssp. nov. is here proposed. Some information on the appreciation of Myoxus glis as a delicacy ("carnes avide eduntur" in Linnaeus' words conclude the paper. Riassunto Carlo Linneo ed il Ghiro - Dopo aver descritto Mus Rattus nella decima edizione del "Systema Naturae" (1758 il naturalista svedese Carlo Linneo confessava di non essere a conoscenza del "Glis" degli antichi autori e ne suggeriva l'identificazione con la Marmotta o con il Criceto comune; è infatti noto che Myoxus glis non è diffuso in Svezia. In base ad una lettera ricevuta dal suo corrispondente in Slovenia, Giovanni Antonio Scopoli, Linneo fu in grado di descrivere questa nuova specie come Sciurus Glis nella dodicesima edizione del "Systema

Predação oportunista de Artibeus planirostris (Spix, 1823 e Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae por marsupiais e anuro na APA do Rio Curiaú, Amapá, Brasil Opportunistic predation of Artibeus planirostris (Spix, 1823 and Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae by marsupials and anuran in the APA do Rio Curiaú, Amapá State, Brazil

Directory of Open Access Journals (Sweden)

Isai Jorge de Castro

2011-03-01

Full Text Available Durante estudos com morcegos em floresta de várzea na APA do Rio Curiaú, Amapá, Brasil, observamos três casos de predações oportunistas de morcegos frugívoros capturados em redes de neblina. Duas destas predações ocorreram por marsupiais e uma por anuro. Artibeus planirostris (Spix, 1823 (Chiroptera, Phyllostomidae foi predado por Didelphis marsupialis Linnaeus, 1758 e Philander opossum (Linnaeus, 1758 (Didelphimorphia, Didelphidae. Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae foi predado por Leptodactylus pentadactylus (Laurenti, 1768 (Anura, Leptodactylidae. A vocalização dos morcegos provavelmente atraiu os marsupiais para a rede, onde estes os predaram aproveitando que estavam presos. Este tipo de interação pode ocorrer naturalmente, no entanto, com maior dificuldade de registro.We observed three occasional predations of bats captured in mist nets by marsupials and a frog during studies in a várzea forest in the Amapá state. Artibeus planirostris (Spix, 1823 (Chiroptera, Phyllostomidae was preyed upon by Didelphis marsupialis Linnaeus, 1758 and Philander opossum (Linnaeus, 1758 (Didelphimorphia, Didelphidae. Carollia perspicillata (Linnaeus, 1758 (Chiroptera, Phyllostomidae was preyed on by Leptodactylus pentadactylus (Laurenti, 1768 (Anura, Leptodactylidae. The bats vocalizations probably attracted the marsupials and a frog to the mist nets where they preyed. This interaction form can occur naturally, however, are more difficult to observed.

Evaluation of First Voided Urine Samples For Detection of Ureaplasma Uriealyticum and Mycoplasma Hominis in Urinary Tracts of Men and Women Suffering from Nongonococcal and Nonspecific Urethritis

Directory of Open Access Journals (Sweden)

M Mohamadi

2007-07-01

Full Text Available Introduction: Ureaplasma uriealyticum is one of the most important causes of Nongonococcal and Nonspecific urethritis (NGU & NSU in men. Mycoplasma hominis too has a causal role in NGU & NSU. This study aimed to investigate whether it is possible to detect Mycoplasma hominis and Ureaplasma uriealyticum in first voided urine samples in men suffering from NGU & NSU without complaints of urethral secretions and in women with clinical symptoms despite negative vaginal secretion culture test results. Methods: First voided urine samples were taken from 150 patients (21 women & 129 men suffering from NGU & NSU who referred to the Division of Bacteriology, School of Public Health, Tehran University of Medical Sciences in 2004-2005. Samples were examined by culture method. Results: Cultures were positive for Mycoplasma and Ureoplasma in 49 (32.6 % of the 150 samples. Of the 21 samples taken from women, 5 samples were positive for Mycoplasma & Ureoplasma (2 samples Mycoplasma, 3 samples Ureaplasma. Samples from 44 men were positive for Ureoplasma & Mycoplasma(17 samples Mycoplasma, 4 samples Ureaplasma and 23 samples were positive for both. Ureoplasma urealyticum was detected in 30 samples (20% and Mycoplasma hominis, was detected in 42 samples (28%. Conclusion: The results of this study provides evidence that culture tests can be done using voided urine in order to detect Mycoplasma hominis and ureaplasma urealyticum in patients suffering from Nongonococcal urethris; men who do not have urethral secretions and women with clinical symptoms despite negative vaginal secretion culture test results.

ヒト精子運動に及ぼす Ureaplasma urealyticum 及び Mycoplasma hominis の影響

OpenAIRE

Chang, Myung Woong; Choi, Tae Kyung; Matsuo, Yoshiyasu; Yoshii, Zensaku

1984-01-01

The human spermatozoal motility was significantly affected by the whole culture solution and slightly less significantly by the microbial cell suspension of Ureaplasma urealyticum but not the microbial metabolites (culture supernatant). The same phenomenon was observed with the preparations of Mycoplasma hominis in somewhat less degree.

A Clinical Study on 1 Case of Patient with Bilateral Simultaneous Bell's Palsy Treated by Hominis Placenta Herbal-Acupuncture

Directory of Open Access Journals (Sweden)

Kwon, Kang

2003-06-01

Full Text Available Objective : This study was carried out to investigate the progress of bilateral simultaneous facial palsy and the effect of Hominis Placenta herbal-acupunture and the other oriental medical therapies. Methods : We used two methods to research the progress of disease. 1. Diagnosis - Facial muscle test, Taste test, Hearing test, Photographies, Lab-finding 2. Treatment - Acupuncture, Herbal-acupuncture, Electroacupuncture, Herb-med Results : The onset of Rt. facial palsy was earlier than Lt. facial palsy 3days. The reaction on the treatment of Rt. facial palsy was more dull than Lt. facial palsy. In terms of treatment period, Rt. facial palsy was very longer than Lt. facial palsy. Conclusion : According to the above results, we discoveried that Hominis Placenta herbal-acupunture and the other oriental medical therapies had good influence on the bilateral simultaneous facial palsy. In the future, we should endeavor to know influence between Rt. and Lt. face in case of bilateral simultaneous Bell's palsy.

Detection of T. vaginalis,M. hominis,M. genitalium, C. trachomatis, N. gonorrhoeae and U. urealyticum using Multiplex PCR

Directory of Open Access Journals (Sweden)

Tamara Brunelli

2013-03-01

Full Text Available Intoduction. The sexually transmitted diseases include a large group of infections affecting both the sexes. In this study we evaluated the prevalence of Trichomonas vaginalis, Mycoplasma hominis, Mycoplasma genitalium, Chlamydia trachomatis, Neisseria gonorrhoeae and Ureaplasma urealyticum in the Prato area during the period September 2010 – July 2011. Methods.We analysed different kind of samples (urine, endocervical swabs, urethral swabs, seminal fluids from hospitalized patients or referred to the Prato clinic subjects.The DNA was obtained using EZ1-DNA extraction kit and EZ1 instrument.The DNA was then amplified using the Seeplex STD6 kit (Seegene, Korea, identifying multiple pathogens simultaneously (T. vaginalis, M. hominis, M. genitalium, C. trachomatis, N. gonorrhoeae e U. urealyticum. The revelation was performed by electrophoresis on microchip (instrument Multina, Shimadzu, Japan. Results. 1136 samples from Italian and foreign patients were examined: 876 were endocervical swabs (77%, 103 urethral swabs (9%, 103 seminal fluids (9%, and 54 urines (5%. The number of females was higher than males [894 (78.7% vs 242 (21.3%]; the mean age of females was 37.0±11.6 years, whereas that of males was 41.5 ±12.63 years.The prevalence of urogenital pathogens was: 15 positive samples for T. vaginalis (1.3%, 56 for M. hominis (4.9%, 13 for M. genitalium (1.1%, 28 for C. trachomatis (2.5%, 8 for N. gonorrhoeae (0.7% and 87 for U. urealyticum (7.7%.Among all positive, 25 subjects were positive for more than one pathogen and in particular: one was positive for the presence of 4 pathogens, five presented 3 pathogens simultaneously and the remaining nineteen for 2 pathogens. Conclusions. This study provides data on the prevalence of sexually transmitted diseases in the hospital of Prato.

Frequency of Blastocystis hominis and other intestinal parasites in stool samples examined at the Parasitology Laboratory of the School of Pharmaceutical Sciences at the São Paulo State University, Araraquara Freqüência de Blastocystis hominis e outros enteroparasitas em amostras de fezes examinadas no Laboratório de Parasitologia da Faculdade de Ciências Farmacêuticas da Universidade Estadual Paulista, Araraquara

Directory of Open Access Journals (Sweden)

Júlio César Miné

2008-12-01

Full Text Available Blastocystis homins is a protozoan that causes an intestinal infection known as human blastocystosis. This infection is diagnosed by means of parasitological examination of stools and by permanent staining techniques. The present study was developed to evaluate the frequency of Blastocystis hominis infection among inhabitants of the Araraquara region, State of São Paulo, and to compare different methods for investigating this protozoan in feces samples. Evaluations on 503 stool samples were performed by means of direct fresh examination and using the techniques of Faust et al., Lutz and Rugai et al. In addition, the iron hematoxylin, trichrome and modified Kinyoun staining techniques were used. Out of the 503 samples examined, 174 (34.6% were found to be positive for the presence of intestinal parasites. The most frequent protozoa and helminths were Entamoeba coli (14.6% and Strongyloides stercoralis (6.7%, respectively. Blastocystis hominis was present in 23 (4.6% fecal samples, with a predominately pasty consistency and without characterizing a condition of diarrhea. Despite the low frequency of Blastocystis hominis found in the Araraquara region, compared with other regions of Brazil, it is important to perform laboratory diagnostic tests for this protozoan. Its finding in fecal material is indicative of food and drinking water contamination. Since the transmission route for this parasite is accepted to be oral-fecal, this implies that the population needs guidance regarding hygiene and basic sanitation measures as a means for controlling health problems caused by enteroparasites.Blastocystis hominis é um protozoário, causador de infecção intestinal denominada blastocistose humana, cujo diagnóstico é realizado pelo exame coproparasitológico e por meio de técnicas de coloração permanente. Este estudo foi desenvolvido para avaliar a freqüência da infecção por Blastocystis hominis em habitantes da região de Araraquara/SP, bem

Loggerhead turtle, Caretta caretta (Linnaeus, 1758 (Testudines, Cheloniidae, as a new host of Monticellius indicum Mehra, 1939 (Digenea: Spirorchiidae and associated lesiond to spirorchiid eggs

Directory of Open Access Journals (Sweden)

Werneck M. R.

2017-12-01

Full Text Available The present note describes the occurrence of Monticellius indicum Mehra, 1939 (Digenea: Spirorchiidae in an adult loggerhead turtle, Caretta caretta (Linnaeus, 1758, found on the coast of the state of Rio de Janeiro, Brazil. Pathological changes due to spirorchiid eggs (type 1 and 3 were found in gastrointestinal system, endocrine system, and heart. This parasite has previously been described in the green turtle, Chelonia mydas (Linnaeus, 1758, from Pakistan, Brazil and Costa Rica as well as in the hawksbill sea turtle, Eretmochelys imbricata (Linnaeus, 1766, in Brazil. This note reports the loggerhead turtle as a new host for M. indicum.

Prevalence and characteristics of Blastocystis hominis infection in children.

Science.gov (United States)

O'Gorman, M A; Orenstein, S R; Proujansky, R; Wadowsky, R M; Putnam, P E; Kocoshis, S A

1993-02-01

Blastocystis hominis, a protozoan whose pathogenicity has been questioned, is sometimes found in the human gastrointestinal tract. We sought to determine the prevalence of Blastocystis in stool and to characterize clinical features of infection with Blastocystis in children. Forty-six (3%) of 1,736 patients undergoing fecal microscopy at Children's Hospital of Pittsburgh between January 1, 1985, and December 31, 1988, harbored Blastocystis. Of these 46 children, 75% had exposure to well water or had been in developing countries. Thirty-nine of the 46 (85%) experienced gastrointestinal symptoms, such as abdominal pain, diarrhea, vomiting, and weight loss. Blastocystis was the only parasite found in 35 of those 39 symptomatic children. Symptoms resolved within one month in 90% of patients receiving antiparasitic pharmacotherapy, but in only 58% (P < .04) of those receiving no therapy. We conclude that children infected with Blastocystis often experience gastrointestinal symptoms and that treatment increases the rate of symptomatic improvement. We speculate that Blastocystis is a human pathogen.

THE METHODS OF LABORATORY DIAGNOSTICS OF UROGENITAL INFECTIONS ASSOCIATED WITH MYCOPLASMA HOMINIS AND UREAPLASMA SPP.

Directory of Open Access Journals (Sweden)

O. V. Zarucheynova

2014-01-01

Full Text Available Wide distribution of urogenital mycoplasmas in the population, the high frequency of carrier state and a long asymptomatic course of disease, the lack of specific clinical symptoms making the diagnosis impossible without using of special laboratory tests. The review focuses on indications for mycoplasma infection screening and for an appointmentof antibiotic therapy. The most commonly used laboratory diagnostic methods of urogenital infections, associated with Mycoplasma hominis and Ureaplasma spp., with their characteristics, advantages and disadvantages are described.

Myiasis in Dogs in the Greater Accra Region of Ghana.

Science.gov (United States)

Johnson, Sherry A M; Gakuya, Daniel W; Mbuthia, Paul G; Mande, John D; Afakye, Kofi; Maingi, Ndichu

2016-01-01

Myiasis is the infestation of tissues of live vertebrate animals and humans with dipterous larvae. In sub-Saharan Africa, Cordylobia anthropohaga and Cordylobia rodhaini are known to be responsible for cutaneous myiasis in animals and humans. Human cases of myiasis, purportedly acquired in Ghana but diagnosed in other countries, have been reported; however, published data on its occurrence in animals in Ghana is unavailable. This study assessed the prevalence of canine myiasis among owned dogs in the Greater Accra region (GAR) of Ghana. A cross-sectional study was conducted in the Greater Accra region of Ghana, selected for being the region with the highest estimated population density of owned dogs. Physical examination and demographic characteristics of the study dogs were assessed. Management of the dogs was assessed through a questionnaire administered to the dog owners. A total of 392 owned dogs were sampled. Twenty-nine (7.4%) had cutaneous myiasis caused by C. rodhaini. In addition, one (0.2%) of the dogs had intestinal myiasis, with Dermatobia hominis as the offending larvae. Among the breeds of dogs with myiasis, the mongrel was most affected, with 24 (82.8%) out of the 29 cases. The mongrels, majority of which (24; 82.8%) were males, were left to roam freely in the community. Results from this study demonstrate that C. rodhaini and D. hominis are important causes of myiasis in owned dogs in the GAR of Ghana. Dogs could play a role in the spread of myiasis to humans, with its attendant public health implications.

Update on Pneumocystis carinii f. sp. hominis Typing Based on Nucleotide Sequence Variations in Internal Transcribed Spacer Regions of rRNA Genes

Science.gov (United States)

Lee, Chao-Hung; Helweg-Larsen, Jannik; Tang, Xing; Jin, Shaoling; Li, Baozheng; Bartlett, Marilyn S.; Lu, Jang-Jih; Lundgren, Bettina; Lundgren, Jens D.; Olsson, Mats; Lucas, Sebastian B.; Roux, Patricia; Cargnel, Antonietta; Atzori, Chiara; Matos, Olga; Smith, James W.

1998-01-01

Pneumocystis carinii f. sp. hominis isolates from 207 clinical specimens from nine countries were typed based on nucleotide sequence variations in the internal transcribed spacer regions I and II (ITS1 and ITS2, respectively) of rRNA genes. The number of ITS1 nucleotides has been revised from the previously reported 157 bp to 161 bp. Likewise, the number of ITS2 nucleotides has been changed from 177 to 192 bp. The number of ITS1 sequence types has increased from 2 to 15, and that of ITS2 has increased from 3 to 14. The 15 ITS1 sequence types are designated types A through O, and the 14 ITS2 types are named types a through n. A total of 59 types of P. carinii f. sp. hominis were found in this study. PMID:9508304

Cryptosporidium hominis Is a Newly Recognized Pathogen in the Arctic Region of Nunavik, Canada: Molecular Characterization of an Outbreak.

Directory of Open Access Journals (Sweden)

Karine Thivierge

2016-04-01

Full Text Available Cryptosporidium is a leading cause of childhood diarrhea in low-resource settings, and has been repeatedly associated with impaired physical and cognitive development. In May 2013, an outbreak of diarrhea caused by Cryptosporidium hominis was identified in the Arctic region of Nunavik, Quebec. Human cryptosporidiosis transmission was previously unknown in this region, and very few previous studies have reported it elsewhere in the Arctic. We report clinical, molecular, and epidemiologic details of a multi-village Cryptosporidium outbreak in the Canadian Arctic.We investigated the occurrence of cryptosporidiosis using a descriptive study of cases with onset between April 2013 and April 2014. Cases were defined as Nunavik inhabitants of any age presenting with diarrhea of any duration, in whom Cryptosporidium oocysts were detected by stool microscopy in a specialised reference laboratory. Cryptosporidium was identified in stool from 51 of 283 individuals. The overall annual incidence rate (IR was 420 / 100,000 inhabitants. The IR was highest among children aged less than 5 years (1290 /100,000 persons. Genetic subtyping for stool specimens from 14/51 cases was determined by DNA sequence analysis of the 60 kDa glycoprotein (gp60 gene. Sequences aligned with C. hominis subtype Id in all cases. No common food or water source of infection was identified.In this first observed outbreak of human cryptosporidiosis in this Arctic region, the high IR seen is cause for concern about the possible long-term effects on growth and development of children in Inuit communities, who face myriad other challenges such as overcrowding and food-insecurity. The temporal and geographic distribution of cases, as well as the identification of C. hominis subtype Id, suggest anthroponotic rather than zoonotic transmission. Barriers to timely diagnosis delayed the recognition of human cryptosporidiosis in this remote setting.

Occurrence of the Leech, Pontobdella muricata Linnaeus, on Elasmobranch Species in the Northern and Central Adriatic Sea.

Science.gov (United States)

Bolognini, Luca; Leoni, Simone; Polidori, Piero; Grati, Fabio; Scarcella, Giuseppe; Pellini, Giulio; Domenichetti, Filippo; Ferrà, Carmen; Fabi, Gianna

2016-12-01

This study provides a parasitological analysis of the elasmobranch species caught in the northern and central Adriatic Sea. Sixty-two marine leeches were recorded on 747 individuals of Raja clavata Linnaeus, 1758 (thornback ray), Myliobatis aquila Linnaeus, 1758 (common eagle ray), and Torpedo marmorata Risso, 1810 (marbled torpedo ray) caught in 56 hauls over a 5 yr period. All leeches were identified as Pontobdella muricata, which is a typical ectoparasite of benthic elasmobranchs. The prevalence of infection ranged from 7.11% on R. clavata to 12.00% on M. aquila. The intensity of infection, the preferential sites of attachment to the host, and the periodicity of infection were evaluated.

Heterogeneity and compartmentalization of Pneumocystis carinii f. sp. hominis genotypes in autopsy lungs

DEFF Research Database (Denmark)

Helweg-Larsen, J; Lundgren, Bettina; Lundgren, Jens Dilling

2001-01-01

The extent and importance of genotype heterogeneity of Pneumocystis carinii f. sp. hominis within lungs have not previously been investigated. Two hundred forty PCR clones obtained from respiratory specimens and lung segments from three patients with fatal P. carinii pneumonia were investigated....... Not all genotypes present in the lungs at autopsy were detected in the diagnostic respiratory samples. Compartmentalization of specific ITS and mtLSU rRNA sequence types was observed in different lung segments. In conclusion, the interpretation of genotype data and in particular ITS sequence types...... in the assessment of epidemiological questions should be cautious since genotyping done on respiratory samples cannot a priori be assumed to represent all genotypes present within the lung....

Association between preterm labor and genitourinary tract infections caused by Trichomonas vaginalis, Mycoplasma hominis, Gram-negative bacilli, and coryneforms

Directory of Open Access Journals (Sweden)

Alaa El-Dien M.S. Hosny

2017-09-01

Conclusion: Our study demonstrated that the main risk factors for PTL were vaginal infection with T. vaginalis, M. hominis, coryneforms, and Gram-negative bacilli, and their determinants (vaginal pH>5, positive whiff test, heavy vaginal bleeding. Both young age (< 20 years and poor obstetric history were also the risk factors. Therefore, screening for genitourinary tract infections is strongly recommended to be included in prenatal care.

First report of Sneathia sanguinegens together with Mycoplasma hominis in postpartum prosthetic valve infective endocarditis: a case report.

Science.gov (United States)

Kotaskova, Iva; Nemec, Petr; Vanerkova, Martina; Malisova, Barbora; Tejkalova, Renata; Orban, Marek; Zampachova, Vita; Freiberger, Tomas

2017-08-14

The presence of more than one bacterial agent is relatively rare in infective endocarditis, although more common in prosthetic cases. Molecular diagnosis from a removed heart tissue is considered a quick and effective way to diagnose fastidious or intracellular agents. Here we describe the case of postpartum polymicrobial prosthetic valve endocarditis in a young woman. Sneathia sanguinegens and Mycoplasma hominis were simultaneously detected from the heart valve sample using broad range 16S rRNA polymerase chain reaction (PCR) followed by sequencing while culture remained negative. Results were confirmed by independent PCR combined with denaturing gradient gel electrophoresis. Before the final agent identification, the highly non-compliant patient left from the hospital against medical advice on empirical intravenous treatment with aminopenicillins, clavulanate and gentamicin switched to oral amoxycillin and clavulanate. Four months after surgery, no signs of inflammation were present despite new regurgitation and valve leaflet flail was detected. However, after another 5 months the patient died from sepsis and recurrent infective endocarditis of unclarified etiology. Mycoplasma hominis is a rare causative agent of infective endocarditis. To the best of our knowledge, presented case is the first report of Sneathia sanguinegens detected in this condition. Molecular techniques were shown to be useful even in polymicrobial infective endocarditis samples.

Antibiotic susceptibility profiles of Mycoplasma hominis and Ureaplasma urealyticum isolated during a population-based study concerning women infertility in northeast Romania

Directory of Open Access Journals (Sweden)

Mareş Mihai

2011-03-01

Full Text Available The study was carried out on 1068 infertile women under initial evaluation. For Mycoplasma hominis, the highest resistance rates were registered for ciprofloxacin (72.22%, followed by macrolides and ofloxacin. For Ureaplasma urealyticum, the ciprofloxacin resistance was also high (51.72%, while the resistance rates to other tested antibiotics were significantly lower.

Sequencing analysis reveals a unique gene organization in the gyrB region of Mycoplasma hominis

DEFF Research Database (Denmark)

Ladefoged, Søren; Christiansen, Gunna

1994-01-01

of which showed similarity to that which encodes the LicA protein of Haemophilus influenzae. The organization of the genes in the region showed no resemblance to that in the corresponding regions of other bacteria sequenced so far. The gyrA gene was mapped 35 kb downstream from the gyrB gene.......The homolog of the gyrB gene, which has been reported to be present in the vicinity of the initiation site of replication in bacteria, was mapped on the Mycoplasma hominis genome, and the region was subsequently sequenced. Five open reading frames were identified flanking the gyrB gene, one...

DNA sequencing reveals limited heterogeneity in the 16S rRNA gene from the rrnB operon among five Mycoplasma hominis isolates

DEFF Research Database (Denmark)

Mygind, T; Birkelund, Svend; Christiansen, Gunna

1998-01-01

To investigate the intraspecies heterogeneity within the 16S rRNA gene of Mycoplasma hominis, five isolates with diverse antigenic profiles, variable/identical P120 hypervariable domains, and different 16S rRNA gene RFLP patterns were analysed. The 16S rRNA gene from the rrnB operon was amplified...

A New Maximum Length Record of the Bluefish (Pomatomus saltatrix Linnaeus, 1766) for Turkey Seas

OpenAIRE

Cengiz, Özgür

2014-01-01

One specimen of the bluefish (Pomatomus saltatrix Linnaeus, 1766) with 76.5 cm in total length and 4800.0 g in total weight was photographed in the Çanakkale Fish Market. The given length is second maximum length record of the bluefish for Turkish waters

Micoplasma hominis, Ureaplasma urealyticum y bacterias aeróbicas en el semen de hombres que consultan por infertilidad Micoplasma hominis, Ureaplasma urealyticum and aerobic bacteria present in the semen from men attending infertility service

Directory of Open Access Journals (Sweden)

Bertha Victoria Rodríguez Pendás

2013-04-01

Full Text Available Introducción: las infecciones en el semen humano pueden alterar la calidad espermática, y vincularse con problemas de infertilidad masculina. Objetivo: determinar la frecuencia de infecciones por Micoplasma hominis, Ureaplasma urealyticum y bacterias aeróbicas en el semen de hombres que consultan por infertilidad, e identificar si existe relación entre las infecciones encontradas y las alteraciones en las variables de calidad del semen. Métodos: se realizó un estudio descriptivo transversal, para evaluar muestras de semen de 140 hombres, con edades entre 20 y 45 años, provenientes de las consultas de infertilidad del Instituto Nacional de Endocrinología. Se realizó un espermograma completo, que incluyó leucocitospermia, siguiendo los lineamientos de la OMS, para determinar las variables cualitativas y cuantitativas del semen. Las muestras de semen fueron cultivadas en agar sangre y agar chocolate a 37° C en atmósfera de CO2 para investigar bacterias aeróbicas, y se utilizó un juego de reactivos (Mycoplasma System Plus que permite realizar el cultivo, la identificación, el conteo semicuantitativo y el antibiograma de micoplasmas/ureaplasma urogenitales. Se tuvo en cuenta los aspectos éticos, y los resultados obtenidos se analizaron mediante cálculo de por cientos y la aplicación de la prueba de chi cuadrado. Resultados: de las 140 muestras de semen evaluadas, 58 (41,4 % mostraron la presencia de infecciones, de ellas 37 correspondieron a Ureaplasma urealyticum (25,7 %, 2 a Micoplasma hominis (1,4 % y 19 a bacterias aeróbicas (13,8 %. Al comparar las variables cualitativas y cuantitativas del semen con los sujetos infectados y no infectados, no se observaron diferencias estadísticamente significativas en ninguna de las variables de calidad espermática evaluadas. Conclusiones: la frecuencia total de infecciones, en la muestra estudiada, fue relativamente alta, pero no asociada a alteraciones en las variables seminales

Molecular characterization of Cryptosporidium parvum and Cryptosporidium hominis GP60 subtypes worldwide

Directory of Open Access Journals (Sweden)

Catalina Avendaño V

2017-09-01

Full Text Available Cryptosporidium is a zoonotic parasite very important in animal health as well as in public health. It is because this is one of the main causes of diarrhea in children, calves, lambs and other variety of youth mammalians in a lot of countries. The globalization has enabled the exchange of biological material in different regions worldwide, encouraging the spread of diseases and exposure to these biological agents to different environmental conditions, inducing adaptation through genetic changes. Based in the polymorphism of the gene for GP60, this review intended to present the distribution of Cryptosporidium parvum and Cryptosporidium hominis in humans and calves worldwide. The subtype that affects cattle more frequently corresponds to IIaA15G2R; while the subtype most frequently isolated from human samples is IaA19G2.

Genomic resources and draft assemblies of the human and porcine varieties of scabies mites, Sarcoptes scabiei var. hominis and var. suis.

Science.gov (United States)

Mofiz, Ehtesham; Holt, Deborah C; Seemann, Torsten; Currie, Bart J; Fischer, Katja; Papenfuss, Anthony T

2016-06-02

The scabies mite, Sarcoptes scabiei, is a parasitic arachnid and cause of the infectious skin disease scabies in humans and mange in other animal species. Scabies infections are a major health problem, particularly in remote Indigenous communities in Australia, where secondary group A streptococcal and Staphylococcus aureus infections of scabies sores are thought to drive the high rate of rheumatic heart disease and chronic kidney disease. We sequenced the genome of two samples of Sarcoptes scabiei var. hominis obtained from unrelated patients with crusted scabies located in different parts of northern Australia using the Illumina HiSeq. We also sequenced samples of Sarcoptes scabiei var. suis from a pig model. Because of the small size of the scabies mite, these data are derived from pools of thousands of mites and are metagenomic, including host and microbiome DNA. We performed cleaning and de novo assembly and present Sarcoptes scabiei var. hominis and var. suis draft reference genomes. We have constructed a preliminary annotation of this reference comprising 13,226 putative coding sequences based on sequence similarity to known proteins. We have developed extensive genomic resources for the scabies mite, including reference genomes and a preliminary annotation.

Nonconserved Residues Ala287 and Ser290 of the Cryptosporidium hominis Thymidylate Synthase Domain Facilitate Its Rapid Rate of Catalysis

Energy Technology Data Exchange (ETDEWEB)

Doan,L.; Martucci, W.; Vargo, M.; Atreya, C.; Anderson, K.

2007-01-01

Cryptosporidium hominis TS-DHFR exhibits an unusually high rate of catalysis at the TS domain, at least 10-fold greater than those of other TS enzymes. Using site-directed mutagenesis, we have mutated residues Ala287 and Ser290 in the folate-binding helix to phenylalanine and glycine, respectively, the corresponding residues in human and most other TS enzymes. Our results show that the mutant A287F, the mutant S290G, and the double mutant all have reduced affinities for methylene tetrahydrofolate and reduced rates of reaction at the TS domain. Interestingly, the S290G mutant enzyme had the lowest TS activity, with a catalytic efficiency {approx}200-fold lower than that of the wild type (WT). The rate of conformational change of the S290G mutant is {approx}80 times slower than that of WT, resulting in a change in the rate-limiting step from hydride transfer to covalent ternary complex formation. We have determined the crystal structure of ligand-bound S290G mutant enzyme, which shows that the primary effect of the mutation is an increase in the distance between the TS ligands. The kinetic and crystal structure data presented here provide the first evidence explaining the unusually fast TS rate in C. hominis.

Cytokine concentrations in seminal plasma from subfertile men are not indicative of the presence of Ureaplasma urealyticum or Mycoplasma hominis in the lower genital tract

NARCIS (Netherlands)

Pannekoek, Y.; Trum, J. W.; Bleker, O. P.; van der Veen, F.; Spanjaard, L.; Dankert, J.

2000-01-01

The inflammatory response to the presence of Ureaplasma urealyticum or Mycoplasma hominis in the lower genital tract of subfertile men without any signs or symptoms of infection was investigated by measuring the concentrations of interleukin (IL)-6, IL-8, tumour necrosis factor-alpha (TNF-alpha) and

Morphology of human Fallopian tubes after infection with Mycoplasma genitalium and Mycoplasma hominis--in vitro organ culture study

DEFF Research Database (Denmark)

Baczynska, Agata; Funch, P; Fedder, J

2007-01-01

BACKGROUND: Female infertility can be caused by scarring and occlusion of the Fallopian tubes. Sexually transmitted bacteria can damage the delicate epithelial layer of human Fallopian tubes (HFT). Genital mycoplasmas are associated with human reproductive failure. Yet, there is not enough evidence...... that mycoplasmas can cause tubal factor infertility. We analysed the effects of infections with Mycoplasma hominis and Mycoplasma genitalium on the HFT epithelium and compared them with the effects of infections with genital pathogens: Chlamydia trachomatis and Neisseria gonorrhoeae. METHODS: We used an in vitro...

Identity, biology and bionomics of the Common Mime Chilasa clytia Linnaeus (Lepidoptera: Papilionidae

Directory of Open Access Journals (Sweden)

V.S. Revathy

2014-12-01

Full Text Available Investigations were made on the identity, biology and bionomics of the Common Mime Chilasa clytia Linnaeus.  Morphological details of the external genitalia were found to be useful in segregating the two forms clytia and dissimilis belonging to this species.  The biology took 32–36 days for completion.  Besides the host plants already recorded, Litsea coriacea was recorded as a new larval host plant of this butterfly.  

Resolution of the type material of the Asian elephant, Elephas maximus Linnaeus, 1758 (Proboscidea, Elephantidae)

DEFF Research Database (Denmark)

Cappellini, Enrico; Gentry, A.; Palkopoulou, E.

2014-01-01

.maximus, a complete foetus preserved in ethanol, is actually an African elephant, genus Loxodonta. We further discovered that an additional E.maximus syntype, mentioned in a description by John Ray (1693) cited by Linnaeus, has been preserved as an almost complete skeleton at the Natural History Museum...

Differential Haematobia irritans infestation levels in beef cattle raised in silvopastoral and conventional pasture systems.

Science.gov (United States)

de S Oliveira, Márcia Cristina; Nicodemo, Maria Luiza F; Gusmão, Marcos R; Pezzopane, José Ricardo M; Bilhassi, Talita B; Santana, Clarissa H; Gonçalves, Thuane C; Rabelo, Márcio D; Giglioti, Rodrigo

2017-11-15

The use of silvopastoral systems (SPS) can be a good alternative to reduce the environmental impacts of livestock breeding in Brazil. One of the reasons for its scarce adoption is the lack of information on health and productivity of cattle raised under these conditions. The experiment reported here was designed to compare the infestation by external parasites - the cattle tick (Rhipicephalus microplus), horn fly (Haematobia irritans), and larvae of the botfly (Dermatobia hominis) - in beef cattle raised in a SPS and a conventional pasture system (CPS), evaluated for 24 months. Data on air and soil temperature, solar radiation, wind incidence and water balance were used to characterize the SPS and CPS. R. microplus adult females and D. hominis larvae were counted on the body of each animal to determine the parasites burdens, but we did not find significant differences between the two systems. Horn flies counts on animals' body, and analysis of the horn fly and its pupal parasitoids associated with the dung pats were obtained in the two systems. Horn fly infestation was significantly lower (p=0.01) in the SPS (13.17±3.46) in comparison with the CPS (24.02±4.43). In SPS and CPS, respectively, the mean densities of pupae of H. irritansin dung pats were 9.8 and 10.7; the mean density of adults of H. irritans, 3.7 and 3.5; and the density of its pupal parasitoids were 20.5 and 5.4. The effect of production system was significant (p<0.05) only for the occurrence of pupal parasitoids of the horn fly, where the greatest occurrences of these natural enemies were in the SPS. These data indicate that natural enemies were able to control, at least partially, the horn fly populations in the cattle. Copyright © 2017 Elsevier B.V. All rights reserved.

Comparison of Assays for Sensitive and Reproducible Detection of Cell Culture-Infectious Cryptosporidium parvum and Cryptosporidium hominis in Drinking Water

Science.gov (United States)

Di Giovanni, George D.; Rochelle, Paul A.

2012-01-01

This study compared the three most commonly used assays for detecting Cryptosporidium sp. infections in cell culture: immunofluorescent antibody and microscopy assay (IFA), PCR targeting Cryptosporidium sp.-specific DNA, and reverse transcriptase PCR (RT-PCR) targeting Cryptosporidium sp.-specific mRNA. Monolayers of HCT-8 cells, grown in 8-well chamber slides or 96-well plates, were inoculated with a variety of viable and inactivated oocysts to assess assay performance. All assays detected infection with low doses of flow cytometry-enumerated Cryptosporidium parvum oocysts, including infection with one oocyst and three oocysts. All methods also detected infection with Cryptosporidium hominis. The RT-PCR assay, IFA, and PCR assay detected infection in 23%, 25%, and 51% of monolayers inoculated with three C. parvum oocysts and 10%, 9%, and 16% of monolayers inoculated with one oocyst, respectively. The PCR assay was the most sensitive, but it had the highest frequency of false positives with mock-infected cells and inactivated oocysts. IFA was the only infection detection assay that did not produce false positives with mock-infected monolayers. IFA was also the only assay that detected infections in all experiments with spiked oocysts recovered from Envirochek capsules following filtration of 1,000 liters of treated water. Consequently, cell culture with IFA detection is the most appropriate method for routine and sensitive detection of infectious Cryptosporidium parvum and Cryptosporidium hominis in drinking water. PMID:22038611

Antibacterial Resistance in Ureaplasma Species and Mycoplasma hominis Isolates from Urine Cultures in College-Aged Females

Science.gov (United States)

Valentine-King, Marissa A.

2017-01-01

ABSTRACT Urinary tract infections (UTIs) affect nearly 20% of women age 15 to 29 and account for an estimated $3.5 billion in costs. Antibiotic resistance prolongs UTI treatment, and resistance profiles vary regionally. This regional variation is an important consideration in guiding empirical treatment selection. Regional studies in the United States have identified tetracycline resistance in over one-third of Ureaplasma species isolates, but no studies have evaluated antibiotic resistance levels in college-aged women with a first-time UTI. We tested a panel of antibiotics and determined the MICs of Ureaplasma species (60 U. parvum and 13 U. urealyticum) and 10 Mycoplasma hominis isolates obtained from urine from college-aged women with a first-time UTI. Low antibiotic resistance was found in this population of women with a first-time UTI. All M. hominis and U. urealyticum isolates were sensitive. However, two U. parvum isolates were resistant, with one to levofloxacin (MIC, 4 μg/ml) and one to tetracycline (MIC, 8 μg/ml). For the Ureaplasma spp., the MIC90s were highest against gentamicin (21 μg/ml) and lowest against doxycycline (0.25 μg/ml). In a comparison of MIC levels between Ureaplasma spp., U. urealyticum had significantly higher MICs against each antibiotic except doxycycline. For the resistant isolates, the genetic mechanisms of resistance were determined. PCR amplification identified tetM to be present in the tetracycline-resistant isolate and an S83W mutation within the parC gene of the quinolone-resistant isolate. To our knowledge, this study is the first to provide molecular and phenotypic evidence of the S83W parC mutation conferring levofloxacin resistance in U. parvum isolated from a patient in the United States. PMID:28827422

Mycoplasma hominis Symbiosis and Trichomonas vaginalis Metronidazole Resistance%人型支原体共生与阴道毛滴虫甲硝唑耐药性的关系

Institute of Scientific and Technical Information of China (English)

王频佳; 谢成彬

2012-01-01

目的 研究人型支原体(Mycoplasma hominis)的共生与阴道毛滴虫(Trichomonas vaginalis)甲硝唑耐药性的关系.方法 2010年11月至2011年7月,自四川省妇幼保健院妇科门诊患者生殖道分泌物中分离出160株阴道毛滴虫,用梯度浓度1 024、512、256……4、2和1 μg/ml甲硝唑分别处理该批虫株,以死亡率≥90％的最低浓度作为甲硝唑最小致死浓度(MLC).以160个阴道毛滴虫分离株中提取的DNA为模板,用PCR技术特异性扩增人型支原体16S rRNA基因,检测滴虫细胞内是否有人型支原体共生.对检出人型支原体DNA的分离株用32μg/ml多西环素清除支原体,比较清除前后甲硝唑MLC的变化.结果 160个阴道毛滴虫分离株中甲硝唑MLC为1～8μg/ml的占61.3％(98/160),16～32μg/ml的占26.3％(42/160),64～256μg/ml的占12.5％(20/160).PCR检测结果显示,有61株(38.1％)检出人型支原体DNA,其中MLC为1～8μg/ml的分离株检出率为13.3％(13/98),16～32μg/ml的分离株检出率为73.8％( 31/42),64～256μg/ml的分离株检出率为85.0％(17/20),不同MLC范围的分离株人型支原体检出率差异有统计学意义(P＜0.01).用多西环素处理后,61株中仅有8株支原体被清除,清除前后甲硝唑MLC无明显变化.结论 四川地区的阴道毛滴虫分离株对甲硝唑表现出一定程度的耐药性,人型支原体的共生可能与之有关,但尚未发现直接证据.%Objective To investigate the relation of Mycoplasma hominis symbiosis and the resistence of Trichomonas vaginalit to metronidazole. Methods From November 2010 to July 2011, 160 isolates of T. Vaginalis were collected from the genital tract secretion of gynecological out-patients at the Sichuan Provincial Hospital for Women and Children. The minimum lethal concentration (MLC) to metronidazole of these isolates was determined by an in. Vitro sensitivity assay with different concentration gradients of metronidazole (from 1 to 1 024 μg/ml), and M

Treatment for intractable anemia with the traditional Chinese medicines Hominis Placenta and Cervi Cornus Colla (deer antler glue

Directory of Open Access Journals (Sweden)

Yasuyo Hijikata

2009-05-01

Full Text Available Yasuyo Hijikata1, Takashi Kano2, Lu Xi31Toyodo Hijikata Clinic, Osaka, Japan; 2Kano Clinic, Osaka city, Osaka, Japan; 3Traditional Chinese Medicine Institute, Si-chuan Province, ChinaObjective: Intractable anemia, such as aplastic anemia or that presumably associated with chronic herpes virus infections, sometimes require bone marrow transplant. We investigated the use of traditional Chinese medicine (TCM for the treatment of intractable anemia. Method: Placenta Hominis (PH, steam boiled and roasted, and Cervi Cornus Colla (deer antler glue has been used in China for hundreds of years to treat anemia. After consent was obtained, we prescribed these two materials for a 74-year-old female with aplastic anemia and a 26-year-old male with presumably a virus-induced anemia. Concomitant conventional therapy was continued in both patients as prescribed by their respective attending physicians. Conclusion: Conventional therapy with steroid hormones, immunosuppressive drugs, platelet and erythrocyte transfusions were not effective in these patients. In addition, both patients suffered from serious side effects. In two patients, ingestion of Placenta Hominis and Cervi Cornus Colla with TCM prescriptions increased the platelet and enhanced the hemoglobin concentration in several months of therapy accompanied by a dramatic improvement in quality of life. The addition to conventional therapy of PH and Cervi Cornus Colla, the latter of which is very easy to obtain, may be one of the potentially advantageous choices in case of otherwise intractable anemia.Keywords: placenta, antler glue, Cervi Cornus Colla, anemia, aplastic anemia

Spirorchiids (Digenea: Spirorchiidae infecting a Hawksbill sea turtle Eretmochelys imbricata (Linnaeus 1758 from Brazil Spirorchiids (Digenea: Spirorchiidae infectando uma tartaruga marinha de pente Eretmochelys imbricata (Linnaeus 1758 no Brasil

Directory of Open Access Journals (Sweden)

M.R. Werneck

2008-06-01

Full Text Available The occurrence of Amphiorchis caborojoensis Fischthal & Acholonu 1976 and Carettacola stunkardi Martin & Bamberger 1952 in a young specimen of Hawksbill sea turtle Eretmochelys imbricata Linnaeus 1758 in Brazil was reported. Five A. caborojoensis trematodes were found in the small intestine (n=2 and liver (n=3, and two adult C. stunkardi specimens were collected from body wash. This is the first report of parasites of E. imbricata in Brazilian waters and Southwestern Atlantic Ocean and the second report of members of the Spirorchiidae family in that region. In addition, E. imbricata is a new host recorded for C. stunkardi.Relata-se a ocorrência de Amphiorchis caborojoensis Fischthal & Acholonu 1976 e Carettacola stunkardi Martin e Bamberger 1952, em um exemplar juvenil de tartaruga marinha de pente Eretmochelys imbricata Linnaeus 1758 no Brasil. Foram coletados cinco trematódeos da espécie A. caborojoensis, dois no intestino delgado e três no fígado e dois exemplares adultos de C. stunkardi no lavado corporal. Destes apenas a espécie A. caborojoensis já tinha sido relatada como parasita dessa espécie de quelônio marinho. Esta é a primeira descrição de parasitas em E. imbricata em águas brasileiras e na área do Atlântico Sul Ocidental, e o segundo relato de membros da família Spirorchiidae na mesma região.

Predation on Alouatta guariba clamitans Cabrera (Primates, Atelidae by Leopardus pardalis (Linnaeus (Carnivora, Felidae Predação em Alouatta guariba clamitans Cabrera (Primates, Atelidae por Leopardus pordalis (Linnaeus (Carnivora, Felidae

Directory of Open Access Journals (Sweden)

João M. D. Miranda

2005-09-01

Full Text Available There are a few studies about predation on primates. Howler monkeys, being relatively large animals, were believed to be preyed on successfully only by medium to large-sized carnivores and large birds of prey. Our study took place at Chácara Payquerê, which is situated in the municipality of Balsa Nova, State of Paraná, Southern Brazil. Fingers and nails from Alouatta guariba clamitans Cabrera, 1940 were founded in two faecal samples from Leopardus pardalis (Linnaeus, 1758. With our documentation large howler monkey remains in faeces, the possibility of ocelot being a potential predator of all Neotropical primates should be taken into consideration.São poucos os estudos sobre a predação de primatas. Sendo os bugios animais relativamente grandes, acredita-se que somente médios e grandes carnívoros e grandes rapineiros possam lograr sucesso em sua predação. O estudo foi realizado na Chácara Payquerê, situada no município de Balsa Nova, Estado do Paraná, sul do Brasil. Dedos e unhas de Alouatta guariba clamitans Cabrera, 1940 foram encontradas em duas amostras fecais de Leopardus pardalis (Linnaeus, 1758 que foram coletadas. Com este registro de grande primata em fezes, a possibilidade de a jaguatirica ser um potencial predador de todos os primatas neotropicais pode ser levada em consideração.

Large outbreak of Cryptosporidium hominis infection transmitted through the public water supply, Sweden.

Science.gov (United States)

Widerström, Micael; Schönning, Caroline; Lilja, Mikael; Lebbad, Marianne; Ljung, Thomas; Allestam, Görel; Ferm, Martin; Björkholm, Britta; Hansen, Anette; Hiltula, Jari; Långmark, Jonas; Löfdahl, Margareta; Omberg, Maria; Reuterwall, Christina; Samuelsson, Eva; Widgren, Katarina; Wallensten, Anders; Lindh, Johan

2014-04-01

In November 2010, ≈27,000 (≈45%) inhabitants of Östersund, Sweden, were affected by a waterborne outbreak of cryptosporidiosis. The outbreak was characterized by a rapid onset and high attack rate, especially among young and middle-aged persons. Young age, number of infected family members, amount of water consumed daily, and gluten intolerance were identified as risk factors for acquiring cryptosporidiosis. Also, chronic intestinal disease and young age were significantly associated with prolonged diarrhea. Identification of Cryptosporidium hominis subtype IbA10G2 in human and environmental samples and consistently low numbers of oocysts in drinking water confirmed insufficient reduction of parasites by the municipal water treatment plant. The current outbreak shows that use of inadequate microbial barriers at water treatment plants can have serious consequences for public health. This risk can be minimized by optimizing control of raw water quality and employing multiple barriers that remove or inactivate all groups of pathogens.

Carl Linnaeus, Erasmus Darwin and Anna Seward: Botanical Poetry and Female Education

Science.gov (United States)

George, Sam

2014-03-01

This article will explore the intersection between `literature' and `science' in one key area, the botanical poem with scientific notes. It reveals significant aspects of the way knowledge was gendered in the Enlightenment, which is relevant to the present-day education of girls in science. It aims to illustrate how members of the Lichfield Botanical Society (headed by Erasmus Darwin) became implicated in debates around the education of women in Linnaean botany. The Society's translations from Linnaeus inspired a new genre of women's educational writing, the botanical poem with scientific notes, which emerged at this time. It focuses in particular on a poem by Anna Seward and argues that significant problems regarding the representation of the Linnaean sexual system of botany are found in such works and that women in the culture of botany struggled to give voice to a subject which was judged improper for female education. The story of this unique poem and the surrounding controversies can teach us much about how gender impacted upon women's scientific writing in eighteenth century Britain, and how it shaped the language and terminology of botany in works for female education. In particular, it demonstrates how the sexuality of plants uncovered by Linnaeus is a paradigmatic illustration of how societal forces can simultaneously both constrict and stimulate women's involvement in science. Despite the vast changes to women's access in scientific knowledge of the present day, this `fair sexing' of botany illustrates the struggle that women have undergone to give voice to their botanical knowledge.

Miologia do membro pélvico da paca (Cuniculus paca Linnaeus, 1766)

OpenAIRE

Leonardo M. Leal; Rafaela M. de Sá; Fabricio S. de Oliveira; Tais H.C. Sasahara; Bruno W. Minto; Marcia R.F. Machado

2015-01-01

Resumo: Objetivam-se descrever os músculos do membro pélvico da paca (Cuniculus paca Linnaeus, 1766), mediante dissecção anatômica dessa região. Foram utilizadas dez Cuniculus paca adultas, machos e fêmeas, pesando entre cinco e 10 kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal/SP. Os animais foram fixados em formaldeído 10% e conservados em solução salina a 30% para dissecação anatômica da musculatura da pelve, coxa e perna, identificando-se a origem e inse...

Antibiotic resistence of Aeromonas hydrophila isolated from Piaractus mesopotamicus (Holmberg, 1887) and Oreochromis niloticus (Linnaeus, 1758)

OpenAIRE

Belém-Costa,Andréa; Cyrino,José Eurico Possebon

2006-01-01

One of the most important problems involving treatments with antibiotics against Aeromonas hydrophila isolated from fishes is that antibiotic resistance develops readily. The antimicrobial activity of chemotherapeutants in isolates from pacu Piaractus mesopotamicus (Holmberg, 1887) and tilapia Oreochromis niloticus (Linnaeus, 1758) was tested by the Kirby-Bauer disk method, over Mueller-Hinton surface agar previously inoculated with 100 µL of bacterial suspensions. After regular incubation, i...

Frequency of Mycoplasma hominis and Ureaplasma urealyticum infections in women with systemic lupus erythematosus Freqüência da infecção pelo Mycoplasma hominis e Ureaplasma urealyticum em mulheres portadoras de lupus eritematoso sistêmico

Directory of Open Access Journals (Sweden)

Alcyone A. Machado

2001-06-01

Full Text Available Ureaplasma urealyticum (UU and Mycoplasma hominis (MH have been detected in the urine of women with systemic lupus erythematosus (SLE. We evaluated the presence of these mycoplasma in the endocervix of women presenting SLE. A total of 40 SLE patients (mean age 40.2 years, and 51 healthy women (mean age 30.9 years, were studied. Endocervical swabs were cultured in specific liquid media for MH or UU, detected by a quantitative color assay, and considered positive at >10³ dilutions. Statistical analysis was performed using the two-tailed Fisher test. UU was detected in 52.5 % of patients and in 11.8% of controls (p= 0.000059. MH was detected in 20% of patients and 2% controls (p=0.003905. Both mycoplasmas were detected in 7.3% patients and 0% controls (pUreaplasma urealyticum (UU e Mycoplasma hominis (MH têm sido detectados em urina de mulheres com lupus eritematoso sistêmico (LES. Avaliamos a presença destes mycoplasmas no endocervix de mulheres apresentando LES. Um total de 40 pacientes com LES (idade média de 40,2 anos, e 51 mulheres sadias (idade média de 30.9 anos, foram estudadas. Swabs do endocervix foram cultivados em meio líquido específico para MH e UU, detectados por teste colorimétrico quantitativo, considerando positivo diluições > 10³ . Análise estatística foi feita usando teste de Fisher. UU foi detectado em 52,5% das pacientes e em 11,8% dos controles (p= 0.000059. MH foi detectado em 20% das pacientes e 2% dos controles (p=0.003905. Ambos mycoplasmas foram detectados em 7,3 % das pacientes e 0% dos controles (p<0.000001. Os resultados aqui reportados corroboram com a associação de infecção por mycoplasma e LES. Estes agentes podem estimular a produção de clones autoreativos.

Helminths of the guinea pig, Cavia porcellus (Linnaeus, in Brazil

Directory of Open Access Journals (Sweden)

Roberto Magalhães Pinto

2002-07-01

Full Text Available Worm burdens were evaluated and compared in two groups of the guinea pig, Cavia poreellus (Linnaeus, 1758: animals of the first group were conventionally maintained in an institutional animal house and those of the second group were openly kept in pet shops in Brazil. Animals from both sources were infected only with the nematode Paraspidodera uncinata (Rudolphi, 1819 Travassos, 1914 (10% of prevalence in guinea pigs from lhe institutional facility and 40% in those animals from the pet shop. Other helminth samples recovered from Brazilian guinea pigs during 52 years and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute (CHIOC were also analyzed. Paraspidodera uncinata and the cestode Monoecocestus parcitesticulatus Rêgo, 1960 were identified in these samples.

First data of Iberian Nematomorpha, with redescription of Gordius aquaticus Linnaeus, G. plicatulus Heinze, Gordionus wolterstorffii (Camerano) and Paragordius tricuspidatus (Dufour)

NARCIS (Netherlands)

Villalobos, de Leonor Cristina; Ribera, Ignacio; Bilton, David T.

2001-01-01

Four species of Nematomorpha are recorded from NE Spain, representing the first reliable data on the group in the Iberian peninsula. Gordius aquations Linnaeus, 1758, G. plicatulus Heinze, 1937, Gordionus wolterstorffii (Camerano, 1888) and Paragordius tricuspidatus (Dufour, 1828) are redescribed

DNA sequencing reveals limited heterogeneity in the 16S rRNA gene from the rrnB operon among five Mycoplasma hominis isolates

DEFF Research Database (Denmark)

Mygind, T; Birkelund, Svend; Christiansen, Gunna

1998-01-01

To investigate the intraspecies heterogeneity within the 16S rRNA gene of Mycoplasma hominis, five isolates with diverse antigenic profiles, variable/identical P120 hypervariable domains, and different 16S rRNA gene RFLP patterns were analysed. The 16S rRNA gene from the rrnB operon was amplified...... by PCR and the PCR products were sequenced. Three isolates had identical 16S rRNA sequences and two isolates had sequences that differed from the others by only one nucleotide....

Refinement of the karyological aspects of Psidium guineense (Swartz, 1788): a comparison with Psidium guajava (Linnaeus, 1753).

Science.gov (United States)

Marques, Anelise Machado; Tuler, Amélia Carlos; Carvalho, Carlos Roberto; Carrijo, Tatiana Tavares; Ferreira, Marcia Flores da Silva; Clarindo, Wellington Ronildo

2016-01-01

Euploidy plays an important role in the evolution and diversification of Psidium Linnaeus, 1753. However, few data about the nuclear DNA content, chromosome characterization (morphometry and class) and molecular markers have been reported for this genus. In this context, the present study aims to shed light on the genome of Psidium guineense Swartz, 1788, comparing it with Psidium guajava Linnaeus, 1753. Using flow cytometry, the nuclear 2C value of Psidium guineense was 2C = 1.85 picograms (pg), and the karyotype showed 2n = 4x = 44 chromosomes. Thus, Psidium guineense has four chromosome sets, in accordance with the basic chromosome number of Psidium (x = 11). In addition, karyomorphometric analysis revealed morphologically identical chromosome groups in the karyotype of Psidium guineense. The high transferability of microsatellites (98.6%) further corroborates with phylogenetic relationship between Psidium guajava and Psidium guineense. Based on the data regarding nuclear genome size, karyotype morphometry and molecular markers of Psidium guineense and Psidium guajava (2C = 0.95 pg, 2n = 2x = 22 chromosomes), Psidium guineense is a tetraploid species. These data reveal the role of euploidy in the diversification of the genus Psidium.

Investigation on Symbiosis of Mycoplasma hominis in Trichomonas vaginalis in Some Areas of Guizhou Province%贵州省部分地区阴道毛滴虫与人型支原体共生情况

Institute of Scientific and Technical Information of China (English)

匡贵榕; 衣凤芸; 杨宇箭; 程其会; 王丽娟; 吴家红

2015-01-01

目的：了解贵州地区阴道毛滴虫临床分离株与人型支原体共生情况。方法：以贵州部分地区女性阴道毛滴虫病患者阴道后穹隆分泌物中采集的阴道毛滴虫虫株，实验室达到纯培养后，采用Chelex-100的方法提取滴虫基因组DNA，设计人型支原体16S rDNA特异引物，进行聚合酶链式反应（ PCR），琼脂糖凝胶电泳法对PCR产物进行分析，观察滴虫细胞内人型支原体共生情况。结果：从临床共采集到165株虫株中，83株获得纯培养；83株中人型支原体检测结果显示有47株阳性，阳性率为56.6%。结论：阴道毛滴虫虫株与人型支原体共生情况在我国贵州地区普遍性存在。%Objective:To investigate the symbiosis of Mycoplasma hominis in Trichomonas vaginalis in Guizhou Province. Methods:The clinical strains of T. vaginalis were collected from the hospitals and family planning service stations in Guiyang city and Anshun city. After pure culture in lab,the ge-nome DNA of T. vaginalis was extracted by Chelex-100,and 16S rDNA fragment of M. hominis was amplified by PCR with the specific primers. Agarose gel electrophoresis analysis was conducted and the symbiosis of M. hominis in T. vaginalis was observed. Results:A total of 165 strains were collected from the hospitals and family planning service stations,and 83 clinical strains attained pure culture,of which 47 strains were detected positively for M. hominis. The positive rate was 56. 6%. Conclusions:The symbiosis of M. hominis in T. vaginalis is prevalent in Guizhou province.

Blastocystis Hominis and Chronic Abdominal Pain in Children: Is there an Association between Them?

Science.gov (United States)

Toro Monjaraz, Erick Manuel; Vichido Luna, Miguel Angel; Montijo Barrios, Ericka; Cervantes Bustamante, Roberto; Zárate Mondragón, Flora; Huante Anaya, Alfonso; Cadena León, José; Mendez, Monserrat Cazares; López Ugalde, Martha; Ramirez Mayans, Jaime A

2017-08-03

Chronic abdominal pain has many etiologies, one of them being parasites. The aim of this study was to find an association between chronic abdominal pain in children and Blastocystis hominis (Bh). Clinical files of patients with Bh and functional abdominal pain were reviewed. A comparison was made between patients who showed an improvement of their symptoms and those who did not. Out of the 138 patients who had functional abdominal pain and Bh, 37 patients did not receive any treatment (26.8%), while 101 received it and were treated with different antimicrobial agents (73.2%); regarding the improvement of symptoms, a statistically significant difference (p abdominal pain in children has different etiologies; however, we have documented through this work that it is appropriate to provide antimicrobial treatment for patients with Bh and chronic abdominal pain. © The Author [2017]. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Protozoarios parásitos de importancia en salud pública transportados por Musca domestica Linnaeus en Lima, Perú

Directory of Open Access Journals (Sweden)

Martín Cárdenas

2013-06-01

Full Text Available El presente trabajo investiga los protozoarios parásitos de importancia para la salud pública transportados por Musca domestica. El estudio se llevó a cabo entre los meses de junio y diciembre de 1998, en los distritos de Comas y San Juan de Lurigancho de la provincia de Lima. Se estudiaron 3014 moscas colectadas en la basura acumulada en la vía pública de los pueblos jóvenes de los distritos mencionados. Las capturas se agruparon en lotes constituidos por un promedio de 30 moscas. Se estudiaron un total de 100 lotes. Las moscas fueron disecadas y procesadas con agua destilada estéril para obtener un macerado intestinal. Para la observación de los parásitos se utilizó el método directo simple y la coloración tricrómica de Gomori ácido resistente modificado. Se encontraron los siguientes protozoarios que parasitan al hombre: Blastocystis hominis (9,0%, Giardia lamblia (3,0%, Cryptosporidium sp. (2,0%, Cyclospora cayetanensis (1,0%, Iodamoeba bütschlii (17,0%, Endolimax nana (5,0% y Chilomastix mesnili (3,0%. Se reporta por primera vez para el Perú a B. hominis y Cyclospora cayetanensis en M. domestica.

Coexistence of Pacific oyster Crassostrea gigas (Thunberg, 1793) and blue mussels Mytilus edulis Linnaeus, 1758 on a sheltered intertidal bivalve bed?

DEFF Research Database (Denmark)

Holm, M.W.; Davids, J.K.; Dolmer, Per

2016-01-01

The invasive Pacific oyster, Crassostrea gigas Thunberg, 1793 was introduced in Denmark for aquaculture in the 1970s. Presently, feral populations are found in many parts of the country, with the largest populations established on existing beds of blue mussel, Mytilus edulis Linnaeus, 1758...

INVAZIA GHIDRINULUI – GASTEROSTEUS ACULEATUS LINNAEUS, 1758 ÎN FLUVIUL NISTRU (LIMITELE REPUBLICII MOLDOVA ŞI FACTORII DETERMINANŢI

Directory of Open Access Journals (Sweden)

Dumitru BULAT

2017-03-01

Full Text Available În condiţiile intensificării presingului antropic în ecosistemele acvatice din Republica Moldova majoritatea speciilor stenobionte au devenit ameninţate cu dispariţia, însă unele, cu potenţial adaptiv înalt, dimpotrivă, pe fonul eliberării nişe­lor spaţiale, pot prolifera în exces şi chiar provoca efect invaziv. Pentru fluviul Nistru (limitele Republicii Moldova un exemplu elocvent este ghidrinul Gasterosteus aculeatus Linnaeus, 1758 care, după construcţia hidrocentralei dela Novodnestrovsk (1981 a devenit o specie multidominantă, formând până la or. Soroca o populaţie locală deosebit de numeroasă.În lucrare sunt analizate particularităţile bioecologice ale ghidrinului şi sunt evidenţiaţi factorii de mediu ce au con­tribuit la invazia taxonului în fl. Nistru (limitele Republicii Moldova.THE INVASION OF THREE-SPINED STICKLEBACK – GASTEROSTEUS ACULEATUS LINNAEUS, 1758 IN DNIESTER RIVER (LIMITS OF REPUBLIC OF MOLDOVA AND ITS DETERINANT FACTORS Under the intensification of anthropogenic pressure in aquatic ecosystems of Republic of Moldova, most of stenobionte species became threatened with extinction, but some species, potentially high adaptive, contrast, in present demonstrates an evident biological progression, in some hydrobiotops causing a stressed invasive effect. For Dniester River (limits of Republic of Moldova three-spined stickleback – Gasterosteus aculeatus Linnaeus, 1758 is a good example, after the construction of Novodnestrovsk hydropower (1981 became a multidominate species forming to Soroca city a particularly large local population.In this paper are analyzed bio- ecological peculiarities of three-spined stickleback and are highlighted environmental factors that contributed to taxon invasion in Dniester River (limits of Republic of Moldova.

Solid state characterization of α-chitin from Vanessa cardui Linnaeus wings

International Nuclear Information System (INIS)

Schiffman, Jessica D.; Schauer, Caroline L.

2009-01-01

Material properties of the painted lady butterfly, Vanessa cardui Linnaeus were investigated using typical material science techniques. The examined butterflies were raised and hatched from the larvae stage and their chemical and crystalline structure evaluated and compared to that of crab shell (α-chitin) and squid pens from Notodarus sloanii and Loligo pealei (β-chitin). Fourier transmission infrared spectroscopy (FTIR) and X-ray diffraction (XRD) revealed that the painted lady butterflies are composed of α-chitin. Additionally, macro- and microstructure characterization of the chitins was conducted utilizing digital photography and field emission scanning electron microscopy (FESEM). This work demonstrates that common characterization techniques combined with simple sample preparation of biological materials can yield successful material characterization, which could aide the fabrication of biomimetic materials.

Solid state characterization of {alpha}-chitin from Vanessa cardui Linnaeus wings

Energy Technology Data Exchange (ETDEWEB)

Schiffman, Jessica D. [Department of Materials Science and Engineering, Drexel University, Philadelphia, PA (United States); Schauer, Caroline L., E-mail: cschauer@coe.drexel.edu [Department of Materials Science and Engineering, Drexel University, Philadelphia, PA (United States)

2009-05-05

Material properties of the painted lady butterfly, Vanessa cardui Linnaeus were investigated using typical material science techniques. The examined butterflies were raised and hatched from the larvae stage and their chemical and crystalline structure evaluated and compared to that of crab shell ({alpha}-chitin) and squid pens from Notodarus sloanii and Loligo pealei ({beta}-chitin). Fourier transmission infrared spectroscopy (FTIR) and X-ray diffraction (XRD) revealed that the painted lady butterflies are composed of {alpha}-chitin. Additionally, macro- and microstructure characterization of the chitins was conducted utilizing digital photography and field emission scanning electron microscopy (FESEM). This work demonstrates that common characterization techniques combined with simple sample preparation of biological materials can yield successful material characterization, which could aide the fabrication of biomimetic materials.

Effects of Hominis Placenta Aqua-acupuncture on Kidney and Liver Intoxicated by HgCI2 in Rats

Directory of Open Access Journals (Sweden)

Lee, Sang-Keel

2000-12-01

Full Text Available Objective: This study was perfomled to examine the therapeutic effect of aqua-acupuncture solution of Hominis Placenta(HP on kidney and liver intoxicated by HgCl2 in rats. Methods: 10% and 25% HP aqua-acupuncture were carried out everyday for 8 days on corresponding bilateral loci of Shinsu(BL23 and Kansu(BL18, respectively, after mercuric chloride intoxication in rats. Thereafter BUN, creatinine, GOT, GPT, ALP, -GT, albumin and total bilirubin were measured before intoxication, and at the 4th and the 8th experimental day. Histopathological and immunochemical observation were also carried out. Results: 1. It showed significant decreases of BUN in the group of 10% HP aqua-acupuncture into Shinsu on the 4th experimental day as compared with the control group. 2. It showed significant decreases of creatinine in the group of 10% HP aqua-acupuncture into Shinsu on the 4th and the 8th experimental days as compared with the control group. 3. There were not any significant changes of GOT, GPT, ALP, γ-GT, albumin and total bilirubin in the HP aqua-acupuncture groups compared with the control group. 4. By the histopathological observations on kidney under a light microscope, all the 10% and 25% HP aqua-acupuncture into Shinsu showed the preventive effect on tubulo-interstitial necrosis and muItifocal calcification in tubular lumen respectively compared with the control group. 5. By the histopathological observations on liver under a light mIcroscope, the groups 10% and 25% HP aqua-acupuncture into Kansu did not show any significant changes in the liver compared with the control group. 6. By the immunochemical analysis of heat shock protein(hsp and glucose-regulated protein(grp in rat renal cortex, the expressions of hsp70 and grp78 were decreased in the and HP aqua-acupuncture into Shinsu respectively compared with the control group. Conclusion: These results suggest that Hominis Placenta aqua-acupuncture have an effect on prevention and protection of

The eye-catching cicada Hamza ciliaris (Linnaeus, 1758) comb. n. in Indonesia and the Pacific: taxonomie status, synonymy, and distribution (Homoptera, Cicadoidea)

NARCIS (Netherlands)

Duffels, J.P.

1991-01-01

The new combination Hamza ciliaris (Linnaeus) is proposed for a cicada species widely distributed in Maluku ( = Moluccas), Timor, Banda, Kei and Banggai Islands, the Philippines, and the Palau group of the Caroline Islands. The synonymy of five species, treated in the literature as junior synonyms

Meiotic behaviour and its implication on species inter-relationship in the genus Curcuma (Linnaeus, 1753 (Zingiberaceae

Directory of Open Access Journals (Sweden)

Judith Mary Lamo

2017-10-01

Full Text Available In this paper, detailed meiotic analysis was investigated in seven species of Curcuma (Linnaeus, 1753 which can contribute significantly to our understanding about species inter-relationship, speciation and evolution. The species were divided into two groups viz., Group I having 2n = 42 (C. comosa Roxburgh, 1810, C. haritha Mangaly & M.Sabu, 1993, C. mangga Valeton & Zijp, 1917, and C. motana Roxburgh, 1800 and Group II with 2n = 63 (C. caesia Roxburgh, 1810, C. longa Linnaeus, 1753 and C. sylvatica Valeton, 1918. Both groups display varying degree of chromosome associations. Group I species showed the prevalence of bivalents, however occasional quadrivalents besides univalents were also encountered. About 48% of the PMCs analyzed in C. mangga showed 21 bivalents (II meiotic configurations, 32% in C. comosa and 16% in C. haritha. Group II species as expected showed the presence of trivalents besides bivalents, univalents and quadrivalents. About 32% of the PMCs analyzed at MI in C. sylvatica showed 21 trivalents (III meiotic configurations, 24% in C. longa and 8% in C. caesia. Overall, low frequency of multivalent associations as compared to bivalents indicates that Curcuma is an allopolyploid complex. Moreover, x = 21 is too high a basic number, therefore, we suggest that the genus Curcuma has evolved by hybridization of species with different chromosome numbers of 2n = 24 and 18, resulting in a dibasic amphidiploid species.

Analysis of the blackening of green pepper (Piper nigrum Linnaeus) berries.

Science.gov (United States)

Gu, Fenglin; Tan, Lehe; Wu, Huasong; Fang, Yiming; Wang, Qinghuang

2013-06-01

This paper investigates polyphenol oxidase (PPO) activity, reduced weight percentage after sun drying, and the changes in colour and appearance of green pepper (Piper nigrum Linnaeus) berries after blanching and sun drying. The results show that the degree of reduced weight percentage and browning in green pepper berries after blanching for 10 min is greater at 100°C than at 90 and 80°C. Moreover, the samples blanched at 100°C for 10 min had the fastest water loss, but the lowest PPO activity. Thus, the PPO enzymatic oxidation of polyphenols might not be the only reason for the browning of green pepper berries. This result is significantly different from that of Variyar, Pendharkar, Banerjeea, and Bandyopadhyay (1988) and therefore deserves further study. Copyright © 2012 Elsevier Ltd. All rights reserved.

Endectocide activity of a pour-on formulation containing 1.5 per cent ivermectin +0.5 per cent abamectin in cattle.

Science.gov (United States)

Silva, Heloisa Cristina; Prette, Nancy; Lopes, Welber Daniel Zanetti; Sakamoto, Cláudio Alessandro M; Buzzulini, Carolina; Dos Santos, Thais Rabelo; Cruz, Breno Cayeiro; Teixeira, Weslen F Pires; Felippelli, Gustavo; Carvalho, Rafael Silveira; Maciel, Willian Giquelin; Soares, Vando Edésio; da Costa, Alvimar José

2015-01-01

The present work aimed to evaluate, through ten different studies, the therapeutic efficacy of a new pour-on formulation, containing 1.5 per cent ivermectin +0.5 per cent abamectin, against parasites of cattle. Results obtained on trials against Rhipicephalus (Boophilus) microplus showed that the pour-on combination of 1.5 per cent ivermectin +0.5 per cent abamectin obtained superior efficacy indexes against this ectoparasite, when compared with formulations containing 0.5 per cent ivermectin, 1 per cent ivermectin and the combination of 1 per cent abamectin +20 per cent levamisole. The results of efficacy of the ivermectin+abamectin and the 0.5 per cent ivermectin against Haematobia irritans were similar. Against Cochliomyia hominivorax larvae, all pour-on formulations tested (1.5 per cent ivermectin +0.5 per cent abamectin, 0.5 per cent ivermectin and 0.5 per cent abamectin), as well as 1 per cent doramectin administered subcutaneously, were considered ineffective. Cattle medicated with 1.5 per cent ivermectin +0.5 per cent abamectin, pour-on, remained free from parasitism by Dermatobia hominis larvae during 42 days (96 per cent efficacy), while values superior to 90 per cent were obtained by 0.5 per cent ivermectin (92 per cent) and 0.5 per cent abamectin (93 per cent) until the 42nd and 35th days post treatment, respectively. Against Haemonchus placei and Oesophagostomum radiatum, the pour-on of ivermectin+abamectin showed better efficacy than the 0.5 per cent ivermectin and 0.5 per cent abamectin. As to Cooperia punctata, there was no difference regarding efficacy results obtained by the avermectins combination and abamectin. The pour-on combination of 1.5 per cent ivermectin +0.5 per cent abamectin obtained high efficacy against R. (B.) microplus, D. hominis and some species of cattle gastrointestinal helminths when compared with formulations of 0.5 per cent ivermectin and 0.5 per cent abamectin administered through the same route.

阴道毛滴虫与人型支原体共生对铁氧还蛋白基因影响%Effects of the Symbiosis of Trichomonas Vaginalis with Mycoplasma Hominis on Ferredoxin Gene

Institute of Scientific and Technical Information of China (English)

刘晓东; 温雯静; 薛长贵

2011-01-01

We isolated 30 Trichomonas vaginalis for the PCR detection from the gynecological outpatients in the Affiliated Hospital of Zhengzhou University using the specific 16s rDNA primers of Mycoplasma hominis. The results showed that there were 25 cases of Mycoplasma hominis infection, with the infection rate of 83. 33%. This gave a clew that the symbiosis of Trichomonas vaginalis with Mycoplasma hominis may be of certain generality in China. We sequenced the ferredoxin gene of 10 Trichomonas vaginalis where 5 Mycoplasma hominis were positive and five negative, and found that the ferredoxin (Fd) gene of the 10 Trichomonas vaginalis were exactly the same. But compared to the genes in the GenBank. A comparative analysis of the gene revealed that there were 3 more ctg bases at the 200th position of encoding leucine, but this did not lead to changes in reading frame. The gene homology was 99%.%采用人型支原体16s rDNA的特异引物,对从郑州大学附属医院妇科门诊患者分离到的30株阴道毛滴虫进行PCR检测,结果有25株感染人型支原体,感染率为83.33%,这显示了阴道毛滴虫和人型支原体之间的共生关系在中国具有普遍性.并对10株阴道毛滴虫(5株人型支原体阳性和5株人型支原体阴性)的铁氧还蛋白(Fd)基因进行测序,探讨人型支原体对Fd基因的影响,结果发现10株阴道毛滴虫的Fd基因完全相同,但与GenBank中的基因进行比较分析,在第200位多出ctg三个碱基,编码亮氨酸,但并未导致读码框架改变.基因同源性为99%.

Attempted eradication of Porphyrio porphyrio Linnaeus in the Florida Everglades

Directory of Open Access Journals (Sweden)

Dave EGGEMAN

2011-01-01

Full Text Available Porphyrio porphyrio (Fulica porphyrio Linnaeus was reported to the South Florida Water Management District in a Water Conservation Area and in constructed wetlands in the Everglades in 2006. A rapid assessment, including casual observations and surveys of land managers, indicated a limited number of P. porphyrio (~300 birds was present, and an eradication attempt was initiated. From 2006 – 2008, more than 3100 P. porphyrio were killed by shotgun from airboats during 73 hunts, suggesting the initial population assessment was severely underestimated. After removing nearly 1500 P. porphyrio in 2008, we concluded that eradication was not possible. Failure of this eradication attempt is attributed to P. porphyrio’s affinity with dense emergent vegetation, which greatly limited shooting effectiveness. Further, the failed eradication underscores the importance of a reporting network to improve early detection and the chance to eliminate naturalized or feral populations of non‐native species.

Intra-puparial development of the females of Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae

Directory of Open Access Journals (Sweden)

José Roberto Pujol-Luz

2012-09-01

Full Text Available Intra-puparial development of the females of Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae. The chronology and morphological changes that take place during intra-puparial development of Chrysomya albiceps is described based on 254 specimens reared in the laboratory. Larvae were obtained from the eggs laid by a single female. The pre-pupae were separated according to the reduction of larval length and the degree of pigmentation and sclerotization of the cuticle. After pupation, 10 individuals were fixed in Carnoy's solution and preserved in 70% ethanol, 10 individuals were fixed every 3 hours up to complete the first 24 hours (n = 80, the remaining individuals were fixed every six hours up to the 90th hour (n = 110 when 54 females emerged. The pupae were immersed in 5% formic acid for 48 hours and maintained in 70% ethanol, and then dissected and analyzed. C. albiceps shows four intra-puparial stages, each of which were described and compared with those described for Musca domestica, Calliphora erythrocephala, Sarcophaga bullata, Cuterebra tenebrosa, Oestrus ovis and Dermatobia hominis. Four developmental stages may be described: (1 the larva-pupa apolysis, after three hours; (2 the criptocephalic pupa, after six hours; (3 the phanerocephalic pupa, after nine hours; (4 the pharate pupa, after nine hours. The pharate adult is completely formed after 81 hours.

Infestasi Pinjal dan Infeksi Dipylidium Caninum Linnaeus pada Kucing Liar di Lingkungan Kampus Institut Pertanian Bogor, Kecamatan Dramaga

OpenAIRE

Bashofi, Aulia Syifak; Soviana, Susi; Ridwan, Yusuf

2015-01-01

This study was conducted to investigate flea infestation and Dipylidium caninum (Linnaeus 1758) infection on stray cat on Bogor Agricultural University Dramaga. Thirty stray cats were collected from various places around on Bogor Agricultural University Dramaga. The stray cats that showed clinical signs of pruritus and alopecia were collected purposively. The whole body was powdered by gamexan powder, after that the fleas were collected by manual and examined microscopically. The totals of 30...

Clinical Review of the Effects of Hominis Placental Pharmacopuncture in the Treatment of Facial Spasm Patients

Directory of Open Access Journals (Sweden)

Jo Na-Young

2013-09-01

Full Text Available Objectives: The main purpose of this research is to investigate the effect of treatment with Hominis Placental pharmacopuncture (HPP for 32 patients with hemifacial spasm. Methods: We treated facial spasm patients with acupuncture and HPP at Sabaek (ST2, Seung-eup (ST1, Gwallyeo (SI18, Chanjuk (BL2, Sajukgong (TE23, Hagwan (ST7, Hyeopgeo (ST6, Jichang (ST4, Wan-gol (SI4 and Yepung (TE17, and we investigated the effect by using Scott’s scale. The data were analyzed by using the SPSS/10.0 for windows program with descriptive statistics, the paired t-test, and the Shapiro-Wilk normality test. Results: After treatment, the grade of the spasm’s intensity based on Scott’s description were decreased significantly. About 72% of the patients felt that the combination treatment had produced excellent results. Conclusion: These data suggested that HPP can be useful for treating facial spasm patients.

Microsatellite loci discovery from next-generation sequencing data and loci characterization in the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758)

OpenAIRE

Ewers-Saucedo, Christine; Zardus, John D.; Wares, John P.

2016-01-01

Microsatellite markers remain an important tool for ecological and evolutionary research, but are unavailable for many non-model organisms. One such organism with rare ecological and evolutionary features is the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758). Chelonibia testudinaria appears to be a host generalist, and has an unusual sexual system, androdioecy. Genetic studies on host specificity and mating behavior are impeded by the lack of fine-scale, highly variable markers, su...

Perbedaan respon Aedes aegypti (Linnaeus) (Diptera: Culicidae), terhadap paparan anti nyamuk bakar dan bunga keluwih (Artocarpus camansi, Blanco)

OpenAIRE

Nur Endah Wahyuningsih; Ramauli Agustina Sihit

2015-01-01

The control of dengue hemorrhagic fever (DHF) it is important to control the vector, i.e. Aedes aegypti (Linnaeus) and Ae. albopictus (Skuse). Usually, controls of these vectors are done using chemical insecticides. Research on mosquito resistance has been done, but the impact of mosquitoes that survive after synthetic (chemical) insecticides application has not been studied. The aim of this research was to analyze the differences of fecundity, fertility and vitality rate of mosquitoes that w...

Intra-puparial development of the females of Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae Desenvolvimento intra-pupal de fêmeas de Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae

Directory of Open Access Journals (Sweden)

José Roberto Pujol-Luz

2012-09-01

Full Text Available Intra-puparial development of the females of Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae. The chronology and morphological changes that take place during intra-puparial development of Chrysomya albiceps is described based on 254 specimens reared in the laboratory. Larvae were obtained from the eggs laid by a single female. The pre-pupae were separated according to the reduction of larval length and the degree of pigmentation and sclerotization of the cuticle. After pupation, 10 individuals were fixed in Carnoy's solution and preserved in 70% ethanol, 10 individuals were fixed every 3 hours up to complete the first 24 hours (n = 80, the remaining individuals were fixed every six hours up to the 90th hour (n = 110 when 54 females emerged. The pupae were immersed in 5% formic acid for 48 hours and maintained in 70% ethanol, and then dissected and analyzed. C. albiceps shows four intra-puparial stages, each of which were described and compared with those described for Musca domestica, Calliphora erythrocephala, Sarcophaga bullata, Cuterebra tenebrosa, Oestrus ovis and Dermatobia hominis. Four developmental stages may be described: (1 the larva-pupa apolysis, after three hours; (2 the criptocephalic pupa, after six hours; (3 the phanerocephalic pupa, after nine hours; (4 the pharate pupa, after nine hours. The pharate adult is completely formed after 81 hours.Desenvolvimento intra-pupal de fêmeas de Chrysomya albiceps (Wiedemann (Diptera, Calliphoridae A cronologia e as mudanças morfológicas que ocorrem durante o desenvolvimento intra-pupal de Chrysomya albiceps são descritos com base em 254 espécimes criados em laboratório. As larvas foram obtidas a partir os ovos postos por uma única fêmea. As pré-pupas foram separadas de acordo com a redução do comprimento larval, o grau de pigmentação e esclerotização da cutícula, depois da formação das pupas, 10 indivíduos foram fixados em solução de Carnoy e conservados em etanol

A new species of Agonopterix feeding on giant hogweed (Heracleum mantegazzianum) in the Caucasus, with a discussion of the nomenclature of A. heracliana (Linnaeus) (Depressariidae)

DEFF Research Database (Denmark)

Karsholt, Ole; Lvovsky, Alexandr L.; Nielsen, Charlotte

2006-01-01

in the umbels of Heracleum mantegazzianum Sommier & Lévier Apiaceae) giant hogweed), an invasive weed in Europe, which is moreover toxic to human skin. The complicated and controversial nomenclature of the related A. heracliana (Linnaeus) (Phalaena (Tortrix)) is discussed, as is that of Depressaria heracliana...

EXPLORATORY CELIOTOMY IN GREEN IGUANA (IGUANA IGUANA, LINNAEUS 1758 SHOWING SIGNS OF URINARY OBSTRUCTION IN THE CITY OF CUIABÁ - MATO GROSSO, BRAZIL

Directory of Open Access Journals (Sweden)

I. N. Angeli

2018-04-01

Full Text Available This case report describes the therapeutic and surgical protocols adopted during the clinical management of a wild green iguana (Iguana iguana iguana,Linnaeus 1758 presented for lethargy, anorexy and clinical signs of urinary obstruction. There were also explored general aspects of the species, as well as the main impairments of health and their respective diagnosis and treatment.

Diet of the fishing bat Noctilio leporinus (Linnaeus (Mammalia, Chiroptera in a mangrove area of southern Brazil Dieta do morcego-pescador Noctilio leporinus (Linnaeus (Mammalia, Chiroptera em uma área de manguezal do sul do Brasil

Directory of Open Access Journals (Sweden)

Marcelo O. Bordignon

2006-03-01

Full Text Available From January to December 1999, the diet of Noctilio leporinus (Linnaeus, 1758 was determined in a salt-water ecosystem, by analysing the feces of bats captured in mist nets. Of the 61 samples analyzed, most contained remains of fish (90.2%, followed by insects (70.5% and crustaceous (29.5%. The most frequent fishes species were: silversides Atherinella brasiliensis (Quoy & Gaimard, 1825, anchovies Cetengraulis edentulus (Cuvier, 1829 and scaly sardines Ophisthonema oglinum (Lesueur, 1818. The most frequent insects were moths (Saturniidae and beetles (Cerambycidae, Scarabaeidae and Coccinellidae, as well as two species of bat ectoparasites (Streblidae. Among the crustaceous the shrimp (Palaemonidae and crabs (Gecarcinidae are was present. The consumption of fish, insects and crustaceans was different for the males and females throughout the year.De janeiro a dezembro de 1999, foi estudada a dieta de Noctilio leporinus (Linnaeus, 1758 em um ecossistema de manguezal, através da análise das fezes de morcegos capturados com redes-neblina. Das 61 amostras analisadas, a maioria continha fragmentos de peixes (90.2%, seguido de insetos (70.5% e crustáceos (29,5%. As espécies de peixes mais freqüentes foram: peixe-rei Atherinella brasiliensis (Quoy & Gaimard, 1825, manjuba Cetengraulis edentulus (Cuvier, 1829 e sardinha Ophisthonema oglinum (Lesueur, 1818. Os insetos mais freqüentes foram mariposas (Saturniidae e besouros (Cerambycidae, Scarabaeidae e Coccinellidae, além de duas espécies de ectoparasitas (Streblidae. Entre os crustáceos, houve a presença apenas de camarões (Palaemonidae e siris (Gecarcinidae. O consumo de peixes, insetos e crustáceos foi diferente para machos e fêmeas ao longo do ano.

Pengelolaan Lingkungan dalam Rangka Mengantisipasi Perkembangan Hama Belalang Nomadacris succincta Linnaeus (Orthoptera: Acrididae

Directory of Open Access Journals (Sweden)

Sri Suharni Siwi

2005-12-01

Full Text Available Swarming grasshopper Nomadacris succincta (Linnaeus, sinonim: Patanga succincta (L. was one of the dominant species attacked corn and soybean plantations at Jeneponto District, South Sulawesi in early 2005. The species has been identified for a long time occurred in that environment, although has never been reported before as pest of farmer's crops. For a basis of the capability in controlling the swarm grasshopper in the field, changed of increasing population hould be monitored regularly to prevent future outbreak. Information on taxonomic and ecology research of N. succincta are needed for environmental management efforts, such as change in morphology, physiology and behavior, change in host's preferences of gregarious adult, and environmental conditions i.e. climate, cultural techniques, and the death of natural enemies in the field.

Biologia reprodutiva da cobra-coral Erythrolamprus aesculapii Linnaeus (Colubridae, no Sudeste do Brasil Reproductive biology of the coral snake Erythrolamprus aesculapii Linnaeus (Colubridae in the Southeastern Brazil

Directory of Open Access Journals (Sweden)

Otávio A.V. Marques

1996-01-01

Full Text Available Dissection of 286 specimens of the "false" coral snake Erythrolamprus aesculapii Linnaeus, 1766, combined with data on captive individuais, provided information on the reproductive biology of this colubrid snake. Adult females (x snout-vent length = 74.5cm attain larger body size than males (x SVL = 62.6. Clutch size ranged from one to eight eggs and was correlated with maternal body size. Neonates measured 20.2-22.5cm SVL and weighed 5.1-5.8g. Males attain sexual maturity earlier than females. Reproduction seems to be aseasonal, with vitellogenesis occurring throughout the year. Apparently the growth rate of folheies decreases in the dry season, possibly due to lower tempeiatures during this period. Multiple clutches were recorded in captive snakes. Foraging strategies and availability of prey may explain continuous reproduction in E. aesculapii. However, data for other related snakes suggest that continuous reproduction is conservative in the Xenodontini.

Um caso de albinismo em Tayassu tajacu Linnaeus (Artiodactyla, Tayassuidae na Serra do Mar, São José dos Pinhais, Paraná A case of albinism in Tayassu tajacu Linnaeus (Artiodactyla, Tayassuidae in Serra do Mar, São José dos Pinhais, Paraná

Directory of Open Access Journals (Sweden)

L. A. Veiga

1994-01-01

Full Text Available Described herein is a case of alhinism in lhe Peccary Tayassu tajacu Linnaeus. 1758 (Artiodaclyla. Tayassuidae. which was observed in Colônia Castelhanos. São José dos Pinhais. Paraná, in lhe Southern Bra/il. The specimen was caplured when very young. The normal peccary (Tayassu tajacu is a dark-gray animal wilh a while hand across the ehest from shoulder Io shoulder. This animal have while skin. hlued eyes bul has pigmented feet.

Microsporidia and Cryptosporidium in horses and donkeys in Algeria: detection of a novel Cryptosporidium hominis subtype family (Ik) in a horse.

Science.gov (United States)

Laatamna, Abd Elkarim; Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Xiao, Lihua; Rost, Michael; McEvoy, John; Saadi, Ahmed Rachid; Aissi, Meriem; Kváč, Martin

2015-03-15

A total of 219 and 124 individual fecal samples of horses and donkeys, respectively, were screened for the presence of Cryptosporidium spp., Encephalitozoon spp., and Enterocytozoon bieneusi DNA by genus-specific nested PCR. Isolates were genotyped by sequence analysis of SSU rRNA, GP60, TRAP-C1, COWP, and HSP70 loci in Cryptosporidium, and the ITS region in microsporidia. Cryptosporidium spp. was detected on 3/18 horse farms and 1/15 farms where donkeys were kept. Overall, five (2.3%) horse and two (1.6%) donkey specimens were PCR positive for Cryptosporidium. Genotyping at SSU and GP60 loci revealed that three isolates from horses and donkeys were C. parvum subtype family IIaA16G1R1, one isolate from a horse was, C. muris RN66, and one isolate from a donkey was C. muris TS03. An isolate from a horse shared 99.4% and 99.3% similarity with Cryptosporidium hominis and C. cuniculus, respectively, at the SSU locus. This isolate shared 100% identity with C. hominis at the TRAP-C1, COWP, and HSP70 loci, and it was from the novel gp60 subtype family IkA15G1. Microsporidia were found on 6/18 horse and 2/15 donkey farms. E. bieneusi was identified in 6.8% (15/219) and 1.6% (2/124), and Encephalitozoon cuniculi was identified in 1.8% (4/219) and 1.6% (2/124), of horses and donkeys, respectively. Three genotypes of E. cuniculi (I, II and III) were detected in horses, and E. cuniculi genotype II was detected in donkeys. Four genotypes of E. bieneusi (horse1, horse 2, CZ3, D) were described in horses. An additional five horses and two donkeys were positive for E. bieneusi, but the isolated were not genotyped. Neither Cryptosporidium nor microsporidia prevalence were affected by sex, age, type of breeding, or whether the host was a horse or a donkey. Copyright © 2015 Elsevier B.V. All rights reserved.

Therapeutic effects of Hominis placenta herb-acupuncture in adjuvant-induced arthritis rat

Directory of Open Access Journals (Sweden)

MiJung Yeom

2002-02-01

Full Text Available Rheumatoid arthritis (RA is a chronic inflammatory autoimmune disease, characterized by leukocyte infiltration, a chronic inflammation of the joint, a pannus formation and the extensive destruction of the articular cartilage and bone. Several proinflammatory cytokines such as tumor necrosis factor-α (TNF-α, interleukin-1β (IL-1β and interleukin 6 (IL-6 have been implicated in the pathological mechanisms of synovial tissue proliferation, joint destruction and programmed cell death in rheumatoid joint. In the Korean traditional medicine, Hominis placenta (HP as an herbal solution of herb-acupuncture has been widely used to treat the inflammatory diseases including RA. In order to study the medicinal effect of HP herb-acupuncture on rheumatoid joint, an adjuvant-induced arthritis (AIA was generated by the injection of 1.5 mg of Mycobacterium tuberculosis, emulsified in squalene, to the base of the tail of Spraque-Dawley (SD rats. After onset stage of polyarthritis, HP was daily injected to the Zusanli (ST36 acupuncture points in both of rat lags and the expression patterns of cytokines such as TNF-α, IL-1β, and IL-6 at the knee joint were analyzed using immunostaining and RT-PCR. The HP herb-acupuncture was found to be effective to alleviate the arthritic symptoms in adjuvant-induced arthritic rats as regards the joint appearance and the expression profiles of inflammatory cytokines. In conclusion, therapeutic effects of HP herb-acupuncture on the rat with AIA might be related to anti-inflammatory activities of the hurb-acupuncture.

Dieta de graxaim-do-mato, Cerdocyon thous (Linnaeus) (Carnivora, Canidae), em uma região suburbana do sul do Brasil

OpenAIRE

Pedó, Ezequiel; Tomazzoni, Ana C.; Hartz, Sandra M.; Christoff, Alexandre U.

2006-01-01

The crab-eating fox, Cerdocyon thous (Linnaeus, 1766), is a small canid with twilight and nocturnal habits from savannas and forests of South America. In this study, we seasonally determined and quantified the diet of C. thous in Lami Biological Reserve, a conservation unit with 179.78ha situated in a suburban area in the municipality of Porto Alegre, southern Brazil. During the year 2000, we collected 80 fecal samples - 20 for each season - in two or three week sampling intervals, along trai...

Growth Parameters and Mortality of Bluefish (Pomatomus saltatrix Linnaeus, 1766) from Gallipoli Peninsula and Dardanelles (Northeastern Mediterranean, Turkey)

OpenAIRE

Cengiz, Özgür; Özekinci, Uğur; Öztekin, Alkan; Kumaova, Can Ali

2013-01-01

In this study, the growth parameters of the bluefish, Pomatomus saltatrix (Linnaeus, 1766), were studied in Gallipoli Peninsula and Dardanelles (northeastern Mediterranean, Turkey) between November 2008 and October 2009. The length-weight relationship was calculated as W=0.0082TL3.02 for females, W=0.0081TL3.03 for males and W=0.0081TL3.03 for all samples. Growth parameters of the populations were L∞= 86.8 cm, k=0.15 year-1, t0=-1.40 for females; L∞=89.1 cm, k=0.16 year-1, t0=-1.46 for males...

Topography of the medullar cone in the giant anteater (Myrmecophaga tridactyla Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Lucas de Assis Ribeiro

2015-12-01

Full Text Available ABSTRACT. Ribeiro L.A., Souza T.A.M., Ribeiro P.R.Q., Santos L.A., Silva D.C.O., Carneiro e Silva F.O., Barros R.A.C. & Zanon R.G. [Topography of the medullar cone in the giant anteater (Myrmecophaga tridactyla Linnaeus, 1758.] Topografia do cone medular do Tamanduá-bandeira (Myrmecophaga tridactyla Linnaeus, 1758. Revista Brasileira de Medicina Veterinária, 37(4:353-358, 2015. Programa de Pós-Graduação em Ciências Veterinárias e Zootecnia, Faculdade de Medicina Veterinária, Universidade Federal de Uberlândia, Rua João Naves de Ávila, 2121, Uberlândia, MG 38408-100, Brasil. E-mail: lucasassis83@yahoo.com.br The giant anteater (Myrmecophaga tridactyla is a representative of the Order Hairy, belonging to the family Myrmecophagidae. General approaches on the behavior, ecology and physical abilities of this animal are available in the literature. However, information regarding different aspects of the anatomy of the nervous system giant anteater are sparsely found. Therefore, the morphological knowledge of the relationship between the spinal cord and vertebral column is of great importance to the scientific, as in the various species of animals, whether domestic or not, the relations of the caudal spinal differ. This difference comes out to meet the interests of wild animal medicine, especially as support for the practice of epidural anesthesia. Thus, the objective was to describe the topography of the conus M. tridactyla, providing anatomical data as a basis for the practice of epidural anesthesia. For this study we used three specimens of giant anteater, prepared by the usual techniques in Macroscopic Anatomy, which had three sacral vertebrae and 4. Sendo que a base do cone medular foi registrada ao nível da terceira vértebra lombar (L3, com comprimento variando entre 3,5cm e 4,5cm e ápice localizando-se ao nível da segunda vértebra sacral (S2. These anatomical findings may point out as a safe place to perform epidural anesthesia

The discovery of Caligus temnodontis Brian, 1924 (Copepoda: Caligidae) from the bluefish Pomatomus saltatrix (Linnaeus) in the eastern Mediterranean Sea.

Science.gov (United States)

Ozak, Argun A; El-Rashidy, Hoda H; Demirkale, Ibrahim; Boxshall, Geoff A

2010-07-01

The temnodontis variety of Caligus mauritanicus Brian, 1924 described by Brian (1924) is a valid species known only from a single host species, Pomatomus saltatrix (Linnaeus). New material of this species has been examined from the same host fish caught from Abuqir Bay, Alexandria (Egypt), from Iskenderun Bay (Turkey) and from off the coast of South Africa. Using this material, C. temnodontis Brian, 1924 is redescribed and compared with related species. It is most closely related to the Indo-Pacific species C. pagrosomi Yamaguti, 1939.

Primera cita y confirmación de reproducción de Gomphus vulgatissimus (Linnaeus, 1758 (Odonata: Gomphidae en Gipuzkoa (País Vasco, España.

Directory of Open Access Journals (Sweden)

Leire Paz

2017-01-01

Full Text Available Con la detección en 2016 de una larva de Gomphus vulgatisimus (Linnaeus, 1758 en el río Araxes se cita la especie por primera vez en el Territorio Histórico de Gipuzkoa (N Península Ibérica, confirmándose asimismo su reproducción en este enclave.

Impact of elevated levels of atmospheric CO2 and herbivory on flavonoids of soybean (Glycine max Linnaeus).

Science.gov (United States)

O'Neill, Bridget F; Zangerl, Arthur R; Dermody, Orla; Bilgin, Damla D; Casteel, Clare L; Zavala, Jorge A; DeLucia, Evan H; Berenbaum, May R

2010-01-01

Atmospheric levels of carbon dioxide (CO2) have been increasing steadily over the last century. Plants grown under elevated CO2 conditions experience physiological changes, particularly in phytochemical content, that can influence their suitability as food for insects. Flavonoids are important plant defense compounds and antioxidants that can have a large effect on leaf palatability and herbivore longevity. In this study, flavonoid content was examined in foliage of soybean (Glycine max Linnaeus) grown under ambient and elevated levels of CO2 and subjected to damage by herbivores in three feeding guilds: leaf skeletonizer (Popillia japonica Newman), leaf chewer (Vanessa cardui Linnaeus), and phloem feeder (Aphis glycines Matsumura). Flavonoid content also was examined in foliage of soybean grown under ambient and elevated levels of O3 and subjected to damage by the leaf skeletonizer P. japonica. The presence of the isoflavones genistein and daidzein and the flavonols quercetin and kaempferol was confirmed in all plants examined, as were their glycosides. All compounds significantly increased in concentration as the growing season progressed. Concentrations of quercetin glycosides were higher in plants grown under elevated levels of CO2. The majority of compounds in foliage were induced in response to leaf skeletonization damage but remained unchanged in response to non-skeletonizing feeding or phloem-feeding. Most compounds increased in concentration in plants grown under elevated levels of O3. Insects feeding on G. max foliage growing under elevated levels of CO2 may derive additional antioxidant benefits from their host plants as a consequence of the change in ratios of flavonoid classes. This nutritional benefit could lead to increased herbivore longevity and increased damage to soybean (and perhaps other crop plants) in the future.

Molecular studies with Aedes (Stegomyia) aegypti (Linnaeus, 1762), mosquito transmitting the dengue virus.

Science.gov (United States)

Pereira, Luciana Patrícia Lima Alves; Brito, Maria Cristiane Aranha; Araruna, Felipe Bastos; de Andrade, Marcelo Souza; Moraes, Denise Fernandes Coutinho; Borges, Antônio Carlos Romão; do Rêgo Barros Pires Leal, Emygdia Rosa

2017-08-01

Dengue is an infectious viral disease, which can present a wide clinical picture, ranging from oligo or asymptomatic forms, to bleeding and shock, and can progress to death. The disease problem has increased in recent years, especially in urban and suburban areas of tropical and subtropical regions. There are five dengue viruses, called serotypes (DEN-1, DEN-2, DEN-3, DEN-4, and DEN-5), which belong to the Flaviviridae family and are transmitted to humans through infected mosquito bites, with the main vector the Aedes aegypti mosquito (Linnaeus, 1762). Studies performed with Ae. aegypti, aimed at their identification and analysis of their population structure, are fundamental to improve understanding of the epidemiology of dengue, as well for the definition of strategic actions that reduce the transmission of this disease. Therefore, considering the importance of such research to the development of programs to combat dengue, the present review considers the techniques used for the molecular identification, and evaluation of the genetic variability of Ae. aegypti.

Parasites of the hard clam Meretrix meretrix Linnaeus from Western Johor Straits, Malaysian

Science.gov (United States)

Azmi, Nur Fauzana; Ghaffar, Mazlan Abd.; Cob, Zaidi Che

2014-09-01

This study describes the apicomplexa as well as other parasites infecting organs/tissues of the hard clam Meretrix meretrix Linnaeus, from Merambong Shoal, Western Johor Straits, Malaysia. Samples were collected randomly by hand picking, in November and December 2013. Histological techniques were performed, stained using Masson's Trichrome protocol and observed under light microscope. The results showed that gonad and gill were the most infected organs followed by digestive gland, intestine and adductor muscle. No pathology condition was observed in the mantle. Histophatological examination showed that the gregarine, Nematopsis, unidentified coccidian and Perkinsus were found in the gill and gonad, and also in the numerous hemocytes. Other pathological conditions such as bacteria-like inclusion and intracellular bacteria were also observed in the same organs. Further investigations are needed particularly on other molluscs present at the study area. Understanding the morphology and pathology of parasites infecting mollusks are very important for management of the resources.

Nesting and diet of Harpia harpyjaLinnaeus in the Native Community of Infi erno, Made de Dios, Peru

OpenAIRE

Piana, Renzo P.

2013-01-01

El Águila Arpía (Harpia harpyja Linnaeus) es la rapaz de mayor tamaño que habita los bosques amazónicos, sin embargo en el Perú, es muy poco lo que se sabe de esta especie. Desde 1996 a 2001, realizó una investigación en la Comunidad Nativa de Infi erno para obtener información sobre la biología de la especie mediante la localización y observación de nidos activos y abandonados. La investigación permitió encontrar los primeros nidos activos descritos para el Águila Arpía en Perú e indica...

Anidamiento y dieta de Harpia harpyjaLinnaeus en la Comunidad Nativa de Infierno, Madre de Dios, Perú

OpenAIRE

Piana, Renzo

2007-01-01

El Águila Arpía (Harpia harpyja Linnaeus) es la rapaz de mayor tamaño que habita los bosques amazónicos, sin embargo en el Perú, es muy poco lo que se sabe de esta especie. Desde 1996 a 2001, realizó una investigación en la Comunidad Nativa de Infierno para obtener información sobre la biología de la especie mediante la localización y observación de nidos activos y abandonados. La investigación permitió encontrar los primeros nidos activos descritos para el Águila Arpía en Perú e indicarían u...

Prevalence of Cryptosporidium parvum/hominis, Entamoeba histolytica and Giardia lamblia among Young Children with and without Diarrhea in Dar es Salaam, Tanzania.

Directory of Open Access Journals (Sweden)

Marit G Tellevik

Full Text Available Although enteroparasites are common causes of diarrheal illness, few studies have been performed among children in Tanzania. This study aimed to investigate the prevalence of Cryptosporidium parvum/hominis, Entamoeba histolytica and Giardia lamblia among young children in Dar es Salaam, Tanzania, and identify risk factors for infection.We performed an unmatched case-control study among children 12 months (P = 0.003; OR = 3.5; 95% CI: 1.5-7.8. Among children aged 7-12 months, those who were breastfed had lower prevalence of G. lamblia infection than those who had been weaned (P = 0.012.Cryptosporidium infection is common among young Tanzanian children with diarrhea, particularly those living with HIV, and infection is more frequent during the rainy season. G. lamblia is frequently implicated in asymptomatic infections, but rarely causes overt diarrheal illness, and its prevalence increases with age.

Miologia do membro pélvico da paca (Cuniculus paca Linnaeus, 1766

Directory of Open Access Journals (Sweden)

Leonardo M. Leal

2015-12-01

Full Text Available Resumo: Objetivam-se descrever os músculos do membro pélvico da paca (Cuniculus paca Linnaeus, 1766, mediante dissecção anatômica dessa região. Foram utilizadas dez Cuniculus paca adultas, machos e fêmeas, pesando entre cinco e 10 kg do plantel de pacas do setor de Animais Silvestres da FCAV, Unesp, Jaboticabal/SP. Os animais foram fixados em formaldeído 10% e conservados em solução salina a 30% para dissecação anatômica da musculatura da pelve, coxa e perna, identificando-se a origem e inserção de cada músculo. Os resultados foram fotodocumentados e discutidos com base na literatura sobre animais domésticos, ratos e cobaias. Salvo algumas variâncias na origem e inserção de cada músculo e na fusão dos ventres de alguns grupos musculares, de forma geral, a musculatura da paca assemelha-se a dos animais domésticos e a de outros roedores.

Reprodução de Nycticorax nycticorax (Linnaeus no litoral de Santa Catarina, Brasil Reproduction of the Nycticorax nycticorax (Linnaeus in the Santa Catarina's coast, Brazil

Directory of Open Access Journals (Sweden)

Joaquim O. Branco

2005-06-01

Full Text Available O savacu Nycticorax nycticorax (Linnaeus, 1758 é uma espécie de hábitos crepusculares e noturnos, com ampla distribuição geográfica. Sua biologia reprodutiva tem sido intensivamente estudada nos países de ocorrência, entretanto, no Brasil, é comumente citada nos levantamentos de ornitólogos, mas não existem informações disponíveis sobre seu ciclo de vida. Esse trabalho objetiva contribuir para o conhecimento da biologia reprodutiva dessa espécie no litoral catarinense. As amostragens foram realizadas nos anos de 2000 a 2002 na Ilha dos Pássaros e de 2002 na Ilha dos Lobos, Santa Catarina. As maiores abundâncias de exemplares e ninhos com ovos ocorreram em outubro, sendo que o comprimento médio dos ovos variou entre 5,02 ± 0,23 a 5,07 ± 0,21 cm e o volume 31,71 ± 2,64 a 35,92 ± 3,47 cm³ e as maiores freqüências de filhotes em novembro, culminando o abandono da colônia em meados de janeiro. Foram identificados sete itens nos regurgitos dos filhotes, sendo que os peixes marinhos representaram 44,4% da massa total. O principal predador na colônia foi o urubu-comum, que atuou sobre os ovos no início da temporada e os filhotes no final.The black-crowned night heron N. nycticorax (Linnaeus, 1758 is a aquatic bird with twilight and night habits, with wide geographical distribution. His reproductive biology has been studied intensively at the occurrence countries, however, in Brazil, it is mentioned commonly in the ornithologists' risings, but available information don't exist on his life cycle. This work aims to contribute for the knowledge of the reproductive biology of that species in the Santa Catarina coast. The samplings were accomplished in the years from 2000 to 2002 in the Ilha dos Pássaros and of 2002 in the Ilha dos Lobos, Santa Catarina. The largest abundances of individuals and nests with eggs happened in October, and the medium length of the eggs varied between 5.02 ± 0.23 to 5.07 ± 0.21 cm and the volume 31

Prevalence of Chlamydia trachomatis, Ureaplasma spp., Mycoplasma genitalium and Mycoplasma hominis among outpatients in central Greece: absence of tetracycline resistance gene tet(M over a 4-year period study

Directory of Open Access Journals (Sweden)

A. Ikonomidis

2016-01-01

Full Text Available A total of 301 men and women attending local urologists and gynaecologists in the state of Thessaly, central Greece, were tested for Chlamydia trachomatis, Ureaplasma spp., Mycoplasma genitalium and Mycoplasma hominis DNA. Investigation of the tet(M gene, which confers tetracycline resistance in these genera, was also performed. Low incidence of C. trachomatis and Mycoplasma spp. as well as high prevalence of Ureaplasma spp., especially among women, were found. The tet(M gene was absent in all cases, notably in a region where doxycycline administration remains the first therapeutic option unless special medical conditions direct otherwise.

Effects of Feeding Frequency on Growth, Feed Consumption, and Body Composition in Juvenile Turbot (Psetta maxima Linnaeus, 1758) at Low Temperature

OpenAIRE

TÜRKER, Ali

2014-01-01

Juvenile turbot Psetta maxima (Linnaeus, 1758) (15.23 ± 2.99 g) were fed to satiation with a commercial extruded feed over a 60-day period. Feeding regimens were twice a day (TD), every other day (EOD), and 2-day intervals (TDI). Fish were kept in seawater (18 ppt) at 5-7.5 °C from January 21 to March 23, 2004. Feed conversion rate (FCR) and the protein efficiency ratios (PER) were within the ranges of 1.12-1.14 and 2.26-2.29, respectively. While the maximum relative growth rate (RGR), weight...

ECTOFAUNA PARASITÁRIA DE CÃES URBANOS DOMICILIADOS ATENDIDOS EM CLÍNICAS VETERINÁRIAS PARTICULARES NA CIDADE DE LAVRAS, MG

Directory of Open Access Journals (Sweden)

Antonio Marcos Guimarães

2011-03-01

Full Text Available The objective of this study was to determine the frequency of ectoparasites in urban domiciled dogs treated at nine private veterinary clinics in the city of Lavras, Minas Gerais, Brazil. Visible and palpable ectoparasites specimens were collected manually from 67 dogs during the period of September 2004 to May 2005, kept in flasks with ethanol 70º GL and identified under a stereomicroscope. In the case of mites that cause mange, performed the analysis of the results obtained from 155 skin scrapings of the same number of dogs with clinical suspicion of parasitic dermatosis was performed, and sent to diagnostic at the Laboratory of Parasitic Diseases of Federal University of Lavras (UFLA, during the period of September 2002 to July 2007. A total of 540 ectoparasites were recorded, and four species were identified: Rhipicephalus sanguineus (60%, Ctenocephalides canis and C. felis (both 36%, and Dermatobia hominis larvae (4%. In scraped skin, positive results were verified in 12.9% (20/155, of which 80.0% with Demodex canis (16/20 and 20.0% with Sarcoptes scabiei var. canis (4/20. After ectoparasites identification a database with the dogs´medical records was made and analyzed by SPSS 12.0. It can be concluded that the predominant species of ectoparasites in dogs treated at private veterinary clinics in the city of Lavras, MG, were Ctenocephalides canis and C. felis (Siphonaptera: Pulicidae and R. sanguineus (Acari: Ixodidae and Demodex canis (Acari: Demodecidae that had a significant predominance (p<0.05 on scraped skin of young animals with suspicion of canine demodicosis.

Enhancement of anti-tubercular activity and biomass of fermented food associated Staphylococcus hominis strain MANF2 using Taguchi orthogonal array and Box-Behnken design.

Science.gov (United States)

Khusro, Ameer; Aarti, Chirom; Dusthackeer, Azger; Agastian, Paul

2018-04-14

The prime focus of the present investigation was to optimize statistically the anti-tubercular activity and biomass of fermented food associated Staphylococcus hominis strain MANF2 using Taguchi orthogonal array (OA) and Box-Behnken design (BBD). The anti-tubercular activity of strain MANF2 was determined against Mycobacterium tuberculosis H37Rv using luciferase reporter phase assay. Among varied media examined, the isolate exhibited impressive anti-tubercular activity with paramount relative light unit reduction of >90% in de Man Rogose Sharpe (MRS) broth. Primarily, the anti-tubercular activity and biomass of strain MANF2 were estimated in MRS broth by optimizing eight diversified parameters using one factor at a time (OFAT) method after working out a series of experiments. The most significant contributing factors selected through OFAT tool were optimized using Taguchi approach with a standard OA layout of L18 (2 2  × 3 6 ). Results demonstrated the significant (P ≤ 0.05) influence of pH, temperature, yeast extract, magnesium sulphate, and glycerol on response variables. These controlled variables were further optimized using BBD matrix at N = 46 by second-order polynomial equation. The fermentation medium of pH 6.5 constituting yeast extract (0.5% w/v), magnesium sulphate (0.1% w/v), and glycerol (1.5% v/v), being further incubated at 30 °C showed enhanced anti-tubercular activity (98.7%) and approximately 4 fold increment in the bacterial biomass yield (8.3 mg/mL) with respect to traditional OFAT method. Three-dimensional response plots of the quadratic model showed interdependent interaction between the significant variables. In conclusion, the present study revealed the first report on the optimization of anti-tubercular activity and biomass of S. hominis via Taguchi OA as well as BBD design, and thus, paved a path for its proficient applications in pharmaceutical industries as dynamic mycobactericidal agent in future. Copyright © 2018

Histological description of Cerdocyon thous (Linnaeus, 1766 respiratory system

Directory of Open Access Journals (Sweden)

Marla P. Rocha

Full Text Available ABSTRACT: The massive agricultural expansion converted the Cerdocyon thous, a South American native predator, in vulnerable specie. Basic data, such as histological description, are important to raise awareness on animal species, helping on preservation strategies. Considering the difficult in obtain samples, as the euthanasia of wild animals for this purpose is not allowed, data on histology are very scarce or inexistent. The objective of this paper was to provide a detailed histological description of the trachea and bronchial tree of the crab-eating fox Cerdocyon thous (Linnaeus, 1766. The specimens (one adult male and one adult female used were provided by the Federal University of Pelotas (Pelotas, RS, Brazil Rehabilitation Center of Wild Fauna (NURFS. Tissue samples were fixed in 10% formalin and included in paraffin. After slicing, samples were stained with HE (hematoxylin and eosin, PAS (periodic acid-Schiff and resorcin fuchsin. Trachea had an average diameter of 7.87mm, and approximately 57% of the mucosa ciliated pseudo-stratified columnar epithelium was composed of goblet cells, mostly in the dorsal region. Bronchia and bronchioles had a mucosal fold with higher number of goblet cells. Using all these techniques there is no great remarkable differences from C. thous trachea and lung, when compared with the previous described structures for carnivores and most mammals, except for the goblet cells “regionalization”. Described results are important to understand the animal physiological and behavioral habits, allowing the development of preservation and protection strategies.

INFLUENCE OF TEMPERATURE ON CERTAIN BIOLOGICAL ATTRIBUTES OF A LADYBEETLE COCCINELLA SEPTEMPUNCTA TA LINNAEUS

Institute of Scientific and Technical Information of China (English)

ShefaliSrivastava; Dmkar

2003-01-01

Influence of temperature on certain biological attributes of an aphidophagous ladybeetle, Coccinella septempunctata Linnaeus, feeding on mustard aphid, Lipaphis erysimi (Kaltenbach), at five different temperatures, viz. 20, 25, 27, 30 and 35℃ was investigated. Its developmental period was shortest (11.7±0.09days) at 35℃ and longest (20.6±0.35 days) at 20℃. Developmental rate increased with increase in temperature. Hatching percent, larval survival, adult emergence and growth index were maximum at 30℃ and minimumat 20℃. Oviposition period and fecundity were highest at 30℃ and lowest at 20℃. A positive linear relationship exists between temperature and developmental rate and negative correlation between the duration of immature life stages and temperature. The proportion of developmental period allocated to each immature stage was found to be similar at each temperature regime. Thus, 30℃ was found as the most suitable for C. septempunctata amongst the five temperatures tested.

Estudio comparativo de la frecuencia de Blastocystis hominis en niños en edad preescolar de una zona urbana y una rural de la ciudad de Cartagena de Indias y su relación con las manifestaciones clínicas y factores de riesgo

Directory of Open Access Journals (Sweden)

Mavianis Pinilla Pérez

2015-01-01

Full Text Available Introducción: las parasitosis intestinales son infecciones comunes a nivel mundial y de mayor prevalencia en las comunidades empobrecidas de países en desarrollo. A finales de los ochenta el Blastocystis hominis no era reportado rutinariamente, representando solo un problema de diagnóstico diferencial; pero en los noventa mediante un oportuno diagnóstico aumenta su prevalencia de 1,5 a 10% en los países desarrollados y de 30 a 50 % en países en desarrollo. Objetivo: comparar la frecuencia de Blastocystis hominis en niños de preescolar de una zona urbana (Crespo y una rural (Boquilla de Cartagena Bolívar y su relación con las manifestaciones clínicas, factores de riesgo. Materiales y métodos: se analizaron mediante la técnica de coprológico seriado, 286 muestras de materia fecal de niños de 1 a 5 años que procedían de una zona urbana y una zona rural de la ciudad de Cartagena de indias. Resultados: se encontraron parásitos en el 38,5% (55/143 de los niños de la zona urbana y el 79% (113/143 de la zona rural. Se encontró asociación entre la presencia de parásitos con la procedencia de los niños evaluados (X2= 48,53; p<0,0001. Se encontró una frecuencia de 51,1% de B. hominis en la zona urbana y 44,8% en la zona rural. Conclusiones: la falta de seguimiento y control de los casos problema sugiere la necesidad de formular e implementar medidas orientadas a mejorar la calidad de vida en las zonas estudiadas.

O mexilhão Perna perna (Linnaeus (Bivalvia, Mytilidae em cultivo na Armação do Itapocoroy, Santa Catarina, Brasil The mussel Perna perna (Linnaeus (Bivalvia, Mytilidae in culture at the Armação of the Itapocoroy, Santa Catarina, Brazil

Directory of Open Access Journals (Sweden)

Adriano W. C. Marenzi

2005-06-01

Full Text Available Para verificar a viabilidade do cultivo do mexilhão, P. perna (Linnaeus, 1758 no sul do Brasil, duas experiências foram executadas na Armação de Itapocoroy. Das variáveis físicas e químicas foram analisadas a salinidade, temperatura e o oxigênio, que se mostraram ideais para esta espécie e, os macronutrientes também dentro dos níveis esperados para a região, não indicando poluição orgânica no local. O crescimento médio foi de 0,58 cm/mês e o aumento do peso foi de 2,57 g/mês. Curvas de crescimento e engordas foram elaboradas tendo como base a produção biológica após 6,7 meses de cultivo. A sobrevivência após oito meses foi de 79,2% e os valores os mais elevados do índice gônodo-somático foram detectados na primavera.To verify the viability of the culture of the mussel, P. perna (Linnaeus, 1758, in the south of Brazil, two experiences had been executed in the Armação do Itapocoroy. The averages of the salinity, temperature and the oxygen had shown ideals for this species and the macronutrients are inside of the natural levels for coast areas, not indicate organic pollution in the place. The average growth was of 0,58 cm/month and the increase of the weight was of 2.57 g/month. Curves of growth and fattening had been elaborated having for result the greater biological production after 6.7 months of culture. The survival after eight months was 79.2% and the most raised values of the gonad-somatic index were detected in the spring.

Dermabacter hominis: a usually daptomycin-resistant gram-positive organism infrequently isolated from human clinical samples

Science.gov (United States)

Fernández-Natal, I; Sáez-Nieto, J A; Medina-Pascual, M J; Albersmeier, A; Valdezate, S; Guerra-Laso, J M; Rodríguez, H; Marrodán, T; Parras, T; Tauch, A; Soriano, F

2013-01-01

During a 12-year period, Dermabacter hominis was isolated from 21 clinical samples belonging to 14 patients attending a tertiary hospital in León, Spain. Samples included blood cultures (14), peritoneal dialysis catheter exit sites (three), cutaneous abscesses (two), an infected vascular catheter (one) and a wound swab (one). Identification was made by API Coryne™ V2.0, Biolog™ GP2 and 16S rRNA gene amplification. Six febrile patients had positive blood cultures (one, two or three sets) and all of them were treated with teicoplanin (two patients), vancomycin, ampicillin plus gentamicin, amoxicillin/clavulanic acid and ciprofloxacin (one each). An additional patient with a single positive blood culture was not treated, the finding being considered non-significant. In the remaining seven patients the organism was isolated from a single specimen and three of them received antimicrobial treatment (ciprofloxacin, ceftriaxone plus vancomycin and amoxicillin/clavulanic acid). At least ten patients had several underlying diseases and conditions, and no direct mortality was observed in relation to the isolated organism. All isolates were susceptible to vancomycin, rifampin and linezolid. Resistance to other antibiotics varied: erythromycin (100%), clindamycin (78.5%), ciprofloxacin (21.4%) and gentamicin, quinupristin-dalfopristin, benzylpenicillin and imipenem 7.1% each. Thirteen isolates were highly resistant to daptomycin with MICs ranging from 8 to 48 (MIC90 = 32 mg/L); only one was daptomycin-sensitive (MIC = 0.19 mg/L). PMID:25356327

Identification and determination of the viability of Giardia lamblia cysts and Cryptosporidium parvum and Cryptosporidium hominis oocysts in human fecal and water supply samples by fluorescent in situ hybridization (FISH) and monoclonal antibodies.

Science.gov (United States)

Lemos, Vanessa; Graczyk, Thaddeus K; Alves, Margarida; Lobo, Maria Luísa; Sousa, Maria C; Antunes, Francisco; Matos, Olga

2005-12-01

In the present study, fluorescent in situ hybridization (FISH) and monoclonal antibodies (MAbs) were evaluated for species-specific detection and viability determination of Giardia lamblia, Cryptosporidium parvum, and Cryptosporidium hominis in human fecal and water supply samples. A total of 50 fecal human samples positive for G. lamblia cysts, 38 positive for C. parvum, and 23 positive for C. hominis were studied. Also, 18 water supply samples positive for Giardia spp. and Cryptosporidium spp. by the United States Environmental Protection Agency (USEPA) Method 1623 were studied by FISH and fluorescein isothiocyanate (FITC)-conjugated MAbs. Eighteen percent of the fecal samples parasitologically positive for G. lamblia presented viable and nonviable cysts, and 5% of those positive for Cryptosporidium spp. presented viable and nonviable oocysts. Of the 18 water supply samples analyzed, 6 (33%) presented Giardia spp. viable and nonviable cysts and 2 (11%) presented viable and nonviable Cryptosporidium spp. oocysts. G. lamblia identification was confirmed by polymerase chain reaction (PCR) and sequencing of the beta-giardin gene in the fecal and water samples found positive by FISH and FITC-conjugated MAbs. C. parvum and Cryptosporidium muris were identified, by PCR and sequencing of the small subunit of ribosomal RNA gene, in seven and one water samples, respectively. Our results confirm that this technique enables simultaneous visualization, species-specific identification, and viability determination of the organisms present in human fecal and water supply samples.

Ontogenia do fruto em desenvolvimento de Alternanthera tenella Colla e Amaranthus blitum Linnaeus (Amaranthaceae Ontogeny of fruits of Alternanthera tenella Colla and Amaranthus blitum Linnaeus (Amaranthaceae

Directory of Open Access Journals (Sweden)

Vanessa de Carvalho Harthman

2012-09-01

Full Text Available Alternanthera tenella Colla e Amaranthus blitum Linnaeus são espécies invasoras que ocorrem em culturas e terrenos baldios na região de Maringá, Paraná. O trabalho teve por objetivo a análise morfoanatômica dos frutos em desenvolvimento e estruturas não pericárpicas dessas duas espécies, com a finalidade de contribuir com informações estruturais para identificação das espécies, classificação dos frutos e investigações ecológicas. Flores e frutos foram coletados no campus da Universidade Estadual de Maringá, fixados em Glutaraldeído, secionados em micrótomo de rotação e corados com a azul de Toluidina. As bractéolas e perigônio são persistentes nos frutos e têm estrutura diferente nas duas espécies. O aquênio de Alternanthera tenella mantém o mesmo número de estratos celulares que o ovário, que sofrem colapso na fase madura, exceto o mesocarpo interno que se mantém com espessamento parietal em U e cristais. O utrículo de Amaranthus blitum é semelhante ao ovário em número de camadas celulares e apresenta aerênquima quando maduro. As sementes maduras são exotestais, com mesotesta e endotesta colapsadas, e embrião curvo. Nesse estudo, foram registrados alguns caracteres estruturais dos perigônios e dos frutos que são potencialmente significativos para caracterização e separação das espécies, ao contrário das sementes que são muito semelhantes.Alternanthera tenella Colla and Amaranthus blitum Linnaeus are weeds that occur in crops and uncultivated areas in the Maringá region of Paraná. In this study, a morphoanatomical analysis of fruit development and the pericarp of A. tenella and A. blitum was made in order to contribute structural information for species identification, fruit classification, and ecological investigations. Flowers and fruits were collected at the campus of the State University of Maringá, Paraná, fixed in glutaraldehyde, sectioned with a rotary microtome and stained with

Microsatellite loci discovery from next-generation sequencing data and loci characterization in the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Christine Ewers-Saucedo

2016-05-01

Full Text Available Microsatellite markers remain an important tool for ecological and evolutionary research, but are unavailable for many non-model organisms. One such organism with rare ecological and evolutionary features is the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758. Chelonibia testudinaria appears to be a host generalist, and has an unusual sexual system, androdioecy. Genetic studies on host specificity and mating behavior are impeded by the lack of fine-scale, highly variable markers, such as microsatellite markers. In the present study, we discovered thousands of new microsatellite loci from next-generation sequencing data, and characterized 12 loci thoroughly. We conclude that 11 of these loci will be useful markers in future ecological and evolutionary studies on C. testudinaria.

Microsatellite loci discovery from next-generation sequencing data and loci characterization in the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758)

Science.gov (United States)

Zardus, John D.; Wares, John P.

2016-01-01

Microsatellite markers remain an important tool for ecological and evolutionary research, but are unavailable for many non-model organisms. One such organism with rare ecological and evolutionary features is the epizoic barnacle Chelonibia testudinaria (Linnaeus, 1758). Chelonibia testudinaria appears to be a host generalist, and has an unusual sexual system, androdioecy. Genetic studies on host specificity and mating behavior are impeded by the lack of fine-scale, highly variable markers, such as microsatellite markers. In the present study, we discovered thousands of new microsatellite loci from next-generation sequencing data, and characterized 12 loci thoroughly. We conclude that 11 of these loci will be useful markers in future ecological and evolutionary studies on C. testudinaria. PMID:27231653

Homage to Linnaeus: How many parasites? How many hosts?

Science.gov (United States)

Dobson, Andy; Lafferty, Kevin D.; Kuris, Armand M.; Hechinger, Ryan F.; Jetz, Walter

2008-01-01

Estimates of the total number of species that inhabit the Earth have increased significantly since Linnaeus's initial catalog of 20,000 species. The best recent estimates suggest that there are ≈6 million species. More emphasis has been placed on counts of free-living species than on parasitic species. We rectify this by quantifying the numbers and proportion of parasitic species. We estimate that there are between 75,000 and 300,000 helminth species parasitizing the vertebrates. We have no credible way of estimating how many parasitic protozoa, fungi, bacteria, and viruses exist. We estimate that between 3% and 5% of parasitic helminths are threatened with extinction in the next 50 to 100 years. Because patterns of parasite diversity do not clearly map onto patterns of host diversity, we can make very little prediction about geographical patterns of threat to parasites. If the threats reflect those experienced by avian hosts, then we expect climate change to be a major threat to the relatively small proportion of parasite diversity that lives in the polar and temperate regions, whereas habitat destruction will be the major threat to tropical parasite diversity. Recent studies of food webs suggest that ≈75% of the links in food webs involve a parasitic species; these links are vital for regulation of host abundance and potentially for reducing the impact of toxic pollutants. This implies that parasite extinctions may have unforeseen costs that impact the health and abundance of a large number of free-living species.

Ultrastructure of Ascaridia galli (Schrank, 1788) (Nematoda: Ascaridida) from the endangered green peafowl Pavo muticus Linnaeus (Galliformes: Phasianidae).

Science.gov (United States)

Zhao, Wen-Ting; Guo, Yan-Ning; Zhang, Lu-Ping; Li, Liang

2016-01-01

Ascaridia galli (Schrank, 1788) is a common parasite of various galliform birds worldwide. Although A. galli has been extensively studied by many author, knowledge of the morphology of this species in detail is still insufficient. In the present paper, the detailed morphology of A. galli was further studied using light and scanning electron microscopy, based on specimens collected from the endangered green peafowl Pavo muticus Linnaeus (Galliformes: Phasianidae) in China. The results revealed some erroneous and previously unreported morphological features, including the lips lacking real denticles, the lateral alae beginning at some distance posterior to the base of the ventrolateral lips and the caudal papillae with 4 different morphotypes. The present morphological and morphometric data complement previous descriptions and enable us to recognize this species more precisely.

Parasitoses intestinais de indígenas da comunidade Mapuera (Oriximiná, Estado do Pará, Brasil: elevada prevalência de Blastocystis hominis e encontro de Cryptosporidium sp e Cyclospora cayetanensis Intestinal parasitosis in Indians of the Mapuera community (Oriximiná, State of Pará, Brazil: high prevalence of Blastocystis hominis and finding of Cryptosporidium sp and Cyclospora cayetanensis

Directory of Open Access Journals (Sweden)

Jaila Dias Borges

2009-06-01

Full Text Available Foi avaliada a ocorrência de parasitoses intestinais em indígenas da aldeia Mapuera (Oriximiná, Estado do Pará, Brasil. No contexto de apreciações congêneres, expressa contribuição para adequado conhecimento do assunto, significativo sob o ponto de vista médico-sanitário. O exame parasitológico das fezes, de 83 pessoas, realizado por meio de quatro métodos, pode ser considerado como dotado de razoável amplitude para estabelecer diagnósticos. Ocorreu encontro de cistos de protozoários e de ovos de helmintos de múltiplos tipos, até mesmo em expressivas porcentagens, merecendo destaque a muito freqüente presença de Blastocystis hominis (57,8%, como também o encontro de Cryptosporidium sp (3,6% e de Cyclospora cayetanensis (10,8%, comentado especificamente. O verificado demonstra que tais índios vivem em ambiente onde prevalecem más condições higiênicas, em especial, facilitador da disseminação de protozoários e helmintos pelo contato com o solo ou ingestão de água e alimentos contaminados.Occurrences of intestinal parasitosis in Indians of the Mapuera community (Oriximiná, State of Pará, Brazil were evaluated. Within the context of group assessment, this study makes a contribution towards adequate knowledge of this subject, which is significant from a medical-sanitary point of view. Parasitological examination of feces from 83 individuals, performed using four different methods, could be considered to have reasonable amplitude for establishing diagnoses. Protozoan cysts and helminth eggs of many types were found, even with significant percentages. The frequent presence of Blastocystis hominis (57.8%, along with findings of Cryptosporidium sp (3.6% and Cyclospora cayetanensis (10.8%, deserved highlighting with specific comments. The findings show that these Indians live in an environment in which poor hygiene conditions prevail. In particular, these facilitate the dissemination of protozoa and helminths through

Report of Enodiotrema megachondrus (Looss, 1899 Looss, 1901 (Digenea: Plagiorchiidae in a green turtle Chelonia mydas Linnaeus, 1758 (Testudines, Cheloniidae from Brazil

Directory of Open Access Journals (Sweden)

Werneck M. R.

2016-12-01

Full Text Available This paper describes the occurrence of Enodiotrema megachondrus (Looss, 1899 Looss, 1901 in a juvenile green sea turtle (Chelonia mydas Linnaeus, 1758 found on the coast of Brazil. This parasite has been described in Caretta caretta from Egypt, France, the Mediterranean Sea, the Madeira Archipelago, the Adriatic Sea and the USA, in C. mydas from Egypt and the USA, in Eretmochelys imbricata from Cuba, in Lepidochelys olivacea from Mexico and Costa Rica and in Lepidochelys kempii from USA. This note represents the first report of E. megachondus in a green sea turtle in the South-West Atlantic Ocean.

Update on geographic spread of invasive lionfishes (Pterois volitans [Linnaeus, 1758] and P. miles [Bennett, 1828]) in the Western North Atlantic Ocean, Caribbean Sea and Gulf of Mexico

Science.gov (United States)

Schofield, Pamela J.

2010-01-01

The Indo-Pacific lionfishes (Pterois volitans [Linnaeus, 1758] and P. miles [Bennett, 1828]: Family Scorpaenidae) are the first nonnative marine fishes to establish in the Western North Atlantic/Caribbean region. The chronology of the invasion was reported last year (Schofield 2009) using records from the US Geological Survey's Nonindigenous Aquatic Species database. This article provides an update of lionfish geographic spread (as of October 2010) and predictions of future range.

Activities of tabanids (Diptera, Tabanidae attacking domestic duck-Cairina moschata (Linnaeus (Aves, Anatidae, introduced in a forest area in the Central Amazon, Manaus, Brazil

Directory of Open Access Journals (Sweden)

Ruth L. M. Ferreira

2004-06-01

Full Text Available Presented here are the feeding habits, attack behavior, daily and annual activity of adult of Phorcotabanus cinereus (Wiedeman, 1821, Chrysops laetus (Fabricius, 1805 and Phaeotabanus cajennensis (Fabricius, 1787, while biting a domestic duck, Cairina moschata (Linnaeus, 1758. The last two species were recorded for the first time attacking birds. This study comprehended monthly observations of two consecutive days from April/97 to March/98 between 5:30 a.m. and 6:30 p.m. at the Army Instructional Base ((BI-2/CIGS near Manaus. Annual occurrence of P. cinereus was from July to September, with a daily occurrence between 9:00 a.m. and 5:00 p.m. and highest activity at 12:00 a.m. and 2:00 p.m. C. laetus ocurred from June to October; with a daily occurrence between 8:00 a.m. and 3 p.m. and highest activity at 11:00 and 12:00 a.m. Occurrence of P. cajennensis with one specimen only, was in July between 10:00 and 11:00 a.m.Atividades de tabanídeos (Diptera, Tabanidae atacando pato doméstico Cairina moschata Linnaeus (Aves, Anatidae, introduzido em área de floresta na Amazônia Central, Manaus, Brasil. São apresentados o hábito alimentar, comportamento de ataque, atividade diária e anual de adultos de Phorcotabanus cinereus (Wiedemann, 1821, Chrysops laetus (Fabricius, 1805 e Phaeotabanus cajennensis (Fabricius, 1787 atacando pato doméstico - Cairina moschata (Linnaeus, 1758. As últimas duas últimas espécies são registradas pela primeira vez atacando aves. O estudo compreendeu observações mensais durante dois dias consecutivos de Abril/97 a Março/98, entre 5:30 e 18:30 h, na base de instrução 2 do Centro de Instrução de Guerra na Selva (BI-2/CIGS, Manaus. A ocorrência anual de P. cinereus, foi de julho a setembro, com atividade diária entre 9:00 e 17:00 horas, com maior abundância entre 12:00 e 14:00 horas. C. laetus, ocorreu de junho a outubro, com atividade diária entre 8:00 e 15:00 horas, e maior abundância entre 11:00 e 12

Mortality of red mullet (Mullus barbatus Linnaeus, 1758 on the Montenegrin shelf (South Adriatic

Directory of Open Access Journals (Sweden)

Joksimović A.

2009-01-01

Full Text Available Red mullet, Mullus barbatus Linnaeus, 1758, is an economically very important species in trawl fisheries in the Adriatic Sea. Material for analysis was collected from October 2002 until May 2004 with a bottom trawl net from commercial trawlers on the Montenegrin shelf. Mortality of this species was analyzed for the first time in this area, sepa­rately for males and females and for both sexes together. Until now, only the spatial distribution and catch per unit of effort (CPUE of Mullus barbatus have been studied in Montenegrin waters. Estimated total mortality rates were Zmales = 0.653 and Zfemales = 0.712. The average mortality rate for both sexes was Z m+f = 0.749, while the natural mortality rate was Mm+f = 0.342. Values of Z in the Montenegrin shelf area are considerably lower than Z values for the Croatian and Italian parts of the Adriatic Sea, indicating that on the Montenegrin shelf fishing of this species is significantly less intensive than in other trawl-fishing areas of the Adriatic Sea.

Synthèses enzymatiques de néoglucoconjugués catalysées par l'alpha-glucosidase purifiée de la blatte Periplaneta americana (Linnaeus

Directory of Open Access Journals (Sweden)

Kamenan A.

2005-01-01

Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.

Confirmation of the presence of Heniochus acuminatus (Linnaeus, 1758 (Chaetodontidae and Pomacanthus maculosus (Forsskål, 1775 (Pomacanthidae in Iraqi marine waters, Arabian Gulf

Directory of Open Access Journals (Sweden)

Jawad, L. A

2014-09-01

Full Text Available Two specimens (116,119 mm TL of Heniochus acuminatus (Linnaeus, 1758 and four specimens (171–190 mm TL of Pomacanthus maculosus (Forsskål, 1775 were collected from Iraqi marine waters of the Arabian Gulf. These findings confirm the presence of H. acuminatus and establish the first record of P. maculosus from Iraqi waters. The samples were captured by hook and line off the coasts of Al–Fao City Peninsula, southern Iraq. Arabian Gulf. morphometric and meristic data are provided and compared with data from other parts of the world.

The availability of Piperaceae and the search for this resource by Carollia perspicillata (Linnaeus (Chiroptera, Phyllostomidae, Carolliinae in Parque Municipal Arthur Thomas, Londrina, Paraná, Brazil

Directory of Open Access Journals (Sweden)

Isaac Passos de Lima

2004-06-01

Full Text Available A study about the species of Piperaceae that are consumed by a colony of Carollia perspicillata (Linnaeus, 1758 in Parque Municipal Arthur Thomas (82,72 ha was carried out. Five available species of Piperaceae were found in the park: Piper aduncum Linnaeus, Piper amalago (Jacq. Yuncker, Piper crassinervium H.B.K., Piper gaudichaudianum Kunth and Piper sp. C. perspicillata fed on all of these species. During the spring, the most abundant item was P. amalago, but the consumption of P. aduncum was the highest. At the beginning of the summer, P. crassinervium was the most abundant and most consumed item. At the end of the summer and during the fall, P. gaudichaudianum was the most abundant and consumed item, even in May, when P. amalago was the most abundant item. During the winter, the most highly available items were P. aduncum, Piper sp. and P. amalago, and the ones that were consumed the most were Piper sp., P. gaudichaudianum and P. aduncum. The results have shown that the preferences of C. perspicillata in the park are related to the greater abundance or the higher energetic value of the available Piperaceae. The greater search for the most energetic and least abundant species, which happened in the spring and winter, is related to the energy gain, that is, the species searches for food that will provide a greater quantity of energy per unit of consumption; and the greater search for the most abundant item, which occurred in the summer and fall, is related to saving the energy used in the search for food.Estudou-se quais espécies de piperáceas são consumidas por uma colônia de Carollia perspicillata (Linnaeus, 1758 localizada do Parque Municipal Arthur Thomas (82,72ha. Foram encontradas no parque: Piper aduncum Linnaeus, Piper amalago (Jacq. Yuncker, Piper crassinervium H.B.K., Piper gaudichaudianum Kunth e Piper sp. C. perspicillata alimentou-se de todas essas espécies. Durante a primavera, o item mais abundante foi P. amalago, porém o

Antibiotic resistence of Aeromonas hydrophila isolated from Piaractus mesopotamicus (Holmberg, 1887 and Oreochromis niloticus (Linnaeus, 1758 Resistência de Aeromonas hydrophila isolada de Piaractus mesopotamicus (Holmberg, 1887 e Oreochromis niloticus (Linnaeus, 1758 a antibióticos

Directory of Open Access Journals (Sweden)

Andréa Belém-Costa

2006-06-01

Full Text Available One of the most important problems involving treatments with antibiotics against Aeromonas hydrophila isolated from fishes is that antibiotic resistance develops readily. The antimicrobial activity of chemotherapeutants in isolates from pacu Piaractus mesopotamicus (Holmberg, 1887 and tilapia Oreochromis niloticus (Linnaeus, 1758 was tested by the Kirby-Bauer disk method, over Mueller-Hinton surface agar previously inoculated with 100 µL of bacterial suspensions. After regular incubation, isolates from tilapia and pacu were uniformly resistant to amoxicillin, ampicillin, lincomycin, novobiocin, oxacillin, penicillin, and trimetoprim+sulfametoxazole. The A. hydrophila type strain presented resistance to the same antimicrobial substances and also against rifampicin; the bacterial isolate from pacu were the only strain resistant to tetracyclin. Isolates from both pacu and tilapia had intermediate reaction with erytromycin. The use of drugs in commercial fish farms in Brazil can favor the development of resistant bacterial strains in native fish species as already observed for exotic species, commercially produced for longer time.Um dos maiores problemas envolvendo o tratamento com antibióticos contra Aeromonas hydrophila isolada de peixes confinados é a rápida resistência ao antibiótico desenvolvida pela bactéria. A atividade antimicrobiana de quimioterapêuticos em isolados a partir de pacu Piaractus mesopotamicus (Holmberg, 1887 e tilápia Oreochromis niloticus (Linnaeus, 1758 foi verificada pelo método de difusão de antibiótico em discos de Kirby-Bauer, sobre uma superfície de Agar Mueller-Hinton previamente inoculada com 100 µL de suspensão bacteriana. Após o período de incubação, os isolados de tilápia e pacu foram uniformemente resistentes a amoxicilina, ampicilina, lincomicina, novobiocina, oxacilina, penicilina e trimetoprim+sulfametoxazol. A cepa tipo para A. hydrophila apresentou resistência às mesmas subst

Locomotion of Stramonita haemastoma (Linnaeus (Gastropoda, Muricidae on a mixed shore of rocks and sand

Directory of Open Access Journals (Sweden)

Marcos G. Papp

2001-03-01

Full Text Available Mixed shores of rocks and sand are appropriate systems for the study of limitations that the isolation of rocks may impose for gastropods that typically inhabit rocky shores. We marked 52 Stramonita haemastoma (Linnaeus, 1767 snails on a mixed shore and found that 34 of them moved between rocks one to four times during 15 surveys in a period of 72 days. In the experiments, the snails moved on rock by continuous, direct, ditaxic, alternate undulations of the foot sole but on submerged sand they used slower arrhythmic discontinuous contractions of the foot sole. They switched between modes of locomotion in response to the type and topography of the substrate and possibly to water dynamics. In nature, snails moved between rocks forming aggregations where they oviposited. This may have masked other causes of movement, such as availability of prey. Most snails burrowed into the sand when the rocks became exposed during low tides. Further experiments are needed to explicitly address the possible causes of movements among rocks and burial.

Viabilidade econômica do cultivo de carpa comum (cyprinus carpio linnaeus, 1758 em monocultivo em densidades diferentes Economical viability of the common carp (Cyprinus carpio Linnaeus, 1758 cultivation in monocultivations in different densities

Directory of Open Access Journals (Sweden)

Álvaro Graeff

2004-06-01

Full Text Available Objetivou-se com esta pesquisa estudar o efeito econômico do povoamento de alevinos I de carpa comum (Cyprinus carpio LINNAEUS, 1758 com densidade diferenciada e com alimentação artificial e adubação química. O delineamento foi inteiramente casualizado com três tratamentos (1; 0,5 e 0,33 peixes/m² avaliados ao longo do tempo e três repetições. Os peixes foram estocados com peso e comprimento médios de 2,40 g e 5,35; 5,40 e 5,39 cm, respectivamente, nos tratamentos, e com 45 dias de idade. As dietas foram formuladas com 27% de PB e 2925 Kcal/Kg de ração, sendo fornecidas diariamente na quantidade de 3% do peso vivo. Os resultados para o comprimento e peso dos peixes foram 25,68; 28,66 e 31,21 cm e 255,00; 424,00 e 519,66 g, respectivamente. A analise econômica foi estudada por meio de planilha de custo. Na produção total, os resultados foram 1882; 1513 e 1367 kg/hectare em um ciclo. Em condições similares, pode-se recomendar zootecnicamente todas as densidades estudadas e, economicamente, a lucratividade da atividade é crescente com o aumento da densidade, havendo diminuição do custo médio ou unitário.This research aimed at studying the economical effect of common carp (Cyprinus carpio LINNAEUS, 1758 settling of fingerlings with differenciated density and with artificial feeding and chemical fertilization. The design was entirely randomized with three treatments (1; 0.5 and 0.33 fishes/m² evaluated along the time and 3 repetitions. The fish were stocked with medium weight and mediun length of 2.40 g and 5.35; 5.40 and 5.39 cm, respectively, in the treatments, and 45 days old. The diets were formulated with 27% PB and 2.925 kcal/kg of ration, being given daily in the quantities of 3% of living weight. The results for the length and weight of the fishes were 25.68; 28.66 and 31.21 cm and 255.00; 424.00 and 519.66 g, respectively. The economical analisys was studied through cost planning. In the total production, the results

Associação entre presença de Mycoplasma hominis e Ureaplasma urealyticum e níveis de citocinas pró e antiinflamatórias no líquido amniótico de gestação de termo

OpenAIRE

Ramos, Bruna Ribeiro de Andrade [UNESP

2011-01-01

Microbial invasion of the amniotic cavity has been described in term deliveries and its role on the immune modulation is of interest to the better understanding of the underlying labor processes. The aim of this study was to determine the prevalence of Mycoplasma hominis and Ureaplasma urealyticum in the amniotic fluid of term pregnancies and to evaluate its influence on cytokines production at the end of pregnancy. A cross sectional study was conducted with fifty five pregnant women out of l...

Antimicrobial and Anti-Proliferative Effects of Skin Mucus Derived from Dasyatis pastinaca (Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Virginia Fuochi

2017-11-01

Full Text Available Resistance to chemotherapy occurs in various diseases (i.e., cancer and infection, and for this reason, both are very difficult to treat. Therefore, novel antimicrobial and chemotherapic drugs are needed for effective antibiotic therapy. The aim of the present study was to assess the antimicrobial and anti-proliferative effects of skin mucus derived from Dasyatis pastinaca (Linnaeus, 1758. Our results showed that skin mucus exhibited a significant and specific antibacterial activity against Gram-negative bacteria but not against Gram-positive bacteria. Furthermore, we also observed a significant antifungal activity against some strains of Candida spp. Concerning anti-proliferative activity, we showed that fish mucus was specifically toxic for acute leukemia cells (HL60 with an inhibition of proliferation in a dose dependent manner (about 52% at 1000 μg/mL of fish skin mucous, FSM. Moreover, we did not observe effects in healthy cells, in neuroblastoma cells (SH-SY5Y, and multiple myeloma cell lines (MM1, U266. Finally, it exhibited strong expression and activity of chitinase which may be responsible, at least in part, for the aforementioned results.

PHYSICO-CHEMICAL LIMITATIVE FACTORS FOR GROWTH AND DEVELOPMENT IN STERLET (ACIPENSER RUTHENUS LINNAEUS, 1758 IN EXTENSIVELY SYSTEM

Directory of Open Access Journals (Sweden)

R. C. DIMA

2009-10-01

Full Text Available The oldest and most common method of increasing fish is a fish breeding ponds in which the supervision of nutrition and growth of biological material. Sterlet (Acipenser ruthenus ruthenus Linnaeus 1785 is the 4th of sturgeon scale and economic importance as a share of production of these fish .Monitoring of physicochemical parameters of sturgeons ponds has a crucial role to obtain satisfactory yields both in qualitative and quantitative. Chemical characteristics of water were determined in laboratory ecosystems Chemistry of the Institute of Research and Development for Ecology Aquaculture, Fisheries and Aquaculture Galaţi for the samples have been taken of the total water. Determination of the chemical characteristics was performed by standardized methods. Physic-chemical parameters of water were determined according to norm on the classification of surface water quality in order to establish the ecological status of water (Order no. 161/2006, for Class II of quality.

Inhibition of lung cancer cells A549 and H460 by curcuminoid extracts and nanoemulsions prepared from Curcuma longa Linnaeus

Directory of Open Access Journals (Sweden)

Chang HB

2015-08-01

Full Text Available Hong-Bin Chang,1 Bing-Huei Chen1,21Department of Food Science, 2Graduate Institute of Medicine, Fu Jen Catholic University, Taipei, TaiwanAbstract: The objectives of this study were to explore the inhibition mechanism of lung cancer cells A549 and H460 by curcuminoid extracts and nanoemulsions prepared from Curcuma longa Linnaeus. In addition, human bronchus epithelial cell line BEAS-2B (normal cell was selected for comparison. A high-performance liquid chromatography (HPLC method was developed to separate and quantify the various curcuminoids in C. longa extract, including curcumin (1,714.5 µg/mL, demethoxycurcumin (1,147.4 µg/mL, and bisdemethoxycurcumin (190.2 µg/mL. A high-stability nanoemulsion composed of Tween 80, water, and curcuminoid extract was prepared, with mean particle size being 12.6 nm. The cell cycle was retarded at G2/M for both the curcuminoid extract and nanoemulsion treatments; however, the inhibition pathway may be different. H460 cells were more susceptible to apoptosis than A549 cells for both curcuminoid extract and nanoemulsion treatments. Growth of BEAS-2B remained unaffected for both the curcuminoid extract and nanoemulsion treatments, with a concentration range from 1 to 4 µg/mL. Also, the activities of caspase-3, caspase-8, and caspase-9 followed a dose-dependent increase for both A549 and H460 cells for both the treatments, accompanied by a dose-dependent increase in cytochrome C expression and a dose-dependent decrease in CDK1 expression. Interestingly, a dose-dependent increase in cyclin B expression was shown for A549 cells for both the treatments, while a reversed trend was found for H460 cells. Both mitochondria and death receptor pathways may be responsible for apoptosis of both A549 and H460 cells.Keywords: curcuminoid extract, curcuminoid nanoemulsion, Curcuma longa Linnaeus, lung cancer cell, cell cycle, apoptosis mechanism

Extensive fragmentation of the X chromosome in the bed bug Cimex lectularius Linnaeus, 1758 (Heteroptera, Cimicidae: a survey across Europe

Directory of Open Access Journals (Sweden)

David Sadílek

2013-10-01

Full Text Available Variation in the number of chromosomes was revealed in 61 samples of Cimex lectularius Linnaeus, 1758 from the Czech Republic and other European countries, hosted on Myotis Kaup, 1829 (4 and Homo sapiens Linnaeus, 1758 (57. The karyotype of all the specimens of C. lectularius analysed contained 26 autosomes and a varying number of the sex chromosomes. The number of sex chromosomes showed extensive variation, and up to 20 fragments were recorded. Altogether, 12 distinct karyotypes were distinguished. The male karyotypes consisted of 29, 30, 31, 32, 33, 34, 35, 36, 37, 40, 42 and 47 chromosomes. The females usually exhibited the number of chromosomes which was complementary to the number established in the males from the same sample. However, 11 polymorphic samples were revealed in which the karyotypes of females and males were not complementary each other. The complement with 2n = 26+X1X2Y was found in 44% of the specimens and 57,4% samples of bed bugs studied. The karyotypes with higher chromosome numbers as well as individuals with chromosomal mosaics were usually found within the samples exhibiting particularly extensive variation between individuals, and such complements were not found within samples contaning a few or single specimen. The occurrence of chromosomal mosaics with the karyotype constitution varying between cells of single individual was observed in five specimens (4.3% from five samples. We assume that polymorphism caused by fragmentation of the X chromosome may result in meiotic problems and non-disjunction can produce unbalanced gametes and result in lowered fitness of individuals carrying higher numbers of the X chromosome fragments. This effect should be apparently enhanced with the increasing number of the fragments and this may be the reason for the observed distribution pattern of individual karyotypes in the studied samples and the rarity of individuals with extremely high chromosome numbers. The assumed lowering of the

Infestasi pinjal dan infeksi Dipylidium caninum Linnaeus pada kucing liar di lingkungan kampus Institut Pertanian Bogor, Kecamatan Dramaga

Directory of Open Access Journals (Sweden)

Aulia Syifak Bashofi

2016-02-01

Full Text Available This study was conducted to investigate flea infestation and Dipylidium caninum (Linnaeus 1758 infection on stray cat on Bogor Agricultural University Dramaga. Thirty stray cats were collected from various places around on Bogor Agricultural University Dramaga. The stray cats that showed clinical signs of pruritus and alopecia were collected purposively. The whole body was powdered by gamexan powder, after that the fleas were collected by manual and examined microscopically. The totals of 30 fecal stray cat samples collected and examined toward D. caninum used Mcmaster methode, flotation methode, and saw the existence of proglottid. The result of identification showed that there was found one species of flea, namely Ctenocephalides felis (Bouche 1835, while on faeces was not found D. caninum. Twenty one stray cats were infected by the flea with density average of fleas per cat was 3.8 ± 1.9 individual.

Estudio genético de la estructura poblacional y conectividad de dos corales endémicos del Mediterráneo: Astroides calycularis (Pallas, 1766) y Cladocora caespitosa (Linnaeus, 1767)

OpenAIRE

Casado-Amezúa, P.

2012-01-01

[ES] El objetivo general de la presente tesis es determinar la estructura genética y el alcance de la conectividad de las poblaciones de dos corales escleractinios del Mediterráneo, Astroides calycularis (Pallas, 1766) y Cladocora caespitosa (Linnaeus, 1767). Estos procesos están generalmente ligados a diferentes características biológicas de las especies, tales como la densidad y distribución de las poblaciones, la fecundidad, el éxito reproductor, el tipo de desarrollo larvario, la capacida...

Bark consumption by the spiny rat Euryzygomatomys spinosus (G. Fischer (Echimyidae on a Pinus taeda Linnaeus (Pinaceae plantation in South Brazil Consumo de Pinus taeda (Pinaceae pelo rato-de-espinho Euryzygomatomys spinosus (G. Fischer (Echimyidae em plantações no Sul do Brasil

Directory of Open Access Journals (Sweden)

Gislene L. Gonçalves

2007-03-01

Full Text Available Feeding damage caused by Euryzygomatomys spinosus (G. Fischer, 1814 (Echimyidae is documented for a Pinus taeda Linnaeus (Pinaceae plantation located in Cambará do Sul, Rio Grande do Sul State, Brazil. Under laboratory conditions, feeding acceptance of P. taeda trunk sections was tested with positive results for E. spinosus, but not for other three co-occurring sigmodontine rodents: Akodon montensis Thomas, 1913, Oligoryzomys nigripes (Olfers, 1818 and Delomys dorsalis (Hensel, 1872.Esse estudo documenta os danos causados por Euryzygomatomys spinosus (G. Fischer, 1814 em plantações de Pinus taeda Linnaeus (Pinaceae localizadas em Cambará do Sul, Estado do Rio Grande do Sul, Brasil. Em laboratório foi testada positivamente a utilização de troncos de Pinus como recurso por E. spinosus, mas não para os outros roedores sigmodontíneos ocorrentes na área: Akodon montensis Thomas, 1913, Oligoryzomys nigripes (Olfers, 1818 e Delomys dorsalis (Hensel, 1872.

Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

Energy Technology Data Exchange (ETDEWEB)

Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)

2010-01-15

The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

The gold tegu, Tupinambis teguixin (Linnaeus, 1758) sensu lato (Squamata: Teiidae): evidence for an established population in Florida

Science.gov (United States)

Edwards, Jake R.; Ketterlin, Jennifer K.; Rochford, Michael R.; Irwin, Rodney; Krysko, Kenneth L.; Duquesnel, James G.; Mazzotti, Frank J.; Reed, Robert

2017-01-01

Gold tegus, Tupinambis teguixin (Linnaeus, 1758), are generalist predators from South America and are ecologically similar to Argentine black and white tegus (Salvator merianae), a successful invader in Florida. We trapped gold tegus in Broward and Miami-Dade counties, Florida, USA. In Miami-Dade County, collection occurred from 2008 through 2016. We combined new trapping records with previous literature records. Ten gold tegus of both sexes and multiple size classes over a nine year period indicate a reproducing population in Miami-Dade County. Tupinambis teguixin is the sixth established non-native teiid species in Florida. Additionally, we report Tupinambis teguixin from Sarasota and Lee counties, Florida, USA. Determining population status in those counties requires further study. It is critical to differentiate this species fromSalvator merianae during removal efforts. The possibility of eradicating Tupinambis teguixin exists if proper identification enables reliable monitoring of the populations.

The effect of Hominis Placenta Pharmacopuncture on Leg spasticity of stroke patients (A Pilot study, Double blind, Randomized, Controlled Clinical Trial

Directory of Open Access Journals (Sweden)

Ju-hwan Noh

2009-12-01

Full Text Available Objective : The purpose of this study is to determine the effect of Hominis Placenta Pharmacopuncture(HPP on lower limb spasticity control in stroke patients. Methods : Twenty stroke patients with Leg spasticity were randomly divided into two groups, a Distilled water Pharmacopuncture(group I and a HPP(group II. The number of Pharmacopuncture was 5 times a week and acupuncture treatment was 3 times a week for 3 weeks. Modified Ashworth Scale(MAS, H-reflex/M-response ratio(H/M ratio, Berg Balance Scale(BBS and Time Up & Go(TUG were used for evaluation of spasticity control before experiment, after 1 week, 2 weeks, 3 weeks. Results : Group I showed significant improvement(p<.05 in BBS but no significant improvement in MAS, H/M ratio, and TUG. Group II showed significant improvement(p<.05 in MAS, BBS, and TUG, but no significant improvement in H/M ratio. The results showed significant difference in TUG, but no significant difference in MAS, H/M ratio and BBS between 2 groups. Conclusion : These results showed that HPP might decrease lower limb spasticity and increase leg motor function in stroke patients. Further studies will be required to examine more cases in the long period for the effect on lower limb in spasticity by HPP.

Diet of crab-eating fox, Cerdocyon thous (Linnaeus (Carnivora, Canidae, in a suburban area of southern Brazil Dieta de graxaim-do-mato, Cerdocyon thous (Linnaeus (Carnivora, Canidae, em uma região suburbana do sul do Brasil

Directory of Open Access Journals (Sweden)

Ezequiel Pedó

2006-09-01

Full Text Available The crab-eating fox, Cerdocyon thous (Linnaeus, 1766, is a small canid with twilight and nocturnal habits from savannas and forests of South America. In this study, we seasonally determined and quantified the diet of C. thous in Lami Biological Reserve, a conservation unit with 179.78ha situated in a suburban area in the municipality of Porto Alegre, southern Brazil. During the year 2000, we collected 80 fecal samples - 20 for each season - in two or three week sampling intervals, along trails inside the Reserve. Samples were dried in an oven for 24h at 60ºC, immersed in 70% alcohol, and prey items were identified using a stereomicroscope. The diet of the crab-eating fox was essentially carnivorous (87.62% composed by vertebrates, with seasonal variation (p = 0.0009 and absence of fruits. Small non-flying mammals and birds were the most frequent prey, being proportionally more preyed in autumn and summer, respectively. Arthropods were more preyed in winter and spring and bird/reptile eggs only in summer and spring, in the reproduction period of these groups.O graxaim-do-mato, Cerdocyon thous (Linnaeus, 1766, é um canídeo de pequeno porte de hábito crepuscular e noturno que ocorre nas savanas e florestas da América do Sul. Neste estudo foi avaliada a sazonalidade e a dieta de C. thous na Reserva Biológica do Lami, uma unidade de conservação com 179,78ha, situada na região suburbana do município de Porto Alegre, no sul do Brasil. Durante o ano de 2000 foram coletadas 80 amostras fecais - 20 por estação do ano - em coletas realizadas a cada duas ou três semanas, percorrendo as trilhas existentes na Reserva. As amostras foram desidratadas em estufa por 24h a 60ºC, imersas em álcool a 70%, e as presas foram identificadas com auxílio de estereomicroscópio. A dieta do graxaim-do-mato apresentou-se essencialmente carnívora (87,62% composta por vertebrados, com variação sazonal (p = 0,0009 e ausência de frutos. Pequenos mamíferos n

Estimación de los principales parámetros reproductivos y productivos del Pecari tajacu, Linnaeus, 1758 pecari de collar o sajino en cautiverio (Loreto, Perú)

OpenAIRE

Rengifo Pinedo, Martha Estela

2009-01-01

Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Producción Animal El presente estudio estimación de los parámetros reproductivos y productivos de Pecari tajacu, Linnaeus, 1758 “pecari de collar” o “sajino” en cautiverio (Loreto, Perú), se llevó a cabo en el Centro Piloto de Zoocria para la Amazonía – UNAP, ubicado en la Región Loreto, Provincia de Maynas, Perú. La investigación es básica descriptiva ex post facto, que consistió en obtener información de los registr...

Effects of culture conditions on the growth and reproduction of Gut Weed, Ulva intestinalis Linnaeus (Ulvales, Chlorophyta

Directory of Open Access Journals (Sweden)

Rapeeporn Ruangchuay

2012-11-01

Full Text Available In vitro cultivation of Gut Weed, Ulva intestinalis Linnaeus, was experimentally studied to support its near optimalfarming, with potential impact in Thailand on its direct use as human food or its co-cultures in shrimp farming.Germling clusters (2 weeks old and 7.50±2.98 mm long were seeded into 500 mL flasks and biomass growth rateoptimized with respect to the main controllable factors; seedling density, salinity, light intensity, and temperature. These factorswere assumed to each have an optimal value independent of the others, and the factors were optimized one at a time. Themaximum growth at three to four weeks of cultivation was obtained at the factor levels of 0.05 gL-1, 20 ppt, 80 mol photonm-2s-1 and 25°C. Early zoosporangia were obtained from 2nd to 4th weeks. The relative growth rate ranged from 9.47 to 22.18 %day-1, and only asexual reproduction of U. intestinalis was observed under these culture conditions.

Inhibition of Various Cancer Cells Proliferation of Bornyl Acetate and Essential Oil from Inula graveolens (Linnaeus Desf

Directory of Open Access Journals (Sweden)

Tunay Karan

2018-05-01

Full Text Available Inula species are medicinal and aromatic plants used for folk medicine extensively. In this work, hydrodistilled essential oil of Inula graveolens (Linnaeus Desf. analyzed by GC-MS which revealed that bornyl acetate was the major product (69.15%. Camphene was the second major compound (11.11%. Antiproliferative activity of the essential oil and bornyl acetate was investigated on HeLa (human cervix carcinoma, HT29 (human colon carcinoma , A549 (human lung carcinoma, MCF7 ( human breast adenocarcinoma cancer cells and FL (human amnion cells normal cells. The cytotoxicity was executed by a Lactate Dehydrogenase (LDH Cytotoxicity Detection Kit. Essential oil and bornyl acetate displayed the outstanding activities on HeLa (IC 50, 64.1, 72.0 µg/mL, HT29 (IC 50, 24.6, 60.5 µg/mL, A549 (IC 50, 28.3, 44.1 µg/mL, MCF-7 (IC 50, 66.5, 85.6 µg/mL, and FL (IC 50, 42.1, 50.6 µg/mL cell lines respectively.

First isolation and RFLP genotyping of Toxoplasma gondii from crab-eating fox (Cerdocyon thous-Linnaeus, 1766).

Science.gov (United States)

de Almeida, Jonatas Campos; de Melo, Renata Pimentel Bandeira; de Morais Pedrosa, Camila; da Silva Santos, Marcelo; de Barros, Luiz Daniel; Garcia, João Luis; Porto, Wagnner José Nascimento; Mota, Rinaldo Aparecido

2017-05-01

Wild animals may play an important role in the transmission and maintenance of Toxoplasma gondii in the environment. The purpose of the present study was to isolate and genotype T. gondii from a free-ranging crab-eating fox (Cerdocyon thous-Linnaeus, 1766). A crab-eating fox in critical health condition was attended in a veterinary hospital in Recife, Pernambuco State, Brazil. The animal died despite emergency treatment. The brain was collected aseptically and destined for mouse bioassay. One isolate of T. gondii was obtained, and Polymerase Chain Reaction - Restriction Fragment Length Polymorphism (PCR-RFLP) was used to assess genetic variability at 11 markers (SAG1, SAG2, altSAG2, SAG3, BTUB, GRA6, c228, c292, L358, PK1 and APICO). A murine model was used to assess the virulence of the isolate. Using the PCR-RFLP, genotype ToxoDB #13 was identified, which is considered an atypical strain. The isolate was classified as avirulent in the murine model. This is the first study to report T. gondii infection in the crab-eating fox. Copyright © 2017 Elsevier B.V. All rights reserved.

Castosyringophilus meropis sp. n. (Acariformes: Syringophilidae) - a new quill mite species parasitising the world population of Merops apiaster Linnaeus (Coraciiformes: Meropidae).

Science.gov (United States)

Skoracki, Maciej; Hromada, Martin; Sikora, Bozena

2017-07-26

A new species, Castosyringophilus meropis sp. n., found in quills of feathers of the European bee-eater Merops apiaster Linnaeus (Coraciiformes: Meropidae) is described. This new species is close to C. claravis Skoracki et Glowska, 2008 and differs, in females, by the presence apunctate coxal fields (vs sparsely punctate in C. claravis) and by the lengths of setae d1 145-180 µm, f2 170-185 µm and ag3 190-215 µm (vs d1 200-220 µm, f2 230-250 µm and ag3 150-170 µm). We present a vast mite material collected from bee-eaters originated from different localities in Europe, Asia and Africa, both breeding and wintering grounds of this bird. It indicates that the whole world population of the European bee-eater is parasitised by this quill mite species.

Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae

Directory of Open Access Journals (Sweden)

Andréa Roveré Franz

2011-03-01

Full Text Available Toxic effects of essential plant oils in adult Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae. Stored grains are subject to losses in quality nutritional value and in sanitation from the time they are stored to the time they are consumed. Botanical insecticides may offer an alternative solution for pest control. The objective was to test the insecticidal properties of the essential oils of Cymbopogon citratus (leaf, Zingiber officinale (root and Mentha sp. (leaf. The efficacy of these oils was tested to control the rice weevil, S. oryzae, using hydrodistillation. Chemical analysis of the essential oils was carried out by gas chromatography. Major components of C. citratus were geranial (48% and neral (31%, of Z. officinale were α-zingibereno (13%, geranial (16%, neral (10% and α-farneseno (5% and of Mentha sp. was menthol (92%. Bioassays were carried out by fumigation and topical application. In topical application assays, the essential oil of C. citratus had greater toxicity (LC50 0.027 µL mL-1 and shorter exposure time than the oils of the other two plants. After 24 h and 48 h, 70% and 100% mortality of S. oryzae occurred, respectively. In fumigation assays, essential oil of Z. officinale had a lower LC50 (1.18 µL cm-2 and 70% mortality after 24 h exposure. Therefore, we recommend the use of essential oils of C. citratus and Z. officinale to control the rice weevil S. oryzae.

The Aggregation of Boron on the Tissues of Gold Fish (Carassius auratus Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Tuncer Okan Genç

2015-03-01

Full Text Available In this study, it was aimed to determine the water-borne and food-borne boron accumulation in the liver and muscle tissues of Gold Fish (Carassius auratus Linnaeus, 1758. For each treatment, 12 individuals were. The water-borne boron treatments were applied as boron acid concentration of 1 mg/L, 10 mg/L and 20 mg/L in the aquarium water, while the food-borne boron treatments were prepared food contained the defined levels of boron (1 mg/kg, 5 mg/kg and 10 mg/kg as boric acid. The boron levels in the tissues were determined by an ICP-MS procedure. The maximum boron concentration was found in the 20mg/L water borne boron treatment in the liver tissue (1.78±0.02 mg/kg. In the water-borne boron treatments, the maximum Transfer Factor (TF was found in the 20mg/L boron concentration, and TF values were increased when the boron concentrations were decreasing. In the 1 mg/kg food-borne boron treatment, TF was found as 0, and increasing concentration of boron in the food caused an increase in TF reached about 0.06. This study suggested that the target organ for boron accumulation is the liver rather than the muscles and the accumulation of food-borne boron is lower when comparing water-borne boron.

Co-infection with vaginal Ureaplasma urealyticum and Mycoplasma hominis increases adverse pregnancy outcomes in patients with preterm labor or preterm premature rupture of membranes.

Science.gov (United States)

Kwak, Dong-Wook; Hwang, Han-Sung; Kwon, Ja-Young; Park, Yong-Won; Kim, Young-Han

2014-03-01

The purpose of this study was to determine the prevalence of Ureaplasma urealyticum (UU) and Mycoplasma hominis (MH) in patients with preterm labor or preterm premature rupture of membranes (PPROM) and to determine the effect of these organisms on pregnancy outcomes based on the density of colonization. The study group consisted of 184 women with preterm labor or PPROM. Vaginal cultures for UU and MH were performed for all patients at admission, and the placentas were histologically evaluated after delivery. The prevalence of positive vaginal fluid cultures for genital mycoplasma was 62.5% (112/179). This group included 99 patients carrying only UU and 13 carrying both organisms. No patients were found to carry only MH. Compared to patients only positive for UU, patients with both organisms showed significantly decreased gestational age at birth and birth weight, and significant increases in the incidences of preterm birth, NICU admissions and histologic chorioamnionitis. Vaginal MH tends to be detected with UU, and patients carrying both organisms simultaneously had more severe adverse pregnancy outcomes compared to patients in preterm labor or PPROM who were only positive for UU.

Padrão de atividade e comportamento de forrageamento do morcego-pescador Noctilio leporinus (Linnaeus (Chiroptera, Noctilionidae na Baía de Guaratuba, Paraná, Brasil Activity pattern and foraging behavior of bulldog-bat Noctilio leporinus (Linnaeus, (Chiroptera, Noctilionidae in Guaratuba Bay, Paraná State, Brazil

Directory of Open Access Journals (Sweden)

Marcelo O. Bordignon

2006-03-01

Full Text Available Entre 18 de janeiro a 16 de dezembro de 1999 foi estudado o comportamento de forrageamento e o padrão de atividade do morcego-pescador Noctilio leporinus (Linnaeus, 1758, em uma área de manguezal na Baía de Guaratuba, Sul do Brasil. Os grupos de N. leporinus observados permaneceram em atividade ao longo de todo o período noturno, mas com um aparente padrão bimodal. Durante os meses de abril a setembro, N. leporinus inicia a sua atividade geralmente às 18:00 h, uma hora mais cedo do que durante os meses de outubro a março, quando inicia sua atividade geralmente às 19:00 h. O comportamento de predação sobre os cardumes de peixes mostrou variações quanto ao local de forrageamento ao longo do período de atividade. Em baixos níveis de maré, os grupos de morcegos pescaram longe da margem em águas mais profundas, mas nos níveis de maré alta os grupos de morcegos permaneceram pescando sempre junto à margem, em águas mais rasas. Este padrão de comportamento em N. leporinus parece ser determinado pelo padrão de deslocamento dos cardumes de peixes na área de estudo.From January 18 to December 16 of 1999 the foraging behavior and activity pattern of fishing bat Noctilio leporinus (Linnaeus, 1758 were studied in mangrove ecosystem of Guaratuba Bay, southern Brazil. The groups of N. leporinus observed remained active during all nightly period but showed an apparent bimodal pattern. During April and September N. leporinus generally begin their activity at 18:00h, one hour earlier than October to March months, when their activity started at 19:00 h. The foraging behavior on fish shoal varied spatially along all the activity period. During low tide level the bat groups remained fishing distant from margin on deeper water, but during high tide level the bats were always observed fishing close to the margin on flat water. This pattern in foraging behavior of N. leporinus appears to be determined by the fish shoal displacement pattern in

Fishery biology of the swordfish (Xiphias gladius, Linnaeus 1758 caught by surface longliners based in Itajaí, southern Brazil

Directory of Open Access Journals (Sweden)

Ana Lia Campos Quaggio

2011-06-01

Full Text Available The Xiphias gladius (Linnaeus, 1758 data used in the present study were obtained from commercial fishing cruises of the pelagic longline fleet based in Itajaí, operating in the Southwest Atlantic. For the Covariance models, fishing effort (number of hooks and catches (kg were pooled and categorized into the following groups: (1 year (1997, 1998, 2001, 2002 and 2007; (2 lunar phase; and (3 seasons, fishing effort being the covariate. The highest mean swordfish catch (kg occurred during the waxing crescent moon and during wintertime. The Mantel-Haenszel procedure was applied to compare the efficiency of the two hooks tested, and showed that the "J" hook type (J 9/0 10º offset, traditionally used by the fleet, catches 1.2-fold more Xiphias gladius than the circle hook (18/0 10º offset, used as an optional device to reduce sea turtle bycatch. The conversion of individual dressed weight (kg into total length (cm from 2000 to 2002, showed that sub-adults represented 66% of the total catch.No presente estudo foram analisados os dados obtidos para Xiphias gladius (Linnaeus, 1758 através de observadores, mapas de bordo e fichas de desembarque de carcaças, coletadas pela frota de espinhel-de-superfície sediada em Itajaí (SC. Modelos de análise de covariância (ANCOVA foram aplicados aos dados de captura (peso em kg do espadarte, tendo como efeitos: (1 anos de 1997, 1998, 2001, 2002 e 2007 (2 fases lunares e (3 épocas do ano. A covariável foi o esforço de pesca (n° de anzóis. As maiores médias de captura ocorreram durante as fases de lua crescente e no inverno. O procedimento estatístico de Mantel-Haenszel foi utilizado para comparar as capturas do espadarte no anzol tipo "Jota" (J 9/0 10º offset, comumente utilizado pela frota, com o anzol tipo "circular" (18/0 10º offset, este último oferecido como alternativa mitigadora à captura de tartarugas marinhas. O teste M-H mostrou que o anzol "Jota" apresentou 1,2 mais chances de capturar

Explaining an Unusually Fast Parasitic Enzyme: Folate Tail-Binding Residues Dictate Substrate Positioning and Catalysis in Cryptosporidium hominis Thymidylate Synthase

Energy Technology Data Exchange (ETDEWEB)

Martucci,W.; Vargo, M.; Anderson, K.

2008-01-01

The essential enzyme TS-DHFR from Cryptosporidium hominis undergoes an unusually rapid rate of catalysis at the conserved TS domain, facilitated by two nonconserved residues, Ala287 and Ser290, in the folate tail-binding region. Mutation of these two residues to their conserved counterparts drastically affects multiple steps of the TS catalytic cycle. We have determined the crystal structures of all three mutants (A287F, S290G, and A287F/S290G) in complex with active site ligands dUMP and CB3717. The structural data show two effects of the mutations: an increased distance between the ligands in the active site and increased flexibility of the folate ligand in the partially open enzyme state that precedes conformational change to the active catalytic state. The latter effect is able to be rescued by the mutants containing the A287F mutation. In addition, the conserved water network of TS is altered in each of the mutants. The structural results point to a role of the folate tail-binding residues in closely positioning ChTS ligands and restricting ligand flexibility in the partially open state to allow for a rapid transition to the active closed state and enhanced rate of catalysis. These results provide an explanation on how folate tail-binding residues at one end of the active site affect long-range interactions throughout the TS active site and validate these residues as targets for species-specific drug design.

Preferência alimentar de adultos de Metriona elatior Klug (Coleoptera: Chrysomelidae, Cassidinae por diferentes híbridos de Solanum melogena Linnaeus (Solanaceae = Feeding preference of adults of Metriona elatior Klug (Coleoptera: Chrysomelidae, Cassidinae for different hybrids of Solanum melogena Linnaeus (Solanaceae

Directory of Open Access Journals (Sweden)

Daniel Gandolfo

2008-10-01

Full Text Available Metriona elatior Klug é potencial candidato para o controle biológico de Solanum viarum Dunal (joá-bravo, pois as larvas e adultos se alimentam de suas folhas e têm baixa taxa de dispersão. A especificidade é um forte requisito para a adequabilidade de umorganismo como agente de controle biológico, especialmente pela estratégia inundativa. Desse modo, a preferência alimentar do adulto desse inseto em laboratório foi avaliada em 14 híbridos de Solanum melogena Linnaeus (berinjela. A criação estoque foi mantida emlaboratório, com os indivíduos se alimentando de folhas do joá-bravo. O estudo foi realizado utilizando-se testes de dupla e múltipla escolha, em períodos de alimentação de 24 e 48h, oferecendo-se discos de tecido foliar, em condições de placas de Petri. As avaliaçõesda sobrevivência e consumo foliar dos insetos adultos recém-emergidos foram realizadas em folhas de joá-bravo e dos híbridos de berinjela, mantidas túrgidas pela imersão do pecíolo em água. A área foliar foi medida antes e após quatro dias de exposição ao inseto. M. elatiorapresentou preferência para alimentação, sobrevivência e consumo na planta daninha. A preferência do crisomelídeo foi maior para o híbrido ‘Minikuro Kowishiki’ de berinjela.Metriona elatior Klug is a potential biocontrol agent for Solanum viarum Dunal (tropical soda apple, because larvae and adults feed on its leaves and this species shows a low dispersion rate. Specificity plays a major role in the feasibility of an organism as abiological control agent, especially in the inundative strategy. The feeding preference of M. elatior adults was evaluated to 14 eggplant (Solanum melogena Linnaeus hybrids. Mass rearing was carried out under lab conditions, with the insect feeding directly on S. viarum leaves. The study started with dual and multiple choice tests in 24 and 48 hour feeding times, by offering leaf disks in Petri dish conditions. Survival and leaf

Water ferns Azolla spp. (Azollaceae as new host plants for the small China-mark moth, Cataclysta lemnata (Linnaeus, 1758 (Lepidoptera, Crambidae, Acentropinae

Directory of Open Access Journals (Sweden)

Atousa Farahpour-Haghani

2017-01-01

Full Text Available Water ferns (Azolla spp., Azollaceae are reported for the first time as host plants for the larvae of the small China-mark moth Cataclysta lemnata (Linnaeus (Lepidoptera: Crambidae: Acentropinae in rice fields and waterways of northern Iran. Cataclysta lemnata is a semi-aquatic species that has been recorded to feed on Lemnaceae and a few other aquatic plants. However, it has not been reported before on Azolla spp. Larvae use water fern as food source and shelter and, at high population density in the laboratory, they completely wiped water fern from the water surface. Feeding was confirmed after rearing more than eight continual generations of C. lemnata on water fern in the laboratory. Adults obtained this way are darker and have darker fuscous markings in both sexes compared with specimens previously reported and the pattern remains unchanged after several generations.

SEROLOGIC RESPONSE TO CANINE DISTEMPER VACCINATION IN CAPTIVE LINNAEUS'S TWO-TOED SLOTHS ( CHOLOEPUS DIDACTYLUS) AFTER A FATAL CANINE DISTEMPER VIRUS OUTBREAK.

Science.gov (United States)

Sheldon, Julie D; Cushing, Andrew C; Wilkes, Rebecca P; Anis, Eman; Dubovi, Edward J

2017-12-01

Canine distemper virus (CDV) affects many wild and captive, nondomestic species worldwide but has not been previously reported in Xenarthra. Paucity of information on vaccination safety and efficacy presents challenges for disease prevention in captive collections. CDV infections and subsequent mortalities in five captive Linnaeus's two-toed sloths ( Choloepus didactylus) in eastern Tennessee are reported. Clinical signs included oculonasal discharge, oral ulcerations, and diarrhea, and the diagnosis was confirmed by necropsy, histopathology, immunohistochemistry, virus isolation, and polymerase chain reaction. Viral sequencing identified the strain to be consistent with a new CDV lineage currently affecting domestic dogs and wildlife in Tennessee. Seven sloths were examined and vaccinated using a recombinant CDV vaccine on days 0 and 21. Subsequent blood samples showed increased titers in 3/4 sloths. Based on the outbreak and serologic findings postvaccination without adverse effects, the authors recommend recombinant CDV vaccination in sloths exposed to known carriers of CDV.

Agonistic and reproductive behaviors in males of red hybrid tilapia, Oreochromis niloticus (Linnaeus, 1758 x O. mossambicus (Peters, 1852 (Osteichthyes: Cichlidae

Directory of Open Access Journals (Sweden)

APT Medeiros

Full Text Available The red hybrid tilapia, Oreochromis niloticus (Linnaeus, 1758 x O. mossambicus (Peters, 1852 is a fertile hybrid used in the semi-intensive level of fish culture in the Northeast of Brazil. It is a territorial cichlid and is highly aggressive towards conspecifics during the breeding season. The purpose of this study was to investigate and describe the aggressive behaviour displayed by the males of this hybrid in non-reproductive and reproductive contexts. Behavioural observations revealed that aggression displayed by the reproductive males of red hybrid tilapia included threatening, undulation, parallel, lateral and frontal attacks, chasing, escape and submission. Possession of a territory influenced male aggressiveness, which was more intense in their own territory than that observed in a neutral situation. The males built nests, irrespective of female presence. All the behavioural patterns were in accordance with those previously described for one parental species, the Nile tilapia, O. niloticus.

Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae

Directory of Open Access Journals (Sweden)

Leonardo Luís Artico

2017-04-01

Full Text Available Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus, meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae).

Science.gov (United States)

Artico, Leonardo Luís; Mazzocato, Ana Cristina; Ferreira, Juliano Lino; Carvalho, Carlos Roberto; Clarindo, Wellington Ronildo

2017-01-01

Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus , meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length) and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

Microorganismos patógenos en Jatropha curcas Linnaeus. Estrategias potenciales para su manejo

Directory of Open Access Journals (Sweden)

O Alonso

Full Text Available Jatropha curcas Linnaeus (piñón botija, considerada la gran promesa verde para el biodiesel, es una planta de la que existen considerables incógnitas en el ámbito científico desde el punto de vista agronómico, sobre todo en lo referente a los microorganismos causantes de enfermedades, entre las que sobresale la conocida como damping off (estrangulamiento de las plántulas que es provocada por varias especies de hongos. Por ello, el objetivo de este artículo es compilar la mayor cantidad de información sobre los principales microorganismos fitopatógenos que afectan a J. curcas, así como las posibles estrategias para su manejo, con el fin de obtener rendimientos eficientes y rentables de este cultivo energético en Cuba. Se encontraron 48 agentes causales de enfermedades; los más representativos fueron los hongos, entre los que predominan los que producen la roya y el mildiu polvoso, fundamentalmente. En cuanto al manejo fitosanitario, se citan las medidas culturales preventivas y las químicas, como curativas. De ahí que en Cuba, al igual que en otros países donde se cultiva el piñón botija, sea imprescindible conocer los fitopatógenos que pueden reducir los rendimientos de dicha planta, para después implementar un sistema de manejo fitosanitario que contribuya a evitar pérdidas considerables en la producción de biodiesel como producto final.

The Mediterranean stony coral Cladocora caespitosa (Linnaeus, 1767) as habitat provider for molluscs: colony size effect

Science.gov (United States)

Pitacco, Valentina; Crocetta, Fabio; Orlando-Bonaca, Martina; Mavrič, Borut; Lipej, Lovrenc

2017-11-01

The stony coral Cladocora caespitosa (Linnaeus, 1767) is an important Mediterranean habitat builder, whose survival is now being threatened by human activities and possibly natural events such as mass mortality and bleaching. We characterized the mollusc assemblage associated with colonies in the Gulf of Trieste (northern Adriatic Sea) and then tested whether the number of mollusc species increases in relation with colony size, following a Species-Area Relationship (SAR) model. At least 62 taxa were found in association with coral colonies, with bivalves constituting the dominant group. More than half of the 3034 specimens encountered were juveniles. Mollusc taxa richness increased with increasing C. caespitosa colony size according to the power-function model, whilst the analyses of trophic and functional groups supports the hypothesis of at least two factors underlying SAR (area per se and habitat diversity). Our results confirmed the importance of C. caespitosa for benthic communities, indicating that larger colonies support higher biodiversity, and suggesting that C. caespitosa is the most important habit builder among Mediterranean cnidarians, having also an influential function as a natural nursery ground. These results underline the necessity of new investigations aimed at filling gaps in our knowledge and planning new measures to protect the species.

Population size structure indices and growth standards for Salmo (trutta trutta Linnaeus, 1758 in Central Italy

Directory of Open Access Journals (Sweden)

Pedicillo G.

2010-10-01

Full Text Available The purpose of this study was to provide reference data on the growth and population structure of brown trout Salmo (trutta trutta Linnaeus, in Central Italy. Standards for growth (percentiles and a standard growth model were developed from the von Bertalanffy growth model by using length-at-age data obtained from 122 sampling sites in the River Tiber basin. Length-frequency indices provide a numeric estimation for deviations of the population structure from a balanced population. We adapted the traditional North American Relative Stock Density (RSD and Proportional Stock Density (PSD indices to brown trout populations in Central Italy by means of two methods. In the first method, the benchmarks of length categories were established by using percentages applied to the largest individual in the dataset. In the second method, asymptotic length and size at maturity were used to define the length categories for index calculation. Both methods were tested on length-frequency data from 263 sampling sites in the River Tiber basin. The results showed that the PSD calculated by the first method provided a better insight into the population structures of brown trout. These results provide tools that will help ichthyologists and fish managers to compare the growth and population structure of brown trout throughout Central Italy.

Anidamientoydieta de Harpia harpyja Linnaeus en la Comunidad Nativa de Infierno, Madre de Dios, Perú

Directory of Open Access Journals (Sweden)

Renzo P. Piana

2013-04-01

Full Text Available El Águila Arpía (Harpia harpyja Linnaeus es la rapaz de mayor tamaño que habita los bosques amazónicos, sin embargo en el Perú, es muy poco lo que se sabe de esta especie. Desde 1996 a 2001, realizó una investigación en la Comunidad Nativa de Infi erno para obtener información sobre la biología de la especie mediante la localización y observación de nidos activos y abandonados. La investigación permitió encontrar los primeros nidos activos descritos para el Águila Arpía en Perú e indicarían una cierta preferencia para anidar en castañales. Así mismo, la información recogida ha permitido establecer que el área de anidamiento de una pareja de Águilas Arpía en la zona de estudio es de aproximadamente 4300 hectáreas. El análisis de los restos de las presas consumidas y de las egagrópilas recolectadas dentro y alrededor de la base de los nidos nos han permitido hacer una primera descripción de la dieta de la especie, la cual está compuesta principalmente por mamíferos arbóreos.

Diversity and distribution of butterflies (Insecta: Lepidoptera of district Dir lower, Khyber Pukhtoonkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Muhammad Inayatullah Khan

2016-03-01

Full Text Available Butterflies are the fine-looking creatures and act as ecological indicators and pollinators. The present study is the first record of Butterfly fauna of Dir lower. Collection was carried out during March - August 2013. The specimens were collected and identified with the help of taxonomic keys and preserved specimens in National Insect Museum Islamabad. The collection of 375 specimens were preserved. Identification revealed 24 species belonging to 20 genera and 7 families. The species are Papilio polyctor Boisduval, Papilio demoleus Linnaeus, Junonia almanac Linnaeus, Pararge schakra Kollar, Junonia hierta Fabricius, Junonia orythea Linnaeus, Argyrius hyperbius Linnaeus, Hypolimnus bolina Linnaeus, Vanessa cashmiriensis Kollar, Phalantha phalantha Drury, Melitea didyma Esper, Lycaena phalaeas Linnaeus, Lybithea lipita Moore, Danius chrysippus Linnaeus, Hipparchia parasitas Kollar, Lethe rohria Fabricius, Maniola davendra Moore, Pontia daplidice Linnaeus, Belenois aurota Fabricius, Pieris brassicae Linnaeus, Colias erate Esper, Eurema hecabe Linnaeus, Colias fieldi Linnaeus and Cynthia cardui Linnaeus. The highest population was shown by Pieris brassicae followed by Danius chrysippus and Cynthia cardui. Twelve species belong to family Nymphalidae (50%, which shows the highest abundance rate. Butterfly density was the highest at Timergara. Butterfly fauna was the highest in May followed by August and lowest in March. It is concluded that pollution free environment of Dir Lower is more suitable for the survival of butterfly fauna. Large scale study is required to fully explore the butterfly fauna of the area.

The morphology and histology of the male reproductive system in Dolycoris baccarum Linnaeus 1758 (Heteroptera: Pentatomidae)--light and scanning electron micoscope studies.

Science.gov (United States)

Özyurt, Nurcan; Candan, Selami; Suludere, Zekiye

2013-01-01

The male reproductive system of Dolycoris baccarum (Linnaeus 1758) is studied morphologically and histologically using both light and scanning electron microscopes (SEM). The reproductive system of the male D. baccarum consists of a pair of testis, a pair of vas deferens, a pair of seminal vesicles, accessory glands (mesadenia, ectadenia), a bulbus ejaculatorius, a pair of ectodermal sacs, and a ductus ejaculatorius. The number of testicular follicles varies from four to six. The testicular follicles have three different development zones (growth zone, maturation zone, differentiation zone). The testes are connected to the seminal vesicles by the vas deferens. Vas deferens and seminal vesicles, which are fine-long and cylindrical. The seminal vesicle is connected with bulbus ejaculatorius which is balloon-shaped and surrounded with accessory glands. The bulbus ejaculatorius is continuous with ductus ejaculatorius which connected to the aedeagus. Copyright © 2012 Elsevier Ltd. All rights reserved.

Ultraestrutura do espermatozóide de Ucides cordatus Linnaeus (Crustacea, Ocypodidae do litoral norte do Brasil Ultrastructure of spermatozoon of the crab Ucides cordatus Linaeus (Crustacea, Decapoda of the northern littoral of Brazil

Directory of Open Access Journals (Sweden)

Edilson Matos

2000-09-01

Full Text Available Ultrastructure of spermatozoa of the crab Ucides cordatus Linnaeus, 1763 is described and illustrated. Three parts can be distinguished: 1. the elongate-ovoid acrosome located anteriorly; 2. the cytoplasmic region; and 3. the nuclear region. The acrosome is composed of a thick electron-dense wall and a less electron-dense subacrosomal space. The cytoplasm region connects the acrosome with the nucleus, and three arms filled with microtubules arise from this region. The nucleus is polymorphous. The spermatozoon of Ucides cordatus follows the general pattern described for other Decapods.

The genome of the obligate intracellular parasite Trachipleistophora hominis: new insights into microsporidian genome dynamics and reductive evolution.

Directory of Open Access Journals (Sweden)

Eva Heinz

Full Text Available The dynamics of reductive genome evolution for eukaryotes living inside other eukaryotic cells are poorly understood compared to well-studied model systems involving obligate intracellular bacteria. Here we present 8.5 Mb of sequence from the genome of the microsporidian Trachipleistophora hominis, isolated from an HIV/AIDS patient, which is an outgroup to the smaller compacted-genome species that primarily inform ideas of evolutionary mode for these enormously successful obligate intracellular parasites. Our data provide detailed information on the gene content, genome architecture and intergenic regions of a larger microsporidian genome, while comparative analyses allowed us to infer genomic features and metabolism of the common ancestor of the species investigated. Gene length reduction and massive loss of metabolic capacity in the common ancestor was accompanied by the evolution of novel microsporidian-specific protein families, whose conservation among microsporidians, against a background of reductive evolution, suggests they may have important functions in their parasitic lifestyle. The ancestor had already lost many metabolic pathways but retained glycolysis and the pentose phosphate pathway to provide cytosolic ATP and reduced coenzymes, and it had a minimal mitochondrion (mitosome making Fe-S clusters but not ATP. It possessed bacterial-like nucleotide transport proteins as a key innovation for stealing host-generated ATP, the machinery for RNAi, key elements of the early secretory pathway, canonical eukaryotic as well as microsporidian-specific regulatory elements, a diversity of repetitive and transposable elements, and relatively low average gene density. Microsporidian genome evolution thus appears to have proceeded in at least two major steps: an ancestral remodelling of the proteome upon transition to intracellular parasitism that involved reduction but also selective expansion, followed by a secondary compaction of genome

A Study of Associated Factors, Including Genital Herpes, in Black ...

African Journals Online (AJOL)

Herpesvirus hominis antibodies were measured by a kinetic neutralisation test. Among Black patients in the Johannesburg area there is a high incidence of carcinoma of the cervix, and H. hominis type 2 infection. A correlation exists between carcinomas of the cervix on the one hand and antibodies to H. hominis type 2 on ...

Chemical Modification of Oryza sativa Linnaeus Husk with Urea for Removal of Brilliant Vital Red and Murexide Dyes from Water by Adsorption in Environmentally Benign Way

International Nuclear Information System (INIS)

Rehman, R.; Mahmud, T.; Kanwal, F.; Aslam, M.N.; Nisar, H.

2013-01-01

Oryza sativa Linnaeus is an important food item all around the world. Due to its huge consumption, a large amount of rice husk is generated as agrowaste which can be used for water treatment by adsorption. Its adsorption capacity further can be enhanced by chemical medication. In the present study, urea modified rice husk has been used for removing Brilliant Vital Red and Murexide form water in an efficient way. After optimizing operating conditions, isothermal and thermodynamical studies were carried out, which showed that maximum adsorption capacity of urea modified rice husk for removing Brilliant Vital Red and Murexide dyes were 28.93 and 30.74 mg.g/sup -1/. Adsorbent characterization was carried out by recording its FT-IR spectra. (author)

Checklist of butterfly fauna of Kohat, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Perveen

2012-09-01

Full Text Available The butterflies play dual role, firstly as the pollinator, carries pollen from one flower to another and secondly their larvae act as the pest, injurious to various crops. Their 21 species were identified belonging to 3 different families from Kohat, Pakistan during September-December 2008. The reported families Namphalidae covered 33%, Papilionidae 10%, and Pieridae 57% biodiversity of butterflies of Kohat. In Namphalidae included: species belonging to subfamily Nymphalinae, Indian fritillary, Argynnis hyperbius Linnaeus; common castor, Ariadne merione (Cramer; painted lady, Cynthia cardui (Linnaeus; peacock pansy, Junonia almanac Linnaeus; blue pansy, J. orithya Linnaeus; common leopard, Phalantha phalantha (Drury; species belonging to subfamily Satyrinae, white edged rock brown, Hipparchia parisatis (Kollar. In Papilionidae included: subfamily Papilioninae, lime butterfly, Papilio demoleus Linnaeus and common mormon, Pa. polytes Linnaeus. In Pieridae included: subfamily Coliaclinae, dark clouded yellow, Colias croceus (Geoffroy; subfamily Coliadinae, lemon emigrant, Catopsilia pomona Fabricius; little orange tip, C. etrida Boisduval; blue spot arab,Colotis protractus Butler; common grass yellow, Eumera hecab (Linnaeus; common brimstone, Gonepteryx rhamni (Linnaeus; yellow orange tip, Ixias pyrene Linnaeus; subfamily Pierinae, pioneer white butterfly, Belenoi aurota Bingham; Murree green-veined white, Pieris ajaka Moore; large cabbage white, P. brassicae Linnaeus; green-veined white, P. napi (Linnaeus; small cabbage white, P. rapae Linnaeus. The wingspan of collected butterflies, minimum was 25 mm of C. etrida which was the smallest butterfly, however, maximum was 100 mm of P. demoleus and P. polytes which were the largest butterflies. A detail study is required for further exploration of butterflies' fauna of Kohat.

Temporal variation in the reproductive success of Cacicus haemorrhous (Linnaeus (Aves, Icterinae in an Atlantic Forest reserve in Southeast Brazil Variação temporal no sucesso reprodutivo de Cacicus haemorrhous (Linnaeus (Aves, Icterinae em uma reserva de Floresta Atlântica no sudeste do Brasil

Directory of Open Access Journals (Sweden)

Charles Duca

2005-06-01

Full Text Available For colonial bird species, egg hatching synchrony has been considered an important factor in their reproductive success. The Red-rumped Cacique, Cacicus haemorrhous (Linnaeus, 1766, is a Passeriformes species (Icterinae that reproduces in colonies in which groups of females lay their eggs at different periods during the reproductive season. The objective of this study was to evaluate if there was a variation in the reproductive success among C. haemorrhous females groups that lay eggs in different periods along the reproductive season. A total of 192 nests from four colonies were monitored at Parque Estadual do Rio Doce, Minas Gerais state, Brazil, and used to calculate the nest survival probability in different periods (early and late of the 2001 reproductive season. The results showed that females that reproduced at the beginning of the reproductive period had higher reproductive success than those that reproduced later. Predation was the main cause of nests loss (48,4%, and an increase in predation rate was observed as the reproductive period advanced.Para espécies de aves coloniais a sincronia de eclosão dos ovos tem sido considerada um fator que influencia o sucesso reprodutivo. O Guaxe, Cacicus haemorrhous (Linnaeus, 1766, é uma espécie de Passeriformes (Icterinae que se reproduz em colônias com grupos de fêmeas fazendo a postura em diferentes períodos ao longo da estação reprodutiva. O objetivo deste estudo foi avaliar se há uma variação no sucesso reprodutivo de C. haemorrhous entre esses grupos de fêmeas que fazem a postura em diferentes períodos ao longo da estação reprodutiva. Quatro colônias totalizando 192 ninhos foram monitoradas no Parque Estadual do Rio Doce, Minas Gerais, Brasil, calculando-se a probabilidade de sobrevivência dos ninhos em relação a diferentes períodos (cedo e tardio ao longo da estação reprodutiva de 2001. Constatou-se que fêmeas que reproduziram mais cedo na estação reprodutiva

Behavioural responses of captive-born greater rheas Rhea americana Linnaeus (Rheiformes, Rheidae submitted to antipredator training Respostas comportamentais de emas cativas Rhea americana Linnaeus (Rheiformes, Rheidae submetidas a treinamentoanti-predação

Directory of Open Access Journals (Sweden)

Cristiano S. de Azevedo

2006-03-01

Full Text Available Human activities have been diminishing greater rhea Rhea americana (Linnaeus, 1758 populations throughout their natural distribution. The reintroductions of captive-born greater rheas have been tried but without success; since the individuals reintroduced were killed by predators. Captive-born animals that have been isolated from predators for many generations can lose their predator recognition abilities. To enhance the survival rates of the reintroduced animals, researchers are now using antipredator training techniques. We studied the response of 15 zoo-borne greater rheas to antipredator training. The animals were divided into three groups: two test groups and one control group. We ran 15 antipredator tests and four control testes with each group. Antipredator tests consisted of pairing a taxidermized predator model or a real predator (domestic dog with a simulation of a capture procedure. Control tests consisted of presenting the predator model (jaguar to the birds, after training but not associating it with an aversive event and recording behavioural responses. All tests were video-recorded and analysed a posteriori. Results showed that the trained rheas responded appropriately to the predators, becoming more vigilant and that there was considerable individual differences in response to antipredator training. The results demonstrated that antipredator training is effective and therefore an invaluable tool for reintroduction projects involving greater rheas. Furthermore, the methods employed in this research project should be applicable to other species of flightless birds.As atividades humanas têm diminuído as populações de emas Rhea americana (Linnaeus, 1758 por toda sua área de distribuição. Reintroduções de emas nascidas em cativeiro têm sido tentadas, mas sem sucesso, uma vez que os indivíduos reintroduzidos são mortos por predadores. Animais nascidos em cativeiro que foram isolados de seus predadores por várias gera

Fertilidade do caranguejo de mangue Ucides cordatus (Linnaeus (Crustacea, Brachyura, Ocypodidae, em Iguape (São Paulo, Brasil Fertility of the mangrove crab Ucides cordatus (Linnaeus (Crustacea, Brachyura, Ocypodidae, at Iguape (São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Gustavo Yomar Hattori

2003-06-01

Full Text Available A total of 58 Ucides cordatus (Linnaeus, 1763 ovigerous females in final embryonic stage were collected in mangrove forest at Iguape (São Paulo. Each female were kept in laboratory until the larvae hatching and had their carapace width (CW measured with caliper (0.05 mm and the larval number (LN calculated by volumetric method. The hatching rates (HR were calculated for each animal's size class (5 mm. The values of LN and CW obtained were subjected to regression analyses and the best fitting model was chosen by comparing the obtained determination coefficients (R². The fertility varied from 71,200 to 220,800 larvae (147,169 ± 32,070 larvae, corresponding to 41.7 to 76.8 mm CW (63.7±7.9 mm, respectively. The relationship LNxCW was expressed by the equation LN = 284.1CW1.5º¹ (N = 58; R² = 0.74; p < 0.01, that showed a positive correlation between the variables. Most part of ovigerous females (89.7% showed their hatching during the nightly period. A negative correlation between HR and CW was observed in these animals (p < 0.05, probably due to reduction of spermatophores in the seminal receptacle (multiparous females or due to senility in the females with large size. The biological studies of U. cordatus are very important for practices adoption that preserve and make the rational use of this recourse in Brazilian's mangrove forests.

On mysterious occurrence of butterflies in the genus Delias at Jinmen Islands, with clarification on the nomenclature of D. pasithoe (Linnaeus, 1767) and D. acalis (Godart, 1819) in southern China.

Science.gov (United States)

Hsu, Yu-Feng; Huang, Hang-Chi; Lu, Chen-Chih

2017-06-11

In recent years, a considerable number of pierid butterflies of the genus Delias have been found from Jinmen Islands, where no available hostplants grow, rendering a proof of cross sea water migration of these butterflies. It is suggested here that these butterflies come from nearby continent of eastern China, visiting the islands for nectar acquisition in seasons when nectar is in short supply because they mostly show up in autumn months. Samples obtained during the survey contained two species, namely Delias pasithoe (Linnaeus, 1767) and Delias acalis (Godart, 1819). Subspecific names applied to both species in eastern China appear to involve nomenclatural problems, with erroneous usage in recent literature.

Gastrintestinal helminths Of Cerdocyon thous (Linnaeus, 1766 -Smith, 1839 from the caatinga area of the Paraíba State, Brazil

Directory of Open Access Journals (Sweden)

Roberto César Lima

2013-12-01

Full Text Available The crab eating fox, Cerdocyon thous (Linnaeus, 1766 – Smith, 1839, is a medium sized canid which is found in almost every region of Brazil. It is the only registered native canid specie to be found in the semi-arid Northeastern region of the country. This study had as its objectives: the identification of the helminth fauna common to Cerdocyon thous found in the Caatinga of the state of Paraíba; and the determination of the ecological indications of helminthic infection, hoping to make a favourable addition to the understanding of this little known biome. In this study, 58 animals that were found as ‘roadkill’ on the highways in the municipality of Patos were used. The gastrointestinal helminths from these animals were colected. All the animals in this study were infected with helminths. 16 species of helminths were identified, two being trematodes, one being a cestode, one being an acanthocephalus, and the remaining twelve being nematodes. In this study a new specie, named Pterygodermatites pluripectinata n. sp. Was discovered and its host and location described.

Study on trace element determination in liver samples of great-white-egret Ardea alba Linnaeus, 1758 (Ardeidae, Aves) for environmental contamination biomionitoring

International Nuclear Information System (INIS)

Silva, Rita de Cassia A.; Saiki, Mitiko

2009-01-01

Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)

Infestação de Aetalion reticulatum (Linnaeus (Hemiptera: Auchenorrhyncha: Aethalionidae em Plantas de Euterpe oleracea Martius (Arecaceae no Estado do Acre

Directory of Open Access Journals (Sweden)

Rodrigo Santos

2015-04-01

Abstract. The açai palm (Euterpe oleracea Martius is a native palm tree from the Amazon region floodplains and may be indicated as the most economically profitable species of this genus. Its fruit pulp is extracted and widely consumed by the population of northern Brazil in several ways. With the expansion of the planted area many factors may affect the production and limit the cultivation, highlighting the occurrence of insect pests that cause losses in production. This report presents the first occurrence of the leafhopper Aetalion reticulatum (Linnaeus (Hemiptera: Auchenorrhyncha: Aethalionidae in E. oleracea plants. The occurrence of this insect associated with açai palms in Rio Branco, Acre, increases the list of hosts for this leafhopper in Brazil and reinforces the need for studies of population dynamics, survey of natural enemies, levels of damage and control methods in order to anticipate population outbreaks of this pest in commercial plantations of açai palms in the State.

Study on trace element determination in liver samples of great-white-egret Ardea alba Linnaeus, 1758 (Ardeidae, Aves) for environmental contamination biomionitoring

Energy Technology Data Exchange (ETDEWEB)

Silva, Rita de Cassia A.; Saiki, Mitiko, E-mail: rcsilva@ipen.b, E-mail: mitiko@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2009-07-01

Predatory birds such as herons have been used as bioindicators of pollution since they are at the top of their food webs. The tissues of these animals are analyzed for assessing environmental pollution caused by toxic elements. In the present study, adequate experimental conditions were established for determination of trace elements concentrations in the liver samples of Great-white-egret (Ardea alba Linnaeus, 1758) for further application of this specimens as a bioindicator of environmental contamination. Four liver samples were collected from Greatwhite- egrets found in the metropolitan region of Sao Paulo and were they analyzed by the method of neutron activation analysis (NAA). Concentrations of the elements Br, Co, Cs, Fe, Na, Rb, Se and Zn were measured in these liver tissues. The findings of this present study demonstrated that the established procedure for liver sample treatment was appropriate to obtain a homogeneous sample. The method of neutron activation analysis (NAA) was very promising for liver sample analysis for evaluation of environmental contamination. (author)

Determination of oral bioavailability of curcuminoid dispersions and nanoemulsions prepared from Curcuma longa Linnaeus.

Science.gov (United States)

Lu, Pei Shan; Inbaraj, Baskaran Stephen; Chen, Bing Huei

2018-01-01

Curcuminoid from Curcuma longa Linnaeus has been demonstrated to be effective in anti-cancer and anti-inflammation. The objectives of the present study were to prepare curcuminoid dispersion and nanoemulsion from C. longa and determine their oral bioavailabilities in rats. After curcuminoid extraction using 99.5% ethanol, bisdemethoxycurcumin (BDMC), demethoxycurcumin (DMC) and curcumin were separated within 10 min by high-performance liquid chromatography using an Eclipse XDB-C18 column (Agilent, Palo Alto, CA, USA) and a gradient mobile phase of 0.1% aqueous formic acid and acetonitrile, with a flow rate of 1 mL min -1 , column temperature of 35 °C and detection wavelength of 425 nm. Curcuminoid nanoemulsion at a particle size of 12.1 nm and encapsulation efficiency 98.8% was prepared using lecithin, Tween 80 and water. A pharmacokinetic study in rats revealed that the parameters including T max , C max , t 1/2 and the area under the curve were higher for curcuminoid nanoemulsions than for curcuminoid dispersion at the same dose employed for gavage administration, whereas, for intravenous injection, an opposite trend was shown. The oral bioavailabilities of BDMC, DMC, curcumin and total curcuminoids in nanoemulsion and dispersion were 34.39 and 4.65%, 39.93 and 5.49%, 47.82 and 9.38%, and 46 and 8.7%, respectively. The results of the present study demonstrate a higher oral bioavailability after incorporation of curcuminoid into nanoemulsion, facilitating its application as a botanic drug. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

A note on captive breeding and reproductive parameters of the Chinese pangolin, Manis pentadactyla Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Fuhua Zhang

2016-09-01

Full Text Available The Chinese pangolin (Manis pentadactyla Linnaeus, 1758 is a critically endangered species, and documents on its captive breeding and reproductive parameters are scarce. MP8, kept in the Pangolin Research Base for Artificial Rescue and Conservation Breeding of South China Normal University (the PRB-SCNU, gave birth to a male offspring (MP86 on 19 October 2011. The baby pangolin was well developed, with a weight of 120 g and a total length of 23.2 cm. The gestation length of MP8 was estimated to be from 182 to 225d. Reproductive parameters of the Chinese pangolin are discussed based on collected data about this species. The Chinese pangolin has an obvious reproductive seasonality and its gestation length is typically six to seven months. In this observation, estrus and mating principally occurred in a one-year period from February to July. Parturition principally took place from September to February of the next year. Chinese pangolins usually give birth to one offspring at a time (n = 27. Sex ratio at birth was 0.71:1 (♀:♂, n = 12. Average weight for the reproducible females was 3.57 ± 1.38 kg (2.14–6.8 kg, n = 15. We estimated that Chinese pangolins could reach sexual maturity before they were one year old.

Collection and collation: theory and practice of Linnaean botany.

Science.gov (United States)

Müller-Wille, Staffan

2007-09-01

Historians and philosophers of science have interpreted the taxonomic theory of Carl Linnaeus (1707-1778) as an 'essentialist', 'Aristotelian', or even 'scholastic' one. This interpretation is flatly contradicted by what Linnaeus himself had to say about taxonomy in Systema naturae (1735), Fundamenta botanica (1736) and Genera plantarum (1737). This paper straightens out some of the more basic misinterpretations by showing that: (1) Linnaeus's species concept took account of reproductive relations among organisms and was therefore not metaphysical, but biological; (2) Linnaeus did not favour classification by logical division, but criticized it for necessarily failing to represent what he called 'natural' genera; (3) Linnaeus's definitions of 'natural' genera and species were not essentialist, but descriptive and polytypic; (4) Linnaeus's method in establishing 'natural' definitions was not deductive, but consisted in an inductive, bottom-up procedure of comparing concrete specimens. The conclusion will discuss the fragmentary and provisional nature of Linnaeus's 'natural method'. I will argue in particular that Linnaeus opted for inductive strategies not on abstract epistemological grounds, but in order to confer stability and continuity to the explorative practices of contemporary natural history.

Prevalence, risk factors of infection and molecular characterization of trichomonads in puppies from French breeding kennels.

Science.gov (United States)

Grellet, Aurélien; Brunopolack; Feugier, Alexandre; Boucraut-Baralon, Corine; Grandjean, Dominique; Vandewynckel, Laurine; Cian, Amandine; Meloni, Dionigia; Viscogliosi, Eric

2013-11-08

The trichomonad species Tritrichomonas fetus and Pentatrichomonas hominis were recently identified in the feces of dogs with diarrhea. However the prevalence and pathogenicity of these parasites in the canine population still remained poorly resolved. Therefore the aim of the present study was (1) to determine the prevalence of trichomonads infecting puppies living in French breeding kennels, (2) to confirm the predominance of P. hominis in dogs, (3) to investigate the genetic diversity of P. hominis isolates identified in the French canine population and (4) to evaluate the risk factors for infection by P. hominis and the influence of the parasite on feces consistency. A total of 215 both diarrheic and non-diarrheic puppies from 25 French breeding kennels were included in this epidemiological survey. Fecal samples from each puppy were examined for 6 gastrointestinal pathogens: parvovirus type 2 (CPV2), coronavirus, Toxocara canis, Cystoisospora ohioensis-complex, Cystoisospora canis, and Giardia intestinalis. A part of each collected stool was also tested for the presence of motile trichomonads by microscopy after culturing. The prevalence of trichomonad infection was 15.8% (34/215) among puppies and 20% (5/25) among breeding kennels. DNA from 26 of the 34 positive samples was successfully amplified using a trichomonad-specific primer pair. Analysis of the sequences of PCR products indicated that P. hominis was the only trichomonad infecting the canine population. All the puppies infected with P. hominis belonged to large breed dogs. Moreover, puppies from large breeding kennels, excreting a high level of G. intestinalis and/or excreting a high level of C. canis oocysts showed a higher probability of being positive for P. hominis infection. Univariate analysis also revealed an increased risk for P. hominis infection in puppies with abnormal feces. However, in a multivariate analysis, CPV2 was the only gastrointestinal pathogen associated with abnormal feces. Since

Pengembangan pemakaian hasil samping agroindustri berbahan dasar jagung sebagai alternatif bahan baku pakan ikan kerapu tikus Cromileptes altivelis

Directory of Open Access Journals (Sweden)

Muhammad Agus Suprayudi

2015-03-01

Full Text Available ABSTRACTThis experiment was conducted to evaluate the use of by product of corn ethanol industry, DDGS (distiller dried grain with soluble and hominy as feed raw material on digestibility and the growth performance of humpback grouper Cromileptes altivelis juvenile. Three experimental diets containing isoprotein (48% but different in DDGS contain were used. Diet A containing 0% of DDGS and hominy while diet B and C containing 10.13% (6.13% of DDGS and 4% of hominy and 19.05% (15.05% of DDGS and 4% of hominy. Reduce of fish meal level in the diet was happen as a consequence of balancing amino acid. For digestibility experiment and Cr2O3 at level of 0.05% was used as a tracer. The feces were daily collected 30‒60 minutes after feeding for 14 days. Dry matter and protein were used as digestibility parameters. Completely randomized design with three treatments and two replicates was used in this experiment. Humpback grouper with an average weight of 11‒14 g were reared at floating net cages (FNG of 3×2×1.5 m3. The stocking density for each cage was 167 fish/FNG and reared for six months. For digestibility measurement 30 fish were held in cylindrical fiber tank filled with 800 L of sea water. Fish were fed three times daily at satiation level. For maintaining net in a clean condition net was changed in every ten days. Feed consumption, digestibility of protein and total, growth performance indicator i,e specific growth rate, feed efficiency protein and lipid retention were used as evaluating parameters. The results showed that the fish fed with diet containing DDGS (6.13% dan hominy (4%, at the level of 10.13% (diet B, shows similar growth performance indicators with the fish fed diet A (0% of DDGS and hominy and the growth performance indicator was higher when being compared to those fish fed diet C (containing 19.05% of DDGS (15.05% and hominy (4% (p<0.05. More over the inclusion of DDGS and hominy at the level of 10,13% give no negatif

Predators and Parasitoids of Cacopsylla pyri (L. (Hemiptera: Psyllidae in Serbia

Directory of Open Access Journals (Sweden)

Dušanka Jerinić Prodanović

2010-01-01

Full Text Available The presence of C. pyri and its natural enemies was studied in both treated and untreated pear orchards in Serbia from 2005 to 2009. Five parasitoid and 21 predator species were identified as present on a considerable number of sites. The following parasitoid species were found: Prionomitus mitratus (Dalman,Psyllaephagus procerus Marcet,Syrphophagus ariantes (Walker,Syrphophagus taeniatus Förster and Tamarixia sp. In the study, the species Psyllaephagus procerus,Syrphophagus ariantes and Tamarixia sp. were forthe first time identified as parasitoids of C. pyri and as new species in the Serbian fauna.Among the parasitoids determined, Prionomitus mitratus predominated. Of the predators, the following species in four orders were registered: Dermaptera [Forficula auricularia Linnaeus (Forficulidae], Heteroptera [Anthocoris nemoralis(Fabricius, Anthocoris nemorum (Linnaeus, Orius (Heterorius minutus (Linnaeus, Orius (Heterorius nigerWolff (Anthocoridae, Campylomma verbasci (Mayer-Dür, Deraeocoris (Deraeocorisruber(Linnaeusand Deraeocoris(Knightocarsuslutescens (Schilling(Miridae],Neuroptera[Chrysopa pallens Rambur,Chrysoperla carnea(Stephens,Chrysopa sp.(Chrysopidae], and Coleoptera [Coccinella septempunctata Linnaeus, Adalia bipunctata Linnaeus, Adalia decempunctata(Linnaeus, Hippodamia tredecimpunctata (Linnaeus,Hippodamia variegata(Goeze,Propylea quatuordecimpunctata (Linnaeus, Calvia (Anisocalvia quatuordecimguttata(Linnaeus(Coccinellidae, Cantharis rustica Fallén, Rhagonycha fulva (Scopoli and Rh. testacea(Linnaeus (Cantharidae]. Of the predators determined, 12 species were registered for the first time as predators of C. pyri in Serbia, while C. rustica, Rhagonycha fulva and Rh.testacea have so far been known neither in Serbia nor in the world as predators of pear suckers.

Effects of supplemental coated or crystalline methionine in low-fishmeal diet on the growth performance and body composition of juvenile cobia Rachycentron canadum (Linnaeus)

Science.gov (United States)

Chi, Shuyan; Tan, Beiping; Dong, Xiaohui; Yang, Qihui; Liu, Hongyu

2014-11-01

We evaluated the effects of supplemental coated and crystalline methionine (Met) on the growth performance and feed utilization of juvenile cobia ( Rachycentron canadum Linnaeus) in a 60-d feeding trial. Fish groups were fed one of six isonitrogenous and isolipidic diets: 1) fishmeal control; 2) un-supplemented experimental (low-fish-meal diet deficient in Met); or 3) one of four Met diets supplemented with crystalline L-Met, cellulose-acetate-phthalate coated L-Met, acrylic-resin coated L-Met, or tripalmitin-polyvinyl alcohol coated L-Met. The test diets were fed to triplicate groups of cobia (initial body weight 5.40±0.07 g) twice a day. The weight gain and specific growth rate of the fish fed the RES diet were highest among the Met-supplemented groups and were 23.64% and 7.99%, respectively, higher than those of the fish fed with the un-supplemented experimental diet ( Pcobia.

Antibacterial activity of GUAVA, Psidium guajava Linnaeus, leaf extracts on diarrhea-causing enteric bacteria isolated from Seabob shrimp, Xiphopenaeus kroyeri (Heller).

Science.gov (United States)

Gonçalves, Flávia A; Andrade Neto, Manoel; Bezerra, José N S; Macrae, Andrew; Sousa, Oscarina Viana de; Fonteles-Filho, Antonio A; Vieira, Regine H S F

2008-01-01

Guava leaf tea of Psidium guajava Linnaeus is commonly used as a medicine against gastroenteritis and child diarrhea by those who cannot afford or do not have access to antibiotics. This study screened the antimicrobial effect of essential oils and methanol, hexane, ethyl acetate extracts from guava leaves. The extracts were tested against diarrhea-causing bacteria: Staphylococcus aureus, Salmonella spp. and Escherichia coli. Strains that were screened included isolates from seabob shrimp, Xiphopenaeus kroyeri (Heller) and laboratory-type strains. Of the bacteria tested, Staphylococcus aureus strains were most inhibited by the extracts. The methanol extract showed greatest bacterial inhibition. No statistically significant differences were observed between the tested extract concentrations and their effect. The essential oil extract showed inhibitory activity against S. aureus and Salmonella spp. The strains isolated from the shrimp showed some resistance to commercially available antibiotics. These data support the use of guava leaf-made medicines in diarrhea cases where access to commercial antibiotics is restricted. In conclusion, guava leaf extracts and essential oil are very active against S. aureus, thus making up important potential sources of new antimicrobial compounds.

Circulating Hemocytes from Larvae of the Japanese Rhinoceros Beetle Allomyrina dichotoma (Linnaeus) (Coleoptera: Scarabaeidae) and the Cellular Immune Response to Microorganisms.

Science.gov (United States)

Hwang, Sejung; Bang, Kyeongrin; Lee, Jiae; Cho, Saeyoull

2015-01-01

Hemocytes of the last larva of the Japanese rhinoceros beetle A. dichotoma (Linnaeus) (Coleoptera: Scarabaeidae) were classified as granulocytes, plasmatocytes, oenocytoids, spherulocytes, prohemocytes, and adipohemocytes. Among these cell types, only the granulocytes became immunologically activated with obvious morphological changes, displaying large amoeba-like, lobopodia-like, and fan-like structures. In addition, their cytoplasmic granules became larger and greatly increased in number. To explore whether these granules could be immunologically generated as phagosomes, total hemocytes were stained with LysoTracker. Greater than 90% of the granulocytes retained the LysoTracker dye at 4 h post-bacterial infection. In flow cytometry analysis, the red fluorescent signal was highly increased at 4 h post-bacterial infection (60.36%) compared to controls (5.08%), as was confirmed by fluorescent microscopy. After 12 h post-infection, these signals returned to basal levels. The uptake of pathogens by granulocytes rapidly triggered the translocation of the microtubule-associated protein 1 light chain 3 alpha (LC3) to the phagosome, which may result in enhanced pathogen killing.

Circulating Hemocytes from Larvae of the Japanese Rhinoceros Beetle Allomyrina dichotoma (Linnaeus (Coleoptera: Scarabaeidae and the Cellular Immune Response to Microorganisms.

Directory of Open Access Journals (Sweden)

Sejung Hwang

Full Text Available Hemocytes of the last larva of the Japanese rhinoceros beetle A. dichotoma (Linnaeus (Coleoptera: Scarabaeidae were classified as granulocytes, plasmatocytes, oenocytoids, spherulocytes, prohemocytes, and adipohemocytes. Among these cell types, only the granulocytes became immunologically activated with obvious morphological changes, displaying large amoeba-like, lobopodia-like, and fan-like structures. In addition, their cytoplasmic granules became larger and greatly increased in number. To explore whether these granules could be immunologically generated as phagosomes, total hemocytes were stained with LysoTracker. Greater than 90% of the granulocytes retained the LysoTracker dye at 4 h post-bacterial infection. In flow cytometry analysis, the red fluorescent signal was highly increased at 4 h post-bacterial infection (60.36% compared to controls (5.08%, as was confirmed by fluorescent microscopy. After 12 h post-infection, these signals returned to basal levels. The uptake of pathogens by granulocytes rapidly triggered the translocation of the microtubule-associated protein 1 light chain 3 alpha (LC3 to the phagosome, which may result in enhanced pathogen killing.

Insecticidal activity of garlic essential oil and their constituents against the mealworm beetle, Tenebrio molitor Linnaeus (Coleoptera: Tenebrionidae)

Science.gov (United States)

Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola

2017-01-01

This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20–40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control. PMID:28425475

Insecticidal activity of garlic essential oil and their constituents against the mealworm beetle, Tenebrio molitor Linnaeus (Coleoptera: Tenebrionidae).

Science.gov (United States)

Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola

2017-04-20

This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20-40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control.

Size differences in the Dufour gland of Apis mellifera Linnaeus (Hymenoptera, Apidae between and within the female castes

Directory of Open Access Journals (Sweden)

Fábio Camargo Abdalla

2001-07-01

Full Text Available The Dufour gland is found closely associated with the sting apparatus of all hymenopteran females, playing multiple roles among bees. In Apis mellifera Linnaeus, 1758 the gland is connected to the dorsal vaginal wall and, in queens, it produces egg-marking pheromones. In workers the function of this gland is unknown, except by its capacity to mimic the queen secretion in egg-laying workers. In an attempt to understand the development and to substantiate the present knowledge about the Dufour gland in A. mellifera, a morphometric study of the gland between and within the female castes was made. Glands of workers and queens with different ages and life stages were dissected and measured with an ocular micrometer adapted to a stereoscope. The results showed that the Dufour gland is larger in queens than in workers, and that among workers, the gland is larger in egg-laying and foragers than it is in newly emerged and nurse workers. The larger size of the gland in egg-laying queens and workers is in accordance with its role in reproduction. In forager workers the larger size of the gland suggest that, as happens in some species of bees, the gland may participate in pheromone production for nest-mate or nest-entrance recognition.

Susceptibility of larvae of Aedes aegypti (Linnaeus (Diptera: Culicidae to entomopathogenic nematode Heterorhabditis bacteriophora (Poinar (Rhabditida: Heterorhabditidae

Directory of Open Access Journals (Sweden)

María L. PESCHIUTTA

2014-01-01

Full Text Available Aedes aegypti (Linnaeus (Diptera: Culicidae es vector de los agentes etiológicos de la fiebre amarilla y del dengue. Una alternativa al control químico de este vector es el uso de agentes biológicos. Los nematodos entomopatógenos son efectivos en el control de plagas. La infectividad y el ciclo de vida de un aislado argentino de Heterorhabditis bacteriophora Poinar (Rhabditida: Heterorhabditidae en larvas de A. aegypti se registró por primera vez bajo condiciones de laborato - rio. Para cada unidad experimental, 30 larvas de mosquito de segundo estadio fueron expuestas a 8 dosis del nematodo (0:1, 1:1, 5:1, 15:1, 100:1, 500:1, 750:1, 1500:1. Los juveniles infectivos (JIs utilizados fueron multiplicados sobre Galleria mellonella (Lepidoptera: Pyralidae. La continuidad infectiva de los JIs obtenidos de A. aegypti fue probada aplicándolos en una dosis de 100:1 sobre larvas del mosquito . Las tasas de mortalidad fueron de 0% a 84%. El número de nematodos desarrollados dentro de la larva de mosquito, la mortalidad larval y los nuevos JIs se incrementaron con el aumento de la dosis de nematodos. Los resultados indican que H. bacteriophora es capaz de infectar larvas de A. aegypti , se desarrolla y produce nuevos JIs, permitiendo la continuidad de su ciclo de vida.

Spatial distribution and esterase activity in populations of Aedes (Stegomyia aegypti (Linnaeus (Diptera: Culicidae resistant to temephos

Directory of Open Access Journals (Sweden)

Wanessa Porto Tito Gambarra

2013-04-01

Full Text Available INTRODUCTION: The need for studies that describe the resistance patterns in populations of Aedes aegypti (Linnaeus in function of their region of origin justified this research, which aimed to characterize the resistance to temephos and to obtain information on esterase activity in populations of Aedes aegypti collected in municipalities of the State of Paraíba. METHODS: Resistance to temephos was evaluated and characterized from the diagnostic dose of 0.352mg i.a./L and multiple concentrations that caused mortalities between 5% and 99%. Electrophoresis of isoenzymes was used to verify the patterns of esterase activity among populations of the vector. RESULTS: All populations of Aedes aegypti were resistant to temephos, presenting a resistance rate (RR greater than 20. The greatest lethal dose 50% of the sample (CL50 was found for the municipality of Lagoa Seca, approximately forty-one times the value of CL50 for the Rockefeller population. The populations characterized as resistant showed two to six regions of α and β-esterase, called EST-1 to EST-6, while the susceptible population was only seen in one region of activity. CONCLUSIONS: Aedes aegypti is widely distributed and shows a high degree of resistance to temephos in all municipalities studied. In all cases, esterases are involved in the metabolism and, consequently, in the resistance to temephos.

Evaluation of the Roche LightMix Gastro parasites multiplex PCR assay detecting Giardia duodenalis, Entamoeba histolytica, cryptosporidia, Dientamoeba fragilis, and Blastocystis hominis.

Science.gov (United States)

Friesen, J; Fuhrmann, J; Kietzmann, H; Tannich, E; Müller, M; Ignatius, R

2018-03-23

Multiplex PCR assays offer highly sensitive and specific tools for the detection of enteric pathogens. This prospective study aimed at comparing the novel Roche LightMix Modular Assay Gastro Parasites (LMAGP) detecting Giardia duodenalis, Entamoeba histolytica, Cryptosporidium spp., Blastocystishominis, and Dientamoebafragilis with routine laboratory procedures. Stool specimens (n = 1062 from 1009 patients) were consecutively examined by LMAGP, R-Biopharm Ridascreen enzyme immunoassays (EIAs) detecting G. duodenalis or E. histolytica/dispar, and microscopy of wet mounts. Discrepant results were analysed by in-house PCR. D. fragilis or B. hominis were detected by LMAGP in 131 (14.4%) and 179 (19.9%; 16 samples positive by microscopy; p PCR). G. duodenalis was detected by LMAGP, EIA, or microscopy in 20, 16, or 9 of 1039 stool samples, respectively; all four samples missed by EIA were confirmed by in-house PCR. In total, 938 stool samples were analysed for E. histolytica/dispar. Nine of ten EIA-positive samples were negative by LMAGP but positive by in-house PCR for E. dispar. One E. histolytica infection (positive by both LMAGP and in-house PCR) was missed by EIA and microscopy. Parasites only detected by microscopy included Enterobius vermicularis eggs (n = 3) and apathogenic amoebae (n = 27). The data call for routine use of multiplex PCR assays for the detection of enteric protozoan parasites in laboratory diagnostics. Copyright © 2018 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

Ovitrampas para Avaliação da Presença de Aedes aegypti (Linnaeus e Aedes albopictus (Skuse no Município de Vassouras, Estado do Rio de Janeiro

Directory of Open Access Journals (Sweden)

Alexandre Oliveira

2014-04-01

Abstract. Aedes aegypti (Linnaeus and Aedes albopictus (Skuse are vectors of many arboviruses including urban yellow fever and dengue, the latter being one of the biggest problems in the world in cities that have hot and humid climate. Having the consecutive cases of dengue in Vassouras, RJ it was important to ascertain the presence and behavior of the vector in different seasons of year and their predominance in the city. In this study we observed the presence of 10.44% Ae. aegypti and 89.56% Ae. albopictus of the 364 viable eggs and being the Matadouro neighborhood (point 4, the local with the largest presence of these culicids. These data showed that Ae. albopictus is ever more present in urban areas.

Histologia do fígado de avestruz (Struthio camelus, Linnaeus 1758

Directory of Open Access Journals (Sweden)

Gisele Saviani

2012-04-01

Full Text Available A criação de avestruz (Struthio camelus, Linnaeus 1758 é uma atividade de grande potencial, porém não existem padrões definidos sobre a histologia do seu fígado, que é um órgão de grande importância no metabolismo. O conhecimento de sua histologia pode contribuir para a detecção de doenças e deficiências nutricionais no animal. Para este estudo foram utilizados 24 avestruzes com idades entre 12 e 18 meses (com peso médio em torno de 80 a 100 kg, provenientes do abatedouro Don Pig, em Botucatu no estado de São Paulo. Os animais foram abatidos com pistola pneumática e, após a sangria, as amostras do fígado foram processadas e observadas em microscopia de luz e microscopia eletrônica de transmissão (MET. A hematoxilina e eosina (H.E, picrossírius, Gordon e Sweets, Sudan black e o ácido peródico de Schiff (PAS são colorações usadas respectivamente para observar a morfologia do fígado, colágeno, fibras reticulares, gordura e glicogênio. Foram encontrados os espaços portahepáticos.O glicogênio mostrou média de 5,68%, o conteúdo lipídico, média de 9,83%, o colágeno média de 14,71% e as fibras reticulares média de 5,96%. Quanto à MET notou-se no citoplasma dos hepatócitos, numerosas mitocôndrias, glicogênio, muitas gotas de gordura, alguns lisossomos, retículo endoplasmático granular ao redor das mitocôndrias, algumas células estreladas, célula em degeneração e o canalículo biliar ao centro. Provavelmente o quadro sugestivo de esteatose é resultante do estado nutricional dos animais. Estes resultados demonstraram que os hepatócitos dos avestruzes são muito similares às outras aves, como também muito semelhantes à estrutura e ultraestrutura das células do fígado de mamíferos.

Quadro citológico vaginal, concentração plasmática de progesterona durante a gestação e medidas fetais em paca (Cuniculus paca Linnaeus, 1766 Vaginal citology, serum progesterone concentration during pregnancy and fetal measurements in paca (Cuniculus paca, Linnaeus 1766

Directory of Open Access Journals (Sweden)

Vânia Maria França Ribeiro

2012-09-01

Full Text Available Em 27 pacas (Cuniculus paca Linnaeus, 1766 objetivou-se descrever aos 30, 60 e 90 dias (D de prenhez diagnosticada por ultrassonografia (US, os tipos celulares do epitélio vaginal em esfregaços vaginais, relatar as condições de abertura da vulva e as características do muco vaginal, determinar a concentração plasmática de progesterona (P4 por radioimunoensaio, e ainda, mensurar por ultrassonografia (US o diâmetro biparietal (DBP fetal aos 60 e 90 dias de prenhez. No D30, 40% das amostras exibiram células (com características estrogênicas superficiais e presença de núcleos nus. Nos D60 e D90, células parabasais, intermediárias, superficiais e naviculares estavam presentes nas mesmas proporções, mas células endocervicais foram descritas em apenas 73,9% e 69% das amostras daqueles dias, respectivamente. No D30 a maior proporção de células naviculares e superficiais diferiu (p The objective of this work was to describe in 27 pacas (Cuniculus paca Linnaeus, 1766 at 30, 60 and 90 days (D of pregnancy diagnosed by ultrasonography (U.S. the cell types of the vaginal epithelium by vaginal smears, to report the vulva opening condition and the characteristics of vaginal mucus, to determine the progesterone (P4 serum concentration by radioimmunoassay, and also measure by ultrasound (U.S. the fetuses biparietal diameter (BPD at 60 and 90 days of pregnancy. At D30, 40% of the smears exhibited surface cells (with estrogenic characteristics and of naked nuclei. At D60 and D90, parabasal, intermediate, superficial, and navicular cells were present in the same proportions, but endocervical cells were described in only 73.9% and 69% of those day's smears, respectively. At D30 the highest proportion of navicular and surface cells differed (p < 0.05 compared with other cell types. The vaginal mucus was crystalline and fluid in 100% and 70% of females at D30 and D60, respectively. It was observed the vaginal vestibule open in around 50% of

Eficiência do Bacillus thuringiensis var. kurstaki (Berliner, 1915 no controle da traça da cera Galleria mellonella (Linnaeus, 1758 (Lepidoptera: Pyralidae Efficiency of Bacillus thuringiensis var. kurstaki (Berliner, 1915 for control of the greater wax moth Galleria mellonella (Linnaeus, 1758 (Lepidoptera: Pyralidae

Directory of Open Access Journals (Sweden)

Deodoro Magno Brighenti

2005-02-01

Full Text Available Objetivou-se avaliar a eficiência do Bacillus thuringiensis var. kurstaki (Berliner no controle de Galleria mellonella (Linnaeus. Os experimentos foram realizados no Laboratório de Biologia de Insetos do Departamento de Entomologia da Universidade Federal de Lavras - UFLA, Lavras, MG, a 28±2ºC, UR 70±10% e fotofase de 12 horas. Aplicou-se formulação comercial de B. thuringiensis var. kurstaki por meio de pulverização, imersão dos favos e também foi incorporada à dieta artificial fornecida às lagartas de terceiro ínstar da traça da cera. A aplicação do produto fitossanitário por meio da pulverização dos favos mostrou-se eficiente no controle de lagartas, atingindo níveis iguais ou superiores a 85% de mortalidade quando foram utilizados 5 g/100 mL de água. Na aplicação por imersão dos favos, todas as dosagens testadas foram eficientes atingindo até 100% de mortalidade. Adicionada à dieta artificial, a concentração com maior porcentagem de mortalidade foi de 10g/60g de dieta. Sintomas de infecção pelo B. thuringiensis foram identificados nas lagartas e o isolamento da bactéria, por meio de uma cultura de Bacillus, comprovou a causa da morte desses insetos em todas as dosagens da formulação comercial do B. thuringiensis var. kurstaki utilizadas.This research aim at evaluating the efficiency of Bacillus thruringiensis var. kurstaki (Berliner in the control of Galleria mellonella (Linnaeus.The experiments were conducted in the Insect Biology Laboratory of the Entomology Department of the Universidade Federal de Lavras - UFLA, Lavras, MG, Brazil, at 28±2ºC, RH 70±10% and 12-hour photophase. Commercial formulation of B. thuringiensis. var. kurstaki was applied through spraying, comb soaking and also incorporated into the artificial diet fed to third instar caterpillars of the greater wax moth. Application of B. thuringiensis var. kurstaki through the spraying of the combs was efficient for control, reaching levels

滴虫阴道炎合并人型支原体感染的临床用药初探

Institute of Scientific and Technical Information of China (English)

罗翠连; 陈怡红; 刘英华

2012-01-01

Trichomonas vaginalis and Mycoplasma hominis is a common parasitic in the female urogenital tract pathogens,which can cause genital tract inflammation.In vitro experiments confirmed the two into a symbiotic relationship and the resistance,thereby causing trichomoniasis vaginitis is difficult to cure.This study using molecular biology technique and clinical testing drug sensitivity test,analysis of trichomonas vaginitis with Mycoplasma hominis infection of Mycoplasma hominis resistance,so as to guide the clinical treatment drug of choice.

Checklist of butterfly (Insecta: Lepidoptera fauna of Tehsil Tangi, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Khan Perveen

2015-12-01

Full Text Available The butterflies (Insecta: Lepidopteraare well known insects, play an important role in the ecosystem as bioindicators and pollinators. They have bright colours, remarkable shapes and supple flight. The present study was conducted to prepare the checklist of butterfly fauna of Tehsil Tangi during August, 2014 to May, 2015. A total of 506 specimens were collected belong to 3 families with 18 genera and 23 species. The collected species are the common or lemon emigrant, Catopsila ponoma Fabricius; mottled emigrant, Catopsilia pyranthe Linnaeus; clouded yellow, Colias fieldii Fabricius; common grass yellow, Eurema hecabe Linnaeus; eastern pale clouded yellow butterfly, Colias erate Esper; Indian cabbage white, Pieris canidia Sparrman; Indian little orange tip, Colotis etrida Boisduval; pioneer white or African caper white, Belonias aurota Fabricius; plain tiger, Danaua chrysippus Linnaeus; blue tiger, Tirumala liminniace Cramer; peacock pansy, Junonia almanac Linnaeus; Indian fritillary, Argyreus hyperbius Linnaeus; Indian red admiral, Venesa indica Herbst; yellow pansy, Junonia hierta Fabricius; blue pansy, Junonia orytha Linnaeus; white edged rock brown, Hipparchia parisatis Kollar; banded tree brwon, Lethe confuse Aurivillius; common castor, Ariadne merione Cramer; painted lady, Caynthia cardui Linnaeus; Himalayan sailer, Neptis mahendra Moore; common boran, Euthalia garuda Hewitson; lime butterfly, Papilio demoleus Linnaeus and great black mormon butterfly, Papilio polytes Linnaeus. It was concluded that the family Nymphalidae has the highest numbers of individuals in the present checklist. It is recommended that butterfly fauna of the study area should be conserved and their habitat should be protected.

Temperature induced variation in oxygen consumption of juvenile and adult stage of the dog conch Laevistrombus canarium (Linnaeus 1758)

Science.gov (United States)

Hassan, Wan Nurul Husna Wan; Amin, S. M. Nurul; Ghaffar, Mazlan Abd; Cob, Zaidi Che

2015-09-01

Laevistrombus canarium Linnaeus, 1758 is one of the important edible sea snail within the western Johor Straits, Malaysia. In this study, the impact of temperature on oxygen consumption (MO2) of L. canarium based on their ontogenetic changes (juvenile and adult) was measured in the laboratory condition at 22.0, 26.0, 30.0 and 34.0°C. Measurement of MO2 were taken every 1 s for 60 min on 4.20 - 34.00 g dog conch using respirometry chamber. All experiments were carried out in static conditions in five replicates with one snail per chambers. The results of oxygen consumption showed that juvenile dog conch respired at the rate of 0.163 ml h-1 and adult respired at the rate of 0.119 ml h-1. Consequently, the oxygen consumption in juvenile and adult dog conch was expressed as a total energy spends. The results indicates that total energy spend for oxygen consumed (ml h-1) of L. canarium at different temperature regimes (22.0 to 34.0°C) slightly increased over time period (0.63 ± 0.12 to 3.24 ± 0.05 J h-1) respectively. This finding of the present study suggested L. canarium is well adapted for life in high temperature environment.

Notes on Apidae and Vespidae (Hymenoptera) Species Collected by Bait Traps in OrganicVineyard and Orchards of Kemalpaşa (İzmir), Western Turkey

OpenAIRE

ÜZÜM, Ahu; TANYERİ, Rukiye; GÜLPERÇİN, Nilay; TEZCAN, Serdar; YILDIRIM, Erol

2010-01-01

Hymenoptera species collected by bait traps during the months of June-October in organic vineyard and orchards in Kemalpaşa district, (İzmir) of Western Turkey were evaluated in this study. As a result, six species belonging 2007 to two families of Hymenoptera were determined. Those were Apis mellifera Linnaeus, 1758, Vespula germanica (Fabricius, 1793), Vespa crabro Linnaeus, 1758, Vespa orientalis Linnaeus, 1771, Polistes dominulus (Christ, 1791) and Polistes gallicus (Linnaeus, 1767). Amon...

Morfologia do estômago e do duodeno da paca (Cuniculus paca Linnaeus, 1766

Directory of Open Access Journals (Sweden)

M.R.F. Machado

2015-12-01

Full Text Available Considerando a importância da paca (Cuniculus paca, Linnaeus, 1766, tanto como fonte proteica alternativa para a população quanto pela possibilidade de vir a se tornar um animal de experimentação e pela falta de informações sobre a sua anatomia, objetivou-se descrever a morfologia macroscópica e histológica do estômago e do duodeno desse roedor, reconhecendo as relações, forma e posição que esses órgãos estabelecem entre si e com outros órgãos. O estômago da paca é unicavitário, está no plano médio mais voltado para o antímero esquerdo, transversalmente, na região hipocôndrica em posição ventrocaudal, interposto entre o esôfago e o duodeno. O duodeno da paca se inicia em sequência ao estômago, segue caudalmente até o nível da quinta ou sexta vértebra lombar, na altura das quais se curva e toma direção cranial, dirigindo-se até o nível da transição entre a última vértebra torácica e a primeira vértebra lombar, onde se continua como jejuno. Histologicamente, o estômago e o duodeno da paca possuem o padrão característico da arquitetura dos órgãos ocos, apresentando as seguintes túnicas: mucosa, submucosa, muscular e serosa. Da forma que se conduziu este estudo, conclui-se que o estômago e duodeno da paca, de forma geral, possuem características morfológicas macroscópicas e histológicas semelhantes às dos animais domésticos e de outros roedores selvagens.

Artrópodos asociados a Jatropha curcas Linnaeus. Funciones y estrategia para su manejo

Directory of Open Access Journals (Sweden)

O Alonso

Full Text Available En la actualidad, Jatropha curcas Linnaeus constituye una de las plantas más investigadas a nivel mundial debido a su potencial como productora de aceite, el cual se puede transformar en biodiesel. Sin embargo, aún no se dispone de suficiente información sobre sus interacciones ecológicas con otros vegetales y animales; por lo que el conocimiento referente a los artrópodos asociados al piñón nombre común por el que se le conoce» es un requisito indispensable para el manejo adecuado del cultivo. El objetivo de este artículo es exponer los resultados de una recopilación realizada acerca de dichos organismos (insectos, ácaros y arañas, fundamentalmente, para lograr una mejor explotación de las plantaciones de este cultivo energético en Cuba. Dentro del grupo de los fitófagos se encontraron 151 especies de insectos, entre las que sobresalen las del orden Hemiptera, por ejemplo: Pachycoris klugii Burmeister (Scutelleridae y Leptoglossus zonatus (Dallas; además de cuatro de ácaros. Entre los benéficos se hallaron 90 especies de insectos, cinco de ácaros y 13 de arañas depredadoras. En cuanto a las estrategias de manejo de plagas, se hace un mayor énfasis en las medidas de control químico y en algunas acciones de tipo cultural. Teniendo en cuenta estos antecedentes, en Cuba es imprescindible conocer los principales organismos asociados a dicha planta, con vistas a incorporar con mayor precisión el componente agroecológico en el manejo de las plagas, y con ello contribuir al mantenimiento de las capacidades productivas de los agroecosistemas y a su resiliencia.

Hematological importance of pseudoeosinophilic granulocytes in acclimation of common carp (Cyprinus carpio Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Damir Suljevic

2017-03-01

Full Text Available Adaptation mechanisms as response to water content, oxygen level and pollutants are very important and they can be interpreted by hematological analysis. The aim of this study was the analysis of hematological and immune adaptations of common carp (Cyprinus carpio Linnaeus, 1758 to thermal stress. All specimens were divided into a control and experimental group. The control group of fish was exposed to a constant water temperature of 10°C. We induced thermal stress in experimental fish by gradually heating water to 28°C, held for 30 minutes and then comparing the obtained results with the control fish. Short-term hyperthermia lead to an increase of the number of leukocytes, especially pseudoeosinophilic granulocytes and monocytes, while the number of neutrophils and lymphocytes was reduced. The analysis of the leukocyte number and differential blood count in the control group showed high individual variation of segmented granulocytes, monocytes and pseudoeosinophilic granulocytes. Statistically significant differences (p=0.00 were found for the white blood cells, nonsegmented neutrophils and pseudoeosinophils between the control and experimental group. The experimental group of males had an increased number of white blood cells, monocytes and pseudoeosinophils, where significant differences were found for nonsegmented and total neutrophils and also for pseudoeosinophils (p=0.00, lymphocytes (p=0.01 and monocytes (p=0.03. Females had an increased total number of white blood cells, lymphocytes, monocytes and pseudoeosinophils, while significant differences (p=0.00 were obtained in the number of white blood cells, non segmented and total neutrophils and pseudoeosinophils between the control and experimental group. Adaptation mechanisms in carp after water temperature heating are mostly reflected in the increase of pseudoeosinophils and the decrease of neutrophils.

Perbedaan respon Aedes aegypti (Linnaeus (Diptera: Culicidae, terhadap paparan anti nyamuk bakar dan bunga keluwih (Artocarpus camansi, Blanco

Directory of Open Access Journals (Sweden)

Nur Endah Wahyuningsih

2015-09-01

Full Text Available The control of dengue hemorrhagic fever (DHF it is important to control the vector, i.e. Aedes aegypti (Linnaeus and Ae. albopictus (Skuse. Usually, controls of these vectors are done using chemical insecticides. Research on mosquito resistance has been done, but the impact of mosquitoes that survive after synthetic (chemical insecticides application has not been studied. The aim of this research was to analyze the differences of fecundity, fertility and vitality rate of mosquitoes that were exposed to natural insecticides i.e with burned breadnut flowers and mosquito coils containing transflutrin and d-aletrin. Mosquito samples were taken from field eggs which were exposed with synthetic and natural insecticides. Mosquitoes that remainder alive after 24 hours exposure were mated and each group were put in 2 cages, each repetition were repeated 3 times. The mosquito eggs were observed until adult mosquitoes die. Then, the fecundity, fertility and vitality rate were compared. Based on our analysis, there were no differences on fecundity rate, between control and mosquitoes that were exposed to natural insecticides, but there were significant differences between the control and the synthetic insecticides. Natural insecticides do not increase the rate of fecundity but synthetic insecticides may increase the rate of fecundity and number of mosquitoes and causes the mosquito lifespan longer than the control and natural insecticide treatment.

Uptake, retention and organ/tissue distribution of 137Cs by Japanese catfish (Silurus asotus Linnaeus)

International Nuclear Information System (INIS)

Malek, M.A.; Nakahara, M.; Nakamura, R.

2004-01-01

The work describes the uptake, retention/biological elimination and organ/tissue distribution of 137 Cs by freshwater Japanese catfish (Silurus asotus Linnaeus) under laboratory conditions. The fish were divided into three groups based on their size and age and reared in 137 Cs-spiked water. The concentration of 137 Cs in the whole body of the live fish was measured at regular intervals up to 60 days. A significant accumulation of 137 Cs was found, but a steady state condition was not achieved by the end of the experiment. The bioaccumulation factors at steady state and the required time to reach steady state were estimated to be 1.55 and 255 days, 1.76 and 180 days and 1.99 and 160 days for large, medium and small size fish, respectively. To determine the effective half-life of 137 Cs, the fish were transferred and reared in the non-contaminated host water. The concentration of the remaining 137 Cs in the whole body of the live fish was measured up to 66 days. The average effective half-life of 137 Cs in the fish species was found to be ∼142 days for fish of all sizes. The distribution of 137 Cs in different organs/tissues of the fish was determined. Accumulation of 137 Cs in muscle/flesh of the fish was found to be ∼75% of whole body accumulation. The uptake rate and the retention capability of juvenile fish were found to be higher and therefore, these were more susceptible to 137 Cs than adult and old fish, and could be an important source of 137 Cs in the human food chain

Aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus- PI e região metropolitana do Recife- PE, Brasil.

OpenAIRE

Jamile Prado dos Santos

2010-01-01

A Leishmaniose Visceral Canina (LVC) no Brasil é causada por Leishmania infantum a qual é relatada em várias regiões. O objetivo desta pesquisafoi verificar aspectos epidemiológicos, clínicos e laboratoriais da leishmaniose visceral em cães (Canis familiaris) (Linnaeus, 1758) provenientes da zona urbana do município de Bom Jesus PI e Região Metropolitana de Recife - PE, Brasil. Cães do município de Bom Jesus, Piauí, e do bairro de Muribeca, município de Jaboatão dos Guararapes, Pernambuco...

Recent record of harpy eagle, Harpia harpyja (Linnaeus) (Aves, Accipitridae), in Atlantic forest of Vale do Rio Doce Natural Reserve, Linhares, Espírito Santo, Brazil and implications for the regional conservation of the species

OpenAIRE

Srbek-Araujo, Ana C.; Chiarello, Adriano G.

2006-01-01

A presente comunicação reporta o registro de um macho adulto de harpia, Harpia harpyja (Linnaeus, 1758), na Reserva Natural da Vale do Rio Doce (RNVRD), região norte do Espírito Santo, em agosto de 2005. A análise deste e de registros históricos da espécie nesta reserva indica a presença de uma população residente na região compreendida pela RNVRD e pela Reserva Biológica de Sooretama. Estas duas reservas, contíguas entre si, compreendem cerca de 46250 ha de Floresta Atlântica de baixada (Mat...

Geographic extent and chronology of the invasion of non-native lionfish (Pterois volitans [Linnaeus 1758] and P. miles [Bennett 1828]) in the Western North Atlantic and Caribbean Sea

Science.gov (United States)

Schofield, Pamela J.

2009-01-01

The Indo-Pacific lionfishes (Pterois volitans [Linnaeus 1758] and P. miles [Bennett 1828]: Family Scorpaenidae) are the first non-native marine fishes to establish in the Western North Atlantic. The chronology of the invasion is reported here using records from the US Geological Survey's Nonindigenous Aquatic Species database. Currently, lionfish are established off the Atlantic coast of the USA from the Florida Keys to Cape Hatteras (North Carolina), the Great Antilles, Bermuda, Bahamas, Cayman Islands and Turks and Caicos. The species have been reported from only one island in the Lesser Antilles (St. Croix), but it is not yet established there. Lionfish are established in Mexico, Honduras and Costa Rica. Reports have come from the Gulf of Mexico (Florida), Belize, Panama and Colombia; although lionfish are not considered established in these localities at this time (August 2009), invasion is likely imminent.

Registro recente de harpia, Harpia harpyja (Linnaeus (Aves, Accipitridae, na Mata Atlântica da Reserva Natural Vale do Rio Doce, Linhares, Espírito Santo e implicações para a conservação regional da espécie Recent record of harpy eagle, Harpia harpyja (Linnaeus (Aves, Accipitridae, in Atlantic forest of Vale do Rio Doce Natural Reserve, Linhares, Espírito Santo, Brazil and implications for the regional conservation of the species

Directory of Open Access Journals (Sweden)

Ana C. Srbek-Araujo

2006-12-01

Full Text Available A presente comunicação reporta o registro de um macho adulto de harpia, Harpia harpyja (Linnaeus, 1758, na Reserva Natural da Vale do Rio Doce (RNVRD, região norte do Espírito Santo, em agosto de 2005. A análise deste e de registros históricos da espécie nesta reserva indica a presença de uma população residente na região compreendida pela RNVRD e pela Reserva Biológica de Sooretama. Estas duas reservas, contíguas entre si, compreendem cerca de 46250 ha de Floresta Atlântica de baixada (Mata de Tabuleiro, na sua maior parte bem conservada. Além da grande extensão de floresta, a rica e densa fauna de mamíferos presente nestas reservas contribuem para a permanência das harpias na região.The present communication reports an observation occurred in August 2005 of the harpy eagle, Harpia harpyja (Linnaeus, 1758, in the Vale do Rio Doce Natural Reserve (VRDNR, located in northern Espírito Santo state, southeastern Brazil. The analysis of this and past records of the species in this reserve indicates the presence of a resident population in the region encompassed by the VRDNR and the Sooretama Biological Reserve. These two reserves total circa 46,250 ha of lowland Atlantic forest (Tabuleiros forest, which are mostly well preserved. Besides the great extension of forests, the rich and abundant mammal fauna present in these two reserves contribute to the regional permanence of the harpy eagle.

The component helminth community in six sympatric species of Ardeidae.

Science.gov (United States)

Navarro, Pilar; Lluch, Javier; Font, Enrique

2005-08-01

We studied the helminth communities in 6 sympatric species of Ardeidae (Ixobrychus minutus (Linnaeus, 1766), Nycticorax nycticorax (Linnaeus, 1758), Bubulcus ibis (Linnaeus, 1758), Egretta garzetta (Linnaeus, 1766), Ardea cinerea (Linnaeus, 1758), and Ardea purpurea (Linnaeus, 1766)) from "La Albufera de Valencia," Spain. The survey revealed 13 species of helminth parasites: 5 digeneans, 2 cestodes, and 6 nematodes. The component helminth communities of the Ardeidae examined are depauperate and conform to the pattern typically found in isolationist communities, probably because of their high trophic dependence on a few prey species. Evenness was positively correlated with richness and abundance, but host body weight was not correlated with the number of helminth species or with the total number of helminths. Ardea cinerea is more heavily infected than E. garzetta by Apharyngostrigea cornu, and B. ibis is more heavily infected than both Ardea cinerea and E. garzetta by Desportesius spinulatus. Apharyngostrigea cornu was positively associated with Desmidocercella numidica and D. spinulatus in A. cinerea.

Genetic variants of genital mycoplasmas and their relation to the clinical course of inflammatory diseases of the urogenital system in women

Directory of Open Access Journals (Sweden)

M. R. Rakhmatulina

2014-01-01

Full Text Available Goal of the study. To study genetic variability of M. hominis (based on the vaa gene and M. genitalium (based on the mg192 gene derived from biological material samples taken from women with different clinical manifestations of inflammatory diseases of the urogenital system and clinically healthy women (for M. hominis. Materials and methods. Genetic variability of twenty M. hominis samples taken from patients with inflammatory diseases of the urogenital system and twenty M. hominis samples taken from patients without clinical and laboratory signs of inflammatory processes of the urogenital system was studied by the sequence analysis method. Genetic variability of eight M. genitalium samples taken from patients with different clinical signs of inflammatory diseases of the urogenital system was also examined by the sequence analysis method. Results. Three genetic variants of M. hominis based on the vaa gene were found; variant I was revealed more often in patients with clinical manifestations of inflammatory diseases (65.0%, and variant II - in clinically healthy women (60.0%. Three phylogenetic M. gentium groups based on the mg192 gene were revealed; two samples were referred to Groups I and II, and four samples were referred to Group III. Samples from each phylogenetic groups were taken from patients with clinical and laboratory manifestations of cervicitis and urethritis. Conclusion. The study data demonstrate a potential effect of the VAA surface protein on the virulence of opportunistic M. hominis pathogens.

GRAMÍNEAS TROPICALES EN EL ENGORDE DE CUYES MEJORADOS SEXADOS (Cavia porcellus Linnaeus EN LA ZONA DE LA MANÁ

Directory of Open Access Journals (Sweden)

Adolfo Sánchez Laiño

2009-06-01

Full Text Available La investigación de gramíneas tropicales en el engorde de cuyes en la zona de La Maná. La misma que persiguió los siguientes objetivos: Incrementar los índices productivos en cuyes (Cavia porcellus Linnaeus peruanos mejorados bajo el efecto del consumo del pasto saboya (Panicum maximun Jack, hojas de maíz (Zea mays y caña de azúcar (Saccharum officinarum L en la zona de La Maná, y determinar la rentabilidad de los tratamientos. Se utilizaron 48 cuyes peruanos mejorados sexados de 35 días de edad con un peso promedio de 305 g. Se aplicó un arreglo factorial 2 (sexo x 3 (gramíneas con cuatro repeticiones, dentro de un (DBCA. Para las comparaciones entre medidas se utilizó la prueba de Tukey al 0.05% de probabilidad. Para obtener la rentabilidad de los tratamientos se utilizó la Relación Beneficio–Costo. Se evaluó el: consumo de gramíneas (g, consumo de alimento (g, ganancia de peso (g, conversión alimenticia, peso vivo (g y rendimiento a la canal (%. Los cuyes machos presentaron el mayor (P0.05 no se vio afectado por el efecto del consumo de gramíneas. La mayor rentabilidad la registraron los cuyes machos alimentados con hoja de maíz + balanceado (52.4%.

Sarcocystis sinensis is the most prevalent thick-walled Sarcocystis species in beef on sale for consumers in Germany.

Science.gov (United States)

Moré, G; Pantchev, A; Skuballa, J; Langenmayer, M C; Maksimov, P; Conraths, F J; Venturini, M C; Schares, G

2014-06-01

Bovines are intermediate hosts of Sarcocystis cruzi, Sarcocystis hirsuta, and Sarcocystis hominis, which use canids, felids, or primates as definitive hosts, respectively. Cattle represent also intermediate hosts of Sarcocystis sinensis, but the definitive hosts of this parasite are not yet known. Sarcocystosis in cattle is frequently asymptomatic. The infection is characterized by the presence of thin-walled (S. cruzi) or thick-walled muscle cysts or sarcocysts (S. hominis, S. sinensis, and S. hirsuta). Recent reports suggest high prevalence of the zoonotic S. hominis in beef in Europe. We therefore aimed at differentiating Sarcocystis spp. in beef offered to consumers in Germany using molecular and microscopical methods, focusing on those species producing thick-walled sarcocysts. A total of 257 beef samples were obtained from different butcheries and supermarkets in Germany and processed by conventional and multiplex real-time PCR. In addition, 130 of these samples were processed by light microscopy and in 24.6% thick-walled cysts were detected. Transmission electron microscopical analysis of six of these samples revealed an ultrastructural cyst wall pattern compatible with S. sinensis in five samples and with S. hominis in one sample. PCR-amplified 18S ribosomal DNA (rDNA) fragments of 28 individual thick-walled cysts were sequenced, and sequence identities of ≥98% with S. sinensis (n = 22), S. hominis (n = 5) and S. hirsuta (n = 1) were observed. Moreover, nine Sarcocystis sp. 18S rDNA full length gene sequences were obtained, five of S. sinensis, three of S. hominis, and one of S. hirsuta. Out of all samples (n = 257), 174 (67.7%) tested positive by conventional PCR and 179 (69.6%) by multiplex real-time PCR for Sarcocystis spp. Regarding individual species, 134 (52%), 95 (37%), 17 (6.6%), and 16 (6.2%) were positive for S. cruzi, S. sinensis, S. hirsuta, and S. hominis, respectively. In conclusion, S. sinensis is the most prevalent thick

The efficacy of a nested PCR in detecting cytochrome c oxidase subunit 1 gene of Sarcoptes scabiei var. Hominis for diagnosing scabies.

Science.gov (United States)

Hahm, J E; Kim, C W; Kim, S S

2018-04-06

A widespread scabies infestation, associated to long-term residence in nursing homes, is becoming a serious issue in developed countries. Mineral oil examination is regarded as the gold standard in diagnosing scabies, but the sensitivity of this method is generally low-approximately 50%. Molecular tests may contribute to enhance the sensitivity of current tests for laboratory diagnosis of human scabies. In this study, we developed new primers for a nested PCR for the cytochrome c oxidase subunit 1 (cox1) gene of Sarcoptes scabiei var. hominis to increase the sensitivity of a previously developed conventional PCR. Clinically suspected scabies patients underwent dermoscopy-guided skin scraping with microscopic examination. The diagnosis was positive for scabies when mites or eggs were found under the microscope, and patients were then designated as 'microscopy-positive'. Patients in the 'microscopy-negative' group presented with negative microscopic results. Skin scrapings were collected from both groups for PCR. Of the total 63 samples, 28 were microscopy-positive and 35 were negative with no differences in sex and age between the two groups. All microscopically proven scabies cases were positive with the cox1 nested PCR. Among microscopy-negative ones, S. scabiei DNA was detected in 9 samples. If sensitivity of the cox1 nested PCR is considered 100% (95% CI, 90.51-100), then sensitivity of microscopy is 75.68% (95% CI, 58.80-88.23; P = 0.004). Nested PCR can be successfully used as an alternative method for diagnosing suspected scabies patient. Therefore, infection control measures and treatments can be initiated before significant transmission occurs, minimizing the risk of outbreaks. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

Dieta e dispersão de sementes por Cerdocyon thous (Linnaeus (Carnívora, Canidae, em um fragmento florestal no Paraná, Brasil Diet and seed dispersal by Cerdocyon thous (Linnaeus in a forest fragment in Paraná (Carnivora, Canidae

Directory of Open Access Journals (Sweden)

Vlamir J. Rocha

2004-12-01

Full Text Available Embora o cachorro-do-mato, Cerdocyon thous (Linnaeus, 1706, seja um Canidae relativamente comum, não há muita informação sobre sua dieta e seu papel como dispersor de sementes nos diferentes habitats onde ocorre. O objetivo deste trabalho foi o de reportar a dieta de C. thous e sua importância como dispersor e/ou predador de sementes, e ainda testar a taxa de germinação de sementes após passar pelo trato digestório do animal. O estudo foi realizado em um fragmento (680 ha de Floresta Estacional Semidecidual, o Parque Estadual Mata dos Godoy, localizado na cidade de Londrina, Paraná, sul do Brasil. A metodologia consistiu de coletas de fezes de C. thous, as quais foram analisadas em laboratório para identificar os itens consumidos. Nos testes de germinação, as sementes foram dispostas para germinar em placas de Petri com algodão umedecido em água. Noventa e três amostras fecais com 219 itens de origem vegetal e animal foram registradas, sendo 36,52% contendo restos de pequenos roedores, 24,19% de gramíneas, 13,24% de aves, 10,47% de insetos, 6,39% de Syagrus romanzoffiana (Cham. Glassm., 4,6% de outros itens de origem animal e 4,54% de outros itens de origem vegetal. Ainda, C. thous dispersou nove espécies de plantas, com relevante importância para a germinação de algumas sementes que passaram pelo trato digestório do animal, exceto para S. romanzoffiana, cujas sementes não germinaram nas condições de laboratório. Conclui-se que, C. thous apresentou uma dieta generalista e oportunista, sobrevivendo em áreas degradadas e antrópicas, e agindo como dispersor de sementes nestes locais.Although the crab eating fox, Cerdocyon thous (Linnaeus, 1706, is a relatively common Canidae, there isn't much information about its diet and its role as a seed disperser in the different habitats where it occurs. The aim of this work was to report the diet of the C. thous and its importance as a seed disperser and / or a seed predator and

Cs-134 transfer from water or food to the Ciprinid Tinca tinca Linnaeus: uptake and loss kinetics

International Nuclear Information System (INIS)

Corisco, J.A.G.; Carreiro, M.C.V.

1991-01-01

Experiments with 134 Cs and the fish Tinca tinca Linnaeus (fam. Cyprinidae), as a part of a more extensive work, concerning a simplified freshwater trophic chain using water from Fratel dam, (at Tejo River), were undertaken. Direct uptake from water, during a period of about 30 days, leads to a kinetics expressed by the power function: CF (t) = 0.58 t 0.781 (t in days), the concentration factor (CF) referred to wet weight. Retention study, showed the existence of two biological half-lives, Tb 1 = 7 days and Tb 2 = 87 days, which might concern respectively, the 134 Cs desorption from the transit organs and the loss of the assimilated isotope from the storage organs. In the accumulation through the food chain, using planktonic crustacean Daphnia magna Straus (Cladocera) as prey, a transfer factor (TF) related to wet weight of both fish and prey, is estimated through the power function: TF (t) = 0.022 t 0.578 (t in days). Finally, the retention study following the food pathway contamination, stresses the existence of one long term component, with half-life Tb = 61 days. The transfer factor kinetics seems to point out to a rather slow process, leading to lower 134 Cs concentration values, than the contamination through the water. The loss of the assimilated 134 Cs, uptaken through both pathways, water or food, is a slow process. The longer biological half-life is very important in Radiological Protection, once it may be attributed to the radionuclide loss from the muscular mass. (author)

Bioekologi vektor demam berdarah dengue (DBD serta deteksi virus dengue pada Aedes aegypti (Linnaeus dan Ae. albopictus (Skuse (Diptera: Culicidae di kelurahan endemik DBD Bantarjati, Kota Bogor

Directory of Open Access Journals (Sweden)

Zahara Fadilla

2015-09-01

Full Text Available Dengue hemorrhagic fever (DHF is a viral disease that threatened community health in Indonesia. As part of an eradication program, it is important to learn the behavioral aspect of the disease vector. The aims of this study were to detect the presence of dengue virus in Aedes spp., at Bantarjati Village, Bogor City and to learn to bioecology of. Aedes aegypti (Linnaeus. Detection of dengue virus in Aedes spp. were done by reverse transcription-polymerase chain reaction (RT-PCR technique that consist of two phase were synthesis phase and cDNA amplification and dengue virus serotipe characterization. The Ae. aegypti and Ae. albopictus (Skuse mosquitoes were collected using the landing and resting moquito collection technique booth indoors and outdoors. The highest density of Ae. aegypti and Ae. albopictus were found in April and the peak activity was occurred at 10:00-11:00 am. Dengue virus was not detected in female mosquitoes Aedes spp.

Mycoplasma contamination of Chlamydia pneumoniae isolates

DEFF Research Database (Denmark)

Huniche, BS; Jensen, Lise Torp; Birkelund, Svend

1998-01-01

media, immunoblotting, polymerase chain reaction and pulsed field gel electrophoresis. Two of the 6 ATCC isolates [ATCC VR1355 (TWAR strain 2043) and ATCC VR1356 (TWAR strain 2023)] were infected with Mycoplasma hominis and 1 isolate [ATCC VR2282 (TWAR strain TW183)] was contaminated with both...... Mycoplasma hominis and Mycoplasma orale, whereas 3 of the ATCC isolates [ATCC VR1310, ATCC VR1360 (TWAR strain CM-1) and ATCC 53592 (TWAR strain AR39)] were not contaminated. The Finnish C. pneumoniae isolates Kajaani 6 and Parola were found to be contaminated with M. hominis and M. orale, respectively...

Fish remnants from the excavations of the Bronze Age barrow near Maryanskoe village (Dnepropetrovsk region, Ukraine

Directory of Open Access Journals (Sweden)

O. M. Kovalchuk

2014-10-01

Full Text Available The Bronze Age mound (2.5–2.3 kya BC is located near the Maryanskoe village (Apostolovskyi district, Dnepropetrovsk region and was excavated in 1953. The results of determination of the fish remnants, which were found during the excavation, are presented in the paper. Eleven species belonging to 9 genera, 5 families and 5 orders (Acipenseriformes, Cypriniformes, Siluriformes, Esociformes, Perciformes were identified: russian sturgeon Acipenser gueldenstaedtii Brandt et Ratzeburg, 1833, stellate sturgeon A. stellatus Pallas, 1771, common ide Idus idus (Linnaeus, 1758, common roach Rutilus rutilus (Linnaeus, 1758, pontic roach R. frisii (Nordmann, 1840, common bream Abramis brama (Linnaeus, 1758, common carp Cyprinus carpio Linnaeus, 1758, tench Tinca tinca (Linnaeus, 1758, european catfish Silurus glanis Linnaeus, 1758, northern pike Esox lucius (Linnaeus, 1758, and zander Sander lucioperca (Linnaeus, 1758. Most of them are quite common in the Dnieper river basin. It was found that carp fishes predominate in the number of species. Most of the bone remnants in the collection belong to zander, catfish and pike, while common roach, pontic roach and common bream are identified by the few bones. This may indicate a different role of these species in the diet of the local population. The ratio of skeletal elements in the collection is the evidence of the fish cutting on the site. Body length and weight was reconstructed for 64 fish specimens. It was found that they were mature and small-sized, except for catfish, pike and perch. Taking into account the characteristics of the funeral rituals of the Yamna culture population, fish bones from the mound near Maryanskoe can be remnants of the parting meal.

Variation in Aedes aegypti (Linnaeus) (Diptera, Culicidae) infestation in artificial containers in Caxias, state of Maranhão, Brazil.

Science.gov (United States)

Soares-da-Silva, Joelma; Ibiapina, Sebastiana Silva; Bezerra, Juliana Maria Trindade; Tadei, Wanderli Pedro; Pinheiro, Valéria Cristina Soares

2012-01-01

Dengue is a serious public health problem worldwide, with cases reported annually in tropical and subtropical regions. Aedes aegypti (Linnaeus, 1762), the main vector of dengue, is a domiciliary species with high dispersal and survival capacities and can use various artificial containers as breeding sites. We assessed potential container breeding sites of A. aegypti in the municipality of Caxias, Maranhão, Brazil. In the initial phase, we analyzed 900 properties in 3 neighborhoods during the dry and rainy seasons (August-October 2005 and February-April 2006, respectively). During the second sampling period, September 2006-August 2007, we used 5 assessment cycles for 300 properties in a single neighborhood. During the dry and rainy seasons, water-storage containers comprised 55.7% (n = 1,970) and 48.5% (n = 1,836) of the total containers inspected, and showed the highest productivity of immature A. aegypti; we found 23.7 and 106.1 individuals/container, respectively, in peridomicile sites. In intradomicile sites, water-storage containers were also the most important breeding sites with 86.4% (n = 973) and 85.6% (n = 900) of all containers and a mean of 7.9 and 108.3 individuals/container in the dry and rainy seaso-October 2006 (1,342). The highest number of positives (70) was recorded in May, mostly (94%) in storage containers. Storage containers are the principal and most productive A. aegypti breeding sites and are a major contributing factor to the maintenance of this vector in Caxias.

Modeling suitable habitat of invasive red lionfish Pterois volitans (Linnaeus, 1758) in North and South America’s coastal waters

Science.gov (United States)

Evangelista, Paul H.; Young, Nicholas E.; Schofield, Pamela J.; Jarnevich, Catherine S.

2016-01-01

We used two common correlative species-distribution models to predict suitable habitat of invasive red lionfish Pterois volitans (Linnaeus, 1758) in the western Atlantic and eastern Pacific Oceans. The Generalized Linear Model (GLM) and the Maximum Entropy (Maxent) model were applied using the Software for Assisted Habitat Modeling. We compared models developed using native occurrences, using non-native occurrences, and using both native and non-native occurrences. Models were trained using occurrence data collected before 2010 and evaluated with occurrence data collected from the invaded range during or after 2010. We considered a total of 22 marine environmental variables. Models built with non-native only or both native and non-native occurrence data outperformed those that used only native occurrences. Evaluation metrics based on the independent test data were highest for models that used both native and non-native occurrences. Bathymetry was the strongest environmental predictor for all models and showed increasing suitability as ocean floor depth decreased, with salinity ranking the second strongest predictor for models that used native and both native and non-native occurrences, indicating low habitat suitability for salinities lionfish could continue to invade southern latitudes in the western Atlantic Ocean and may establish localized populations in the eastern Pacific Ocean. We reiterate the importance in the choice of the training data source (native, non-native, or native/non-native) used to develop correlative species distribution models for invasive species.

Roadkills of vertebrates in Venezuela Vertebrados mortos em estradas na Venezuela

Directory of Open Access Journals (Sweden)

Jan Pinowski

2005-03-01

Full Text Available This paper presents an analysis of vertebrate roadkills in five different habitats of tropical South America. Observations of vertebrate roadkills were conducted in 1978, on a 572 km road between Caracas and Mantecal/Apure in Venezuela, during the rainy season (June-October. During five passages on this route, which includes five distinct habitats, 79 vertebrate carcasses - mammals and reptiles - were found. If we assume that the carcasses remain for two days on the road, vehicles can be expected to strike 350 spectacled caimans Caiman crocodilus Linnaeus, 1758 (Alligatoridae during the rainy season alone. Similar calculations for other species yield 313 snakes and lizards, 294 opossums Didelphis marsupialis Linnaeus, 1758 (Didelphidae, 220 crab-eating foxes Cerdocyon thous (Linnaeus, 1776 (Canidae, 129 tamanduas Tamandua tetradactyla (Linnaeus, 1758 (Myrmecophagidae, 55 capybaras Hydrochaerus hydrochaeris (Linnaeus, 1766 (Hydrochaeridae and 37 eastern cottontails Sylvilagus floridanus Allen, 1890 (Leporidae. Numerous papers have been published on vertebrates killed by vehicles on roads in Europe, North America, and Australia, and several papers are available regarding vertebrate roadkills in Africa and Asia. From South America there are several papers on vertebrates, birds, and mammals, whereas from Venezuela only one and it deals with iguanas (Iguana iguana Linnaeus, 1758, Iguanidae.Este trabalho apresenta uma análise de vertebrados mortos em estrada em cinco habitats tropicais diferentes na América do Sul. As observações dos vertebrados mortos em estrada foram feitas em 1978, a 572 km da rodovia entre Caracas e Mantecal/Apure na Venezuela, durante a estação das chuvas (junho-outubro. Durante cinco passagens nesta rota, a qual inclui cinco habitats diferentes, foram encontradas 79 carcaças de vertebrados - répteis e mamíferos. Assumindo que as carcaças permaneçam por dois dias na estrada, é esperado que veículos matem 350

Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

Science.gov (United States)

Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

Moluscos; anélidos y crustáceos asociados a las raíces de Rhizophora mangle linnaeus, en la región de Santa Marta, caribe colombiano Moluscos; anélidos y crustáceos asociados a las raíces de Rhizophora mangle Linnaeus, en la región de Santa Marta, caribe colombiano

Directory of Open Access Journals (Sweden)

Reyes Rosalba

1992-09-01

Full Text Available A qualitative and quantitative study of the community of macro invertebrates associated to the submerged stilt roots of the red mangrove, Rhizophora mangle Linnaeus, 1753, was carried out trimonthly between December 1988 and September 1989, in three stations at the Cienaga Grande de Santa Marta (CGSM and three at the Parque Nacional Natural Tayrona (PNNT, Bahia de Chengue, Bahia de Nenguange, Colombian Caribbean. 181 species were determined: 99 crustaceans, 50 molluscs and 32 annellids. Most of the 26.729 individuals counted were crustaceans (12.213 moluscs (11.635 and annellids (2.881. The lowest diversity and evenness values, and the highest dominance values were found at the CGSM, while the opposite occurred at the PNNT. Moreover, cluster analysis showed that at the CGSM temporal variations in community composition were greater than spatial ones, while at the PNNT spatial differences were stronger. Other factors that could be importantin determinig community structure were detected, such as vecinity to other ecosystems and/or species- specific biological aspects as adaptations to fluctuating conditions, reproductive acti vities, feeding habits and migration to protected and shaded habitats. Se realizó un estudio trimestral cualitativo y cuantitativo de la comunidad de moluscos, anélidos y crustáceos asociados a las raíces sumergidas del mangle rojo, Rhizophora mangle Linnaeus, entre diciembre de 1988 y septiembre de 1989, en tres estaciones en la Ciénaga Grande de Santa Marta (CGSM y tres en el Parque Nacional Natural Tayrona (PNNT, Bahía de Chengue y Bahía de Nenguange, Caribe colombiano. Se determinaron 181 especies: 99 crustáceos, 50 moluscos y 32 anélidos. En total se contaron 26.729 individuos: 12.213 crustáceos, 11.635 moluscos y 2.881 anélidos. Los valores más bajos de diversidad y equitatividad, y los mayores valores de dominancia, se encontraron en la CGSM, mientras que lo opuesto ocurrió en el PNNT. El análisis de

Antibacterial activity of GUAVA, Psidium guajava Linnaeus, leaf extracts on diarrhea-causing enteric bacteria isolated from Seabob shrimp, Xiphopenaeus kroyeri (Heller Avaliação da atividade antibacteriana de extrato de folhas de goiabeira, Psidium guajava Linnaeus, sobre bactérias entéricas diarreiogênicas, isoladas de camarão sete-barbas, Xiphopenaeus kroyeri (Heller

Directory of Open Access Journals (Sweden)

Flávia A. Gonçalves

2008-02-01

Full Text Available Guava leaf tea of Psidium guajava Linnaeus is commonly used as a medicine against gastroenteritis and child diarrhea by those who cannot afford or do not have access to antibiotics. This study screened the antimicrobial effect of essential oils and methanol, hexane, ethyl acetate extracts from guava leaves. The extracts were tested against diarrhea-causing bacteria: Staphylococcus aureus, Salmonella spp. and Escherichia coli. Strains that were screened included isolates from seabob shrimp, Xiphopenaeus kroyeri (Heller and laboratory-type strains. Of the bacteria tested, Staphylococcus aureus strains were most inhibited by the extracts. The methanol extract showed greatest bacterial inhibition. No statistically significant differences were observed between the tested extract concentrations and their effect. The essential oil extract showed inhibitory activity against S. aureus and Salmonella spp. The strains isolated from the shrimp showed some resistance to commercially available antibiotics. These data support the use of guava leaf-made medicines in diarrhea cases where access to commercial antibiotics is restricted. In conclusion, guava leaf extracts and essential oil are very active against S. aureus, thus making up important potential sources of new antimicrobial compounds.O chá de folhas de goiaba Psidium guajava Linnaeus é comumente usado como remédio nas gastrenterites e diarréias infantis por aqueles que não têm acesso a antibióticos. Esta pesquisa estudou o efeito antibacteriano sobre bactérias causadoras de diarréias, do óleo essencial e do extrato de folhas de goiabeira usando como diluente: metanol, hexano e acetato de etila. Os extratos foram testados sobre Staphylococcus aureus, Salmonella spp. e Escherichia coli. As bactérias testadas foram isoladas de camarão sete-barbas Xiphopenaeus kroyeri (Heller usando-se como controle cepas padrão, de cada espécie. Das bactérias testadas, o melhor efeito inibitório foi

What is «to act for an end»? Francisco Suarez’ answer in the ms De beatitudine (1579 and in De ultimo fine hominis (1628

Directory of Open Access Journals (Sweden)

Rosa Colmenarejo Fernández

2018-05-01

Full Text Available The influence of the work and teaching of Francisco Suárez (Granada, 1548-Lisbon, 1617 in the shaping of modern thought has been widely studied in areas such as political philosophy and law, metaphysics, and epistemology. However, the moral philosophy of Suarez, in particular that which, as he himself explains, was needed as a basis for his moral theology, has yet to be analyzed. In this paper, we propose to elucidate some aspects of Suarez’s theory of human agency final causality. We compare two of his commentaries, from different periods, on the I-IIae of Thomas Aquinas’ Summa theologiae: the unpublished manuscript De beatitudine (1579 and Suarez’s treatise De ultimo fine hominis, the first of five treatises on morality posthumously published by Baltasar Álvares (1628. The question analyzed here, the nature of final causality, is assumed as a heuristic instrument to acquaint readers with both the sources studied and the philosophical import of Suárez’ doctrine on morality. The findings suggest the following: i the closeness, still with doubts, of Suárez’ 1579 commentary to Thomas’ doctrine of human agency final causality; (ii in the 1628 commentary, his partial assumption of Thomas’ doctrine on the role of intellect in free choice, and his clear determination in the assertion that the locus finis is the will. Working with these nuances, we illustrate some connection points that show both how 16th century scholasticism deals with philosophical tradition to explain a new image of man, and how subsequent moral philosophy is influenced by these theories while rejecting their theological foundation.

Plasma Membrane-Located Purine Nucleotide Transport Proteins Are Key Components for Host Exploitation by Microsporidian Intracellular Parasites

Science.gov (United States)

Heinz, Eva; Hacker, Christian; Dean, Paul; Mifsud, John; Goldberg, Alina V.; Williams, Tom A.; Nakjang, Sirintra; Gregory, Alison; Hirt, Robert P.; Lucocq, John M.; Kunji, Edmund R. S.; Embley, T. Martin

2014-01-01

Microsporidia are obligate intracellular parasites of most animal groups including humans, but despite their significant economic and medical importance there are major gaps in our understanding of how they exploit infected host cells. We have investigated the evolution, cellular locations and substrate specificities of a family of nucleotide transport (NTT) proteins from Trachipleistophora hominis, a microsporidian isolated from an HIV/AIDS patient. Transport proteins are critical to microsporidian success because they compensate for the dramatic loss of metabolic pathways that is a hallmark of the group. Our data demonstrate that the use of plasma membrane-located nucleotide transport proteins (NTT) is a key strategy adopted by microsporidians to exploit host cells. Acquisition of an ancestral transporter gene at the base of the microsporidian radiation was followed by lineage-specific events of gene duplication, which in the case of T. hominis has generated four paralogous NTT transporters. All four T. hominis NTT proteins are located predominantly to the plasma membrane of replicating intracellular cells where they can mediate transport at the host-parasite interface. In contrast to published data for Encephalitozoon cuniculi, we found no evidence for the location for any of the T. hominis NTT transporters to its minimal mitochondria (mitosomes), consistent with lineage-specific differences in transporter and mitosome evolution. All of the T. hominis NTTs transported radiolabelled purine nucleotides (ATP, ADP, GTP and GDP) when expressed in Escherichia coli, but did not transport radiolabelled pyrimidine nucleotides. Genome analysis suggests that imported purine nucleotides could be used by T. hominis to make all of the critical purine-based building-blocks for DNA and RNA biosynthesis during parasite intracellular replication, as well as providing essential energy for parasite cellular metabolism and protein synthesis. PMID:25474405

Plasma membrane-located purine nucleotide transport proteins are key components for host exploitation by microsporidian intracellular parasites.

Directory of Open Access Journals (Sweden)

Eva Heinz

2014-12-01

Full Text Available Microsporidia are obligate intracellular parasites of most animal groups including humans, but despite their significant economic and medical importance there are major gaps in our understanding of how they exploit infected host cells. We have investigated the evolution, cellular locations and substrate specificities of a family of nucleotide transport (NTT proteins from Trachipleistophora hominis, a microsporidian isolated from an HIV/AIDS patient. Transport proteins are critical to microsporidian success because they compensate for the dramatic loss of metabolic pathways that is a hallmark of the group. Our data demonstrate that the use of plasma membrane-located nucleotide transport proteins (NTT is a key strategy adopted by microsporidians to exploit host cells. Acquisition of an ancestral transporter gene at the base of the microsporidian radiation was followed by lineage-specific events of gene duplication, which in the case of T. hominis has generated four paralogous NTT transporters. All four T. hominis NTT proteins are located predominantly to the plasma membrane of replicating intracellular cells where they can mediate transport at the host-parasite interface. In contrast to published data for Encephalitozoon cuniculi, we found no evidence for the location for any of the T. hominis NTT transporters to its minimal mitochondria (mitosomes, consistent with lineage-specific differences in transporter and mitosome evolution. All of the T. hominis NTTs transported radiolabelled purine nucleotides (ATP, ADP, GTP and GDP when expressed in Escherichia coli, but did not transport radiolabelled pyrimidine nucleotides. Genome analysis suggests that imported purine nucleotides could be used by T. hominis to make all of the critical purine-based building-blocks for DNA and RNA biosynthesis during parasite intracellular replication, as well as providing essential energy for parasite cellular metabolism and protein synthesis.

Genetic variability of genital mycoplasmas and its clinical value

Directory of Open Access Journals (Sweden)

K. I. Plakhova

2015-01-01

Full Text Available The article presents data on genetic variability of genital mycoplasmas. The author presents the results of genetic variability studies for M. hominis, gene vaa, U. parvum, gene mba, and M. genitalium, gene mg192, sampled from women with different clinical manifestations of inflammatory diseases of the urogenital system. Based on the molecular typing results for 138 samples of genital mycoplasmas, the author revealed a relationship between clinical manifestations of inflammatory diseases of the urogenital system caused by U. parvum and different U. parvum serovars as well as different genetic variations of M. hominis.Infection with 6 U. parvum serovar results in the development of inflammatory diseases of the urogenital tract accompanied by subjective manifestations (р < 0.05. Genetic variant II of М. hominis was revealed more often in patients with clinical manifestations of inflammatory diseases while variant I was revealed more often in patients infected with М. hominis without any signs of inflammation (р < 0.05. Genetic variants of M. genitalium were determined; no significant differences in terms of their prevalence in the examined patients were revealed.

Comparative in vitro activities of investigational peptide deformylase inhibitor NVP LBM-415 and other agents against human mycoplasmas and ureaplasmas.

Science.gov (United States)

Waites, Ken B; Reddy, Nipun B; Crabb, Donna M; Duffy, Lynn B

2005-06-01

Peptide deformylase inhibitor LBM-415 and seven other drugs were tested against Mycoplasma pneumoniae (100 isolates), Mycoplasma hominis (20 isolates), Mycoplasma fermentans (10 isolates), and Ureaplasma species (50 isolates). LBM-415 was active against M. pneumoniae (MICs, hominis and M. fermentans and modest activity against Ureaplasma spp.

Variation in Aedes aegypti (Linnaeus (Diptera, Culicidae infestation in artificial containers in Caxias, state of Maranhão, Brazil

Directory of Open Access Journals (Sweden)

Joelma Soares-da-Silva

2012-04-01

Full Text Available INTRODUCTION: Dengue is a serious public health problem worldwide, with cases reported annually in tropical and subtropical regions. Aedes aegypti (Linnaeus, 1762, the main vector of dengue, is a domiciliary species with high dispersal and survival capacities and can use various artificial containers as breeding sites. We assessed potential container breeding sites of A. aegypti in the municipality of Caxias, Maranhão, Brazil. METHODS: In the initial phase, we analyzed 900 properties in 3 neighborhoods during the dry and rainy seasons (August-October 2005 and February-April 2006, respectively. During the second sampling period, September 2006-August 2007, we used 5 assessment cycles for 300 properties in a single neighborhood. RESULTS: During the dry and rainy seasons, water-storage containers comprised 55.7% (n = 1,970 and 48.5% (n = 1,836 of the total containers inspected, and showed the highest productivity of immature A. aegypti; we found 23.7 and 106.1 individuals/container, respectively, in peridomicile sites. In intradomicile sites, water-storage containers were also the most important breeding sites with 86.4% (n = 973 and 85.6% (n = 900 of all containers and a mean of 7.9 and 108.3 individuals/container in the dry and rainy seaso-October 2006 (1,342. The highest number of positives (70 was recorded in May, mostly (94% in storage containers. CONCLUSIONS: Storage containers are the principal and most productive A. aegypti breeding sites and are a major contributing factor to the maintenance of this vector in Caxias.

Blastocytosis hominis Infection

Science.gov (United States)

... increases in places with inadequate sanitation and poor personal hygiene. Risk factors Blastocystis is common, and anyone can ... you have blastocystis or another gastrointestinal infection, good personal hygiene can help keep you from spreading the infection ...

The genome structure of Arachis hypogaea (Linnaeus, 1753 and an induced Arachis allotetraploid revealed by molecular cytogenetics

Directory of Open Access Journals (Sweden)

Eliza F. de M. B. do Nascimento

2018-03-01

Full Text Available Peanut, Arachis hypogaea (Linnaeus, 1753 is an allotetraploid cultivated plant with two subgenomes derived from the hybridization between two diploid wild species, A. duranensis (Krapovickas & W. C. Gregory, 1994 and A. ipaensis (Krapovickas & W. C. Gregory, 1994, followed by spontaneous chromosomal duplication. To understand genome changes following polyploidy, the chromosomes of A. hypogaea, IpaDur1, an induced allotetraploid (A. ipaensis × A. duranensis4x and the diploid progenitor species were cytogenetically compared. The karyotypes of the allotetraploids share the number and general morphology of chromosomes; DAPI+ bands pattern and number of 5S rDNA loci. However, one 5S rDNA locus presents a heteromorphic FISH signal in both allotetraploids, relative to corresponding progenitor. Whilst for A. hypogaea the number of 45S rDNA loci was equivalent to the sum of those present in the diploid species, in IpaDur1, two loci have not been detected. Overall distribution of repetitive DNA sequences was similar in both allotetraploids, although A. hypogaea had additional CMA3+ bands and few slight differences in the LTR-retrotransposons distribution compared to IpaDur1. GISH showed that the chromosomes of both allotetraploids had preferential hybridization to their corresponding diploid genomes. Nevertheless, at least one pair of IpaDur1 chromosomes had a clear mosaic hybridization pattern indicating recombination between the subgenomes, clear evidence that the genome of IpaDur1 shows some instability comparing to the genome of A. hypogaea that shows no mosaic of subgenomes, although both allotetraploids derive from the same progenitor species. For some reasons, the chromosome structure of A. hypogaea is inherently more stable, or, it has been at least, partially stabilized through genetic changes and selection.

Mersin Bölgesinde Yetiştiriciliği Yapılan Bazı Akvaryum Balıkları (POECİLİDAE'nda Rastlanılan Lernea cyprinaceae (Linnaeus, 1758 Enfeksiyonu.

Directory of Open Access Journals (Sweden)

C. Erkin Koyuncu

2015-12-01

Full Text Available Bu araştırma Nisan - Ağustos 2002 tarihleri arasında Mersin Bölgesi’nde bir akvaryum işletmesinde Poecilidae familyasına ait balıklarda görülen ani ölümlerin nedenini ortaya koymak amacıyla yapılmıştır. Balıkların deri, yüzgeç ve solungaç dokularından alınan parazitler laboratuvarda incelenmesi sonucunda ölümlere neden olan etmenin Lernaea cyprinacea (Linnaeus, 1758 olduğu tespit edilmiştir. Araştırmada 110 adet balık incelenmiş olup, bunlardan 49 adetinin parazit ile enfeste olduğu saptanmıştır. Ayrıca parazitin morfolojik özellikleri ve balıklarda oluşturduğu semptomlar incelenmiştir. Balıklar Kloramin T (10 ppm / 1 saat / 3 gün kullanılarak tedavi edilmiştir

Induction of gynogenetic and androgenetic haploid and doubled haploid development in the brown trout (Salmo trutta Linnaeus 1758).

Science.gov (United States)

Michalik, O; Dobosz, S; Zalewski, T; Sapota, M; Ocalewicz, K

2015-04-01

Gynogenetic and androgenetic brown trout (Salmo trutta Linnaeus 1758) haploids (Hs) and doubled haploids (DHs) were produced in the present research. Haploid development was induced by radiation-induced genetic inactivation of spermatozoa (gynogenesis) or eggs (androgenesis) before insemination. To provide DHs, gynogenetic and androgenetic haploid zygotes were subjected to the high pressure shock to suppress the first mitotic cleavage. Among haploids, gynogenetic embryos were showing lower mortality when compared to the androgenetic embryos; however, most of them die before the first feeding stage. Gynogenetic doubled haploids provided in the course of the brown trout eggs activation performed by homologous and heterologous sperm (rainbow trout) were developing equally showing hatching rates of 14.76 ± 2.4% and 16.14 ± 2.90% and the survival rates at the first feeding stage of 10.48 ± 3.48% and 12.78 ± 2.18%, respectively. Significantly, lower survival rate was observed among androgenetic progenies from the diploid groups with only few specimens that survived to the first feeding stage. Cytogenetic survey showed that among embryos from the diploid variants of the research, only gynogenetic individuals possessed doubled sets of chromosomes. Thus, it is reasonable to assume that radiation employed for the genetic inactivation of the brown trout eggs misaligned mechanism responsible for the cell divisions and might have delayed or even arrested the first mitotic cleavage in the androgenetic brown trout zygotes. Moreover, protocol for the radiation-induced inactivation of the paternal and maternal genome should be adjusted as some of the cytogenetically surveyed gynogenetic and androgenetic embryos exhibited fragments of the irradiated chromosomes. © 2015 Blackwell Verlag GmbH.

CHLAMYFAST-OIA TEST IN THE GENITAL CHLAMYDIA MALE INFECTION DIAGNOSIS

Directory of Open Access Journals (Sweden)

Anka Vasic

2004-07-01

Full Text Available The genital infections caused by Chlamydia trachomatis (Ch. trachomatis, Mycoplasma hominis (M. hominis and Ureaplasma urealyticum (U. urealyticum represent, in the countries with developed industry, those diseases which are most often sexually transmissible. Chronic infections provoked by the mentioned causes are considered to be the risk factors for sterility.The aim of this paper is to examine the importance and specific characteristics of the CHLAMYFAST-OIA test in the Chlamydia genital infection diagnosis. This study includes 400 male patients with urethritis symptoms. The CHLAMYFAST-optical immunologic test has been used to determine the presence of the Ch. trachomatis in the genital tract of 360 males (Mycoplasma, International, France. The genital microplasmas, that is M. hominis and U. urealyticum, have been detected with the use of MYCOFAST-test (Mycroplasm International, France. The presence of the genital microplasmas has been studied in 129 patients.Chlamydia genital infection has been determined in 128 males (35,55%. The genital infection caused by M. hominis has been determined in a largely lower number of patients (3; 2,32%, as well as the infection caused by U. urealyticum (in 8 patients; 6,20%. Mixed infections have been detected in 8 patients. In 6 men (4,64% there has been detected a mixed infection caused by genital microplasmas. The mixed infection provoked by Ch. Trachomatis and M. hominis, and the one caused by Ch. trachomatis and U. urealyticum, has been proven only in one patient respectively.

Hubungan Infeksi Parasit Usus dengan Pengetahuan Perilaku Hidup Bersih Sehat pada Anak SD Bekasi, 2012

Directory of Open Access Journals (Sweden)

Rebecca O. Fransisca

2015-09-01

Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 Infeksi parasit usus dapat mengganggu tumbuh kembang anak dan mempengaruhi kualitas hidup. Tujuan penelitian ini adalah mengetahui prevalensi infeksi parasit usus pada anak sekolahdasar di Bekasi pada tahun 2012 dan hubungannya dengan tingkat pengetahuan tentang perilakuhidup bersih sehat (PHBS. Penelitian cross sectional ini dilakukan di sekolah dasar negri (SDNdan madrasah ibtidaiyah (MI di Bekasi. Data diambil pada bulan April 2012 dengan menggunakankuesioner yang berisi pertanyaan mengenai PHBS dan pemeriksaan feses. Semua murid kelas 3, 4,5, dan 6 yang hadir dijadikan subjek penelitian. Dari 130 sampel feses, 64,6% positif terinfeksi parasitusus yaitu B.hominis (43,1%, E. coli (3,1%, G. lamblia (3,1%, H. nana (2,3%, infeksi campur B.hominis dan E. coli (3,1%, B. hominis dan G. lamblia (8,5%, B. hominis dan T. trichiura (0,8%, B.hominis, E. coli, T. trichiura dan H. nana (0,8%. Hanya 3 subjek (2,3% yang memiliki pengetahuanbaik mengenai PHBS sedangkan 72 subjek (55,4% berpengetahuan sedang dan 55 subjek (42,3%memiliki pengetahuan kurang. Uji chi square menunjukkan perbedaan bermakna (p=0,043 sehinggadisimpulkan infeksi parasit usus berhubungan dengan tingkat pengetahuan PHBS. Kata Kunci: infeksi parasit usus, pengetahuan PHBS, anak sekolah dasar The Prevalence of Intestinal Parasitic Infection among Primary School Childrenin Bekasi, 2012 and its Associationwith Knowledge about Clean and Healthy Behaviour Abstract Intestinal parasitic infection can interfere children’s growth and development which will affect their quality of life. The purpose of this research is to find out the prevalence of intestinal parasitic infectionamong primary school children in Bekasi in 2012 and its association with knowledge level about cleanand healthy living behaviour (PHBS. This cross sectional study was conducted in primary school(SDN and Islamic primary school in Bekasi (MI. Data was

Descripción osteológica del rorcual común (Balaenoptera physalus, Linnaeus, 1758 del Museo de Ciencias Naturales de Barcelona

Directory of Open Access Journals (Sweden)

Carrillo, M.

2014-09-01

Full Text Available Description of the skeleton of the fin whale (Balaenoptera physalus, Linnaeus, 1758 at the Natural History Museum of Barcelona We describe the osteology of the fin whale (Balaenoptera physalus, L., registration code MZB 83-308 at the Natural History Museum of Barcelona. The specimen was stranded and died on a beach in Llançà (Girona, Spain in 1862. The skeleton weighed 1,161.59 kg and measured 14. 6 m, although the live animal would have been longer because the invertebral tissue was not included in the length originally stated. The newly reconstructed skeleton includes the invertebral discs and is 17.5 m long. The skull weighs 484 kg and the condilobasal length is 431 cm ( 24. 84% of the total length, corresponding to the mean length of specimens in the Mediterranean. The vertebral column has 58 vertebra structured following the formula: C7 T14 L14 Cd23. It is 10.29 m long and weighs 470.95 kg. All the cervical vertebra are free and show dorsoventral compression, differing from the thoracic, lumbar and first caudal vertebra that are relatively uniform, and rounded. From Cd14 se onwards, the vertebra vary in shape and the relationship between width and height is greater than 1, indicating lateral compression. The lack of suture lines in the epiphysis of the ulna and radius indicates the specimen is an adult that has reached ossification maturation.

Preferência alimentar de adultos de Metriona elatior Klug (Coleoptera: Chrysomelidae, Cassidinae por diferentes híbridos de Solanum melogena Linnaeus (Solanaceae - DOI: 10.4025/actascibiolsci.v30i4.5874 Feeding preference of adults of Metriona elatior Klug (Coleoptera: Chrysomelidae, Cassidinae for different hybrids of Solanum melogena Linnaeus (Solanaceae - DOI: 10.4025/actascibiolsci.v30i4.5874

Directory of Open Access Journals (Sweden)

Robinson Antonio Pitelli

2008-11-01

Full Text Available Metriona elatior Klug é potencial candidato para o controle biológico de Solanum viarum Dunal (joá-bravo, pois as larvas e adultos se alimentam de suas folhas e têm baixa taxa de dispersão. A especificidade é um forte requisito para a adequabilidade de um organismo como agente de controle biológico, especialmente pela estratégia inundativa. Desse modo, a preferência alimentar do adulto desse inseto em laboratório foi avaliada em 14 híbridos de Solanum melogena Linnaeus (berinjela. A criação estoque foi mantida em laboratório, com os indivíduos se alimentando de folhas do joá-bravo. O estudo foi realizado utilizando-se testes de dupla e múltipla escolha, em períodos de alimentação de 24 e 48h, oferecendo-se discos de tecido foliar, em condições de placas de Petri. As avaliações da sobrevivência e consumo foliar dos insetos adultos recém-emergidos foram realizadas em folhas de joá-bravo e dos híbridos de berinjela, mantidas túrgidas pela imersão do pecíolo em água. A área foliar foi medida antes e após quatro dias de exposição ao inseto. M. elatior apresentou preferência para alimentação, sobrevivência e consumo na planta daninha. A preferência do crisomelídeo foi maior para o híbrido Minikuro Kowishiki de berinjela.Metriona elatior Klug is a potential biocontrol agent for Solanum viarum Dunal (tropical soda apple, because larvae and adults feed on its leaves and this species shows a low dispersion rate. Specificity plays a major role in the feasibility of an organism as a biological control agent, especially in the inundative strategy. The feeding preference of M. elatior adults was evaluated to 14 eggplant (Solanum melogena Linnaeus hybrids. Mass rearing was carried out under lab conditions, with the insect feeding directly on S. viarum leaves. The study started with dual and multiple choice tests in 24 and 48 hour feeding times, by offering leaf disks in Petri dish conditions. Survival and leaf

Methods for Assessing the Impact of Fog Oil Smoke on Availability, Palatability, & Food Quality of Relevant Life Stages of Insects for Threatened and Endangered Species

Science.gov (United States)

2007-04-09

wood roach (Parcoblatta uhleriana [ Saussure ]), mosquito (Culex sp.), ant (Camponotus pennsylvanicus [DeGeer]), and beetle (Tenebrio molitor Linnaeus...wood roach (Parcoblatta uhleriana [ Saussure ]), beetle (Tenebrio molitor linnaeus), mosquito (Culex sp), and ant (Camponotus pennsylvanicus [De Geer

Environmental influences on the Indo-Pacific octocoral Isis hippuris Linnaeus 1758 (Alcyonacea: Isididae): genetic fixation or phenotypic plasticity?

Science.gov (United States)

Rowley, Sonia J; Pochon, Xavier; Watling, Les

2015-01-01

As conspicuous modular components of benthic marine habitats, gorgonian (sea fan) octocorals have perplexed taxonomists for centuries through their shear diversity, particularly throughout the Indo-Pacific. Phenotypic incongruence within and between seemingly unitary lineages across contrasting environments can provide the raw material to investigate processes of disruptive selection. Two distinct phenotypes of the Isidid Isis hippurisLinnaeus, 1758 partition between differing reef environments: long-branched bushy colonies on degraded reefs, and short-branched multi/planar colonies on healthy reefs within the Wakatobi Marine National Park (WMNP), Indonesia. Multivariate analyses reveal phenotypic traits between morphotypes were likely integrated primarily at the colony level with increased polyp density and consistently smaller sclerite dimensions at the degraded site. Sediment load and turbidity, hence light availability, primarily influenced phenotypic differences between the two sites. This distinct morphological dissimilarity between the two sites is a reliable indicator of reef health; selection primarily acting on colony morphology, porosity through branching structure, as well as sclerite diversity and size. ITS2 sequence and predicted RNA secondary structure further revealed intraspecific variation between I. hippuris morphotypes relative to such environments (ΦST = 0.7683, P < 0.001). This evidence suggests-but does not confirm-that I. hippuris morphotypes within the WMNP are two separate species; however, to what extent and taxonomic assignment requires further investigation across its full geographic distribution. Incongruence between colonies present in the WMNP with tenuously described Isis alternatives (Isis reticulataNutting, 1910, Isis minorbrachyblastaZou, Huang & Wang, 1991), questions the validity of such assignments. Furthermore, phylogenetic analyses confirm early taxonomic suggestion that the characteristic jointed axis of the Isididae is in

Esterase-D and chromosome patterns in Central Amazon piranha (Serrasalmus rhombeus Linnaeus, 1766 from Lake Catalão

Directory of Open Access Journals (Sweden)

Aylton Saturnino Teixeira

2006-01-01

Full Text Available This study presents additional genetic data on piranha (Serrasalmus rhombeus Linnaeus, 1766 complex previously diagnosed due to the presence of distinct cytotypes 2n = 58 and 2n = 60. Three esterase-D enzyme loci (Est-D1, Est-D2 and Est-D3 were examined and complemented with chromosomal data from 66 piranha specimens collected from Lake Catalão. For all specimens the Est-D1 and Est-D2 loci were monomorphic. In contrast, the Est-D3 locus was polymorphic with genotypes and alleles being differentially distributed in the previously described cytotypes and served as the basis for detecting a new cytotype (2n = 60 B. In cytotype 2n = 58 the Est-D3 locus was also polymorphic and presented Mendelian allelic segregation with four genotypes (Est-D3(11, Est-D3(12, Est-D3(22 and Est-D3(33 out of six theoretically possible genotypes, presumably encoded by alleles Est-D3¹ (frequency = 0.237, EsT-D3² (0.710 and Est-D3³ (0.053. A Chi-squared (chi2 test for Hardy-Weinberg equilibrium was applied to the Est-D3 locus and revealed a genetic unbalance in cytotype 2n = 58, indicating the probable existence in the surveyed area of different stocks for that karyotypic structure. A silent null allele (Est-D3(0 with a high frequency (0.959 occurred exclusively in the 2n = 60 cytotype. On the other hand, the new cytotype 2n = 60 B described here for the first time was monomorphic for the presumably fixed Est-D3³ allele. The data as a whole should contribute to the better understanding the rhombeus complex taxonomic status definition in the Central Amazon.

Environmental influences on the Indo–Pacific octocoral Isis hippuris Linnaeus 1758 (Alcyonacea: Isididae): genetic fixation or phenotypic plasticity?

Science.gov (United States)

Pochon, Xavier; Watling, Les

2015-01-01

As conspicuous modular components of benthic marine habitats, gorgonian (sea fan) octocorals have perplexed taxonomists for centuries through their shear diversity, particularly throughout the Indo–Pacific. Phenotypic incongruence within and between seemingly unitary lineages across contrasting environments can provide the raw material to investigate processes of disruptive selection. Two distinct phenotypes of the Isidid Isis hippuris Linnaeus, 1758 partition between differing reef environments: long-branched bushy colonies on degraded reefs, and short-branched multi/planar colonies on healthy reefs within the Wakatobi Marine National Park (WMNP), Indonesia. Multivariate analyses reveal phenotypic traits between morphotypes were likely integrated primarily at the colony level with increased polyp density and consistently smaller sclerite dimensions at the degraded site. Sediment load and turbidity, hence light availability, primarily influenced phenotypic differences between the two sites. This distinct morphological dissimilarity between the two sites is a reliable indicator of reef health; selection primarily acting on colony morphology, porosity through branching structure, as well as sclerite diversity and size. ITS2 sequence and predicted RNA secondary structure further revealed intraspecific variation between I. hippuris morphotypes relative to such environments (ΦST = 0.7683, P < 0.001). This evidence suggests—but does not confirm—that I. hippuris morphotypes within the WMNP are two separate species; however, to what extent and taxonomic assignment requires further investigation across its full geographic distribution. Incongruence between colonies present in the WMNP with tenuously described Isis alternatives (Isis reticulata Nutting, 1910, Isis minorbrachyblasta Zou, Huang & Wang, 1991), questions the validity of such assignments. Furthermore, phylogenetic analyses confirm early taxonomic suggestion that the characteristic jointed axis of the

Environmental influences on the Indo–Pacific octocoral Isis hippuris Linnaeus 1758 (Alcyonacea: Isididae: genetic fixation or phenotypic plasticity?

Directory of Open Access Journals (Sweden)

Sonia J. Rowley

2015-08-01

Full Text Available As conspicuous modular components of benthic marine habitats, gorgonian (sea fan octocorals have perplexed taxonomists for centuries through their shear diversity, particularly throughout the Indo–Pacific. Phenotypic incongruence within and between seemingly unitary lineages across contrasting environments can provide the raw material to investigate processes of disruptive selection. Two distinct phenotypes of the Isidid Isis hippuris Linnaeus, 1758 partition between differing reef environments: long-branched bushy colonies on degraded reefs, and short-branched multi/planar colonies on healthy reefs within the Wakatobi Marine National Park (WMNP, Indonesia. Multivariate analyses reveal phenotypic traits between morphotypes were likely integrated primarily at the colony level with increased polyp density and consistently smaller sclerite dimensions at the degraded site. Sediment load and turbidity, hence light availability, primarily influenced phenotypic differences between the two sites. This distinct morphological dissimilarity between the two sites is a reliable indicator of reef health; selection primarily acting on colony morphology, porosity through branching structure, as well as sclerite diversity and size. ITS2 sequence and predicted RNA secondary structure further revealed intraspecific variation between I. hippuris morphotypes relative to such environments (ΦST = 0.7683, P < 0.001. This evidence suggests—but does not confirm—that I. hippuris morphotypes within the WMNP are two separate species; however, to what extent and taxonomic assignment requires further investigation across its full geographic distribution. Incongruence between colonies present in the WMNP with tenuously described Isis alternatives (Isis reticulata Nutting, 1910, Isis minorbrachyblasta Zou, Huang & Wang, 1991, questions the validity of such assignments. Furthermore, phylogenetic analyses confirm early taxonomic suggestion that the characteristic jointed

Anthelmintic efficacy of pumpkin seed (Cucurbita pepo Linnaeus, 1753) on ostrich gastrointestinal nematodes in a semiarid region of Paraíba State, Brazil.

Science.gov (United States)

Feitosa, Thais Ferreira; Vilela, Vinícius Longo Ribeiro; Athayde, Ana Célia Rodrigues; Braga, Fábio Ribeiro; Dantas, Elaine Silva; Vieira, Vanessa Diniz; de Melo, Lídio Ricardo Bezerra

2013-01-01

The aim of this study was to verify the in vivo effectiveness of pumpkin seed (Curcubita pepo Linnaeus, 1753) in naturally infected ostriches in the Cariri zone, semiarid region of Paraíba State, Brazil. Forty-eight ostriches were used, African Black breed, of 14 to 36 months old, naturally infected by gastrointestinal nematodes. These animals were divided into four groups of 12 ostriches. Group 1 consists of animals treated with 0.5 g/kg live weight (l. w.) of pumpkin seed meal; group 2 received 1 g/kg l. w. of pumpkin seed meal; group 3 was treated with Albendazole 5 %, at the dosage of 1 mL/10 kg l. w.; and Group 4 was the control group and do not received treatment. Groups 1 and 2 received the treatment for three consecutive days, orally, at intervals of 7 days, totaling nine administrations. The Albendazole 5 % was administered one time, at the beginning of the experiment, according to the manufacturer's recommendations. The groups treated with pumpkin seed showed a significant decrease in egg counts per gram of feces (EPG), wherein group 2 (1 g/kg l. w.) was the most effective. The control and drug groups showed no reduction in EPG. The results of the present study demonstrate that the administration of pumpkin seed was effective in controlling gastrointestinal helminths in naturally infected ostriches.

Feeding associations between capybaras Hydrochoerus hydrochaeris (Linnaeus (Mammalia, Hydrochaeridae and birds in the Lami Biological Reserve, Porto Alegre, Rio Grande do Sul, Brazil Associações alimentares entre capivaras (Hydrochoerus hydrochaeris (Linnaeus (Mammalia, Hydrochaeridae e aves na Reserva Biológica do Lami, Porto Alegre, Rio Grande do Sul, Brasil

Directory of Open Access Journals (Sweden)

Ana C. Tomazzoni

2005-09-01

Full Text Available Feeding associations between capybaras Hydrochoerus hydrochaeris (Linnaeus, 1766 and some bird species were registered in the Lami Biological Reserve, southern Brazil, through observations in a set of transects established in the five major vegetation types of the study area: shrubby and herbaceous swamps, wet grasslands, sandy grasslands and forests. Data included: date and time, vegetation type, bird species, number of individuals (birds and capybaras, type of prey consumed, foraging strategy of the birds and the behavior of the capybaras in relation to the presence of birds. Five species of birds were registered: Caracara plancus (Miller, 1777, Furnarius rufus (Gmelin, 1788, Machetornis rixosus (Vieillot, 1819, Milvago chimachima (Vieillot, 1816 and Molothrus bonariensis (Gmelin, 1789. The interactions were observed in the shrubby swamp (M. bonariensis, forest (C. plancus and wet grassland (F. rufus, M. rixosus, M. chimachima. The foraging strategies were: (1 use of the capybara as a perch, hunting from its back (M. rixosus, M. bonariensis; (2 use of the capybara as a beater, hunting in the ground (F. rufus, M. rixosus, M. bonariensis; (3 foraging in the skin of the capybara, by picking the ectoparasites (C. plancus, F. rufus, M. chimachima. Strategies (1 and (2 were employed to catch arthropods flushed from the vegetation. Sometimes, capybaras lay down and exposed the abdomen and lateral areas of their bodies to facilitate cleaning by M. chimachima, but the presence of other bird species seemed to be neutral to capybaras.Foram registradas associações alimentares entre capivaras Hydrochoerus hydrochaeris (Linnaeus, 1766 e aves na Reserva Biológica do Lami, sul do Brasil, por meio de observações em um conjunto de transecções estabelecidas nos cinco principais tipos de vegetação existentes na área: banhado arbustivo, banhado herbáceo, campo úmido, campo arenoso e mata. As informações coletadas foram: data, horário, tipo de vegeta

Antalya İli Batı Kıyıları (Lara – Kalkan'nın Ekonomik Amaçlı Deniz Algleri

Directory of Open Access Journals (Sweden)

Furkan DURUCAN

2014-12-01

Abstract: This study has been carried out with seasonal samples in five stations in order to determine commercial seaweed in west coast of Antalya Province (Lara, Phaselis, Beymelek, Kaş, Kalkan. At the end of study, Rhodophyta (Corallina elongata Ellis & Solander, Corallina officinalis (Linnaeus, Gelidium capillaceum (S.G. Gmelin Kützing, Gelidium latifolium (Greville Bornet & Thuret, Jania adhaerens Lamouroux, Jania rubens (Linnaeus Lamouroux, Porphyra leucosticta Thuret, Heterokontophyta (Cystoseira compressa (Esper Gerloff et Nizamuddin, Cystoseira crinita Duby, Cystoseira elegans Sauvageau, Cystoseira spinosa Sauvageau, Cystoseira stricta (Montagne Sauvageau, Padina pavonica (Linnaeus Thivy, Sargassum vulgare C. Agardh, Chlorophyta (Enteromorpha intestinalis (L. Nees, Gayralia oxysperma (Kützing K.L. Vinogradova ex Scagel et al. ve Ulva lactuca Linnaeus. Species belong to the families have been determined as an important economic potential in this region. Key Words: Mediterranean, Antalya, seaweeds for economic purposing

TROPHIC RELATIONS OF LADY BEETLES (COLEOPTERA, COCCINELLIDAE OF THE URALS

Directory of Open Access Journals (Sweden)

Z. I. Tyumaseva

2016-05-01

Full Text Available The article contains the study of the trophic relations of the lady beetles living in the Urals. The study allocates three ecological groups depending on the peculiarities of the beetles and larvae nutrition: phytophages, micetophages, and entomophages-predators. We have revealed 66 species of lady birds-predators and two species-phytophages: Subcoccinella vigintiquatuorpunctata (Linnaeus, 1758 and Bulaea lichatschovii (Hummel, 1827. In the group of obligatory micetophages in the Urals we registered the representatives of the tribe Halyziini, it is Halyzia sedecimguttata (Linnaeus, 1758 and Psyllobora vigintiduopunctata (Linnaeus, 1758.

Vessel noise pollution as a human threat to fish: assessment of the stress response in gilthead sea bream (Sparus aurata, Linnaeus 1758).

Science.gov (United States)

Celi, Monica; Filiciotto, Francesco; Maricchiolo, Giulia; Genovese, Lucrezia; Quinci, Enza Maria; Maccarrone, Vincenzo; Mazzola, Salvatore; Vazzana, Mirella; Buscaino, Giuseppa

2016-04-01

This study examined the effects of boat noise pollution on the stress indices of gilthead sea bream (Sparus aurata, Linnaeus 1758). To assess the stress response in these fish, biometric values and plasma parameters such as ACTH, cortisol, glucose, lactate, haematocrit, Hsp70, total protein, cholesterol, triglycerides and osmolarity were analysed. After acclimatization of the animals, the experiment was carried out in a tank fitted with underwater speakers where the fish were exposed to sound treatments (in duplicate) consisting of: 10 days of no sound (control treatment; the animals were only exposed to the experimental tank's background noise) and 10 days of noise derived from original recordings of motor boats, including recreational boats, hydrofoil, fishing boat and ferry boat (vessel noise treatment). The exposure to noise produced significant variations in almost all the plasma parameters assessed, but no differences were observed in weights and fork lengths. A PERMANOVA analysis highlighted significantly increased values (p < 0.05) of ACTH, cortisol, glucose, lactate, haematocrit, Hsp70, cholesterol, triglycerides and osmolarity in the fish exposed to vessel noise for 10 days. This study clearly highlights that anthropogenic noise negatively affects fish, and they are valuable targets for detailed investigations into the effects of this global pollutant. Finally, these experimental studies could represent part of the science that is able to improve the quality of the policies related to management plans for maritime spaces (Marine Strategy Framework Directive 56/2008 CE) that are aimed at stemming this pollutant phenomenon.

A Review of the Dodo and its Ecosystem: Interdisciplinary Research of a Vertebrate Concentration-Lagerstätte in Mauritius

NARCIS (Netherlands)

Rijsdijk, K.F.; Hume, J.P.; de Louw, P.G.B.; Meijer, H.J.M.; Janoo, A.; de Boer, E.J.; Steel, L.; de Vos, J.; van der Sluis, L.G.; Hooghiemstra, H.; Florens, F.B.V.; Baider, C.; Vernimmen, T.J.J.; Baas, P.; van Heteren, A.H.; Rupear, V.; Beebeejaun, G.; Grihault, A.; van der Plicht, J.; Besselink, M.; Lubeek, J.K.; Jansen, M.; Kluiving, S.J.; Hollund, H.; Shapiro, B.; Collins, M.; Buckley, M.; Jayasena, R.M.; Porch, N.; Floore, R.; Bunnik, F.; Biedlingmaier, A.; Leavitt, J.; Monfette, G.; Kimelblatt, A.; Floore, P.; Claessens, L.P.A.M.

2016-01-01

The dodo Raphus cucullatus Linnaeus, 1758 Linnaeus, C. 1758. Systema Naturae per Tegna Tria Naturae, Secundum Classes, Ordines, Genera, Species, cum Characteribus, Differentiis, Synonymis, Locis. Tenth Edition. Laurentii Salvii, Stockholm, 824 pp., an extinct and flightless, giant pigeon endemic to

Nuevas citas y ampliación de la distribución conocida de Ropalóceros en la Comunidad Valenciana y provincia de Teruel

Directory of Open Access Journals (Sweden)

Montagud, S.

2007-06-01

Full Text Available The authors summarize data for 18 species of Rhopalocera to complete knowledge of their distribution and biology in Comunidad Valenciana and Teruel province. These species have been selected for two reasons: 1 Danaus plexippus (Linnaeus, 1758, Erebia meolans (de Prunner, 1798, Polyommatus (Meleageria daphnis (Denis & Schiffermüller, 1775, Laeosopis roboris (Esper, 1789, Nordmannia acaciae (Fabricius, 1787 and Plebeius hespericus (Rambur, 1839 are new records for Comunidad Valenciana and 2 Euchloe belemia (Esper, 1800, Pieris mannii (Mayer, 1851, Zegris eupheme (Esper, 1804, Colotis evagore (Klug, 1829, Aporia crataegi (Linnaeus 1758, Erebia epistygne (Hübner, 1819, Melitaea cinxia (Linnaeus, 1758, Libythea celtis (Laicharting, 1782, Glaucopsyche (Iolana iolas (Ochsenheimer, 1816, Scolitantides orion (Pallas, 1771, Neozephyrus quercus (Linnaeus, 1758 and Plebeius (Aricia morronensis Ribbe, 1910, for these species, known distribution is considerably extended and interesting data about their biology are provided.

Se aporta información sobre 18 especies de ropalóceros presentes en la Comunidad Valenciana y provincia de Teruel. Algunas de estas especies se dan a conocer por vez primera de esta región, como es el caso de Danaus plexippus (Linnaeus, 1758, Erebia meolans (de Prunner, 1798, Polyommatus (Meleageria daphnis (Denis & Schiffermüller, 1775, Laeosopis roboris (Esper, 1789, Nordmannia acaciae (Fabricius, 1787 y Plebeius hespericus (Rambur, 1839. Para el resto se amplía considerablemente su distribución conocida y/o se acompaña de algunos comentarios de interés sobre su biología: Euchloe belemia (Esper, 1800, Pieris mannii (Mayer, 1851, Zegris eupheme (Esper, 1804, Colotis evagore (Klug, 1829, Aporia crataegi (Linnaeus 1758,

Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Mariangela Toledo Barbino

2011-08-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

Cestodes of the blue shark, Prionace glauca (Linnaeus 1758), (Carcharhiniformes: Carcharhinidae), off the west coast of Baja California Sur, Mexico.

Science.gov (United States)

Méndez, Oscar; Galván-Magaña, Felipe

2016-03-03

The cestode species recovered from the spiral intestines of 27 blue sharks (Prionace glauca) (Linnaeus, 1758) are reported from the western coast of Baja California Sur (BCS). The sampling was undertaken on a monthly basis from January 2003 to January 2004. The helminthological examination indicated the presence of four species of cestodes: Platybothrium auriculatum Yamaguti, 1952; Prosobothrium japonicum Yamaguti, 1934; Anthobothrium caseyi (Yamaguti, 1934) Ruhnke & Caira, 2009; and Paraorygmatobothrium prionacis (Yamaguti, 1934) Ruhnke, 1994. Of all the 27 sharks examined, 88.8% were infected with at least one cestode species. The most frequent species was P. auriculatum infecting 85% of the spiral intestines examined. In contrast the species with the highest mean intensity was P. prionacis (80.4 200). The species richness of cestodes in P. glauca is very similar in other regions of the world despite its wide distribution; however, this richness is low compared with other species of sharks within the same family. The feeding and host-specific are important factors that influence the parameters of infection of cestodes in this shark. On the west coast of BCS, Prionace glauca feeds mainly on red crab Pleuroncodes planipes Stimpson, 1860; squids Gonatus californiensis Young, 1972, Ancistrocheirus lesueurii (D'Orbigny, 1842), Haliphron atlanticus Steenstrup, 1861, and low proportion of fish teleosts as Merluccius productus (Ayres, 1855), Sardinops sp. Hubbs, 1929 and Scomber japonicus Houttuyn, 1872. We speculate that these prey could be involved as the second intermediate hosts of these cestodes, as in other members of these genera, although the life cycles of none are known.

The parasitic fauna of the European bison (Bison bonasus) (Linnaeus, 1758) and their impact on the conservation. Part 1. The summarising list of parasites noted.

Science.gov (United States)

Karbowiak, Grzegorz; Demiaszkiewicz, Aleksander W; Pyziel, Anna M; Wita, Irena; Moskwa, Bożena; Werszko, Joanna; Bień, Justyna; Goździk, Katarzyna; Lachowicz, Jacek; Cabaj, Władysław

2014-09-01

During the current century, 88 species of parasites have been recorded in Bison bonasus. These are 22 species of protozoa (Trypanosoma wrublewskii, T. theileri, Giardia sp., Sarcocystis cruzi, S. hirsuta, S. hominis, S. fusiformis, Neospora caninum, Toxoplasma gondii, Cryptosporidium sp., Eimeria cylindrica, E. subspherica, E. bovis, E. zuernii, E. canadensis, E. ellipsoidalis, E. alabamensis, E. bukidnonensis, E. auburnensis, E. pellita, E. brasiliensis, Babesia divergens), 4 trematodes species (Dicrocoelium dendriticum, Fasciola hepatica, Parafasciolopsis fasciolaemorpha, Paramphistomum cervi), 4 cestodes species (Taenia hydatigena larvae, Moniezia benedeni, M. expansa, Moniezia sp.), 43 nematodes species (Bunostomum trigonocephalum, B. phlebotomum, Chabertia ovina, Oesophagostomum radiatum, O. venulosum, Dictyocaulus filaria, D.viviparus, Nematodirella alcidis, Nematodirus europaeus, N. helvetianus, N. roscidus, N. filicollis, N. spathiger, Cooperia oncophora, C. pectinata, C. punctata, C. surnabada, Haemonchus contortus, Mazamastrongylus dagestanicus, Ostertagia lyrata, O. ostertagi, O. antipini, O. leptospicularis, O. kolchida, O. circumcincta, O. trifurcata, Spiculopteragia boehmi, S. mathevossiani, S. asymmetrica, Trichostrongylus axei, T. askivali, T. capricola, T. vitrinus, Ashworthius sidemi, Onchocerca lienalis, O. gutturosa, Setaria labiatopapillosa, Gongylonema pulchrum, Thelazia gulosa, T. skrjabini, T. rhodesi, Aonchotheca bilobata, Trichuris ovis), 7 mites (Demodex bisonianus, D. bovis, Demodex sp., Chorioptes bovis, Psoroptes equi, P. ovis, Sarcoptes scabiei), 4 Ixodidae ticks (Ixodes ricinus, I. persulcatus, I. hexagonus, Dermacentor reticulatus), 1 Mallophaga species (Bisonicola sedecimdecembrii), 1 Anoplura (Haematopinus eurysternus), and 2 Hippoboscidae flies (Lipoptena cervi, Melophagus ovinus). There are few monoxenous parasites, many typical for cattle and many newly acquired from Cervidae.

Effects of 200 Gy 60Co-γ Radiation on the Regulation of Antioxidant Enzymes, Hsp70 Genes, and Serum Molecules of Plutella xylostella (Linnaeus).

Science.gov (United States)

Li, Xiaoxue; Luo, Lingyan; Karthi, Sengodan; Zhang, Ke; Luo, Jianjun; Hu, Qiongbo; Weng, Qunfang

2018-04-26

The diamondback moth, Plutella xylostella (Linnaeus), is one of the notorious pests causing substantial loses to many cruciferous vegetables across the nations. The effects of 60 Co-γ radiation on physiology of P. xylostella were investigated and the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella . First, in our research, we detected Oxidase system and stress response mechanism of irradiated pupae, the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella . The levels of superoxide dismutase (SOD) and catalase (CAT) were increased significantly in contrast the level of peroxidase (POD) and glutathione S-transferase (GST) were decreased in 12⁻24 h post-treatment. The heat shock proteins (Hsps) gene expression level was significant increasing, maximum > 2-folds upregulation of genes were observed in peak. However, they also had a trend of gradual recovery with development. Second, we detected the testis lactate dehydrogenase (LDH) and acid phosphatase (ACP) activity found that in male adults testis they increased significantly than control during its development. Thus the present research investigation highlights that the 60 Co-γ radiation treatments alters the physiological development of diamondback moth. The results showed that 200 Gy dosage resulted in stress damage to the body and reproductive system of the diamondback moth.

Absorbed Dose Rate Due to Intake of Natural Radionuclides by Tilapia Fish (Tilapia nilotica,Linnaeus, 1758) Estimated Near Uranium Mining at Caetite, Bahia, Brazil

International Nuclear Information System (INIS)

Pereira, Wagner de S; Kelecom, Alphonse; Azevedo Py Junior, Delcy de

2008-01-01

The uranium mining at Caetite (Uranium Concentrate Unit--URA) is in its operational phase. Aiming to estimate the radiological environmental impact of the URA, a monitoring program is underway. In order to preserve the biota of the deleterious effects from radiation and to act in a pro-active way as expected from a licensing body, the present work aims to use an environmental protection methodology based on the calculation of absorbed dose rate in biota. Thus, selected target organism was the Tilapia fish (Tilapia nilotica, Linnaeus, 1758) and the radionuclides were: uranium (U-238), thorium (Th-232), radium (Ra-226 and Ra-228) and lead (Pb-210). As, in Brazil there are no radiation exposure limits adopted for biota the value proposed by the Department of Energy (DOE) of the United States of 3.5x10 3 μGy y -1 has been used. The derived absorbed dose rate calculated for Tilapia was 2.51x10 0 μGy y -1 , that is less than 0.1% of the dose limit established by DOE. The critical radionuclide was Ra-226, with 56% of the absorbed dose rate, followed by U-238 with 34% and Th-232 with 9%. This value of 0.1% of the limit allows to state that, in the operational conditions analyzed, natural radionuclides do not represent a radiological problem to biota

ESPECIES DE DRYOPHTHORINAE (COLEOPTERA: CURCULIONIDAE ASOCIADAS A PLÁTANO Y BANANO (Musa spp. EN COLOMBIA

Directory of Open Access Journals (Sweden)

JOSE RUBIO-GOMEZ

2009-05-01

Full Text Available RESUMEN Se presenta una sinopsis de los escarabajos de la subfamilia Dryophthorinae (Coleoptera: Curculionidae asociados a cultivos de plátano y banano en Colombia. Adicionalmente se ofrecen claves ilustradas para las especies del país. Se registran seis especies asociadas a dichos cultivos: Cosmopolites sordidus (Germar, 1824, Metamasius hemipterus (Linnaeus, 1758, Metamasius hebetatus (Gyllenhal, 1838, Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758 y Polytus mellerborgii (Boheman, 1838. Palabras clave: picudos, plátano, banano, Polytus, Colombia. ABSTRACT This synopsis is about beetle’s subfamily Dryophthorinae (Coleoptera: Curculionidae associated to plantain and banana crops. Additionally keys illustrated for the species of the country are offered. Six species associated to these cultures are registered: Cosmopolites sordidus (Germar, 1824, Metamasius hemipterus (Linnaeus, 1758, Metamasius hebetatus (Gyllenhal, 1838, Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758 y Polytus mellerborgii (Boheman, 1838. Key words: weevils, plantain, banana, Polytus, Colombia.

Prevalence of Cryptosporidium spp. and other intestinal parasites in children with diarrhea

Directory of Open Access Journals (Sweden)

Mutalip Çiçek

2011-03-01

Full Text Available This study was planned to determine the role of Cryptosporidium sp. and other intestinal parasites in the diarrheal diseases in children with 0-15 years old Van district.Materials and methods: In this study, stool samples of 450 children were examined for parasites. In the study, nativ-lugol, formaldehyde-ethyl acetate sedimentation methods and trichrome staining methods were used to detect parasites in stool samples. Additionally, sedimentation methods and modified acid fast staining method were used to detect the Cryptosporidium oocysts.Results: Parasites were found in 154 (34.2% among 450 children’s with diarrhea. In this study; the ratios of parasites were as follow: Giardia intestinalis 13.5%, Blastocystis hominis 10%, Entamoeba coli 3.78%, Cryptosporidium spp. 2.2%, Hymenolepis nana 1.33 %ve Ascaris lumbricoides 1.11%.Entamoeba histolytica/Entamoeba dispar 0.89%, Chilomastix mesnili 1.78%, Iodamoeba butschlii 0.89%, Entamoeba hartmanni 0.89%, Trichomonas hominis 0.67%, Enteromonas hominis 0.67%,Conclusion: In the investigate, it was found that Giardia intestinalis and Blastocystis hominis were most prominent agents in children with diarrhea in our vicinity and Cryptosporidium spp also was an important agent which should be investigated carefully in especially risk group in routine laboratory studies.

Molecular epidemiology of Staphylococcus spp. contamination in the ward environment: study on mecA and femA genes in methicillin-resistant strains.

Science.gov (United States)

Ashimoto, A; Hamada, T; Adachi, A; Tanigawa, T; Tanaka, Y

1995-01-01

Staphylococcus spp. were isolated from the ward environment and antibiotic susceptibility tests were performed. Twenty-nine strains out of 274 isolates were S. aureus, and 41.4% of the S. aureus strains were methicillin resistant (MRSA). All 12 strains of MRSA were also resistant to oxacillin, ceftizoxime, ampicillin and clindamycin. Among the coagulase-negative staphylococci (CNS), methicillin-resistant (MR) strains of S. epidermidis, S. capitis, S. warneri, S. haemolyticus, S. hominis, S. auricularis, S. saprophyticus and S. cohnii were isolated. Eight of the 10 S. Haemolyticus strains were methicillin resistant. The femA gene was detected in S. aureus (MSSA and MRSA), but not in CNS by polymerase chain reaction (PCR) analysis and Southern blot analysis. The mecA gene was found in all the MRSA and MR-S. epidermidis strains tested, and one of the two MR-S. hominis strains, but not in MSSA, MS-S. epidermidis, MS-S. hominis, or MS-S. haemolyticus. DNA from one strain of MR-S. hominis and 2 strains of MR-S. haemolyticus was not amplified by PCR using the mecA gene primer, or hybridized by Southern blotting. The ambiguity that mecA was detected in some MR-CNS strains, but not in others is discussed.

Inhibition of lung cancer cells A549 and H460 by curcuminoid extracts and nanoemulsions prepared from Curcuma longa Linnaeus.

Science.gov (United States)

Chang, Hong-Bin; Chen, Bing-Huei

2015-01-01

The objectives of this study were to explore the inhibition mechanism of lung cancer cells A549 and H460 by curcuminoid extracts and nanoemulsions prepared from Curcuma longa Linnaeus. In addition, human bronchus epithelial cell line BEAS-2B (normal cell) was selected for comparison. A high-performance liquid chromatography (HPLC) method was developed to separate and quantify the various curcuminoids in C. longa extract, including curcumin (1,714.5 μg/mL), demethoxycurcumin (1,147.4 μg/mL), and bisdemethoxycurcumin (190.2 μg/mL). A high-stability nanoemulsion composed of Tween 80, water, and curcuminoid extract was prepared, with mean particle size being 12.6 nm. The cell cycle was retarded at G2/M for both the curcuminoid extract and nanoemulsion treatments; however, the inhibition pathway may be different. H460 cells were more susceptible to apoptosis than A549 cells for both curcuminoid extract and nanoemulsion treatments. Growth of BEAS-2B remained unaffected for both the curcuminoid extract and nanoemulsion treatments, with a concentration range from 1 to 4 μg/mL. Also, the activities of caspase-3, caspase-8, and caspase-9 followed a dose-dependent increase for both A549 and H460 cells for both the treatments, accompanied by a dose-dependent increase in cytochrome C expression and a dose-dependent decrease in CDK1 expression. Interestingly, a dose-dependent increase in cyclin B expression was shown for A549 cells for both the treatments, while a reversed trend was found for H460 cells. Both mitochondria and death receptor pathways may be responsible for apoptosis of both A549 and H460 cells.

Size and quality of wood used by Rosalia alpina (Linnaeus, 1758 (Coleoptera: Cerambycidae in beech woodlands of Gipuzkoa (northern Spain

Directory of Open Access Journals (Sweden)

CASTRO, A., MARTINEZ DE MURGUIA, L., FERNANDEZ, J., CASIS, A., MOLINO-OLMEDO, F.

2012-01-01

Full Text Available La conservación de la especie saproxilófaga legalmente protegida Rosalia alpina (Linnaeus, 1758 en los hayedos de Europa conlleva una gestión adecuada de los árboles muertos y moribundos. Sin embargo, los parámetros de los árboles preferidos (tamaño y calidad de la madera permanecen aún poco conocidos. En esta contribución se analizan los datos de distribución procedentes de seis años de trabajo en cuatro Lugares de Interés Comunitario de la provincia de Gipuzkoa (norte de España. Los individuos vivos de R. alpina y sus orificios de emergencia fueron registrados exclusivamente en hayas. 72 individuos vivos y 520 orificios fueron registrados en 77 árboles. Las evidencias de ocupación (presencia de individuos vivos o de orificios o de ambos fueron más frecuentes en troncos Ø > 25 cm de hayas en pie (tanto aún vivas como muertas que en ramas y árboles caídos y más delgados. Sin embargo, el número de orificios no mostró diferencias entre las clases de tamaño y la calidad de la madera de los troncos principales. Las ramas más gruesas (Ø > 15 cm registraron mayores tasas de presencia y número de orificios que las más finas. Conociendo los tipos de árboles más seleccionados, se sugiere la elaboración de un mapa regional de disponibilidad de hábitat como herramienta práctica para planificar estrategias de conservación.

The formulation of the essential oil of Piper aduncum Linnaeus (Piperales: Piperaceae) increases its efficacy as an insect repellent.

Science.gov (United States)

Mamood, S N H; Hidayatulfathi, O; Budin, S B; Ahmad Rohi, G; Zulfakar, M H

2017-02-01

The essential oil (EO) of Piper aduncum Linnaeus, known as 'sireh lada' to locals Malaysian, has the potential to be used as an alternative to synthetic insect repellents such as N,N-diethyl-meta-toluamide. However, the EO's efficacy as a repellent decreases after application due to the high volatility of its active ingredients. A number of studies have showed that optimizing the formulation of plant-based EOs can improve their efficacy as repellents. The present study sought to evaluate the effectiveness of 10% P. aduncum EO in ethanol and in three different semisolid formulations: ointment, cream and gel. These formulations were tested on Aedes aegypti under laboratory conditions. Each formulation was applied to the subject's hands, which were then inserted into a cage containing 25 nulliparous A. aegypti. The number of mosquitoes landing on or biting each subject's hand was recorded, and the repellency percentage, landing/biting percentage and protection time for each of the formulations were compared. There were no statistically significant differences between the semisolid EO formulations with regards to the repellency percentage and the landing/biting percentage at 4 h post-application. All three semisolid EO formulations were able to repel >65% of the A. aegypti at 4 h post-application. The EO ointment formulation provided a protection time (182.5 ± 16.01 min) that was statistically significantly longer than that associated with the EO gel formulation (97.5 ± 14.93 min). Meanwhile, the EO cream formulation provided a protection time of 162.5 ± 6.29 min. As the EO cream and ointment formulations displayed better repellent properties than the EO gel formulation, they appear to be the most promising P. aduncum EO formulations to be developed and commercialized as alternatives to synthetic repellents.

Spatially explicit genetic structure in the freshwater sponge Ephydatia fluviatilis (Linnaeus, 1759 within the framework of the monopolisation hypothesis

Directory of Open Access Journals (Sweden)

Livia Lucentini

2013-02-01

Full Text Available An apparent paradox is known for crustaceans, rotifers and bryozoans living in inland small water bodies: a potential for wide distribution due to the presence of resting stages is coupled with marked genetic differences between nearby water bodies, with enclave distributions masking clear phylogeographic patterns. According to the monopolisation hypothesis, this is due to the accumulation of resting stages, monopolising each water body. Freshwater sponges could represent a useful system to assess the generality of the mo- nopolisation hypothesis: these organisms i live in the same habitats as crustaceans, rotifers and bryozoans, ii produce resting stages that can accumulate, and iii have indeed a wide distribution. Currently, no studies on spatially explicit genetic differentiation on fresh- water sponges are available. The aim of the present study is to provide additional empirical evidence in support of the generality of the scenario for small aquatic animals with resting stages by analysing genetic diversity at different spatial scales for an additional model system, the freshwater sponge ephydatia fluviatilis (Linnaeus, 1759. We expected that system genetic variability would follow enclave distributions, no clear phylogeographical patterns would be present, and nearby unconnected water bodies would show markedly different populations for this new model too. We analysed the ribosomal internal transcribed spacer regions 5.8S-ITS2-28S, the D3 domain of 28S subunit, the mitochondrial Cytochrome c Oxidase I (COI and ten specific microsatellite markers of nine Italian and one Hungarian populations. Mitochondrial and nuclear sequences showed no or very low genetic polymorphism, whereas high levels of differentiation among populations and a significant polymorphism were observed using microsatellites. Microsatellite loci also showed a high proportion of private alleles for each population and an overall correlation between geographic and genetic

Facilitative and competitive interactions between sympatric cattle, red deer and wild boar in Dutch woodland pastures

NARCIS (Netherlands)

Kuiters, A.T.; Groot Bruinderink, G.W.T.A.; Lammertsma, D.R.

2005-01-01

Use of cattle-grazed and ungrazed woodland pastures by red deer Cervus elaphus Linnaeus, 1758 and wild boar Sus scrofa Linnaeus, 1758 was investigated monthly by measuring dung-deposition rates. Cattle Bos taurus grazed pastures year-round, with peak intensities during the growing season

Evaluación estacional de la riqueza y abundancia de especies de mamíferos en la Reserva Biológica Municipal "Mário Viana", Mato Grosso, Brasil

Directory of Open Access Journals (Sweden)

Ednaldo Cândido Rocha

2006-09-01

Full Text Available Estudiamos la fauna de mamíferos terrestres medianos y grandes, tomando en cuenta la riqueza y abundancia de las especies y la cantidad de individuos, en la Reserva Biológica Municipal "Mário Viana", Nova Xavantina, Mato Grosso, Brasil. Hicimos dos visitas mensuales durante todo el año 2001 en un transecto de 2 820 m de extensión, previamente preparado para la identificación de huellas. Identificamos 22 especies en la estación lluviosa y 18 de ellas también en la seca. Registramos Pseudalopex vetulus (Lund, 1842 (zorro, Eira barbara (Linnaeus, 1758 (hurón, Puma concolor (Linnaeus, 1771 (puma e Hydrochaeris hydrochaeris (Linnaeus, 1766 (capiguara durante la estación de lluvias. Según el procedimiento Jackknife, la riqueza de especies durante la estación seca (19.83, con intervalo de confianza (IC = 2.73 fue menor que durante la estación lluviosa (25.67, con IC= 3.43. Solamente cuatro mostraron índices de abundancia significativamente diferentes entre estaciones: Dasypus novemcinctus Linnaeus, 1758 (armadillo de nueve bandas, Euphractus sexcinctus (Linnaeus, 1758 (armadillo de seis bandas, Dasyprocta azarae Lichtenstein, 1823 (agutí y Tapirus terrestris (Linnaeus, 1758 (tapir. Por otro lado, Priodontes maximus (Kerr, 1792 (armadillo gigante y Leopardus pardalis (Linnaeus, 1758 (ocelote se destacaron por presentar un índice de abundancia idéntico entre las estaciones. La distribución de la abundancia de las especies en el área de muestreo, siguió más o menos el patrón esperado para las comunidades en equilibrio, especialmente en la estación lluviosa, evidenciando que el ambiente aún mantiene una buena calidad para la conservación de los mamíferos. El presente estudio mostró que la RBMMV, a pesar de ser pequeña (con aproximadamente 470 ha, desempeña un papel importante para la conservación de la mastofauna de la región, siendo un área de refugio en un ambiente con mucha influencia antrópica, principalmente por la cr

Ankara Vespidae (Insecta, Hymenoptera) Türleri Üzerine Faunistik Çalışmalar ve Ekolojik Gözlemler

OpenAIRE

TÜZÜN, Ayla; KEKİLLİOĞLU, Aysel

2003-01-01

Bu araştırma, 1998-2001 yılları arasında Türkiye’nin başkenti Ankara ili civarında yapılan arazi çalışmaları sonucunda elde edilen 683 örneğe dayanmaktadır. Çalışma sonucunda 4 cinse ait (Vespa, Vespula, Dolichovespula, Polistes ) 9 tür ve 1 alt tür; Vespa orientalis Linnaeus, 1771, Vespula (Paravespula) germanica (Fabricius, 1793), Vespula (Paravespula) vulgaris (Linnaeus, 1758), Dolichovespula (Metavespula) slyvestris (Scopoli, 1763), Polistes (s.str.) gallicus (Linnaeus, 1767), Polistes (s...

Observations on the behaviour of the Scarlet Ibis, Eudocimus ruber, in Artis Zoo, Amsterdam

NARCIS (Netherlands)

Spil, R.E.; Walstijn, van M.W.; Albrecht, H.

1985-01-01

The Scarlet Ibis, Eudocimus ruber (Linnaeus), fam. Threskiornithidae, is the closest relative of the White Ibis, Eudocimus albus (Linnaeus). The two species live in adjoining geographical areas. Nothing is known about the Scarlet Ibis’s breeding biology in the wild and only little about its breeding

Cangrejos Gecarcinidos (Crustacea; Gecarcinidae de Colombia Cangrejos Gecarcinidos (Crustacea; Gecarcinidae de Colombia

Directory of Open Access Journals (Sweden)

Prahl Henry von

1984-09-01

Full Text Available Diagnostic patterns and figures allow correct identifications of those crabs; also coloration, ecology and their distribution are given. The following crabs are reported for Colombia: Gecarcinus (Gecarcinus ruricola (Linnaeus, 1758, G. (G. lateralis lateralis (Freminville, 1835, G. (G. lateralis quadratus Saussure, 1835, G. (lohngarthia malpilensis Faxon, 1893, Cardisoma guanhumi Latreille, 1825, C. crassum Smith, 1870, Ucides cordatus cordatus (Linnaeus, 1763 and U. cordatus occidentalis. (Ortman, 1898. Se presentan diagnósticos sistemáticos y figuras, que permiten la correcta identificación de estos cangrejos, adicionando notas sobre su coloración, ecología, distribución general y distribución en Colombia.Se reportan las siguientes especies: Gecarcinus (Gecarcinus ruricola (Linnaeus, 1758, G. (G. lateralis lateralis (Freminville, 1835, G. (G. lateralis quadratus Saussure, 1835, G. (lohngarthia malpilensis Faxon, 1839, Cardisoma guanhumi Latreille, 1825, C. crassum Smith, 1870, Ucides cordatus cordatus (Linnaeus, 1763 y U. cordatus occidentalis (Ortman, 1898.   

Populations and home range relationships of the box turtle, Terrapene carolina (Linnaeus)

Science.gov (United States)

Stickel, L.F.

1949-01-01

A population study of Terrapene carolina (Linnaeus) was made at the Patuxent Research Refuge, Maryland, from 1944 to 1947. A thirty acre area in bottomland forest was selected for intensive study. Turtles were marked by filing notches in marginal scutes according to a code. Turtles make extensive use of brushy shelter during the day as well.as at night. Gully banks and woods openings are used for sunning. Nights are usually spent in a 'form,' constructed by the turtle in leaves, debris, or earth. A form may be used once or it may be used repeatedly by the same or different turtles. Weather conditions most favorable to turtle activity are high humidity, warm sunny days, and frequent rains. Periods of activity are alternated with periods of quiet, even in favorable weather. There is no evidence for territorialism. Ranges of turtles of all ages and both sexes overlap grossly. Turtles are frequently found near each other but no antagonistic behavior has been observed. Adult turtles occupy specific home ranges which they maintain from year to year. Turtles retained their ranges even though a flood that completely covered the study area. Maximum home range diameters were determined by measurements of the mapped ranges of individual turtles. There was no significant difference between sizes of male and female ranges: males 33O+ 26 feet, females 37O+29 feet. A trail-laying device was used in following travel routes for 456 turtle days. Normal movements within the home range are characterized by (1) turns, doublings, detours, and criss-crossing paths, (2) interspersion of fairly direct traverses of the home range, (3) frequently repeated travels over certain routes. Maximum limits of the home range are ordinarily reached within a few days or weeks, although some turtles cover only one portion of the range at a time. Some turtles have two home ranges. One of these turtles was followed with a trailer for 161 days in 1946 and 1947. Trips outside the home range are made by

Phenology of Spalangia endius Walker (Hymenoptera, Pteromalidae in pupae of Musca domestica Linnaeus (Diptera, Muscidae under laboratory conditions Fenologia de Spalangia endius Walker (Hymenoptera, Pteromalidae em pupas de Musca domestica Linnaeus (Diptera, Muscidae em condições de laboratório

Directory of Open Access Journals (Sweden)

Dani Furtado de Araújo

2012-12-01

Full Text Available This work describes the phenology of Spalangia endius Walker in pupae of Musca domestica Linnaeus under laboratory conditions. In order to understand the developmental cycle of Spalangia endius under laboratory conditions, 360 Musca domestica pupae aged from 24 to 48 hours were exposed to 15 S. endius pairs for a period of 24 hours at 26 ± 2ºC. These pupae were kept in a BOD incubator at the same temperature, with a relative humidity of Objetivando conhecer o ciclo de desenvolvimento de Spalangia endius sob condições de laboratório, 360 pupas de Musca domestica com idade de 24 a 48 horas foram expostas a 15 casais de S. endius por um período de 48 horas a 26 ± 2ºC. Estas pupas foram mantidas em BOD. Com mesma temperatura, umidade relativa <70% e com fotofase de 12 horas, onde diariamente dissecava-se 15 espécimes para avaliar o estágio e tempo de desenvolvimento do himenóptero. A fenologia permite concluir que S. endius apresenta um ciclo de desenvolvimento de 19 dias, cujo período de incubação foi de 24 horas, o desenvolvimento de larvas de S. endius ocorreu nos oito dias subsequentes nos quais uma série de alterações morfológicas foi observada. O estágio de pré-pupa deu-se no décimo dia onde cessa a movimentação e inicia a eliminação de mecônio. O estágio pupal ocorreu do décimo primeiro dia ao décimo nono, momento da emergência dos primeiros machos, já as fêmeas iniciaram a emergência aproximadamente 24 horas após. Estes resultados permitem avaliar aspectos da bionomia pormenorizada do desenvolvimento de S. endius para armazenar e programar a produção deste parasitóide, otimizando sua utilização como agente de controle biológico.

Absorbed Dose Rate Due to Intake of Natural Radionuclides by Tilapia Fish (Tilapia nilotica,Linnaeus, 1758) Estimated Near Uranium Mining at Caetité, Bahia, Brazil

Science.gov (United States)

Pereira, Wagner de S.; Kelecom, Alphonse; Py Júnior, Delcy de Azevedo

2008-08-01

The uranium mining at Caetité (Uranium Concentrate Unit—URA) is in its operational phase. Aiming to estimate the radiological environmental impact of the URA, a monitoring program is underway. In order to preserve the biota of the deleterious effects from radiation and to act in a pro-active way as expected from a licensing body, the present work aims to use an environmental protection methodology based on the calculation of absorbed dose rate in biota. Thus, selected target organism was the Tilapia fish (Tilapia nilotica, Linnaeus, 1758) and the radionuclides were: uranium (U-238), thorium (Th-232), radium (Ra-226 and Ra-228) and lead (Pb-210). As, in Brazil there are no radiation exposure limits adopted for biota the value proposed by the Department of Energy (DOE) of the United States of 3.5×103 μGy y-1 has been used. The derived absorbed dose rate calculated for Tilapia was 2.51×100 μGy y-1, that is less than 0.1% of the dose limit established by DOE. The critical radionuclide was Ra-226, with 56% of the absorbed dose rate, followed by U-238 with 34% and Th-232 with 9%. This value of 0.1% of the limit allows to state that, in the operational conditions analyzed, natural radionuclides do not represent a radiological problem to biota.

Absorbed dose rate due to intake of natural radionuclides by Tilapia fish (Tilapia nilotica, Linnaeus, 1758) estimated near uranium anomaly at Santa Quiteria, Ceara, Brazil

International Nuclear Information System (INIS)

Pereira, Wagner de; Kelecom, Alphonse; Py Junior, Delcy de Azevedo

2007-01-01

The uranium mining at Santa Quiteria (Santa Quiteria Unit - USQ) is in its environmental licensing phase. Aiming to estimate the radiological environmental impact of the USQ, a monitoring program is underway. However, radioprotection of biota is not explicitly mentioned in Brazilian norms. In order to preserve the biota of the deleterious effects from radiation and to behave in a pro-active way as expected by licensing organs, the present work aims to use an environmental protection methodology, based on the calculation of absorbed dose rate in biota. Thus, selected biomarker was the fish tilapia (Tilapia nilotica, Linnaeus, 1758) and the radionuclides were: uranium (U-238), thorium (Th-232), radium (Ra-226 and Ra-228) and lead (Pb-210). Since there are no exposition limits for biota, in Brazil, the value proposed by the Department of Energy (DOE) of the United States of 3.5 x 10 3 μGy/y has been used. The derived absorbed dose rate calculated for tilapia was 2.76 x 10 0 μGy/y, that is less than 0.1 % of the limit established by DOE. The critical radionuclide was U-238, with 99% of the absorbed dose rate. This value of 0.1% of the limit allows to state that in pre-operational conditions analyzed natural radionuclides do not represent a radiological problem to the biota. (author)

Absorbed dose rate due to intake of natural radionuclides by Tilapia fish (Tilapia nilotica, Linnaeus, 1758) estimated near uranium anomaly at Santa Quiteria, Ceara, Brazil

Energy Technology Data Exchange (ETDEWEB)

Pereira, Wagner de [Industrias Nucleares do Brasil S.A. (INB), Pocos de Caldas, MG (Brazil). Coordenacao de Protecao Radiologica. Unidade de Tratamento de Minerios], E-mail: wspereira@inb.gov.br; Kelecom, Alphonse [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Programa de Pos-graduacao em Ciencia Ambiental; Py Junior, Delcy de Azevedo [Industrias Nucleares do Brasil S.A. (INB), Caetite, BA (Brazil). Coordenacao de Protecao Radiologica. Unidade de Concentrado de Uranio], E-mail: Delcy@inb.gov.br

2007-07-01

The uranium mining at Santa Quiteria (Santa Quiteria Unit - USQ) is in its environmental licensing phase. Aiming to estimate the radiological environmental impact of the USQ, a monitoring program is underway. However, radioprotection of biota is not explicitly mentioned in Brazilian norms. In order to preserve the biota of the deleterious effects from radiation and to behave in a pro-active way as expected by licensing organs, the present work aims to use an environmental protection methodology, based on the calculation of absorbed dose rate in biota. Thus, selected biomarker was the fish tilapia (Tilapia nilotica, Linnaeus, 1758) and the radionuclides were: uranium (U-238), thorium (Th-232), radium (Ra-226 and Ra-228) and lead (Pb-210). Since there are no exposition limits for biota, in Brazil, the value proposed by the Department of Energy (DOE) of the United States of 3.5 x 10{sup 3} {mu}Gy/y has been used. The derived absorbed dose rate calculated for tilapia was 2.76 x 10{sup 0} {mu}Gy/y, that is less than 0.1 % of the limit established by DOE. The critical radionuclide was U-238, with 99% of the absorbed dose rate. This value of 0.1% of the limit allows to state that in pre-operational conditions analyzed natural radionuclides do not represent a radiological problem to the biota. (author)

Teknik budi daya larva Hermetia illucens (Linnaeus (Diptera: Stratiomyidae sebagai sumber protein pakan ternak melalui biokonversi limbah loading ramp dari pabrik CPO

Directory of Open Access Journals (Sweden)

Agustin Zarkani

2015-09-01

Full Text Available Larvae of Hermetia illucens fly (Linnaeus is an important source of alternative protein and can be used as pellets for feeds. Currently the production of H. illucens larvae is still limited because its rearing depends on palm kernel meal. The objective of the research is to explore alternative media for rearing, i.e. using loading ramp waste from crude palm oil factory. The study was conducted using physical-chemical analysis of the media. Evaluation of potential rearing media of loading ramp was done by studying the suitability of loading ramp fermented by EM4®, rumen microbes, and organic liquid fertilizer and without fermentation. Treatment media was develop with an enrichment ratio of 1 : 0.25, 1 : 05, and 1 : 1 (v/v for bran and husk, and 1.25, 2.5, and 5% (w/w for coconut sugar. Each experiment was arranged in complete randomized design using 20 larva of the 2nd instar. Larvas were incubated in plastic with tube with diameter of 10 cm and 20 cm in height containing of media 300 g. Response differences in growth and mortality were analyzed by ANOVA and least significant differences test at 0.05 levels. Preference and analysis suitability of the media were conducted using material enrichment. Results show that the loading ramp waste contain 9.80% protein and 10.32% fat. Although the media are could support growth and development of the larvae at different degree, media from waste fermentation POC loading ramp with bran enrichment 1 : 0.5 (v/v is the best media for rearing larva.

Some aspects on the reproductive cycle of European conger eel, Conger conger (Linnaeus, 1758 (Osteichthyes, Anguilliformes, Congridae captured from Western Algerian coasts: a histological description of spermatogenesis

Directory of Open Access Journals (Sweden)

Abi-ayad Sidi-Mohammed El-Amine

2011-09-01

Full Text Available The aim of this work was to study the annual reproductive cycle of European conger eel (Conger conger,Linnaeus, 1758 through analysis and description of spermatogenesis. A sample of 168 males was capturedbetween September 2008 and August 2009 from the Western coast of Algeria, from Béni Saf. Fish length andweight varied between 26.20-112 cm and 0.45-3.44 kg, respectively.Condition factors (K, gonadosomatic index (G.S.I. and hepatosomatic index (H.S.I. were calculatedmonthly. Factor K reached the minimum in August/September (0.10% corresponding to reproductive periodand a maximum in January (0.18%. Although G.S.I. values revealed to be statistically not significant, therewere two peaks for G.S.I., the first in March, denoting the beginning of spermatogenesis, and the second inAugust/September, indicating the reproduction period. H.S.I. reached a peak in December (1.90%, then thevalue decreased to a minimum in April.Histological analysis of testis allowed us to distinguish 5 stages summarized as follows: Stage 1:Spermatogonia A; Stage 2: Spermatogonia B; Stage 3: Spermatocytes and spermatids; Stage 4: Spermatocytes,spermatids and spermatozoa (cytodifferentiation of spermatids into spermatozoa; Stage 5: Spermatozoa(spermiogenesis or cytodifferentiation of spermatids into spermatozoa.

Una nueva especie de Meloe Linnaeus, 1758 del suroeste de Marruecos incluida en el grupo de M. (Eurymeloe rugosus Marsham, 1802 (Coleoptera: Meloidae

Directory of Open Access Journals (Sweden)

Ruiz, José L.

2015-06-01

Full Text Available The scientific collections of the Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid hold an extense set of entomological materials collected in Morocco along the first decades of the XXth century by the preeminent naturalist M. Martínez de la Escalera. Morphological studies of the specimens of the genus Meloe Linnaeus, 1758 (Coleoptera: Meloidae reveals the existence of populations morphologically differentiated along the coastal regions of Essaouira and Ifni. These populations are included within the Meloe rugosus Marsham, 1802 species group in the subgenus Eurymeloe Reitter, 1911. Their differential traits with respect to all other North African and European species of the Meloe rugosus species group are constant, and permit considering these populations as a taxonomic independent unit described herein, Meloe baamarani n. sp. This new species is characterized by having a black, opaque, general coloration all over the body and appendages; black short vestiture; broad head with broadly rounded temples, without median longitudinal groove; long antennae, with segments III to VIII subcylindrical and longer than wide; pronotum transverse, with convergent sides toward the base, without median groove; head and pronotum punctuation dense; aedeagus narrow, median lobe wide and strong, dorsally sinuous, with ventral hooks close to the apex. Meloe baamarani can be only confused on the western regions of northern Africa with Meloe mediterraneus Müller, 1925. This species shares a general appearance with M. baamarani, but differs in many morphological traits. Among those, tegument micro-reticulation, absence of median groove along the head, pronotum morphology and macrosculpture, and configuration of the male genitalia, are included.Las colecciones científicas del Museo Nacional de Ciencias Naturales (MNCN-CSIC, Madrid albergan un extenso material entomológico recogido en Marruecos a principios del siglo XX por el insigne naturalista M. Mart

THE NUTRITION OF A PIKEPERCH, Stizostedion lucioperca Linnaeus, 1758 in THE RIVER NERETVA

Directory of Open Access Journals (Sweden)

Sadbera Trožić-Borovac

2007-04-01

., 1976; T r o ž i ć – B o r o v a c, 2002a, it could be concluded that a pikeperch has no competitor. The other fish species have fed on the invertebrates and plants of benthos, accept a rare lake trout Salmo trutta m. lacustris Linnaeus, 1758 specimens which have shown tendency to the greedy way of the nutrition. This paper is the contribution to the knowledge of a pikeperch nutrition in the river Neretva accumulations that is, beside the reproduction, the important character of population growth control of this greedy animal, and in the aim of the survival of the autochthonous ichthyopopulations in the river Neretva system.

Noteworthy bird records at Lagoa Santa, southeastern Brazil Registros notáveis de aves em Lagoa Santa, sudeste do Brasil

Directory of Open Access Journals (Sweden)

Marcos Rodrigues

2008-03-01

Full Text Available Lagoa Santa, a small town in southeastern Brazil where naturalist Peter Lund lived, is regarded nowadays as an important historical site for the biological sciences. From 1847 to 1855, J.T. Reinhardt, hosted by Lund, collected 343 bird species. This material is an outstanding reference for many modern ornithological studies. The present paper reports the occurrence of some rare and threatened birds for the region of Lagoa Santa between 1998 and 2005. In this account I list the Rusty-margined Guan Penelope superciliaris Temminck, 1815; the Roseate Spoonbill Platalea ajaja Linnaeus, 1758; the Maguari Stork Ciconia maguari (Gmelin, 1789; the Wood Stork Mycteria americana Linnaeus, 1758; the Black Hawk-eagle Spizaetus tyrannus (Wied, 1820 and the Turquoise-fronted Parrot Amazona aestiva (Linnaeus, 1758. It is also reported the southernmost record for the Blue-and-yellow Macaw Ara ararauna (Linnaeus, 1758 and the range extension of the Crowned Slaty flycatcher Griseotyrannus aurantioatrocristatus (d'Orbigny and Lafresnaye, 1837. These data can be used as a baseline for studies of colonization and extinction.Lagoa Santa, cidade onde viveu Peter Lund é um dos sítios de maior importância histórica para as ciências biológicas. Durante os anos de 1847 e 1855, J.T. Reinhardt, a convite de Lund, coletou 343 espécies de aves que são hoje referência para vários estudos ornitológicos. O presente artigo relata a ocorrência de algumas aves raras e/ou ameaçadas para a região de Lagoa Santa, entre 1998 e 2005. A lista de espécies inclui a jacupemba Penelope superciliaris Temminck, 1815, o colhereiro Platalea ajaja Linnaeus, 1758, a maguari Ciconia maguari (Gmelin, 1789, a cabeça-seca Mycteria americana Linnaeus, 1758, o gavião-pega-macaco Spizaetus tyrannus (Wied, 1820; e o papagaio-verdadeiro Amazona aestiva (Linnaeus, 1758. Relata-se também a ocorrência mais meridional da arara-canindé Ara ararauna (Linnaeus, 1758, e a expansão da distribui

DYNAMICS OF PIKE (ESOX LUCIUS LINNAEUS, 1758 AGE STRUCTURE IN THE DNIEPER LOWER REACHES IN CONNECTION WITH FISHING

Directory of Open Access Journals (Sweden)

K. Geina

2015-03-01

Full Text Available Purpose. To analyze the dynamics of pike (Esox luceus Linnaeus, 1758 age structure of the Dnieper lower reaches in conditions of the modification of fishing pressure. Methodology. An analysis of fishing situation has been performed based on data of official fishery statistics. Fish sampling was done at control-observation posts of the Institute of Fisheries of the NAAS of Ukraine and directly in the fishery. Juvenile fish yield was determined using a complex of fry fishing gears using a stationary net-station. Field and cameral processing of the material was performed using generally accepted methods. Findings. A retrospective analysis of the situation in the Dnieper-Bug lower reach system clearly indicates on the presence of continuous tendency of catch decline of representative of native fish fauna – pike. With relatively uniform indices of the “yield” of its juveniles before Dnieper flow impoundment and in conditions of present time, its commercial catches significantly dropped. The dynamics of pike current age structure indicates on an increase of relative density of age groups, which form the recruitment of the commercial portion of the population (1-1+ and a decrease of importance of the component of the right side of age series. A discrepancy between the observed changes of the age group and commercial harvest quantities indicates on increased human pressure on this species. Originality. For the first, we analyzed the dynamics of fish juvenile “yield” and age structure of pike commercial stock of the Dnieper lower reaches in the river flow transformation process. Practical value. A decrease of the ichthyomass of piscivorous fishes in the Dnieper lower reaches results in changes of fish populations of littoral biotopes towards the prevalence of the dominance of coarse species that lead to a deterioration of forage availability for a number of valuable commercial species. An increase of the number of pike can regulate the strain

Evaluation of architectural and histopathological biomarkers in the intestine of brown trout (Salmo trutta Linnaeus, 1758) challenged with environmental pollution.

Science.gov (United States)

Barišić, Josip; Filipović Marijić, Vlatka; Mijošek, Tatjana; Čož-Rakovac, Rozelindra; Dragun, Zrinka; Krasnići, Nesrete; Ivanković, Dušica; Kružlicová, Dáša; Erk, Marijana

2018-06-14

In the present study novel histopathological approach, using fish intestine as a sensitive bioindicator organ of pollution impact in the freshwater ecosystem, was proposed. Histopathological alterations were compared between native brown trout (Salmo trutta Linnaeus, 1758) from the reference (Krka River spring) and pollution impacted location (influence of technological/municipal wastewaters and agricultural runoff near the Town of Knin) of the karst Krka River in Croatia. In brown trout from both locations, severe parasitic infestation with acanthocephalan species Dentitruncus trutae was found, enabling evaluation of acanthocephalan infestation histopathology, which indicated parasite tissue reaction in a form of inflammatory, necrotic and hyperplastic response that extended throughout lamina epithelialis mucosae, lamina propria, and lamina muscularis mucosae. New semi-quantitative histological approach was proposed in order to foresee alterations classified in three reaction patterns: control tissue appearance, moderate (progressive) tissue impairment and severe (regressive and inflammatory) tissue damage. The most frequent progressive alteration was hyperplasia of epithelium on the reference site, whereas the most frequent regressive alterations were atrophy and necrosis seen on the polluted site. Furthermore, histopathological approach was combined with micromorphological and macromorphological assessment as an additional indicator of pollution impact. Among 15 observed intestinal measures, two biomarkers of intestinal tissue damage were indicated as significant, height of supranuclear space (hSN) and number of mucous cells over 100 μm fold distance of intestinal mucosa (nM), which measures were significantly lower in fish from polluted area compared to the reference site. Obtained results indicated that combined histological and morphological approach on fish intestinal tissue might be used as a valuable biological tool for assessing pollution impact on

Detecting of Mycoplasma genitalium in male patients with urethritis symptoms in Turkey by polymerase chain reaction

International Nuclear Information System (INIS)

Dolapci, Istar; Tekeli, Alper; Ozsan, Murat; Elhan, Atilla; Yaman, Onder; Ergin, Sureyya

2005-01-01

The aim of this study was to investigate the incidence of Mycoplasma genitalium in the urine samples of 63 male patients who had urethritis symptoms. Along with Neisseria gonorrhoeae (N. gonorrhoeae) and Chlamydia trachomatis (C. trachomatis). We also investigated Mycoplasma hominis (M. hominis) and Ureaplasma urealyticum (U. urealyticum), both of which are known to cause urethritis. Microorganisms were investigated in urine samples of the patients with polymerase chain reaction. The study was conducted between September 2003 - February 2004 at the Department of Microbiology and Clinical Microbiology Ankara University School of Medicine, Ankara, Turkey. A total of 63 urine samples were analyzed and 6 (9.52%) patients had N. gonorrhoeae, 4 (6.34%) had C. trachomatis, while 4 (6.34%) urines were positive in terms of M. genitalium. Nevertheless, 3 (4.76%) patients had U. urealyticum and 2 (3.17%) patients had M. hominis. One urine sample was positive in terms of both N. gonorrhoeae and U. urealyticum, and another urine sample was positive in terms of both M. hominis and U. urealyticum. The results were compared with the control group and found no statistically significant difference. Mycoplasma species are found in normal flora of urogenital system and also as an agent of urogenital infection. In our study, we found low microorganism rates when compared with Europe and America. This difference may be due to the conservative sexual behavior in Turkey. (author)

[The distribution of intestinal parasites in people admitted to the Yüzüncü Yıl University Parasitology Laboratory of Health Research and Training Hospital, in 2009].

Science.gov (United States)

Yılmaz, Hasan; Taş-Cengiz, Zeynep; Ceylan, Abdulkadir; Ekici, Abdurrahman

2012-01-01

This study was performed to present the distribution of intestinal parasites in parients admitted to the Parasitology Laboratory of the Health Research and Training Hospital of Yüzüncü Yıl University in 2009. A total of 6267 patients (3037 female, 3230 male; 3798 of 13 years and under, 2469 of 14 years and over) were included. The stool samples were examined by native-Lugol, flotation and sedimentation methods in the Parasitology Laboratory of the hospital. Trichrome and modified acid-fast staining methods were also applied to suspicious stools. One or more than one parasite species were found in 28.5% of 6267 examined stool samples. Parasitosis was determined in 28% of female and 29% of male. Distribution of the parasites determined in the patients was as follows: 15.4% Blastocystis hominis, 6.6% Giardia intestinalis, 4.9% Entamoeba coli, 3.2% plenty B. hominis, 1.7% Chilomastix mesnili, 1.3% Hymenolepis nana, 0.7% Iodamoeba butschlii, 0.5% Ascaris lumbricoides, 0.1% Entamoeba histolytica/Entamoeba dispar, 0.1% Endolimax nana, 0.1% Enteromonas hominis, 0.1% Trichomonas hominis, 0.1% Cyclospora cayetanensis, 0.1% Enterobius vermicularis, 0.03% Entamoeba hartmanni, 0.03% Dicrocoelium dendriticum,0.03% Taenia saginata and 0.02% Trichuris trichiura. This research shows that the intestinal parasitosis problem still continues in the province.

Effects of 200 Gy 60Co-γ Radiation on the Regulation of Antioxidant Enzymes, Hsp70 Genes, and Serum Molecules of Plutella xylostella (Linnaeus

Directory of Open Access Journals (Sweden)

Xiaoxue Li

2018-04-01

Full Text Available The diamondback moth, Plutella xylostella (Linnaeus, is one of the notorious pests causing substantial loses to many cruciferous vegetables across the nations. The effects of 60Co-γ radiation on physiology of P. xylostella were investigated and the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella. First, in our research, we detected Oxidase system and stress response mechanism of irradiated pupae, the results displayed that 200 Gy irradiation significantly alters the antioxidant enzyme regulation in six-day-old male pupae of P. xylostella. The levels of superoxide dismutase (SOD and catalase (CAT were increased significantly in contrast the level of peroxidase (POD and glutathione S-transferase (GST were decreased in 12–24 h post-treatment. The heat shock proteins (Hsps gene expression level was significant increasing, maximum > 2-folds upregulation of genes were observed in peak. However, they also had a trend of gradual recovery with development. Second, we detected the testis lactate dehydrogenase (LDH and acid phosphatase (ACP activity found that in male adults testis they increased significantly than control during its development. Thus the present research investigation highlights that the 60Co-γ radiation treatments alters the physiological development of diamondback moth. The results showed that 200 Gy dosage resulted in stress damage to the body and reproductive system of the diamondback moth.

Estudio de patógenos implicados en enfermedades de transmisión sexual: Sensibilidad antibiótica. Genotipado y detección de cepas de linfogranuloma venéreo

OpenAIRE

Maulide Cane, Réka

2014-01-01

Trabajo fin de máster en Medicina Tropical y Salud Internacional Objetivo: El objetivo principal del presente trabajo es el estudio del porcentaje de casos de infección por Chamydia trachomatis (C. trachomatis), Neisseria gonorrhoeae (N. gonorrhoeae), Mycoplasma hominis (Mycoplasma hominis) y Ureaplasma urealyticum (U. urealyticum) y la determinación de la resistencia antibiótica a N. gonorrhoeae en muestras de pacientes que acudieron a consultas de la Fundación Jiménez Díaz durante el per...

The Clinical Study about Honilirls Placenta Herbal Acupuncture on Bell's Palsy

Directory of Open Access Journals (Sweden)

Lee Chae-Woo

2005-12-01

Full Text Available Objectives : This study has been designed and performed to identify the effect on Bell's palsy according to the injection of herbal medicine induced from the Hominis Placenta. Methods : We measured the facial palsy changes of the patients who were admitted for Bell's palsy in the Oriental Medical hospital of Dongeui medical center from 03-01-2004 to 07-31-2004. Bell's palsy patients were divided into two groups. One group(A group was injected with Hominis Placenta herbal acupuncture. The other group(B group was injected with normal saline. Then effects of these treatment was evaluated by Yanagihara's unweighted grading system. Results : A group was marked more higher than B group in treatment outcome. we discovered that it is significant differences between two groups after 4 week. Conclusions : These results provided that A group is more effective than B group. For clearly proving the effect of Hominis Placenta herbal acupuncture on Bell's palsy, it is need more sample's number and more treatment's duration.

Influence of water infusion of medicinal plants on larvae of Strongyloides papillosus (Nematoda, Strongyloididae

Directory of Open Access Journals (Sweden)

A. A. Boyko

2016-08-01

Full Text Available One of the most common nematodes of ruminants is Strongyloides papillosus (Wedl, 1856. Disease caused by these parasites brings economic losses to livestock operations. Therefore it is necessary to control their numbers. The eggs and three larval stages of S. papillosus live in the environment, while the fourth, fifth and mature individuals live in host organisms. Control of these parasites is necessary at all stages of development, including the free-living stage. An experiment on changes in the number strongiloids under the influence of environmental factors was carried out using aqueous extracts of medicinal plants. In the laboratory experiment we researched the effect on the survival of invasive and noninvasive types of S. papillosus larvae of 24 hours exposure at different doses to Artemisia absinthium Linnaeus, 1753, Artemisia annua Linnaeus, 1753, Echinacea purpurea (Linnaeus, 1753 Moench, 1794, Matricaria chamomilla Linnaeus, 1753, Tanacetum vulgare Linnaeus, 1753, Salvia sclarea Linnaeus, 1753, Levisticum officinale W.D.J. Koch, 1824, Petroselinum crispum (Miller, 1768 Nyman ex A.W. Hill, 1925. The death of 50% of S. papillosus invasive larvae was registered at 464 ± 192 mg/l concentration of aqueous extract of S. sclarea inflorescences. The greatest effect up-on the non-invasive larvae was caused by aqueous extracts of inflorescences of S. sclarea, M. chamomilla and seeds of P. crispum: at concentrations of 327 ± 186, 384 ± 155 and 935 ± 218 mg/l, respectively, 50% of non-invasive larvae died. According to the results of the research, we suggest further study of the nematocidal activity of combinations, contained in the aboveground parts, of clary sage (S. sclarea, camomile (M. chamomilla and seeds of parsley (P. crispum, and also experimental usage of these species in the fodder compound for cattle, sheep, goats and pigs on experimental farms.

Avaliação de inseticidas no controle de Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae e Rhyzopertha dominica (Fabricius (Coleoptera, Bostrichidae em trigo armazenado Efficacy of insecticides to control Sitophilus oryzae (Linnaeus (Coleoptera, Curculionidae and Rhyzopertha dominica (Fabricius (Coleoptera, Bostrichidae in stored wheat

Directory of Open Access Journals (Sweden)

Rui S. Furiatti

1999-03-01

Full Text Available The efficiency of insecticides against Sitophilus oryzae (Linnaeus, 1763 (Coleoptera, Curculionidae and Rhyzopertha dominica (Fabricius, 1792 (Coleoptera, Bostrichidae was determined exposing them to treated wheat in laboratory. Each plot, which was composed by 1.2 kg of wheat grain, was treated with 5 ml of the concentration/kg of wheat using a propelling air atomizer. Fifteen days after treatment 50 g samples of the grain were taken, from each plot, placed in plastic jars into which 10 adult insects of each species were released. This was repeated every 30 days until 165 days after treatment. The number of dead insects was counted 15 days after each infestation thus the evaluations were made at 30, 60, 90, 120, 150 and 180 days after the insecticide application. Esfenvalerate+fenitrothion+pyperonil butoxide (0,375+7,5+3,0 and 0,5+10,0+4,0 g a.i./t, fenitrothion+esfen-valerate (7,5+0,375 and 10,0+0,375 g a.i./t, fenitrothion+synergised deltamethrin (7,5+0,375 g a.i./t and fenitrothion (7,5 g a.i./t were effective against Sitophilus oryzae until 180 days after treatment. Esfenvalerate+fenitrothion+pyperonil butoxide (0,5+10,0+4,0 g a.i./t, fenitrothion+esfenvalerate (7,5+0,375 and 10,0+0,375 g a.i./t, fenitrothion+synergised deltamethrin (7,5+0,375 g a.i./t were effective against R. dominica until 180 days after treatment. Synergised deltamethrin (0,375 g a.i./t was effective against S. oryzae until 150 days and against R. dominica until 120 days after treatment. Esfenvalerate (0,5 g a.i./t was ineffective against S. oryzae and effective until 60 days after treatment against R. dominica. Fenitrothion (7,5 g a.i./t was ineffective against R. dominica. The use of mixtures of organophosphorus plus pyrethroids were more effective against S. oryzae and R. dominica when compared with these insecticides used alone.

Ecologia da comunidade de metazoários parasitos da anchova Pomatomus saltator (Linnaeus (Osteichthyes, Pomatomidae do litoral do estado do Rio de Janeiro, Brasil Community ecology of metazoan parasites of bluefish Pomatomus saltator (Linnaeus (Osteichthyes, Pomatomidae from the littoral of State of Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

José Luis Luque

1999-01-01

Full Text Available Fifty-five specimens of bluefish, Pomatomus saltator (Linnaeus, 1766, collected at Cabo Frio (23ºS, 42ºW, State of Rio de Janeiro, Brazil, between March 1995 and November 1995, were necropsied to study their infracommunities of metazoan parasites. Sixteen species of metazoan parasites were collected. All fish were parasitized by one or more metazoan. The digeneans were the majority of the parasite specimens collected, with 44.2%, followed by the helminth larval stages (cestodes, acanthocephalans, and nematodes with 40.6%. The Simpson index for all parasite species was 0.097, indicating lack of dominance by any species in the parasite community. Microcotyle pomatomi Goto, 1899 showed the higher frequency of dominance and mean relative dominance. The parasite species of P. saltator showed the typical overdispersed pattern of distribution. The majority of parasite species showed positive correlation between the host's total body length and prevalence or parasite abundance. Two species, Brachyphallus parvus (Manter, 1947 and Phocanema sp. have differences in their prevalences and abundances in relation to sex of the hosts. The mean diversity in the infracommunities of P. saltator was H'=1.243±0.521, with correlation with the host's total length and without difference between male and female fish. The components of the parasite community of P. saltator showed overall positive association. All pairs confonned by ectoparasites and adult endoparasites species showed signiticant positive association or covariation between their abundances. Five pairs of endoparasites larval species showed positive association or covariation, and two pairs, showed negative association and covariation. The parasite community of P. saltator was dominated by species with high prevalence values, that composed a high number of associations, thus, is considered closer to the interactive type.

Return to Glacier Bay

Science.gov (United States)

Bodkin, James L.

2003-01-01

Seven species of pigeons and doves were cultured for yeasts in the upper digestive tract. The following list gives the isolation rate for each columbid species and the yeasts cultured from them: feral pigeon Columba Livia (Gmelin) 95% -Candida albicans (Robin) Berkhout, C. tropicalis (Castellani) Berkhout, C. krusei (Cast.) Berkhout, C. guilliermondii (Cast.) Langeron et Guerra, Torulopsis glabrata (Anderson) Lodder et De Vries, Saccharomyces telluris Van der Walt, and Geotrichum sp.; white-crowned pigeon (C. leucocephala Linnaeus) 56% -- S. telluris; mourning dove (Zenaidura rnacroura Linnaeus) 24% -- C. albicans, C. tropicalis, C. guilliermondii, and Geotrichurn sp.; passerine ground dove (Collumbigallina passerina Linnaeus) 20% -- C. parapsilosis (Ashford) Langeron et Talice, Kloeckera apiculata (Reess Emend. Klocker) Janke; zenaida dove (Zenaida aurita Temminck) 16% -- C. albicans, C. guilliermondii, and T. glabrata; one moustasche dove (Geotrygon mystacea Gosse) -- C. guillierrnondii; ringed turtle dove (Streptopelia rizoria Linnaeus) 14% -- C. albicans and Geotrichurn sp. No signs of disease could be seen in the 139 birds that were examined, and it was concluded that these yeasts comprise a part of the columbid's normal microbial flora.

Larvicidal Potential of the Halogenated Sesquiterpene (+)-Obtusol, Isolated from the Alga Laurencia dendroidea J. Agardh (Ceramiales: Rhodomelaceae), against the Dengue Vector Mosquito Aedes aegypti (Linnaeus) (Diptera: Culicidae)

Science.gov (United States)

Salvador-Neto, Orlando; Gomes, Simone Azevedo; Soares, Angélica Ribeiro; Machado, Fernanda Lacerda da Silva; Samuels, Richard Ian; Nunes da Fonseca, Rodrigo; Souza-Menezes, Jackson; Moraes, Jorge Luiz da Cunha; Campos, Eldo; Mury, Flávia Borges; Silva, José Roberto

2016-01-01

Dengue is considered a serious public health problem in many tropical regions of the world including Brazil. At the moment, there is no viable alternative to reduce dengue infections other than controlling the insect vector, Aedes aegypti Linnaeus. In the continuing search for new sources of chemicals targeted at vector control, natural products are a promising alternative to synthetic pesticides. In our work, we investigated the toxicity of a bioactive compound extracted from the red alga Laurencia dendroidea J. Agardh. The initial results demonstrated that crude extracts, at a concentration of 5 ppm, caused pronounced mortality of second instar A. aegypti larvae. Two molecules, identified as (−)-elatol and (+)-obtusol were subsequently isolated from crude extract and further evaluated. Assays with (−)-elatol showed moderate larvicidal activity, whereas (+)-obtusol presented higher toxic activity than (−)-elatol, with a LC50 value of 3.5 ppm. Histological analysis of the larvae exposed to (+)-obtusol revealed damage to the intestinal epithelium. Moreover, (+)-obtusol-treated larvae incubated with 2 µM CM-H2DCFDA showed the presence of reactive oxygen species, leading us to suggest that epithelial damage might be related to redox imbalance. These results demonstrate the potential of (+)-obtusol as a larvicide for use against A. aegypti and the possible mode of action of this compound. PMID:26821032

Methicillin resistance of airborne coagulase-negative staphylococci in homes of persons having contact with a hospital environment.

Science.gov (United States)

Lis, Danuta O; Pacha, Jerzy Z; Idzik, Danuta

2009-04-01

The persons having contact with a hospital environment (hospital personnel workers and discharged patients) are highly exposed to colonization with multidrug-resistant bacteria. The aim of this study was to evaluate the airborne Staphylococcus genus features in homes in which inhabitants have had contact with the hospital environment. Airborne bacteria were collected using a 6-stage Anderson impactor. The Staphylococcus species composition and resistance to methicillin, and other antimicrobial agents among 3 coagulase-negative staphylococci (CNS) species (S cohnii spp cohnii, S epidermidis, S hominis), were determined. Antibiotic resistance of isolates was tested using the agar screen method with methicillin, the polymerase chain reaction technique to detect the mecA gene, and the disk diffusion method. A higher prevalence of methicillin-resistant (MR) strains among the species isolated (40% of S epidermidis, 40% of S hominis, and 60% of S cohnii spp cohnii) was found in homes of persons who had contact with a hospital environment compared with the reference homes (only 12% of S hominis). The mecA gene was revealed in all MR S epidermidis strains and in some MR S hominis (50%) and S cohnii spp cohnii (33%) strains. All isolated MR CNS strains were susceptible to vancomycin, rifampicin, and linezolid. High numbers of airborne multidrug-resistant MR CNS in the homes of persons having contact with a hospital environment indicates that such inhabitants pose a risk of intrafamilial spreading of MR strains via air.

Mycoplasma and ureaplasma infection and male infertility: a systematic review and meta-analysis.

Science.gov (United States)

Huang, C; Zhu, H L; Xu, K R; Wang, S Y; Fan, L Q; Zhu, W B

2015-09-01

The relationship between mycoplasma and ureaplasma infection and male infertility has been studied widely; however, results remain controversial. This meta-analysis investigated the association between genital ureaplasmas (Ureaplasma urealyticum, Ureaplasma parvum) and mycoplasmas (Mycoplasma hominis, Mycoplasma genitalium), and risk of male infertility. Differences in prevalence of ureaplasma and mycoplasma infection between China and the rest of the world were also compared. Study data were collected from PubMed, Embase and the China National Knowledge Infrastructure. Summary odds ratio (OR) with 95% confidence interval (CI) was applied to assess the relationship. Heterogeneity testing and publication bias testing were also performed. A total of 14 studies were used: five case-control studies with 611 infertile cases and 506 controls featuring U. urealyticum infection, and nine case-control studies with 2410 cases and 1223 controls concerning M. hominis infection. Two other infection (U. parvum and M. genitalium) were featured in five and three studies, respectively. The meta-analysis results indicated that U. parvum and M. genitalium are not associated with male infertility. However, a significant relationship existed between U. urealyticum and M. hominis and male infertility. Comparing the global average with China, a significantly higher positive rate of U. urealyticum, but a significantly lower positive rate of M. hominis, was observed in both the infertile and control groups in China. © 2015 American Society of Andrology and European Academy of Andrology.

A checklist of butterflies of Dakshina Kannada District, Karnataka, India

Directory of Open Access Journals (Sweden)

Deepak Naik

2016-10-01

Full Text Available In a preliminary study on the butterflies of Dakshina Kannada District, located in the southwestern part of the Karnataka along the Western Ghats in Karnataka State in India, a total of 172 species of butterflies belonging to 117 genera, from six families was prepared by visiting various landscapes during the period September 2012 to December 2015.  Of the various species recorded, Papilio clytia (Linnaeus, Papilio lio medon (Moore, Pachlio ptahector (Linnaeus, Castalius rosimon (Fabricius, Acytolepis puspa (Horsefield, Lethe europa (Fabricius, Neptis jumbah (Moore, Dophlae velina (Stoll, Hypolimnas misippus (Linnaeus and Doleschallia bisaltide (Cramer comes under the Schedule I of the Indian Wildlife Protection Act 1972.  The present study provides the baseline data of butterfly species of Dakshina Kannada. 

Detection and differentiation of Cryptosporidium by real-time polymerase chain reaction in stool samples from patients in Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Roberta Flávia Ribeiro Rolando

2012-06-01

Full Text Available This study reports the first genetic characterisation of Cryptosporidium isolates in Brazil using real-time polymerase chain reaction (RT-PCR. A total of 1,197 faecal specimens from children and 10 specimens from human immunodeficiency virus-infected patients were collected between 1999-2010 and screened using microscopy. Forty-eight Cryptosporidium oocyst-positive isolates were identified and analysed using a generic TaqMan assay targeting the 18S rRNA to detect Cryptosporidium species and two other TaqMan assays to identify Cryptosporidium hominis and Cryptosporidium parvum. The 18S rRNA assay detected Cryptosporidium species in all 48 of the stool specimens. The C. parvum TaqMan assay correctly identified five/48 stool samples, while 37/48 stool specimens were correctly amplified in the C. hominis TaqMan assay. The results obtained in this study support previous findings showing that C. hominis infections are more prevalent than C. parvum infections in Brazil and they demonstrate that the TaqMan RT-PCR procedure is a simple, fast and valuable tool for the detection and differentiation of Cryptosporidium species.

Clinical Studies on Herbal Acupuncture Therapy in Peripheral Facial Palsy

Directory of Open Access Journals (Sweden)

Shin, Min-Seop

2001-06-01

Full Text Available Objectives : The treatment of Bell's palsy must be divided into three states(acute, subacute and healing state. 41 cases of the patient suffering from Bell's palsy were treated and observed from january 2000 to July 2001. The usage of herbal acupunctures on that disease have been effective. So I propose a method of herbal acupunctures on Bell's palsy. Methods : By the states(acute, subacute and healing state of Bell's palsy, SY(消炎 herbal acupuncture is used at the acute state, Hominis Placenta(紫河車 at the subacute, JGH(中氣下陷 at the healing state. Results : 1. At the acute state, SY(消炎 herbal acupuncture is effective to postauricular pain. 2. At the subacute state, Hominis Placenta(紫河車 herbal acupuncture is effective to decreasing pain and improving symptoms. 3. By the states(acute, subacute and healing state of Bell's palsy, SY(消炎, Hominis Placenta(紫河車 and JGH(中氣下陷 herbal acupuncture is effective to improving symptoms of Bell's palsy.

A morphohistological and histochemical study of hatchery-reared European hake, Merluccius merluccius (Linnaeus, 1758, during the lecitho-exotrophic larval phase

Directory of Open Access Journals (Sweden)

Juan B. Ortiz-Delgado

2011-11-01

Full Text Available The larval development of reared European hake, Merluccius merluccius (Linnaeus, 1758, during the lecithotrophic phase, from hatching until 5 days post-hatching (dph, and throughout the endo-exotrophic feeding phase (6-10 dph was studied by histology and histochemistry. Many crucial morphological, cellular and tissular changes were observed during both feeding phases, mostly those related to digestive and visual ontogenetic events, such as differentiation of buccopharyngeal cavity and eye development (at hatching; pigmentation and differentiation of cone-photoreceptors (4 dph; opening of the mouth and anus, appearance of intestinal valves (5-6 dph; presence of buccopharyngo-esophageal (5-6 dph and intestinal (9 dph mucous cells; folding of intestinal mucosa (6 dph; development of regional specific digestive musculature (6 dph; typical structure and functionality of the liver (sinusoids, biliary and pancreatic ducts, glycogen, protein and lipid reserves (4-6 dph; and characteristic acinar distribution pattern of eosinophilic zymogen granules of the exocrine pancreas (6 dph. Between 9 and 10 dph, the hake larvae showed evident signs of lipid absorption within enterocytes of the anterior intestinal region and a remarkable process of pynocitosis and intracellular digestion was detected in the posterior intestine (supranuclear inclusions or acidophilic protein vesicles. In hake larvae at 10 dph, a proliferation of renal tubules, spleen differentiation and gill development, as well as the presence of the first thyroid follicle, were clearly distinguished. At this time, stomach gastric gland differentiation was not detected and endocrine pancreas and gill lamellae were not evidenced. However, and interestingly, swim bladder and eyes (developing rods were well differentiated in larval development from 9 dph onwards. In summary, in European hake larval development during the endo-exogenous feeding phase and especially at 9 to 10 dph, most systems, organs

Piojos (Phthiraptera: Insecta) de aves de la familia Laridae (Aves: Charadriiformes) en Chile

OpenAIRE

GONZÁLEZ-ACUÑA, DANIEL; FISCHER, CHRISTOF; PALMA, RICARDO; MORENO, LUCILA; BARRIENTOS, CARLOS; MUÑOZ, LISANDRO; ARDILES, KAREN; CICCHINO, ARMANDO

2006-01-01

Seis especies de piojos (Phthiraptera: Philopteridae, Menoponidae) fueron colectadas sobre cuatro especies de aves marinas de la familia Laridae en la costa de Chile. Se registran: Saemundssonia sternae (Linnaeus, 1758) y Quadraceps sellatus (Burmeister, 1838) sobre el gaviotín boreal (Sterna hirundo, Linnaeus, 1758); Saemundssonia lari (O. Fabricius, 1780), Quadraceps punctatus (Burmeister, 1838) y Quadraceps ornatus (Grube, 1851) parasitando a la gaviota dominicana (Larus dominicanus Lichte...

Parasitismo natural por Synhimantus (Dispharynx) nasuta (Nematoda: Acuariidae) en Pavo real (Pavo cristatus) en cautiverio

OpenAIRE

Gómez-Puerta, Luis A.; Enciso, Marco A.; Rojas, Gianmarco

2009-01-01

The nematode Synhimantus (Dispharynx) nasuta (Rudolphi, 1819) Chabaud, 1975 parasiting the proventriculus of two chicks of Common Peafowl (Pavo cristatus Linnaeus, 1758) in captivity from Lima, Peru is described. En el presente trabajo se describe al nematodo Synhimantus (Dispharynx) nasuta (Rudolphi, 1819) Chabaud, 1975 parasitando el proventrículo de dos polluelos de Pavo real (Pavo cristatus Linnaeus, 1758) en cautiverio provenientes de Lima, Perú.

Dryophthorinae Species (Coleoptera: Curculionidae) Associted to Platain and Banana crops (Musaspp.) in Colombia

OpenAIRE

SEPÚLVEDA-CANO, PAULA A; RUBIO-GÓMEZ, JOSÉ D

2009-01-01

Se presenta una sinopsis de los escarabajos de la subfamilia Dryophthorinae (Coleoptera: Curculionidae) asociados a cultivos de plátano y banano en Colombia. Adicionalmente se ofrecen claves ilustradas para las especies del país. Se registran seis especies asociadas a dichos cultivos: Cosmopolites sordidus (Germar, 1824), Metamasius hemipterus (Linnaeus, 1758), Metamasius hebetatus (Gyllenhal, 1838), Metamasius submaculatus Champion, 1910, Rhyncophorus palmarum (Linnaeus, 1758) y Polytus mell...

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 0000004359 [Cryptosporidium hominis] ... Length = 172 ... Query: 219 DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDK...NQQDCIDINECQENSGLGPCEFGCK 278 ... DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCK Sbjct: 1 ... DIDECKEGSHSCSHICVNTR

Efficiency of box-traps and leg-hold traps with several bait types for capturing small carnivores (Mammalia in a disturbed area of Southeastern Brazil

Directory of Open Access Journals (Sweden)

Fernanda Michalski

2007-03-01

Full Text Available Capturing small carnivores is often necessary for obtaining key ecological data. We compared the efficiency of box and leg-hold traps, using live and dead bait, to capture six carnivore species (Herpailurus yagouaroundi (É. Geoffroyi, 1803, Leopardus tigrinus (Schreber, 1775, Nasua nasua (Linnaeus, 1766, Cerdocyon thous (Linnaeus, 1766, Eira barbara (Linnaeus, 1758, and Galictis cuja (Molina, 1782. The use of leg-hold traps significantly increased the capture rate of carnivores (5.77% and non-target species (non-carnivores, 11.54%. Dead bait significantly attracted more non-carnivores than carnivores and live bait was more efficient for capturing carnivores (2.56% than non-carnivores (0.77%. Both box and leg-hold traps caused some minor injuries (swelling and claw loss. We provide recommendations for the ethical use of these trap and bait types. Rev. Biol. Trop. 55 (1: 315-320. Epub 2007 March. 31.La captura de pequeños carnívoros es una práctica común para obtener datos ecológicos. Comparamos la eficiencia de cepos (trampas acolchadas y trampas tomahawk para capturar seis especies carnívoras (Herpailurus yagouaroundi (É. Geoffroyi, 1803, Leopardus tigrinus (Schreber, 1775, Nasua nasua (Linnaeus, 1766, Cerdocyon thous (Linnaeus, 1766, Eira barbara (Linnaeus, 1758, and Galictis cuja (Molina, 1782, utilizando carnadas vivas y muertas. Con los cepos se incrementó significativamente la tasa de captura de carnívoros (5.77% y otros mamíferos (no-carnívoros, 11.54%. La carnada muerta atrajo significativamente mas no-carnívoros que carnívoros, mientras que con la carnada viva se capturaron más carnívoros (2.56% vs 0.77% no-carnívoros. Ambos tipos de trampas; cepos y tomahawk, causaron algunas pequeñas lastimaduras (inflamación y pérdida de garras. Hacemos algunas recomendaciones para el uso ético de este tipo de trampas y cebos.

Composição e caracterização da fauna de mamíferos de médio e grande porte em uma pequena reserva de cerrado em Mato Grosso, Brasil Composition and characterization of the medium and large size mammal fauna in a small cerrado reserve in Mato Grosso, Brazil

Directory of Open Access Journals (Sweden)

Ednaldo Cândido Rocha

2006-08-01

Full Text Available Este estudo foi realizado na Reserva Biológica Municipal "Mário Viana", Nova Xavantina, MT, objetivando inventariar e avaliar a abundância e diversidade de mamíferos terrestres de médio e grande porte. Para tanto, foram realizadas duas visitas mensais a um transecto com 2.820 m de extensão, durante todo o ano de 2001, para o levantamento de pegadas (rastreamentos e outras evidências de mamíferos. Um total de 29 espécies foram registradas na área de estudo, sendo que 22 ocorreram no transecto e tiveram suas seqüências individuais de pegadas quantificadas para realização do cálculo dos índices de abundância e de diversidade de Shannon-Wiener (H'. De acordo com seus índices de abundância, as espécies foram classificadas em raras, comuns e abundantes. Dentre outras, onça-parda (Puma concolor - Linnaeus, 1771 e tatu-canastra (Priodontes maximus - Keer, 1792 mostraram-se raras; jaguatirica (Leopardus pardalis - Linnaeus, 1758, e tamanduá-bandeira (Myrmecophaga tridactyla - Linnaeus, 1758, comuns; e cutia (Dasyprocta azarae - Lichtenstein, 1823 e tapeti (Sylvilagus brasiliensis - Linnaeus, 1758, abundantes. O H' encontrado foi 2,40, sendo considerado significativo. O presente trabalho apontou que, apesar de pequena (470 ha, a área de estudo desempenha importante papel para a conservação da mastofauna da região de Nova Xavantina, MT.This study was carried out at the 'Mario Viana' Municipal Biological Reserve in Nova Xavantina, MT, aiming to make an inventory and evaluate the abundance and diversity of terrestrial mammals of medium and large size. Thus, two monthly visits were made to a 2.820 m long transect throughout 2001 to assess tracking and other evidences of mammals. Twenty-nine species were recorded in the study area, with 22 in the transect and two individual tracking sequences being quantified for calculation of the Shannon-Wiener (H' abundance and diversity indices. According to the abundance indices, the species were

High-resolution melting-curve (HRM) analysis for C. meleagridis identification in stool samples.

Science.gov (United States)

Chelbi, Hanen; Essid, Rym; Jelassi, Refka; Bouzekri, Nesrine; Zidi, Ines; Ben Salah, Hamza; Mrad, Ilhem; Ben Sghaier, Ines; Abdelmalek, Rym; Aissa, Sameh; Bouratbine, Aida; Aoun, Karim

2018-02-01

Cryptosporidiosis represents a major public health problem. This infection, caused by a protozoan parasite of the genus Cryptosporidium, has been reported worldwide as a frequent cause of diarrhoea. In the immunocompetent host, the typical watery diarrhea can be self-limiting. However, it is severe and chronic, in the immunocompromised host and may cause death. Cryptosporidium spp. are coccidians, which complete their life cycle in both humans and animals. The two species C. hominis and C. parvum are the major cause of human infection. Compared to studies on C. hominis and C. parvum, only a few studies have developed methods to identify C. meleagridis. To develop a new real time PCR-coupled High resolution melting assay allowing the detection for C. meleagridis, in addition of the other dominant species (C. hominis and C. parvum). The polymorphic sequence on the dihydrofolate reductase gene (DHFR) of three species was sequenced to design primers pair and establish a sensitive real-time PCR coupled to a high-resolution melting-curve (HRM) analysis method, allowing the detection of Cryptosporidium sp. and discrimination between three prevalent species in Tunisia. We analyzed a collection of 42 archived human isolates of the three studied species. Real-time PCR coupled to HRM assay allowed detection of Cryptosporidium, using the new designed primers, and basing on melting profile, we can distinguish C. meleagridis species in addition to C. parvum and C. hominis. We developed a qPCR-HRM assay that allows Cryptosporidium genotyping. This method is sensitive and able to distinguish three Cryptosporidium species. Copyright © 2017. Published by Elsevier Ltd.

Association of genital mycoplasmas including Mycoplasma genitalium in HIV infected men with nongonococcal urethritis attending STD & HIV clinics.

Science.gov (United States)

Manhas, Ashwini; Sethi, Sunil; Sharma, Meera; Wanchu, Ajay; Kanwar, A J; Kaur, Karamjit; Mehta, S D

2009-03-01

Acute nongonococcal urethritis (NGU) is one of the commonest sexually transmitted infections affecting men. The role of genital mycoplasmas including Mycoplasma genitalium in HIV infected men with NGU is still not known. The aim of this study was to determine the isolation pattern/detection of genital mycoplasma including M. genitalium in HIV infected men with NGU and to compare it with non HIV infected individuals. One hundred male patients with NGU (70 HIV positive, 30 HIV negative) were included in the study. Urethral swabs and urine samples obtained from patients were subjected to semi-quantitative culture for Mycoplasma hominis and Ureaplasama urealyticum, whereas M. genitalium was detected by PCR from urine. The primers MgPa1 and MgPa3 were selected to identify 289 bp product specific for M. genitalium. Chalmydia trachomatis antigen detection was carried out by ELISA. M. genitalium and M. hominis were detected/isolated in 6 per cent of the cases. M. genitalium was more common amongst HIV positive cases (7.1%) as compared to HIV negative cases (3.3%) but difference was not statistically significant. Co-infection of C. trachomatis and U. urealyticum was found in two HIV positive cases whereas, C. trachomatis and M. hominis were found to be coinfecting only one HIV positive individual. M. genitalium was found to be infecting the patients as the sole pathogen. Patients with NGU had almost equal risk of being infected with M. genitalium, U. urealyticum or M. hominis irrespective of their HIV status. M.genitalium constitutes one of the important causes of NGU besides other genital mycoplasmas.

Detecting the Diversity of Mycoplasma and Ureaplasma Endosymbionts Hosted by Trichomonas vaginalis Isolates

Science.gov (United States)

Ioannidis, Anastasios; Papaioannou, Panagiota; Magiorkinis, Emmanouil; Magana, Maria; Ioannidou, Vasiliki; Tzanetou, Konstantina; Burriel, Angeliki R.; Tsironi, Maria; Chatzipanagiotou, Stylianos

2017-01-01

Objectives: The symbiosis of Trichomonas vaginalis and Mycoplasma hominis is the first described association between two obligate human parasites. Trichomonas is the niche and the vector for the transmission of M. hominis infection. This clinically significant symbiosis may affect T. vaginalis virulence and susceptibility to treatment. The aims of this study were to investigate the intracellularly present Mycoplasma and Ureaplasma species in T. vaginalis strains isolated from the vaginal discharge of infected women as well as to trace the diversity pattern among the species detected in the isolated strains. Methods: Hundred pure T. vaginalis cultures were isolated from ~7,500 patient specimens presented with clinical purulent vaginitis. PCR and sequencing for Mycoplasma/Ureaplasma spp. were performed in DNA extracted from the pure cultures. In addition, vaginal discharge samples were cultured for the presence of M. hominis and U. urealyticum. Phylogenetic analysis assisted the identification of interspecies relationships between the Mycoplasma and Ureaplasma isolates. Results: Fifty four percentage of T. vaginalis isolates were harboring Mycoplasma spp. Phylogenetic analysis revealed three distinct clusters, two with already characterized M. hominis and Ureaplasma spp. (37% of total Mycoplasma spp.), whereas one group formed a distinct cluster matched with the newly identified species Candidatus Mycoplasma girerdii (59.3%) and one or more unknown Mycoplasma spp. (3.7%). Conclusions: T. vaginalis strains associated with vaginal infection might host intracellular mycoplasmas or ureaplasmas. Intracellular Mollicutes that remain undetected in the extracellular environment when conventional diagnostic methods are implemented may comprise either novel species, such as Candidatus M. giredii, or unknown species with yet unexplored clinical significance. PMID:28702014

Detecting the Diversity of Mycoplasma and Ureaplasma Endosymbionts Hosted by Trichomonas vaginalis Isolates

Directory of Open Access Journals (Sweden)

Anastasios Ioannidis

2017-06-01

Full Text Available Objectives: The symbiosis of Trichomonas vaginalis and Mycoplasma hominis is the first described association between two obligate human parasites. Trichomonas is the niche and the vector for the transmission of M. hominis infection. This clinically significant symbiosis may affect T. vaginalis virulence and susceptibility to treatment. The aims of this study were to investigate the intracellularly present Mycoplasma and Ureaplasma species in T. vaginalis strains isolated from the vaginal discharge of infected women as well as to trace the diversity pattern among the species detected in the isolated strains.Methods: Hundred pure T. vaginalis cultures were isolated from ~7,500 patient specimens presented with clinical purulent vaginitis. PCR and sequencing for Mycoplasma/Ureaplasma spp. were performed in DNA extracted from the pure cultures. In addition, vaginal discharge samples were cultured for the presence of M. hominis and U. urealyticum. Phylogenetic analysis assisted the identification of interspecies relationships between the Mycoplasma and Ureaplasma isolates.Results: Fifty four percentage of T. vaginalis isolates were harboring Mycoplasma spp. Phylogenetic analysis revealed three distinct clusters, two with already characterized M. hominis and Ureaplasma spp. (37% of total Mycoplasma spp., whereas one group formed a distinct cluster matched with the newly identified species Candidatus Mycoplasma girerdii (59.3% and one or more unknown Mycoplasma spp. (3.7%.Conclusions:T. vaginalis strains associated with vaginal infection might host intracellular mycoplasmas or ureaplasmas. Intracellular Mollicutes that remain undetected in the extracellular environment when conventional diagnostic methods are implemented may comprise either novel species, such as Candidatus M. giredii, or unknown species with yet unexplored clinical significance.

New records of epibiont Ciliates (Ciliophora) from Indian coast with descriptions of six new species

Digital Repository Service at National Institute of Oceanography (India)

Chatterjee, T.; Fernandez-Leborans, G.; Ramteke, D.; Ingole, B.S.

patzcuarensis Villalobos, 1943, lake Pátzcuaro (Michoacán, Mexico) (Mayen-Estrada & Aladro-Lubel, 1998). On Liocarcinus depurator (Linnaeus, 1758), L. vernalis (Risso, 1827), Goneplax rhomboids( Linnaeus, 1758), Dardanus arrosor (Herbst, 1796), Paguristes... oculatus (Fabricius, 1775), Pagurus excavates (Herbst, 1791), and Pagurus prideaux Leach, 1815 from N.W. Mediterranean Sea (Fernandez-Leborans, 2003). Acknowledgement Thanks are due to Dr Marleen De Troch, Marine Biology Section, University of Ghent...

Mamíferos carnívoros e sua relação com a diversidade de hábitats no Parque Nacional dos Aparados da Serra, sul do Brasil Carnivore mammals and their relation with habitat diversity in Aparados da Serra National Park, southern Brazil

Directory of Open Access Journals (Sweden)

Maria de Fátima M. dos Santos

2004-09-01

Full Text Available A survey of carnivore mammals was accomplished in Aparados da Serra National Park from February 1998 to March 2000. The park has 10,250 ha and is considered a biodiversity core area of the Atlantic Forest Biosphere Reserve in the Rio Grande do Sul State, Brazil. The landscape is characterized by relatively well preserved relicts of Araucaria angustifolia (Bertol. Kuntze forest, grasslands and Atlantic Forest, which have contributed for the survival of endangered carnivore mammals. The National Park was divided in a grid of 16 km² cells using a 1:50,000 scale map. The animals were recorded using indirect methods, by identifying signs (scats, tracks and direct observation in 2.5 km long and 5 m wide transects, with 10 replicates in each grid cell. Interviews with local people were also used to confirm the animal presence. A total of 13 species was recorded: Procyon cancrivorus (Cuvier, 1798, Pseudalopex gymnocercus (G. Fischer, 1814, Leopardus pardalis (Linnaeus, 1758 and Cerdocyon thous (Linnaeus, 1766 were the most frequent species registered. Nasua nasua (Linnaeus 1766, Herpailurus yaguarondi (Lacépède, 1809, Chrysocyon brachyurus (Illiger, 1815, Eira barbara (Linnaeus, 1758, Leopardus sp., Puma concolor (Linnaeus, 1771, Galictis cuja (Molina, 1782, Conepatus chinga (Molina, 1892 and Lontra longicaudis (Olfers, 1818 showed lower frequencies. The Park presented areas with significant differences (Mantel Test, P< 0.05 in species richness and composition related to habitat classes. Areas with high habitat richness presented high species richness. The Araucaria forest was the habitat that presented the higher carnivore richness. The border areas of the Park are influenced by several environmental degradation factors that could be affecting the distribution of carnivores.

Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

OpenAIRE

Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena

2015-01-01

Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

Novos relatos de carrapatos em Rondônia, Amazônia ocidental brasileira

OpenAIRE

LABRUNA, Marcelo Bahia; BARBIERI, Fábio Silva; MARTINS, Thiago Fernandes; BRITO, Luciana Gatto; RIBEIRO, Francisco Dimas Sales

2010-01-01

In the present study, we provide new tick records from Vilhena Municipality, in the Southeast of the State of Rondônia, Northern Brazil. Ticks collected from a capybara, Hydrochoerus hydrochaeris (Linnaeus), were identified as Amblyomma romitii Tonelli-Rondelli (1 female), and Amblyomma sp. (1 larva). Ticks collected from a harpy eagle, Harpia harpyja (Linnaeus), were identified as Amblyomma cajennense (Fabricius) (16 nymphs) and Haemaphysalis juxtakochi Cooley (1 nymph). Ticks collected from...

New tick records in Rondônia, Western Brazilian Amazon

OpenAIRE

Labruna,Marcelo Bahia; Barbieri,Fábio Silva; Martins,Thiago Fernandes; Brito,Luciana Gatto; Ribeiro,Francisco Dimas Sales

2010-01-01

In the present study, we provide new tick records from Vilhena Municipality, in the Southeast of the State of Rondônia, Northern Brazil. Ticks collected from a capybara, Hydrochoerus hydrochaeris (Linnaeus), were identified as Amblyomma romitii Tonelli-Rondelli (1 female), and Amblyomma sp. (1 larva). Ticks collected from a harpy eagle, Harpia harpyja (Linnaeus), were identified as Amblyomma cajennense (Fabricius) (16 nymphs) and Haemaphysalis juxtakochi Cooley (1 nymph). Ticks collected from...

Molecular appraisal of intestinal parasitic infection in transplant recipients

Directory of Open Access Journals (Sweden)

Pooja Yadav

2016-01-01

Full Text Available Background & objectives: Diarrhoea is the main clinical manifestation caused by intestinal parasitic infections in patients, with special reference to transplant recipients who require careful consideration to reduce morbidity and mortality. Further, molecular characterization of some important parasites is necessary to delineate the different modes of transmission to consider appropriate management strategies. We undertook this study to investigate the intestinal parasitic infections in transplant recipients with or without diarrhoea, and the genotypes of the isolated parasites were also determined. Methods: Stool samples from 38 transplant recipients comprising 29 post-renal, two liver and seven bone marrow transplant (BMT recipients presenting with diarrhoea and 50 transplant recipients (42 post-renal transplant, eight BMT without diarrhoea were examined for the presence of intestinal parasites by light microscopy using wet mount, modified Ziehl-Neelsen staining for intestinal coccidia and modified trichrome staining for microsporidia. Genotypes of Cryptosporidium species were determined by multilocus genotyping using small subunit ribosomal (SSUrRNA, Cryptosporidium oocyst wall protein (COWP and dihydrofolate reductase (DHFR as the target genes. Assemblage study for Giardia lamblia was performed using triose phosphate isomerase (TPI as the target gene. Samples were also screened for bacterial, fungal and viral pathogens. Results: The parasites that were detected included Cryptosporidium species (21%, 8/38, Cystoisospora (Isospora belli (8%, 3, Cyclospora cayetanensis (5%, 2, G. lamblia (11%, 4, Hymenolepis nana (11%, 4, Strongyloides stercoralis (3%, 1 and Blastocystis hominis (3%, 1. Multilocus genotyping of Cryptosporidium species at SSUrRNA, COWP and DHFR loci could detect four isolates of C. hominis; two of C. parvum, one of mixed genotype and one could not be genotyped. All the C. hominis isolates were detected in adult post

LINNAEUS OIL

African Journals Online (AJOL)

eobe

Crude jatropha oil; Heterogeneous catalyst; Transesterification ... mmage for alternative fuel ... be designed to give higher activity and lifetimes [13]. So, the need for a cheap catalyst for biodiesel synthesis from no ... methanol (High Performance Liquid Chromatography ... ratio and were then charged into the glass reactor.

Detection of carboxylesterase and esterase activity in culturable gut bacterial flora isolated from diamondback moth, Plutella xylostella (Linnaeus, from India and its possible role in indoxacarb degradation

Directory of Open Access Journals (Sweden)

Shanivarsanthe Leelesh Ramya

2016-06-01

Full Text Available Abstract Diamondback moth (DBM, Plutella xylostella (Linnaeus, is a notorious pest of brassica crops worldwide and is resistant to all groups of insecticides. The insect system harbors diverse groups of microbiota, which in turn helps in enzymatic degradation of xenobiotic-like insecticides. The present study aimed to determine the diversity of gut microflora in DBM, quantify esterase activity and elucidate their possible role in degradation of indoxacarb. We screened 11 geographic populations of DBM in India and analyzed them for bacterial diversity. The culturable gut bacterial flora underwent molecular characterization with 16S rRNA. We obtained 25 bacterial isolates from larvae (n = 13 and adults (n = 12 of DBM. In larval gut isolates, gammaproteobacteria was the most abundant (76%, followed by bacilli (15.4%. Molecular characterization placed adult gut bacterial strains into three major classes based on abundance: gammaproteobacteria (66%, bacilli (16.7% and flavobacteria (16.7%. Esterase activity from 19 gut bacterial isolates ranged from 0.072 to 2.32 µmol/min/mg protein. Esterase bands were observed in 15 bacterial strains and the banding pattern differed in Bacillus cereus – KC985225 and Pantoea agglomerans – KC985229. The bands were characterized as carboxylesterase with profenofos used as an inhibitor. Minimal media study showed that B. cereus degraded indoxacarb up to 20%, so it could use indoxacarb for metabolism and growth. Furthermore, esterase activity was greater with minimal media than control media: 1.87 versus 0.26 µmol/min/mg protein. Apart from the insect esterases, bacterial carboxylesterase may aid in the degradation of insecticides in DBM.

Seasonal variations in the biochemical composition of some common seaweed species from the coast of Abu Qir Bay, Alexandria, Egypt

OpenAIRE

Khairy, Hanan M.; El-Shafay, Shimaa M.

2013-01-01

Variations in protein, carbohydrate, lipid, ash, moisture, fatty acid and aminoacid contents of the seaweeds Ulva lactuca Linnaeus (Chlorophyta),Jania rubens (Linnaeus) J.V. Lamouroux and Pterocladia capillacea (S.G. Gmelin) Bornet(Rhodophyta) were studied seasonally from spring to autumn 2010. The seaweeds were collected from a rocky site near Boughaz El-Maadya on the coast of Abu Qir Bay east of Alexandria, Egypt. Remarkable seasonal variations were recorded in the levels of the studied pa...

Eficiência de extratos vegetais no controle de Diabrotica speciosa (Germar, 1824 (Coleoptera: Chrysomelidae, em laboratório

Directory of Open Access Journals (Sweden)

Junir Antonio Lutinski

2010-04-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n1p83 Vulgarmente conhecida como “vaquinha”, Diabrotica speciosa (Germar, 1824 ocorre na maioria dos estados brasileiros, destacando-se como uma das mais importantes pragas do feijoeiro e do milho. Visando avaliar a atividade inseticida de extratos brutos aquosos de nove espécies vegetais sobre os adultos deste inseto, realizou-se este trabalho. O experimento, conduzido em laboratório, foi realizado sob delineamento completamente casualizado, com dez tratamentos e quatro repetições. Para tal, utilizou-se um frasco, contendo em seu interior cinco espécimes adultos e uma folha de feijoeiro (Phaseolus vulgaris Linnaeus previamente imersa no extrato, tampado com um recorte de pano poroso e fixado por uma borracha. A variável avaliada foi número de espécimes de D. speciosa vivos. Os tratamentos consistiram em extratos de salvia (Salvia officinalis Linnaeus, cravo (Eugenia caryophyllata Thunb, noz-moscada (Myristica fragans Houtt, cinamomo (Melia azedarach Linnaeus, timbó (Ateleia glazioveana Baill, eucalipto (Eucalyptus citriodora Hook, canela (Cinnamomum zeylanicum Blume, figueira (Ficus microcarpa Linnaeus f., alecrim (Rosmarinus officinalis Linnaeus e a testemunha (apenas água destilada. As avaliações de sobrevivência foram realizadas a cada 24 horas, durante 10 dias. Sobre o número de espécimes vivos efetuou-se a análise de variância em bifatorial (10 extratos x 11 horários após a aplicação. As médias foram agrupadas pelo teste de Duncan ao nível de 5% de probabilidade de erro. Os extratos mais eficientes foram o timbó, noz-moscada e cinamomo, com porcentagens de eficiência variando entre 80,4% e 100%.

Karyotypes, male meiosis and comparative FISH mapping of 18S ribosomal DNA and telomeric (TTAGGn repeat in eight species of true bugs (Hemiptera, Heteroptera

Directory of Open Access Journals (Sweden)

Snejana Grozeva

2011-11-01

Full Text Available Eight species belonging to five true bug families were analyzed using DAPI/CMA3-staining and fluorescence in situ hybridization (FISH with telomeric (TTAGGn and 18S rDNA probes. Standard chromosomal complements are reported for the first time for Deraeocoris rutilus (Herrich-Schäffer, 1838 (2n=30+2m+XY and D. ruber (Linnaeus, 1758 (2n=30+2m+XY from the family Miridae. Using FISH, the location of a 18S rDNA cluster was detected in these species and in five more species: Megaloceroea recticornis (Geoffroy, 1785 (2n=30+XY from the Miridae; Oxycarenus lavaterae (Fabricius, 1787 (2n=14+2m+XY from the Lygaeidae s.l.; Pyrrhocoris apterus (Linnaeus, 1758 (2n=22+X from the Pyrrhocoridae; Eurydema oleracea (Linnaeus, 1758 (2n=12+XY and Graphosoma lineatum (Linnaeus, 1758 (2n=12+XY from the Pentatomidae. The species were found to differ with respect to location of a 18S rRNA gene cluster which resides on autosomes in O. lavaterae and P. apterus, whereas it locates on sex chromosomes in other five species. The 18S rDNA location provides the first physical landmark of the genomes of the species studied. The insect consensus telomeric pentanucleotide (TTAGGn was demonstrated to be absent in all the species studied in this respect, D. rutilus, M. recticornis, Cimex lectularius Linnaeus, 1758 (Cimicidae, E. oleracea, and G. lineatum, supporting the hypothesis that this motif was lost in early evolution of the Heteroptera and secondarily replaced with another motif (yet unknown or the alternative telomerase-independent mechanisms of telomere maintenance. Dot-blot hybridization analysis of the genomic DNA from C. lectularius, Nabis sp. and O. lavaterae with (TTAGGn and six other telomeric probes likewise provided a negative result.

Karyotypic diversity in four species of the genus Gymnotus Linnaeus, 1758 (Teleostei, Gymnotiformes, Gymnotidae): physical mapping of ribosomal genes and telomeric sequences

Science.gov (United States)

Scacchetti, Priscilla Cardim; Pansonato-Alves, José Carlos; Utsunomia, Ricardo; Oliveira, Claudio; Foresti, Fausto

2011-01-01

Abstract Conventional (Giemsa, C-Banding, Ag-NORs, CMA3) and molecular (5S rDNA, 18S rDNA, telomeric sequences) cytogenetic studies were carried out in specimens of ten distinct fish populations of the genus Gymnotus (Gymnotus sylvius Albert and Fernandes-Matioli, 1999, Gymnotus inaequilabiatus Valenciennes, 1839, Gymnotus pantherinus Steindachner, 1908, and G. cf. carapo Linnaeus, 1758) from different Brazilian hydrographic basins. Gymnotus sylvius presented a diploid number of 40 chromosomes (22m+12sm+6st), Gymnotus pantherinus presented 52 chromosomes (32m+18sm+2st), while Gymnotus inaequilabiatus (42m+10sm+2a)and Gymnotus cf. carapo (38m+12sm+4st) presented 54 chromosomes. The C-banding technique revealed centromeric marks in all chromosomes of all species. Besides that, conspicuous blocks of heterochromatin were found interstitially on the chromosomes of Gymnotus inaequilabiatus, Gymnotus cf. carapo,and Gymnotus pantherinus. All four species showed single nucleolus organizing regions confirmed by results obtained through Ag-NORs and FISH experiments using 18S rDNA probes, which showed the NORs localized on the first chromosome pair in Gymnotus inaequilabiatus, Gymnotus cf. carapo,and Gymnotus pantherinus, and on pair 2 in Gymnotus sylvius. CMA3 staining revealed additional unrelated NORs marks in Gymnotus sylvius and Gymnotus pantherinus. The 5S rDNA probes revealed signals on one pair in Gymnotus sylvius and two pairs in Gymnotus pantherinus; Gymnotus inaequilabiatus had about seventeen pairs marked, and Gymnotus cf. carapo had about fifteen pairs marked. It is considered that the high amount of heterochromatin identified in the chromosomes of Gymnotus inaequilabiatus and Gymnotus cf. carapo could have facilitated the dispersion of 5S rDNA in these species. Interstitial signals were detected on the first metacentric pair of Gymnotus sylvius by telomeric probes (TTAGGG)n indicating the possible occurrence of chromosomal fusions in this species. The present

Karyotypic diversity in four species of the genus Gymnotus Linnaeus, 1758 (Teleostei, Gymnotiformes, Gymnotidae: physical mapping of ribosomal genes and telomeric sequences

Directory of Open Access Journals (Sweden)

Priscilla Scacchetti

2011-08-01

Full Text Available Conventional (Giemsa, C-Banding, Ag-NORs, CMA3 and molecular (5S rDNA, 18S rDNA, telomeric sequences cytogenetic studies were carried out in specimens of ten distinct fish populations of the genus Gymnotus (G. sylvius Albert and Fernandes-Matioli, 1999, G. inaequilabiatus Valenciennes, 1839, G. pantherinus Steindachner, 1908, and G. cf. carapo Linnaeus, 1758 from different Brazilian hydrographic basins. G. sylvius presented a diploid number of 40 chromosomes (22m+12sm+6st, G. pantherinus presented 52 chromosomes (32m+18sm+2st, while G. inaequilabiatus (42m+10sm+2a and G. cf. carapo (38m+12sm+4st presented 54 chromosomes. The C-banding technique revealed centromeric marks in all chromosomes of all species. Besides that, conspicuous blocks of heterochromatin were found interstitially on the chromosomes of G. inaequilabiatus, G. cf. carapo, and G. pantherinus. All four species showed single nucleolus organizing regions confirmed by results obtained through Ag-NORs and FISH experiments using 18S rDNA probes, which showed the NORs localized on the first chromosome pair in G. inaequilabiatus, G. cf. carapo, and G. pantherinus, and on pair 2 in G. sylvius. CMA3 staining revealed additional unrelated NORs marks in G. sylvius and G. pantherinus. The 5S rDNA probes revealed signals on one pair in G. sylvius and two pairs in G. pantherinus; G. inaequilabiatus had about seventeen pairs marked, and G. cf. carapo had about fifteen pairs marked. It is considered that the high amount of heterochromatin identified in the chromosomes of G. inaequilabiatus and G. cf. carapo could have facilitated the dispersion of 5S rDNA in these species. Interstitial signals were detected on the first metacentric pair of G. sylvius by telomeric probes (TTAGGGn indicating the possible occurrence of chromosomal fusions in this species. The present study reveals valuable cytotaxonomic markers for this group and allows a more precise evaluation of the processes involved in the

Eosinophils increase in animals that received biotherapic

Directory of Open Access Journals (Sweden)

Pedro Gilberto Silva Morais

2012-12-01

Full Text Available Dairy industry is an important Brazilian economic activity participating of income generation. European breeds cattle aren’t adapted to parasites found in the tropics, like the Rhipicephalus microplus tick. Parasites can acquire resistance to allopathic products, but not to homeopathic products. We evaluate the efficacy of an antiparasiticide biotherapic against the R. microplus tick. The biotherapic was prepared according to the homeopathic pharmacopoeia recommendations from vegetable (Abrotanum and animal products (Rhipicephalus microplus, Amblyomma cajenennense, Haematobia irritans, Musca domestica, Dermatobia hominis, all diluted and vigorous shaken (dynamized in water or alcohol at a ratio of 1:99, in the 12th Centesimal Hahnemann (CH12, with limestone as the carrier. This homeophatic product found in veterinary pharmacies of Ituiutaba’s region, Minas Gerais State, is registered at Ministério da Agricultura, Pecuária e Abastecimento (MAPA. Natural tick infestation was accessed in thirty Girolando (Gir x Holstein cows with 7 to 13 year-old, by monthly counting of tick female bigger than 6 mm, from October/2009 to July/2011. Cows were divided in three groups of 10 similar animals. The treated group (T1 received roughage, concentrate and biotherapic. The placebo group (T2 received roughage, concentrate and limestone and the control group (T3 received only roughage and concentrate. T1 and T2 groups were managed together and remained in the same paddock. T3 group was separed from T1 and T2 by a wire fence. From October 2009 to September 2010 blood cell counts and serum biochemical tests were performed monthly only in T1 and T2, but visual clinical observations were made in all animals. Any group was treated with acaricide when the count’s average reached 50 or more ticks. It was necessary 7 baths with acaricide in T1 and T2, while in T3 group (control group it was necessary 19 acaricide baths to control the cattle tick. We verified

Efeitos do endosulfano em concentrações subletais em carpas (Cyprinus carpio, Linnaeus, 1758: Análises morfométricas, histológicas e ultraestrutural e avaliação da atividade da colinesterase

Directory of Open Access Journals (Sweden)

Lígia Maria Salvo

2008-04-01

Full Text Available Endosulfan, an organochlorine pesticide, has been banned by most developed countries, although it is still produced, sold and used in developing countries. Used for control in crops, as well as for insect control in public health programs in some countries, its effects on the environment and its toxicity are still in discussion. For some researchers, its bioaccumulation in terrestrial organisms is considered irrelevant but for aquatic life it should be considered carefully. The present research work was to carry out an study on the effects of sublethal concentrations of endosulfan on the fresh water fish carp (Cyprinus carpio, Linnaeus, 1758. The fishes were exposed during 15 days to 0.001 mg/L of endosulfan using dimethylsulfoxide 0.1% (DMSO as solvent. The acetylcholinesterase activity on the brain and axial muscle, as well as liver morphometric, histopathologic and ultrastructural analysis were studied. The hepatic somatic index and the livers weight showed smaller values when compared with the control groups, besides being also observed histopathological and ultrastructural alterations. It has not been observed significant alterations in the cholinesterase activity of both brain and striated muscle. These results suggest that the organochloride endosulfan caused toxic effects in the hepatic metabolism of the fish exposed to it in sub lethal doses.

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available reonine protein kinase KKIALRE (EC 2.7.1.-) ... [Cryptosporidium hominis] ... Length = 361 ... Query: 10 ... LNRYKTICE...IGEGAFGVVFKCMDLVTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN 69 ... LNRYKTICEIGEGAFGVVFKCMDL...VTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN Sbjct: 1 ... LNRYKTICEIGEGAFGVVFKCMDLVTNEIVALK

Development of Supputius cincticeps (Heteroptera, Pentatomidae) fed with Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae) and Musca domestica (Diptera, Muscidae) larvae

OpenAIRE

Beserra, Eduardo B.; Zanuncio, Teresinha V.; Zanuncio, José C.; Santos, Germi P.

1995-01-01

Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860) were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV) in Viçosa (Minas Gerais, Brazil) at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viabil...

The Rolf and Gertrud Dahlgren Prize for 2017 Awarded to Hans Walter Lack

DEFF Research Database (Denmark)

Friis, Ib

2018-01-01

The reasons for awarding the Rolf and Gertrud Dahlgren Prize to Hans Walter Lack are summarised and the prize described. It is also mentioned that Rosén's Linnaeus Medal in Gold was awarded to Arne Strid at the same ceremony.......The reasons for awarding the Rolf and Gertrud Dahlgren Prize to Hans Walter Lack are summarised and the prize described. It is also mentioned that Rosén's Linnaeus Medal in Gold was awarded to Arne Strid at the same ceremony....

Emergence of methicillin-resistant coagulase-negative staphylococci resistant to linezolid with rRNA gene C2190T and G2603T mutations.

Science.gov (United States)

Cidral, Thiago André; Carvalho, Maria Cícera; Figueiredo, Agnes Marie Sá; de Melo, Maria Celeste Nunes

2015-10-01

The aim of this article were to determinate the mechanism of linezolid resistance in coagulase-negative methicillin-resistant staphylococci from hospitals in the northeast of Brazil. We identified the isolates using VITEK(®) 2 and MALDI-TOF. Susceptibility to antibiotics was measured by the disk-diffusion method and by Etest(®) . Extraction of the whole genome DNA was performed, followed by screening of all the strains for the presence of mecA and cfr genes. The domain V region of 23S rRNA gene was sequenced and then aligned with a linezolid-susceptible reference strain. Pulsed-field gel electrophoresis (PFGE) macro-restriction analysis was performed. Three linezolid-resistant Staphylococcus hominis and two linezolid-resistant Staphylococcus epidermidis strains were analyzed. The isolates showed two point mutations in the V region of the 23S rRNA gene (C2190T and G2603T). We did not detect the cfr gene in any isolate by PCR. The S. hominis showed the same pulsotype, while the S. epidermidis did not present any genetic relation to each other. In conclusion, this study revealed three S. hominis and two S. epidermidis strains with resistance to linezolid due to a double mutation (C2190T and G2603T) in the domain V of the 23S rRNA gene. For the first time, the mutation of C2190T in S. epidermidis is described. This study also revealed the clonal spread of a S. hominis pulsotype between three public hospitals in the city of Natal, Brazil. These findings highlight the importance of continued vigilance of linezolid resistance in staphylococci. © 2015 APMIS. Published by John Wiley & Sons Ltd.

Molecular characterization of Cryptosporidium spp. from HIV infected patients from an urban area of Brazil Caracterização molecular de Cryptosporidium spp. de pacientes de área urbana do Brasil infectados por HIV

Directory of Open Access Journals (Sweden)

Patrícia de Lucca

2009-12-01

Full Text Available Cryptosporidium spp. are important cause of enteric disease in humans, but may also infect animals. This study describes the relative frequency of several Cryptosporidium species found in human specimens from HIV infected patients in the São Paulo municipality obtained from January to July 2007. Sequence analysis of the products of nested-PCR based on small subunit rRNA and Cryptosporidium oocyst wall protein coding genes revealed 17 (63.0% isolates of C. hominis, four (14.8% C. parvum, five (18.5% C. felis and one (3.7% C. canis. These findings suggest that, in urban environments of Brazil, the cat adapted C. felis may play a potential role in the zoonotic transmission of cryptosporidiosis whereas the anthroponotic transmission of cryptosporidiosis caused by C. hominis seems to predominate.Cryptosporidium spp. são importantes causas de doenças entéricas em humanos, mas podem também ser encontrados em animais. O presente estudo descreve a frequência relativa de diversas espécies de Cryptosporidium em amostras de humanos da cidade de São Paulo, Brasil, obtidas de janeiro a julho de 2007. Análises de sequências de produtos de nested PCR direcionadas ao genes codificadores da menor unidade ribosomal e da proteina de parede de oocistos revelaram 17 (63,0% isolados de C. hominis, quatro (14,8% C. parvum, cinco (18,5% C. felis, e um (3,7% C. canis. Estes resultados sugerem que, em ambientes urbanos no Brasil, o genótipo adaptado ao gato pode desempenhar potencial papel na transmissão zoonótica de criptosporidiose, enquanto a transmissão antroponótica da criptosporidiose causada pelo C. hominis parece predominar.

Molecular Method Development to Identify Foodborne Sarcocystishominis in Raw Beef Commercial Hamburger

Directory of Open Access Journals (Sweden)

Bahador Hajimohammadi

2014-11-01

Full Text Available Background: Sarcocystisspp. is zoonotic parasitic pathogen endangering safety of meat and derived meat products such as hamburgers which is among the most popular fast foods worldwide. Objectives: The current study aimed to design a protocol for molecular identification of Sarcocystis hominis in commercial hamburgers using PCR-RFLP with target of 18S rRNA. Materials and Methods: A total of 25 raw commercial hamburger samples were randomly collected from supermarkets of Yazd city, Iran. Five mm slices from different parts of each sample were selected, well mixed, and then preserved in ethanol 70% at -20°C for the next steps. The genomic DNA was extracted using salting out method. Detection and identification of Sarcocystis isolates were performed using PCR RFLP. The 18s rRNA gene sequence was mined from GenBank and the specific primer pair was designed using Primer3 software. Restriction fragment length polymorphims (RFLP analysis was performed using BfaI and RsaI restriction enzymes. The digestion was analyzed, using agarose gel electrophoresis alongside 100base pair DNA ladder. Results: Among 25 commercial hamburger samples, 17 samples showed a PCR product around 900 bp which could detect Sarcocyst Spp. After RFLP with BfaI, the restriction fragments of 376 bp and 397 bp detected S. hominis or S. hirsuta and fragments of 184 bp, 371 bp and 382 bp detected S. cruzi. After RFLP with RsaI, the restriction fragments of 376 bp and 557 bp detected S. hirsuta and fragment of 926 bp, without any digestion, detected S. hominis. For verification, each species detected in samples was randomly selected and sent for sequencing and the results were analyzed with BLAST. Conclusions: In conclusion, the current study developed a practical technique to detect the prevalence of S. hominis in meat products such as hamburgers.

Distribución y estado de conservación de los galápagos autóctonos, Emys orbicularis (Linnaeus, 1758 y Mauremys leprosa (Schweigger, 1812, en Castilla y León.

Directory of Open Access Journals (Sweden)

ALARCOS, G., FLECHOSO, F., LIZANA, M., MADRIGAL, J., ALVAREZ, F.

2013-01-01

(Schweigger, 1812 como de Emys orbicularis (Linnaeus, 1758. A pesar del aparente buen estado de alguna de estas poblaciones, se ha observado el declive en las zonas limítrofes de sus áreas de distribución. En otras provincias la presencia es anecdótica y casi residual. Cuando valoramos el estado de conservación regional obtuvimos que el galápago europeo se presenta como Vulnerable VUA3ceE y el galápago leproso como Casi Amenazado NT. Como principales factores del declive se señalan la desaparición de numerosos medios acuáticos, los cambios en el uso agrícola y la captura en nasas cangrejeras. Finalmente, se sugiere la realización de estudios específicos sobre poblaciones aisladas para determinar la necesidad de reproducción en cautividad para reforzarlas y conectarlas, y realizar estudios genéticos con el fin de valorar su origen como poblaciones introducidas o autóctonas. En obras o actuaciones sobre medios de presencia potencial realizar estudios específicos para minimizar los impactos negativos. También es importante realizar campañas de concienciación y buenas prácticas a determinados sectores, como el de los pescadores de cangrejos de río, que pueden afectar de forma directa y muy negativamente a las poblaciones.

Bone morphology of the hind limbs in two caviomorph rodents.

Science.gov (United States)

de Araújo, F A P; Sesoko, N F; Rahal, S C; Teixeira, C R; Müller, T R; Machado, M R F

2013-04-01

In order to evaluate the hind limbs of caviomorph rodents a descriptive analysis of the Cuniculus paca (Linnaeus, 1766) and Hydrochoerus hydrochaeris (Linnaeus, 1766) was performed using anatomical specimens, radiography, computed tomography (CT) and full-coloured prototype models to generate bone anatomy data. The appendicular skeleton of the two largest rodents of Neotropical America was compared with the previously reported anatomical features of Rattus norvegicus (Berkenhout, 1769) and domestic Cavia porcellus (Linnaeus, 1758). The structures were analyzed macroscopically and particular findings of each species reported. Features including the presence of articular fibular projection and lunulae were observed in the stifle joint of all rodents. Imaging aided in anatomical description and, specifically in the identification of bone structures in Cuniculus paca and Hydrochoerus hydrochaeris. The imaging findings were correlated with the anatomical structures observed. The data may be used in future studies comparing these animals to other rodents and mammalian species. © 2012 Blackwell Verlag GmbH.

Zooarqueologia dos mamíferos aquáticos e semi-aquáticos da Ilha de Santa Catarina, sul do Brasil

Directory of Open Access Journals (Sweden)

Pedro Volkmer de Castilho

2001-09-01

Full Text Available This study analyzes the use of aquatic mammals by prehistoric societies of Santa Catarina Island, Southern Brazil. Samples from two archaeological sites were examined: Rio do Meio (RM and Porto do Rio Vermelho (SCPRV. Nine aquatic mammal species were found: a pinnipeds: Arctocephalus australis (Zimmerman, 1783 and A. tropicalis (Gray, 1872, and b cetaceans: Eubalaena australis (Desmoulins, 1822, Delphinus delphis Linnaeus, 1758, Stenella frontalis (Cuvier, 1829, Steno bredanensis (Lesson, 1828, Tursiops truncatus (Montagu, 1821, Pontoporia blainvillei (Gervais & d'Orbigny, 1844 and a non-identified rorqual from the genus Balaenoptera Lacépède, 1804. Three especies of semi-aquatic mammals were also recorded: Hydrochoerus hydrochaeris (Linnaeus, 1758, Tapirus terrestris (Linnaeus, 1758 and Lontra longicaudis (Olfers,1818. Both sites presented similar species diversity, although abundance was greater at the most recent site (RM. There were more samples from axial skeletons, but in genera the anatomical regions were homogeneously distributed among the identified taxa.

[Chlamydia trachomatis and urogenital mycoplasms in nonconococcal urethritis in men].

Science.gov (United States)

Vesić, Sonja; Vukićević, Jelica; Gvozdenović, Eleonora; Skiljević, Dusan; Janosević, Slobodanka; Medenica, Ljiljana

2010-01-01

Nongonococcal urethritis is the most common sexually transmitted infection in men, with vast majority of the etiological agents such as Chlamydia trachomatis, followed by urogenital mycoplasmas. The aim of this study was to determine the prevalence of Chlamydia trachomatis, Ureaplasma urealyticum and Mycoplasma hominis in nongonococcal urethritis in men, and to examine infections associated with these agents. Material and methods 299 sexually active, heterosexual men with nongonococcal urethritis were included into the study. Urethral samples were taken with a dacron swab placed into the urethra up to 2-3 cm. The Direct immunofluorescence technique was performed for identification of Chlamydia trachomatis. Ureaplasma urealyticum and Mycoplasma hominis were detected with Mycoplasma IST assay. Chlamydia trachomatis was detected in 22.75%, Uraeplasma urealyticum in 21.08% and Mycoplasma hominis in 8.02% cases. We found no significant differences in prevalence between Chlamydia trachomatis and Ureaplasma urealyticym (p > 0.05). Monoinfections were found in 51.85% with significantly higher rate (p urethritis with prevalence of 51.85% in monoinfections and 11.70% in associated infections. In 36.45% of cases the etiology of urethritis was not elucidated. These results suggest that more sensitive diagnostic tool should be applied when searching for the derailed etiology of nongonococcal urethritis.

Detection of carboxylesterase and esterase activity in culturable gut bacterial flora isolated from diamondback moth, Plutella xylostella (Linnaeus), from India and its possible role in indoxacarb degradation.

Science.gov (United States)

Ramya, Shanivarsanthe Leelesh; Venkatesan, Thiruvengadam; Srinivasa Murthy, Kottilingam; Jalali, Sushil Kumar; Verghese, Abraham

2016-01-01

Diamondback moth (DBM), Plutella xylostella (Linnaeus), is a notorious pest of brassica crops worldwide and is resistant to all groups of insecticides. The insect system harbors diverse groups of microbiota, which in turn helps in enzymatic degradation of xenobiotic-like insecticides. The present study aimed to determine the diversity of gut microflora in DBM, quantify esterase activity and elucidate their possible role in degradation of indoxacarb. We screened 11 geographic populations of DBM in India and analyzed them for bacterial diversity. The culturable gut bacterial flora underwent molecular characterization with 16S rRNA. We obtained 25 bacterial isolates from larvae (n=13) and adults (n=12) of DBM. In larval gut isolates, gammaproteobacteria was the most abundant (76%), followed by bacilli (15.4%). Molecular characterization placed adult gut bacterial strains into three major classes based on abundance: gammaproteobacteria (66%), bacilli (16.7%) and flavobacteria (16.7%). Esterase activity from 19 gut bacterial isolates ranged from 0.072 to 2.32μmol/min/mg protein. Esterase bands were observed in 15 bacterial strains and the banding pattern differed in Bacillus cereus - KC985225 and Pantoea agglomerans - KC985229. The bands were characterized as carboxylesterase with profenofos used as an inhibitor. Minimal media study showed that B. cereus degraded indoxacarb up to 20%, so it could use indoxacarb for metabolism and growth. Furthermore, esterase activity was greater with minimal media than control media: 1.87 versus 0.26μmol/min/mg protein. Apart from the insect esterases, bacterial carboxylesterase may aid in the degradation of insecticides in DBM. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

Populations and home range relationships of the box turtle, Terrapene c. carolina (Linnaeus)

Science.gov (United States)

Stickel, L.F.

1950-01-01

SUMMARY: A population study of the box turtle (Terrapene c. carolina Linnaeus) was made during the years 1944 to 1947 at the Patuxent Research Refuge, Maryland. A thirty acre area in well drained bottomland forest on the flood plain of the Patuxent River was selected for intensive study. Similarly forested land extended in all directions from the study plot. Markers were established at eighty-three foot intervals over the study plot for reference in recording locality data. Individuals were marked by filing notches in the marginal scutes according to a code system. There were 2109 collections of study area turtles. Records of collecting sites and turtle behavior showed that in the bottomlands habitat cover is utilized extensively during the day as well as at night. Turtles not actively moving about are almost always found in or around brush piles, heaps of debris, and tangles of vines and briars. Gully banks and woods openings are used for sunning. Turtles are occasionally found in the mud or water of the gullies. The commonest type of night retreat is a cavity constructed by the turtle in leaves, debris, or earth. These cavities, termed 'forms,' may be used only once, but are sometimes used repeatedly, often at intervals of several days or more. Different turtles sometimes use the same form on successive nights. Weather conditions most favorable to turtle activity are high humidity, warm sunny days, and frequent rains. The most unfavorable influences are low temperatures and drought. On most summer days there are some active turtles but individual turtles are not active every day. Periods of activity are alternated with periods of quiet even in favorable weather. This behavior is most pronounced in early spring and late fall when inactive days are often more numerous than active ones. Adult turtles occupy specific home ranges which they maintain from year to year. The turtles living in the study plot retained their ranges even through a flood that completely

Infracommunities of intestinal helminths of the Red Fox Vulpes vulpes (Linnaeus, 1758 from Italian Alps

Directory of Open Access Journals (Sweden)

Anna Rita Di Cerbo

2003-10-01

Full Text Available Vulpes vulpes (Linnaeus, 1758 is one of the most common carnivore in Italy and its spread includes almost the whole national territory. The species shows an high ecological plasticity and a variable diet composition connected in part to human sources. This high adaptability permits the red foxes to colonize different habitats like the suburbs of large cities as well as the small villages located in mountain areas. On the other hand, the tourism pressure seems to assume a great importance in the Alps, also in those areas where the foxes live. So, indirect interactions could take place between these animals and the humans. The role of V. vulpes in the zoonoses has not to be understated since this carnivore could transmit parasitic diseases that are able to cause serious pathologies in humans. This study aims just to investigate on intestinal communities of helmiths of V. vulpes in order to make progress in current knowledge on epidemiological situation in Italian Alps. During 1998-2003, we have examined 450 foxes from Trentino Alto Adige, Veneto, Lombardia and Valle d'Aosta. The specimens collected were found dead or have been hunted (according to national law n. 157/92 in localities situated between 170 and 2200 m a.s.l. The carcasses were carried to the provincial sections of Zooprofilattici Institutes, where the intestine was drawn by each sample and all the material was sent to the Faculty of Veterinary Medicine of Milan. Parasitological examination of the small intestines was performed by the analysis of the whole sediment and counting technique (SCT. Parasites were preserved in alcohol 70° before to be clarified or stained and identified by microscope (Zeiss Axioscop. Mean abundance, mean intensity and prevalence were calculated for each taxon of helminth. Dates of sampling were grouped within the four seasons. Statistic tests were performed with software package SPSS rel. 11.5 and spatial analysis with the

New tick records in Rondônia, Western Brazilian Amazon Novos relatos de carrapatos em Rondônia, Amazônia ocidental brasileira

Directory of Open Access Journals (Sweden)

Marcelo Bahia Labruna

2010-09-01

Full Text Available In the present study, we provide new tick records from Vilhena Municipality, in the Southeast of the State of Rondônia, Northern Brazil. Ticks collected from a capybara, Hydrochoerus hydrochaeris (Linnaeus, were identified as Amblyomma romitii Tonelli-Rondelli (1 female, and Amblyomma sp. (1 larva. Ticks collected from a harpy eagle, Harpia harpyja (Linnaeus, were identified as Amblyomma cajennense (Fabricius (16 nymphs and Haemaphysalis juxtakochi Cooley (1 nymph. Ticks collected from a yellow-footed tortoise, Chelonoidis denticulada (Linnaeus, were identified as Amblyomma rotundatum Koch (10 females, 2 nymphs, and Amblyomma sp. (2 larvae. The present record of A. romitii is the first in the State of Rondônia, and represents the southernmost record for this tick species, indicating that its distribution area is much larger than currently recognized. Although both A. cajennense and H. juxtakochi have been reported parasitizing various bird species, we provide the first tick records on a harpy eagle. A. rotundatum is widespread in the State of Rondônia, and has been previously reported on the yellow-footed tortoise. The present records increase the tick fauna of Rondônia to 26 species.O presente estudo relata novos achados de carrapatos provenientes do Município de Vilhena, Sudeste do Estado de Rondônia, na região Norte do Brasil. Carrapatos colhidos de uma capivara, Hydrochoerus hydrochaeris (Linnaeus, foram identificados como Amblyomma romitii Tonelli-Rondelli (1 fêmea e Amblyomma sp. (1 larva. Carrapatos colhidos de uma águia harpia, Harpia harpyja (Linnaeus, foram identificados como Amblyomma cajennense (Fabricius (16 ninfas e Haemaphysalis juxtakochi Cooley (1 ninfa. Carrapatos colhidos de um jabuti, Chelonoidis denticulada (Linnaeus, foram identificados como Amblyomma rotundatum Koch (10 fêmeas, 2 ninfas e Amblyomma sp. (2 larvas. O presente achado de A. romitii é o primeiro no Estado de Rondônia, representando o achado mais

Helminths parasites of whales in Brazil

Directory of Open Access Journals (Sweden)

Luís C. Muniz-Pereira

1999-01-01

Full Text Available Three species of whale Balaenoptera borealis Lesson, 1828, B. physalus (Linnaeus, 1758 and Physeter catodon Linnaeus, 1758 captured in the Brazilian coast were necropsied for helminths. Balaenoptera borealis and B. physalus were infected by Crassicauda crassicauda (Nematoda, Tetrameridae and Ogmogaster antarcticus (Digenea: Notocotylidae, which are referred for the first time in Brazil. Balaenoptera borealis was also infected by Lecithodesmus goliath (Digenea, Campulidae and Bolbosoma turbinella (Acanthocephala, Polymorphidae. Physeter catodon was infected by Anisakis physeteris (Nematoda, Anisakidae, which is a new record to this host in Brazilian waters.

Interaction of Microbiology and Pathology in Women Undergoing Investigations for Infertility

Directory of Open Access Journals (Sweden)

Joseph Debattista

2004-01-01

asymptomatic women undergoing investigation of infertility were correlated with the outcomes of microbiological screening for Chlamydia trachomatis, Mycoplasma pneumoniae, Mycoplasma hominis, ureaplasma species, Neisseria gonorrhoeae, Neisseria meningitidis and Chlamydia pneumoniae.

Total and cytosolic concentrations of twenty metals/metalloids in the liver of brown trout Salmo trutta (Linnaeus, 1758) from the karstic Croatian river Krka.

Science.gov (United States)

Dragun, Zrinka; Filipović Marijić, Vlatka; Krasnići, Nesrete; Ivanković, Dušica; Valić, Damir; Žunić, Jakov; Kapetanović, Damir; Smrzlić, Irena Vardić; Redžović, Zuzana; Grgić, Ivana; Erk, Marijana

2018-01-01

Total and cytosolic concentrations of twenty metals/metalloids in the liver of brown trout Salmo trutta (Linnaeus, 1758) were studied in the period from April 2015 to May 2016 at two sampling sites on Croatian river Krka, to establish if river water contamination with metals/metalloids downstream of Knin town has influenced metal bioaccumulation in S. trutta liver. Differences were observed between two sites, with higher concentrations of several elements (Ag, As, Ca, Co, Na, Se, Sr, V) found downstream of Knin town, whereas few others (Cd, Cs, Mo, Tl) were, unexpectedly, increased at the Krka River spring. However, total metal/metalloid concentrations in the liver of S. trutta from both sites of the Krka River were still mainly below previously reported levels for pristine freshwaters worldwide. The analysis of seasonal changes of metal/metalloid concentrations in S. trutta liver and their association with fish sex and size mostly indicated their independence of fish physiology, making them good indicators of water contamination and exposure level. Metal/metalloid concentrations in the metabolically available hepatic cytosolic fractions reported in this study are the first data of that kind for S. trutta liver, and the majority of analyzed elements were present in the cytosol in the quantity higher than 50% of their total concentrations, thus indicating their possible availability for toxic effects. However, the special attention should be directed to As, Cd, Cs, and Tl, which under the conditions of increased exposure tended to accumulate more within the cytosol. Although metal/metalloid concentrations in S. trutta liver were still rather low, monitoring of the Krka River water quality and of the health status of its biota is essential due to a trend of higher metal/metalloid bioaccumulation downstream of Knin town, especially taking into consideration the proximity of National Park Krka and the need for its conservation. Copyright © 2017 Elsevier Inc. All

Evaluación del impacto de la caza en mamíferos de la cuenca del río Alto Itaya, Amazonía peruana

Directory of Open Access Journals (Sweden)

Rolando Aquino

2013-04-01

Full Text Available En el presente trabajo se informa sobre la abundancia, presión de caza y el impacto de la caza en mamíferos que habitan los bosques de la cuenca del río Alto Itaya. La información procede de censos por transectos y registros de caza llevados a cabo en seis comunidades. Entre los mamíferos de caza, el choro (Lagothrix poeppigii Schinz fue el más abundante con 15,4 individuos/km², mientras que el mono aullador (Alouatta seniculus Linnaeus y el venado colorado (Mazama americana Erxleben fueron los menos abundantes con 0,15 individuos/km² y 0,5 individuos/ km2, respectivamente. Por otro lado, del área fueron cosechados un promedio anual de 1176 mamíferos, equivalente a 14184,6 kg. Finalmente, el modelo de cosecha sugiere sobrecaza del tapir (Tapirus terrestris Linnaeus, huangana (Tayassu pecari Link, choro (L. poeppigii, mono aullador (A. seniculus y machín negro (Cebus apella Linnaeus, cuyas cosechas en algunos casos alcanzaron el 100% de la producción anual.

Phenotypic, Genotypic, and Antimicrobial Characteristics of Streptococcus halichoeri Isolates from Humans, Proposal To Rename Streptococcus halichoeri as Streptococcus halichoeri subsp. halichoeri, and Description of Streptococcus halichoeri subsp. hominis subsp. nov., a Bacterium Associated with Human Clinical Infections.

Science.gov (United States)

Shewmaker, P L; Whitney, A M; Humrighouse, B W

2016-03-01

Phenotypic, genotypic, and antimicrobial characteristics of six phenotypically distinct human clinical isolates that most closely resembled the type strain of Streptococcus halichoeri isolated from a seal are presented. Sequencing of the 16S rRNA, rpoB, sodA, and recN genes; comparative whole-genome analysis; conventional biochemical and Rapid ID 32 Strep identification methods; and antimicrobial susceptibility testing were performed on the human isolates, the type strain of S. halichoeri, and type strains of closely related species. The six human clinical isolates were biochemically indistinguishable from each other and showed 100% 16S rRNA, rpoB, sodA, and recN gene sequence similarity. Comparative 16S rRNA gene sequencing analysis revealed 98.6% similarity to S. halichoeri CCUG 48324(T), 97.9% similarity to S. canis ATCC 43496(T), and 97.8% similarity to S. ictaluri ATCC BAA-1300(T). A 3,530-bp fragment of the rpoB gene was 98.8% similar to the S. halichoeri type strain, 84.6% to the S. canis type strain, and 83.8% to the S. ictaluri type strain. The S. halichoeri type strain and the human clinical isolates were susceptible to the antimicrobials tested based on CLSI guidelines for Streptococcus species viridans group with the exception of tetracycline and erythromycin. The human isolates were phenotypically distinct from the type strain isolated from a seal; comparative whole-genome sequence analysis confirmed that the human isolates were S. halichoeri. On the basis of these results, a novel subspecies, Streptococcus halichoeri subsp. hominis, is proposed for the human isolates and Streptococcus halichoeri subsp. halichoeri is proposed for the gray seal isolates. The type strain of the novel subspecies is SS1844(T) = CCUG 67100(T) = LMG 28801(T). Copyright © 2016, American Society for Microbiology. All Rights Reserved.

Desenvolvimento de Podisus nigrispinus (Dallas (Heteroptera, Pentatomidae com Zophobas confusa Gebien (Coleoptera, Tenebrionidae comparado à duas outras presas alternativas Development of Podisus nigrispinus (Dallas (Heteroptera, Pentatomidae fed with Zophobas confusa Gebien (Coleoptera, Tenebrionidae compared with two another alternative preys

Directory of Open Access Journals (Sweden)

Teresinha V Zanuncio

1996-01-01

Full Text Available Nymphs of Podisus nigrispinus (Dallas, 1851 were fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae and Musca domestica Linnaeus, 1758 (Diptera, Muscidae under 25±0.5ºC, 60±10% of RH and photophase of 12h. Nymphal viability of P. nigrispinus were 64.0%, 80.0% and 92.0% with Z. confusa, M. domestica and T. molitor, respectively. No differences were found for pre-oviposition period, number of egg masses, number of eggs, egg viability, and longevity for females of this predator fed with any of these preys.

Influência do período de quiescência dos ovos sobre o ciclo de vida de Aedes aegypti (Linnaeus, 1762 (Diptera, Culicidae em condições de laboratório

Directory of Open Access Journals (Sweden)

Silva Heloisa Helena Garcia da

1999-01-01

Full Text Available Estudou-se a influência do período de quiescência dos ovos no ciclo de vida de Aedes aegypti (Linnaeus, 1762 (Diptera, Culicidae em condições de laboratório, na busca de informações que possam melhorar o direcionamento das ações de controle, pois sabe-se que o ovo é a forma mais resistente do ciclo biológico, possibilitando ao mosquito ampla sobrevida, devido à resistência às adversidades climáticas. Os experimentos foram realizados numa câmara biológica, mantida à temperatura de 28 ± 1oC, com umidade relativa de 80 ± 5% e fotofase de 12 horas. Apresentam-se os dados da influência de diferentes períodos de quiescência sobre a eclosão das larvas, desenvolvimento larval e pupal, ciclo evolutivo. Verificou-se o efeito altamente significativo do período de quiescência na eclosão das larvas. O período de quiescência não influenciou nas durações dos períodos de incubação, larval e pupal. Constatou-se que ovos de um mesmo período de quiescência apresentaram períodos de incubação estatisticamente diferentes entre si. As larvas eclodiam em grupos, definidos pela incubação, e este efeito de grupo foi significativo na duração do ciclo. Pode-se afirmar que, em 99,8% dos ciclos, a variação foi determinada pela incubação.

Growth performance and carcass characteristics of Tanzania Shorthorn Zebu cattle finished on molasses or maize grain with rice or maize by-products

DEFF Research Database (Denmark)

Asimwe, I.; Kimambo, A. E.; Laswai, G. H.

2015-01-01

Forty five steers (2.5–3.0 years of age and 200±5 (SEM) kg body weight) were allotted randomly into five diets to assess the effects of finishing Tanzania Shorthorn Zebu (TSZ) cattle in feedlot using diets based on either molasses or maize grain combined with maize or rice by-products. The diets...... were hay and concentrate mixtures of hominy feed with molasses (HFMO), rice polishing with molasses (RPMO), hominy feed with maize meal (HFMM), rice polishing with maize meal (RPMM) and a control of maize meal with molasses (MMMO). All concentrate mixtures contained cotton seed cake, mineral mixture.......35 for HFMO) than in maize grain based diets (6.94, 6.73 and 6.19 for RPMM, MMMO and HFMM, respectively). Energy intake was highest (P

How nest translocation-time, clutch size and presence of yolkless eggs affected hatching success in Dermochelys coriacea (Linnaeus, 1766 (Testudines: Dermochelyidae, at Projeto Tamar-Ibama, Espirito Santo, Brazil

Directory of Open Access Journals (Sweden)

Dal Pont Morisso, Eduardo

2004-07-01

Full Text Available En este estudio se analizó el manejo de los nidos de la especie Dermochelys coriacea, utilizados por el Proyecto Tamar-Ibama entre las temporadas reproductivas de 1989/1990 a 1998/1999, para verificación del éxito de la eclosión en relación a los tiempos de traslación. El estudio se realizó en el litoral norte del Estado de Espírito Santo. Existió tendencia a que el tiempo de traslación influencie el éxito de eclosión de los nidos. Los nidos trasladados entre 6 y más de 24 horas presentaron mayor cantidad de huevos sin desarrollo embrionario. No se encontró relación entre el número de huevos inviables trasladados y el tamaño de la postura, con el porcentual de eclosión. Se sugiere que la traslación sea realizada hasta las 6 horas, o 15 días después de la oviposición. The results of managing Dermochelys coriacea (Linnaeus, 1766 nests by Projeto TAMAR - IBAMA, in Northern Espírito Santo, Brazil, during the nesting seasons from 1989/90 to 1998/99 are analyzed. The influence of the translocation time on hatching success of the studied nests is discussed. The time translocation, in relation to natural oviposition, seems to increase the number of non-developed eggs found in each nest if translocated between 6 hours and 15 days post egg-laying. There was no relationship established between either the number of yolkless eggs in a translocated nest or the clutch size, with hatching success. The translocation of Dermochelys nests either within 6 hours or after 15 days from natural oviposition is recommended.

in the Upper and Lower Genital Tracts of Fertile and Infertile Populations

Directory of Open Access Journals (Sweden)

Mark G. Martens

1993-01-01

Full Text Available Objective: The genital mycoplasmas (Mycoplasma hominis and Ureaplasma urealyticum and Chlamydia trachomatis have been implicated as possible etiologic factors in infertility. Their role in patients with infertility needs to be further defined.

Avaliação hematológica e dosagem bioquímica de ALT, AST e creatinina em elefante-marinho-do-sul, Mirounga leonina (linnaeus, 1758, encontrado no litoral de Salvador, Bahia

Directory of Open Access Journals (Sweden)

Bruno Lopes Bastos

2006-02-01

Full Text Available Since 1999 the Aquatic Mammals Rescue Center - AMRC has been working in the rescue and rehabilitation of stranded cetaceans and pinnipeds on the coast of Bahia, Brazil. This paper presents and analyses the blood cells count and clinical chemistry of alanine aminotransferase (ALT, aspartate aminotransferase (AST and creatinine of a southern elephant seal, Mirounga leonina (LINNAEUS, 1758, found on February the 11th at Barra Beach, Salvador, BA. The specimen was an orphan male calf, with 137cm of length and estimated weight of 49kg. It presented bad nutritional conditions and a shark bite on the right shoulder area. Clinical management was performed for 56 days, anthelmintic Febendazole was utilized, and the bite was treated with iodined alcohol, Nitrofurazone solution and Kethanserin, simultaneously with Enrofloxacin 10%, Potenay®, Vitamin B Complex and Benerva®. On the 16th the animal presented a right unilateral conjuntivitis, treated with Cloranphenicol oftalmic pomade until the end of its stay in the captive. During this period a total of six blood samples were collected, three for total blood counts and the others for the biochemistry determination of ALT, AST and creatinine. According to the haematological analysis the seal developed an anaemia which was classified as microcytic and normochromic. Lymphopenia, eosinopenia and monocytopenia were also observed, possibly due to its handling and stress conditions. The clinical chemistry presented low values for AST and creatinine, although this did not represent the existence of any pathologic context or disease with clinical significance.

New tick records in Rondônia, Western Brazilian Amazon.

Science.gov (United States)

Labruna, Marcelo Bahia; Barbieri, Fábio Silva; Martins, Thiago Fernandes; Brito, Luciana Gatto; Ribeiro, Francisco Dimas Sales

2010-01-01

In the present study, we provide new tick records from Vilhena Municipality, in the Southeast of the State of Rondônia, Northern Brazil. Ticks collected from a capybara, Hydrochoerus hydrochaeris (Linnaeus), were identified as Amblyomma romitii Tonelli-Rondelli (1 female), and Amblyomma sp. (1 larva). Ticks collected from a harpy eagle, Harpia harpyja (Linnaeus), were identified as Amblyomma cajennense (Fabricius) (16 nymphs) and Haemaphysalis juxtakochi Cooley (1 nymph). Ticks collected from a yellow-footed tortoise, Chelonoidis denticulada (Linnaeus), were identified as Amblyomma rotundatum Koch (10 females, 2 nymphs), and Amblyomma sp. (2 larvae). The present record of A. romitii is the first in the State of Rondônia, and represents the southernmost record for this tick species, indicating that its distribution area is much larger than currently recognized. Although both A. cajennense and H. juxtakochi have been reported parasitizing various bird species, we provide the first tick records on a harpy eagle. A. rotundatum is widespread in the State of Rondônia, and has been previously reported on the yellow-footed tortoise. The present records increase the tick fauna of Rondônia to 26 species.

7 CFR 360.200 - Designation of noxious weeds.

Science.gov (United States)

2010-01-01

... mantegazzianum Sommier & Levier (giant hogweed) Homeria spp. Imperata brasiliensis Trinius (Brazilian satintail) Imperata cylindrica (Linnaeus) Raeuschel (cogongrass) Ischaemum rugosum Salisbury (murainograss) Leptochloa...

Ten new records of marine invertebrates from the Azores

Directory of Open Access Journals (Sweden)

WIRTZ, P.

2009-01-01

Full Text Available The sea anemones Telmatactis cricoides (Duchassaign, 1850 and Actinia n. sp., themolluscs Tonna galea Linnaeus, 1758, Vitreolina philippi (de Rayneval & Ponzi, 1854,Melanella n. sp., Phidiana lynceus (de Rayneval & Ponzi, 1854 and Anomia patelliformis(Linnaeus, 1761, the nemertine Baseodiscus delineatus (DelleChiaje, 1825 and the echinoderms Leptosynapta inhaerens (O. F. Müller, 1776 and Stichopus regalis (Cuvier, 1817, are here recorded from the Azores for the first time. The presence of the two starfishspecies Chaetaster longipes (Retzius, 1805 and Luidia ciliaris (Philippi, 1837 in the Azores is confirmed and the spawning behaviour of the sea urchin Echinocyamus pusillus (O. F. Müller, 1776 is described.

Aspectos bionômicos de Eois tegularia (Guenée e Eois glauculata (Walker (Lepidoptera, Geometridae, Larentiinae e seus parasitóides Bionomic aspects of Eois tegularia (Guenée and Eois glauculata (Walker (Lepidoptera, Geometridae, Larentiinae and their parasitoids

Directory of Open Access Journals (Sweden)

Sandra Maria Pasenow Braga

2001-09-01

Full Text Available Eois tegularia (Guenée, [1858] and Eois glauculata (Walker, [1863] larvae were studied by one year in semidec iduous forest at Canchim Farm (EMBRAPA, São Carlos, São Paulo, Brazil. Specimens were hosted by species of Piper Linnaeus (Piperaceae: P. mollicomum Kunth, P. amalogo Linnaeus, P. glabratum Kunth and P. gaudichaudianum Kunth. Some parasitoids were reared from the larvae of Eois Hübner, 1818 species, as follow. Hymenoptera: Cotesia Cameron, 1891, Apanteles Foerster, 1862, Glyptapanteles Ashmead, 1904, Dolichogenidea Viereck, 1911, Meteorus Haliday, 1835 (Braconidae; Mesochorus Gravenhorst, 1829, Venturia Schrottky, 1902 (Ichneumonidae; Elachertus Spinola, 1811 (Eulophidae; Perilampus Latreille, 1809 (Perilampidae, Diptera: Myiopharus Brauer & Bergenstamm, 1889 (Tachinidae.

Efficacy of magneto-laser therapy in the treatment of ureaplasma infection

Directory of Open Access Journals (Sweden)

N N Aliev

2018-04-01

Full Text Available Aim. To study clinical and epidemiological data in males and females with ureaplasma infection and to evaluate efficacy of magneto-laser therapy used as additional treatment of ureaplasma infection. Methods. 104 patients (94 men and 10 women with urogenital ureaplasma infection were observed. Patients were divided into two groups: a study group (n=55 that received standard and magneto-laser therapy, and a comparison group (n=49 that received only standard treatment. Polymerase chain reaction was used to investigate samples for Mycoplasma hominis, Ureaplasma parvum and urealyticum, and bacteriological study for Mycoplasma hominis and Ureaplasma spp. was additionally performed with determining their antibiotic susceptibility. Magnetic therapy was conducted with the use of Michelangelo device (Italy for 10 minutes to small pelvis area for 10 days. Results. As a result, 78 (82.9% males were diagnosed with uretritis, 52 (55.3% with prostatitis, 37 (39.3% with cystitis. In females monoinfection was more prevalent than in males (50.0% vs 40.4%. Ureaplasmosis predominantly affected subjects aged 20-29 (97.8% and 30-39 (86.0% years. In female group, patients aged 20-29 years prevailed, while in a male group - patients aged 30-39 years. In males, the association of Ureaplasma with Mycoplasma hominis (36.1% prevailed. Conclusion. Complex treatment of ureaplasma infection of urogenital tract including magneto-laser therapy demonstrated high clinical efficacy and allowed achieving clinical and laboratory cure of ureaplasma infection in 85.4% of cases.

Mamíferos do município de Fênix, Paraná, Brasil: etnozoologia e conservação Mammals of the municipality of Fênix, Paraná, Brazil: ethnozoology and conservation

Directory of Open Access Journals (Sweden)

Fabiana Rocha-Mendes

2005-12-01

Full Text Available Com base na abordagem etnozoológica foram resgatadas informações históricas e atuais sobre a mastofauna do município de Fênix, mesorregião centro-ocidental do estado do Paraná, sul do Brasil. Para tanto, no ano de 2004, foram realizadas entrevistas com 19 moradores locais por meio de uma conversa informal que tinham por objetivo o preenchimento de um questionário básico e a apresentação de fotografias da fauna potencial da região. Como resultado, foram registradas 39 espécies de mamíferos, sendo que destas, pelo menos seis são novos registros para a área. Informações obtidas em relação à caça indicam que esta atividade, muito comum no passado, ainda é presente, inclusive em unidades de conservação, como o Parque Estadual Vila Rica do Espírito Santo. As espécies que sofreram e sofrem maior pressão de caça são as mesmas citadas para outras partes do neotrópico. Atualmente, Hydrochaeris hydrochaeris (Linnaeus, 1766 (Hydrochaeridae é a espécie mais procurada, dada à facilidade de encontrá-la em diversas áreas naturais ou parcialmente antropizadas do município. No que se refere à predação causada por animais silvestres sobre animais domésticos, quase 80% dos entrevistados relataram ter sofrido perdas em suas criações, principalmente galinhas, resultantes de ataques de carnívoros de médio porte. Dados sobre alterações temporais na composição da mastofauna também foram obtidos junto aos entrevistados, como a extinção local de alguns mamíferos de grande porte (Panthera onca (Linnaeus, 1758 (Felidae, Tapirus terrestris (Linnaeus, 1758 (Tapiridae e Tayassu pecari (Link, 1795 (Tayassuidae e o aumento populacional de Cebus nigritus (Goldfuss, 1809 (Cebidae e de Nasua nasua (Linnaeus 1766 (Procyonidae, supostamente relacionado ao consumo de plantações como o milho.Based on an ethnozoological approach we obtained historical and present information on the mammalian fauna of the municipality of Fênix

Mamíferos de médio e grande porte e sua relação com o mosaico de habitats na cuesta de Botucatu, Estado de São Paulo, Brasil

Directory of Open Access Journals (Sweden)

Telma R. Alves

2012-06-01

Full Text Available A região da cuesta de Botucatu caracteriza-se por um gradiente topográfico contendo um mosaico de ambientes com diferentes formações de vegetação natural (floresta estacional semidecidual, cerrado e matas ciliares, além de áreas antropizadas com a predominância de pastagens, plantações de cana-de-açúcar, laranja, e reflorestamentos de eucalipto, com paisagem fragmentada. Inserida nesta região, a Fazenda Experimental Edgardia, pertencente à Universidade Estadual Paulista, Campus de Botucatu, representa uma amostra desta heterogeneidade ambiental, tendo grande importância para a conservação da biodiversidade, tanto de flora como fauna. Entretanto, poucos são os estudos sobre a sua fauna, principalmente de mamíferos. O presente trabalho teve como objetivo conhecer a fauna de mamíferos de médio e grande porte nesta área, e sua relação com o mosaico de habitats. Foram obtidos registros indiretos da presença de mamíferos através de vestígios (pegadas e fezes em transectos (trilhas pré-existentes, ao longo de um ano. De março de 2004 a março de 2005 foram registradas 18 espécies de mamíferos silvestres de médio e grande porte. Quanto à ocorrência destacou-se Mazama sp., presente em todos os ambientes, com maior abundância relativa no ambiente de transição de floresta/Cerradão. Puma concolor (Linnaeus, 1771, Leopardus pardalis (Linnaeus, 1758, Cerdocyon thous (Linnaeus, 1766, Procyon cancrivorus (Cuvier, 1798 e Dasypus novemcinctus (Linnaeus, 1758 também foram encontradas em praticamente todos os ambientes, e espécies como Chironectes minimus (Zimmermann, 1780, Cuniculus paca Linnaeus, 1766, Eira barbara (Linnaeus, 1758 e uma espécie do gênero Conepatus Gray, 1837 estiveram restritas a ambientes específicos. A análise de correspondência mostrou oito espécies com ocorrência em todos os ambientes: sete mais associadas aos ambientes de várzea, floresta e pastagem e três aos ambientes de cultura de arroz

Sarcocystis in Biology of Foodborne Parasites CRC Press

Science.gov (United States)

People can contract infections by consuming beef infected with Sarcocystis hominis or pork infected with Sarcocystis suihominis. Proper cooking can eliminate this foodborne risk of infection. Here, the biology of such parasites is thoroughly reviewed, focusing on the epidemiology, diagnosis, treat...

Evaluation of corrosion and corrosion control on interstate 89 bridge #30 and #31.

Science.gov (United States)

2015-06-01

This report summarizes the evaluation of the performance of cathodic protection installed on I-89 bridges over : Gile Pond Road (NH Route 114) during a rehabilitation project in 1987. : Control bridges of I-89 over Hominy Pot Road, approximately 1.5 ...

United States Air Force Graduate Student Research Program for 1990. Program Technical Report. Volume 2

Science.gov (United States)

1991-06-05

Paul Lemke*** 105 Organizational Learning and Aircrew Performance Thomas Broersma 106 PCR Analysis of Ureaplasma urealyticum and Joseph Brogan...Eye Robyn Robinson 115 PCR Analysis of Ureaplasma urealyticum and Robert Sabatini Mycoplasma hominis *** Same Report as Dr. Vito DelVecchio *** 116

A note on the occurrence of praniza larvae of Gnathiidae (Crustacea, Isopoda on fishes from Northeast of Pará, Brazil

Directory of Open Access Journals (Sweden)

Daniel G. Diniz

2008-12-01

Full Text Available The infection of the estuarine teleost fishes Mugil gaimardianus Desmarest, 1831 (Mugilidae, Arius phrygiatus Valenciennes, 1839 (Ariidae, Conodon nobilis Linnaeus, 1759 (Haemulidae, Cetengraulis edentulus Cuvier, 1829 (Engraulidae, and Anableps anableps Linnaeus, 1758 (Anablepidae by praniza larvae of Gnathiidae (Crustacea, Isopoda was studied in specimens fished off the Atlantic Ocean in Northeast of Pará State, near Bragança, Brazil. The highest infection prevalence value was found in Anableps anableps (42.3% and the lowest in Conodon nobilis (9.1%. The mean intensity varied from 1 parasitein Conodon nobilis to 19.5 in Arius phrygiatus. A description of the larvae is provided. The morphology of the mouthparts is related to the blood sucking activity, and is compared with the characteristics of other gnathiidae species.Foi estudada a parasitose dos peixes estuarinos Mugil gaimardianus Desmarest, 1831 (Mugilidae, Arius phrygiatus Valenciennes, 1839 (Ariidae, Conodon nobilis Linnaeus, 1759 (Haemulidae, Cetengraulis edentulus Cuvier, 1829 (Engraulidae, e Anableps anableps Linnaeus, 1758 (Anablepidae por larvas praniza de Gnathiidae (Crustacea, Isopoda em exemplares pescados no Oceano Atlântico, no Nordeste do Pará, próximo a Bragança, Brasil. O valor mais elevado da prevalência da infecção foi observado em A. anableps (42,3% e o menor em C. nobilis (9,1%. A intensidade média da parasitose variou entre 1 parasita em C. nobilis até 19,5 em A. phrygiatus. Efetua-se a descrição da larva, verificando-se que a morfologia da armadura bucal está relacionada com a atividade sugadora de sangue, e faz-se a comparação com as características de outras espécies.

Molecular Characterization of Cryptosporidium Species and Giardia duodenalis from Symptomatic Cambodian Children

Science.gov (United States)

Moore, Catrin E.; Elwin, Kristin; Phot, Nget; Seng, Chanthou; Mao, Saroeun; Suy, Kuong; Kumar, Varun; Nader, Johanna; Bousfield, Rachel; Perera, Sanuki; Bailey, J. Wendi; Beeching, Nicholas J.; Day, Nicholas P. J.; Parry, Christopher M.; Chalmers, Rachel M.

2016-01-01

Background In a prospective study, 498 single faecal samples from children aged under 16 years attending an outpatient clinic in the Angkor Hospital for Children, northwest Cambodia, were examined for Cryptosporidium oocysts and Giardia cysts using microscopy and molecular assays. Methodology/Principal Findings Cryptosporidium oocysts were detected in 2.2% (11/498) of samples using microscopy and in 7.7% (38/498) with molecular tests. Giardia duodenalis cysts were detected in 18.9% (94/498) by microscopy and 27.7% (138/498) by molecular tests; 82% of the positive samples (by either method) were from children aged 1–10 years. Cryptosporidium hominis was the most common species of Cryptosporidium, detected in 13 (34.2%) samples, followed by Cryptosporidium meleagridis in 9 (23.7%), Cryptosporidium parvum in 8 (21.1%), Cryptosporidium canis in 5 (13.2%), and Cryptosporidium suis and Cryptosporidium ubiquitum in one sample each. Cryptosporidium hominis and C. parvum positive samples were subtyped by sequencing the GP60 gene: C. hominis IaA16R6 and C. parvum IIeA7G1 were the most abundant subtypes. Giardia duodenalis was typed using a multiplex real-time PCR targeting assemblages A and B. Assemblage B (106; 76.8% of all Giardia positive samples) was most common followed by A (12.3%) and mixed infections (5.1%). Risk factors associated with Cryptosporidium were malnutrition (AOR 9.63, 95% CI 1.67–55.46), chronic medical diagnoses (AOR 4.51, 95% CI 1.79–11.34) and the presence of birds in the household (AOR 2.99, 95% CI 1.16–7.73); specifically C. hominis (p = 0.03) and C. meleagridis (p<0.001) were associated with the presence of birds. The use of soap was protective against Giardia infection (OR 0.74, 95% CI 0.58–0.95). Conclusions/Significance This is the first report to describe the different Cryptosporidium species and subtypes and Giardia duodenalis assemblages in Cambodian children. The variety of Cryptosporidium species detected indicates both

Rapid detection of dihydropteroate polymorphism in AIDS-related Pneumocystis carinii pneumonia by restriction fragment length polymorphism

DEFF Research Database (Denmark)

Helweg-Larsen, J; Eugen-Olsen, J; Lundgren, B

2000-01-01

Sulpha agents, which act by inhibiting the enzyme dihydropteroate synthase (DHPS), are used widely for the treatment and prophylaxis of Pneumocystis carinii pneumonia (PCP). Recently, we have shown that mutations in the dihydropteroate synthase (DHPS) gene of Pneumocystis carinii f.sp hominis...

A foodborne outbreak of Cryptosporidium hominis infection

DEFF Research Database (Denmark)

Ethelberg, S.; Lisby, M.; Vestergaard, L. S.

2009-01-01

separate salad bar ingredients were found to be likely sources: peeled whole carrots served in a bowl of water, grated carrots, and red peppers (in multivariate analysis, whole carrots: OR 2.1, 95% CI 1.1-4.0; grated carrots: OR 2.1, 95% CI 1.2-3.9; peppers: OR 3.3, 95% CI 1.7-6.6). We speculate...

First report of blood parasites in fishes from Kashmir and their effect on the haematological profile

Directory of Open Access Journals (Sweden)

N. Shahi1

2013-09-01

Full Text Available Cyprinus carpio communis Linnaeus, Carassius carassius Linnaeus, Schizothorax curvifrons Heckel and Triplophysa marmorata species of fishes were captured from Anchar Lake and river Jhelum of Kashmir Himalaya for hematological and parasitological analysis. During the investigation haemoflagellates from the genus Babesiosoma and Trypanosoma were recorded in the blood smears. Trypanosomes were present in all the species except C. carpio, whereas Babesiosoma were only found in T. marmorata. Haematological analysis revealed a significant (p<0.01 reduction in red blood cell count in the fishes infected with Babesiosoma and Trypanosoma. A significant decrease (p<0.05 was recorded in haemoglobin value and packed cell volume in the infected fishes in comparison to the non-infected fishes.

A preliminary checklist of butterflies (Lepidoptera: Rhophalocera of Mendrelgang, Tsirang District, Bhutan

Directory of Open Access Journals (Sweden)

I.J. Singh

2014-05-01

Full Text Available The survey was conducted to prepare a preliminary checklist of butterflies of Mendrelgang, Bhutan. Butterflies were sampled from February 2012 to February 2013 to assess the species richness in a degraded forest patch of a sub-tropical broadleaf forest. This short-term study recorded 125 species of butterflies in 78 genera from five families. Of these, Sordid Emperor Apatura sordida Moore, Black-veined Sergeant Athyma ranga ranga Moore, Sullied Sailor Neptis soma soma Linnaeus, Blue Duke Euthalia durga durga Moore, Pea Blue Lampides boeticus Linnaeus and Chocolate Albatross Appias lyncida Cramer are listed in Schedule II of the Indian Wildlife (Protection Act (IWPA 1972. This study provides the baseline data of butterfly species richness of Mendrelgang.

Detection and prevalence of protozoan parasites in ready-to-eat packaged salads on sale in Italy.

Science.gov (United States)

Caradonna, Tiziana; Marangi, Marianna; Del Chierico, Federica; Ferrari, Nicola; Reddel, Sofia; Bracaglia, Giorgia; Normanno, Giovanni; Putignani, Lorenza; Giangaspero, Annunziata

2017-10-01

To investigate the prevalence of protozoan contamination by Giardia duodenalis, Cryptosporidium spp., Toxoplasma gondii and Cyclospora cayetanensis, in 'ready to eat' (RTE) salads on sale in Italy, 648 packages were purchased from industrial and local brands. Nine individual packages from each brand were collected per month, pooled and subjected to microscopy and molecular analyses. Microscopic examination of 864 slides detected Cryptosporidium spp. but also Blastocystis hominis and Dientamoeba fragilis. Molecular tools identified G. duodenalis assemblage A, Cryptosporidium parvum and Cryptosporidium ubiquitum, T. gondii Type I and C. cayetanensis. B. hominis and D. fragilis were also molecularly confirmed. The overall prevalence of each protozoan species was 0.6% for G. duodenalis, 0.8% for T. gondii, 0.9% for Cryptosporidium spp., and 1.3% for C. cayetanensis, while prevalence for B. hominis was 0.5% and for D. fragilis 0.2%. Microscopy and/or molecular tools revealed that 4.2% of the samples were contaminated by at least one protozoan species, and 0.6% of samples presented contamination by two protozoan species, with a number of oocysts ranging from 62 to 554 per g of vegetable matter for T. gondii, and 46 to 1.580 for C. cayetanensis. This is Europe's first large-scale study on the presence of protozoans in packaged salads, and shows that RTE sanitation processes do not guarantee a product free from protozoans of fecal origin. Copyright © 2017 Elsevier Ltd. All rights reserved.

Changes in bacterial flora associated with skin damage on hands of health care personnel.

Science.gov (United States)

Larson, E L; Hughes, C A; Pyrek, J D; Sparks, S M; Cagatay, E U; Bartkus, J M

1998-10-01

In a prospective observational study of 40 nurses (20 with diagnosed hand irritation and 20 without), nurses with damaged hands did not have higher microbial counts (P = .63), but did have a greater number of colonizing species (means: 3.35 and 2.63, P = .03). Although numbers were small, nurses with damaged hands were significantly more likely to be colonized with Staphylococcus hominis (P = .03). Fifty-nine percent of S hominis isolates from nurses with damaged hands were resistant to methicillin compared with 27% of isolates from those with healthy skin (P = .14). Twenty percent of nurses with damaged hands were colonized with Staphylococcus aureus compared with none of the nurses with normal hands (P = .11). Nurses with damaged hands were also twice as likely to have gram-negative bacteria (P = .20), entercocci (P = .13), and Candida (P = .30) present on the hands. Antimicrobial resistance of the coagulase-negative staphylococcal flora (with the exception of S hominis) did not differ between the 2 groups, nor did a trend toward increasing resistance exist when compared with other studies during the past decade. Skin moisturizers and protectant products were used almost universally by nurses at work, primarily products brought from home. Efforts to improve hand condition are warranted because skin damage can change microbial flora. Such efforts should include assessment or monitoring of hand care practices, formal institutional policy adoption and control of use of skin protectant products or lotions, and prudent use of latex gloves or more widespread use of powder-free and nonlatex products.

Leukocyte Lysis and Cytokine Induction by the Human Sexually Transmitted Parasite Trichomonas vaginalis.

Directory of Open Access Journals (Sweden)

Frances Mercer

2016-08-01

Full Text Available Trichomonas vaginalis (Tv is an extracellular protozoan parasite that causes the most common non-viral sexually transmitted infection: trichomoniasis. While acute symptoms in women may include vaginitis, infections are often asymptomatic, but can persist and are associated with medical complications including increased HIV susceptibility, infertility, pre-term labor, and higher incidence of cervical cancer. Heightened inflammation resulting from Tv infection could account for these complications. Effective cellular immune responses to Tv have not been characterized, and re-infection is common, suggesting a dysfunctional adaptive immune response. Using primary human leukocyte components, we have established an in vitro co-culture system to assess the interaction between Tv and the cells of the human immune system. We determined that in vitro, Tv is able to lyse T-cells and B-cells, showing a preference for B-cells. We also found that Tv lysis of lymphocytes was mediated by contact-dependent and soluble factors. Tv lysis of monocytes is far less efficient, and almost entirely contact-dependent. Interestingly, a common symbiont of Tv, Mycoplasma hominis, did not affect cytolytic activity of the parasite, but had a major impact on cytokine responses. M. hominis enabled more diverse inflammatory cytokine secretion in response to Tv and, of the cytokines tested, Tv strains cleared of M. hominis induced only IL-8 secretion from monocytes. The quality of the adaptive immune response to Tv is therefore likely influenced by Tv symbionts, commensals, and concomitant infections, and may be further complicated by direct parasite lysis of effector immune cells.

Leukocyte Lysis and Cytokine Induction by the Human Sexually Transmitted Parasite Trichomonas vaginalis

Science.gov (United States)

Mercer, Frances; Diala, Fitz Gerald I.; Chen, Yi-Pei; Molgora, Brenda M.; Ng, Shek Hang; Johnson, Patricia J.

2016-01-01

Trichomonas vaginalis (Tv) is an extracellular protozoan parasite that causes the most common non-viral sexually transmitted infection: trichomoniasis. While acute symptoms in women may include vaginitis, infections are often asymptomatic, but can persist and are associated with medical complications including increased HIV susceptibility, infertility, pre-term labor, and higher incidence of cervical cancer. Heightened inflammation resulting from Tv infection could account for these complications. Effective cellular immune responses to Tv have not been characterized, and re-infection is common, suggesting a dysfunctional adaptive immune response. Using primary human leukocyte components, we have established an in vitro co-culture system to assess the interaction between Tv and the cells of the human immune system. We determined that in vitro, Tv is able to lyse T-cells and B-cells, showing a preference for B-cells. We also found that Tv lysis of lymphocytes was mediated by contact-dependent and soluble factors. Tv lysis of monocytes is far less efficient, and almost entirely contact-dependent. Interestingly, a common symbiont of Tv, Mycoplasma hominis, did not affect cytolytic activity of the parasite, but had a major impact on cytokine responses. M. hominis enabled more diverse inflammatory cytokine secretion in response to Tv and, of the cytokines tested, Tv strains cleared of M. hominis induced only IL-8 secretion from monocytes. The quality of the adaptive immune response to Tv is therefore likely influenced by Tv symbionts, commensals, and concomitant infections, and may be further complicated by direct parasite lysis of effector immune cells. PMID:27529696

Bioactivity of flours of seeds of leguminous crops Pisum sativum ...

African Journals Online (AJOL)

Bioactivity of flours of seeds of leguminous crops Pisum sativum, Phaseolus vulgaris and Glycine max used as botanical insecticides against Sitophilus oryzae Linnaeus (Coleoptera: Curculionidae) on sorghum grains.

Mode d'exploitation et durabilité de la pêche de Oreochromis niloticus (Linnaeus, 1758, Clarias gariepinus (Burchell, 1822 et Gymnarchus niloticus (Cuvier, 1829 dans le lac de barrage du Sourou (Burkina Faso

Directory of Open Access Journals (Sweden)

Dialla, Z.

2016-01-01

Full Text Available Mode of Operation and Sustainability of Oreochromis niloticus (Linnaeus, 1758, Clarias gariepinus (Burchell, 1822 and Gymnarchus niloticus (Cuvier, 1829 Fisheries in the Sourou Dam Lake (Burkina Faso. This research on fishery exploitation in the Sourou dam raises the issue of sustainable management of common property. The central hypothesis is that the effectiveness of co-management for sustainable fishing practices is related to the level of ownership of that management and actors' games by fishing communities. In analysing co-management induced effects on fishing practices and exploitation of C. gariepinus, O. niloticus and G. niloticus species, related to its implementation in Sourou fishery, a research methodology that combines qualitative and quantitative methods is used. Socio-economic surveys were conducted with 30 fishermen in three villages bordering the fishery. Biological surveys were also conducted with catches of C. gariepinus, O. niloticus and G. niloticus of these fishermen,. The results indicate a weak ownership of the co-management model by fishermen and the strategies of actors that consist to minimize the costs of the sustainable management of fisheries resources at individual level. Indeed, even when informed of fisheries regulations, fishermen use prohibited fishing equipment (54.1% of the catches of studied species, and fishi illegally (43.3% of the fishermen. Furthermore, significant proportions of each studied species are captured before their first maturity sizes (52.2% of C. gariepinus, 15.8% of G. niloticus and 14.3% of O. niloticus. So, the central hypothesis is verified because the weak ownership of co-management by fishing communities and the actors' strategies do not encourage them to develop a responsible behavior for sustainable fishing.

Human evolution

DEFF Research Database (Denmark)

Llamas, Bastien; Willerslev, Eske; Orlando, Ludovic Antoine Alexandre

2017-01-01

The field of human ancient DNA (aDNA) has moved from mitochondrial sequencing that suffered from contamination and provided limited biological insights, to become a fully genomic discipline that is changing our conception of human history. Recent successes include the sequencing of extinct homini...

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ch_oct10_gene_aa_db Chro.60303 >1wicA 11 152 1 150 4e-26 ... gb|EAL37012.1| conserverd MSP-domain transme...mbrane protein [Cryptosporidium ... hominis] ... Length = 150 ... Query: 1 ... MSME...GAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVAFKIKTTAPRGYLVRPSSG 60 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLIL...ENITSSTVAFKIKTTAPRGYLVRPSSG Sbjct: 1 ... MSMEGAKLVRVHPEKALEFPLVLYSSVTTPLILENITSSTVA

Information visualization courses for students with a computer science background.

Science.gov (United States)

Kerren, Andreas

2013-01-01

Linnaeus University offers two master's courses in information visualization for computer science students with programming experience. This article briefly describes the syllabi, exercises, and practices developed for these courses.

Production and characterization of antimicrobial active substance ...

African Journals Online (AJOL)

Linnaeus) Lamouroux; Ulva fasciata Delile and Sargassum vulgare C. Agardh] belonging to Rhodophyta, Chlorophyta and Phaeophyceae, respectively, were collected seasonally in 2007 to 2008 from Abu-Qir bay (Alexandria, Egypt).

Acute diarrhoea associated with Cryptosporidium sp in Belém, Brazil (preliminary report

Directory of Open Access Journals (Sweden)

Edvaldo Carlos Brito Loureiro

1986-04-01

Full Text Available Cryptosporidium sp was detected in faeces from three children suffering from acute diarrhoea. In two cases no other concomitant agents were detected and in a 3rd. this agent was associated with Entamoeba histolytic, Entamoeba coli, Endolimax nana, Chilomastix mesnili and Pentatricbomonas hominis.

Carboxypeptidase activity in human mycoplasmas.

OpenAIRE

Shibata, K; Watanabe, T

1986-01-01

Mycoplasma salivarium produced citrulline, ammonia, and ATP from N-benzoylglycyl-L-arginine. The activity was inhibited by EDTA and was therefore concluded to be due to an arginine-specific carboxypeptidase. The activity was also found to exist in M. orale, M. buccale, M. faucium, and M. hominis.

Clusters of Pneumocystis carinii pneumonia

DEFF Research Database (Denmark)

Helweg-Larsen, J; Tsolaki, A G; Miller, Raymonde

1998-01-01

Genotyping at the internal transcribed spacer (ITS) regions of the nuclear rRNA operon was performed on isolates of P. carinii sp. f. hominis from three clusters of P. carinii pneumonia among eight patients with haematological malignancies and six with HIV infection. Nine different ITS sequence...

Plasmodium durae Herman from the introduced common peafowl in northern Nigeria.

Science.gov (United States)

Laird, M

1978-02-01

Plasmodium (Giovannolaia) durae Herman was originally described from Kenya, the type host being the common turkey, Meleagris gallopavo Linnaeus. There are no field records of this association outside of Africa, where the parasite, herein reported from another introduced and domesticated bird (the common peafowl, Pavo cristatus Linnaeus), was recently listed from 2 native Phasianidae of the genus Francolinus. The justification for the present identification is submitted against background data concerning malaria parasites from turkeys and other Galliformes in Africa and elsewhere, and restraint is urged in describing yet more "new species" of avian Plasmodium belonging to morphologically close taxa within Novyella and Giovannolaia. A near relative of P. durae, Plasmodium dissanaikei de Jong, is transferred from the former subgenus to the latter one.

Identification of Staphylococcus species with the API STAPH-IDENT system.

Science.gov (United States)

Kloos, W E; Wolfshohl, J F

1982-01-01

The API STAPH-IDENT system was compared with conventional methods for the identification of 14 Staphylococcus species. Conventional methods included the Kloos and Schleifer simplified scheme and DNA-DNA hybridization. The API STAPH-IDENT strip utilizes a battery of 10 miniaturized biochemical tests, including alkaline phosphatase, urease, beta-glucosidase, beta-glucuronidase, and beta-galactosidase activity, aerobic acid formation from D-(+)-mannose, D-mannitol, D-(+)-trehalose, and salicin, and utilization of arginine. Reactions of cultures were determined after 5 h of incubation at 35 degrees C. Results indicated a high degree of congruence (greater than 90%) between the expedient API system and conventional methods for most species. The addition of a test for novobiocin susceptibility to the API system increased the accuracy of identification of S. saprophyticus, S. cohnii, and S. hominis, significantly. Several strains of S. hominis, S. haemolyticus, and S. warneri which were difficult to separate with the Kloos and Schleifer simplified scheme were accurately resolved by the API system. PMID:6752190

Molecular Characterization of Cryptosporidium spp. in Children from Mexico

Science.gov (United States)

Valenzuela, Olivia; González-Díaz, Mariana; Garibay-Escobar, Adriana; Burgara-Estrella, Alexel; Cano, Manuel; Durazo, María; Bernal, Rosa M.; Hernandez, Jesús; Xiao, Lihua

2014-01-01

Cryptosporidiosis is a parasitic disease caused by Cryptosporidium spp. In immunocompetent individuals, it usually causes an acute and self-limited diarrhea; in infants, infection with Cryptosporidium spp. can cause malnutrition and growth retardation, and declined cognitive ability. In this study, we described for the first time the distribution of C. parvum and C. hominis subtypes in 12 children in Mexico by sequence characterization of the 60-kDa glycoprotein (GP60) gene of Cryptosporidium. Altogether, 7 subtypes belonging to 4 subtype families of C. hominis (Ia, Ib, Id and Ie) and 1 subtype family of C. parvum (IIa) were detected, including IaA14R3, IaA15R3, IbA10G2, IdA17, IeA11G3T3, IIaA15G2R1 and IIaA16G1R1. The frequency of the subtype families and subtypes in the samples analyzed in this study differed from what was observed in other countries. PMID:24755606

Bacterial endocarditis due to eikenella corrodens: A case report

Directory of Open Access Journals (Sweden)

Mahapatra A

2003-01-01

Full Text Available Of all the causes of bacterial endocarditis, HACEK group consisting of Haemophilus, Actinobacillus actinomycetemcomitans, Cardiobacterium hominis, Eikenella corrodens, and Kingella Kingae are rare causative agents. We report a case of bacterial endocarditis by E. corrodens, which is one of the members of the HACEK group.