WorldWideScience

Sample records for depths slutfoervaring av

  1. Final disposal of high-level nuclear waste in very deep boreholes. An evaluation based on recent research of bedrock conditions at great depths; Slutfoervaring av hoegaktivt kaernavfall i djupa borrhaal. En utvaerdering baserad paa senare aars forskning om berggrunden paa stora djup

    Energy Technology Data Exchange (ETDEWEB)

    Aahaell, Karl-Inge [Karlstad Univ. (Sweden)

    2007-01-15

    This report evaluates the feasibility of very deep borehole disposal of high-level nuclear waste, e.g., spent nuclear fuel, in the light of recent technological developments and research on the characteristics of bedrock at extreme depths. The evaluation finds that new knowledge in the field of hydrogeology and technical advances in drilling technology have advanced the possibility of using very deep boreholes (3-5 km) for disposal of the Swedish nuclear waste. Decisive factors are (1) that the repository can be located in stable bedrock at a level where the groundwater is isolated from the biosphere, and (2) that the waste can be deposited and the boreholes permanently sealed without causing long-term disturbances in the density-stratification of the groundwater that surrounds the repository. Very deep borehole disposal might offer important advantage compared to the relatively more shallow KBS approach that is presently planned to be used by the Swedish nuclear industry in Sweden, in that it has the potential of being more robust. The reason for this is that very deep borehole disposal appears to permit emplacement of the waste at depths where the entire repository zone would be surrounded by stable, density-stratified groundwater having no contact with the surface, whereas a KBS-3 repository would be surrounded by upwardly mobile groundwater. This hydro-geological difference is a major safety factor, which is particularly apparent in all scenarios that envisage leakage of radioactive substances. Another advantage of a repository at a depth of 3 to 5 km is that it is less vulnerable to impacts from expected events (e.g., changes in groundwater conditions during future ice ages) as well as undesired events (e.g. such as terrorist actions, technical malfunction and major local earthquakes). Decisive for the feasibility of a repository based on the very deep borehole concept is, however, the ability to emplace the waste without failures. In order to achieve this

  2. Final disposal of high-level radioactive waste in deep boreholes. An evaluation based on recent research on the bedrock at great depths; Slutfoervaring av hoegaktivt kaernavfall i djupa borrhaal. En utvaerdering baserad paa senare aars forskning om berggrunden paa stora djup

    Energy Technology Data Exchange (ETDEWEB)

    Aahaell, Karl-Inge [Karlstad Univ. (Sweden)

    2006-05-15

    New knowledge in hydrogeology and boring technology have opened the possibility to use deep boreholes as a repository for the Swedish high-level radioactive wastes. The determining property is that the repository can be housed in the stable bedrock at levels where the ground water has no contact with the biosphere and disposal and sealing can take place without disturbing the ground water stratification outside the disposal area. An advantage compared to a shallow repository of KBS-3 type, that is now being planned in Sweden, is that a borehole repository is likely to be technologically more robust, since the concept 'deep boreholes' seems to admit such a deep disposal that the entire disposal area would be surrounded by stable density-layered ground water, while a KBS-3 repository would be surrounded by moving ground water in contact with level close to the surface. This hydrological difference is of great importance for the safety in scenarios with leaching of radioactive substances. A deep repository is also less vulnerable for effects from natural events such as glaciation and earthquakes as well as from technological mishaps and terrorist actions. A crucial factor is, however, that the radioactive waste can be disposed of, in a secure way, at the intended depth, which will require new research and technology development.

  3. Place of the final disposal of short lived dismantling waste; Plats foer slutfoervaring av kortlivat rivningsavfall

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-01-15

    This report deals with the short-lived low and intermediate level radioactive waste, which will mainly arise from the dismantling of the Swedish nuclear power plants, but also the dismantling of other nuclear facilities. For these installations to be dismantled, there must be the capacity to receive and dispose of dismantling waste. SKB plans to expand the existing final repository for short-lived radioactive waste (SFR) in Forsmark for this purpose. The legislation requires alternatives to the chosen location. The alternate location for the disposal of decommissioning waste SKB has chosen to compare with is a location in the Simpevarp area outside Oskarshamn. There are currently Oskarshamn nuclear power plant and SKB between stock 'CLAB'. The choice of Simpevarp as alternative location is based on that it's one of the places in the country where data on the bedrock is available to an extent that allows an assessment of the prospects for long-term security, such an assessment is actually showing good potential, and that the location provide realistic opportunities to put into practice the disposal of decommissioning waste. At a comparison between the disposal of short-lived decommissioning waste in an extension of SFR with the option to build a separate repository for short-lived decommissioning waste in Simpevarp, the conclusion is that both options offer potentially good prospects for long-term security. The differences still indicated speaks to the Forsmark advantage. Similar conclusions were obtained when comparing the factors of environment, health and social aspects.

  4. Depth

    NARCIS (Netherlands)

    Koenderink, J.J.; Van Doorn, A.J.; Wagemans, J.

    2011-01-01

    Depth is the feeling of remoteness, or separateness, that accompanies awareness in human modalities like vision and audition. In specific cases depths can be graded on an ordinal scale, or even measured quantitatively on an interval scale. In the case of pictorial vision this is complicated by the f

  5. Depth

    NARCIS (Netherlands)

    Koenderink, J.J.; Van Doorn, A.J.; Wagemans, J.

    2011-01-01

    Depth is the feeling of remoteness, or separateness, that accompanies awareness in human modalities like vision and audition. In specific cases depths can be graded on an ordinal scale, or even measured quantitatively on an interval scale. In the case of pictorial vision this is complicated by the

  6. Technical description - interim storage, encapsulation and disposal of spent nuclear fuel; Teknisk beskrivning - mellanlagring, inkapsling och slutfoervaring av anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-15

    The purpose of the annex Technical description is, in accordance with Chapter 22 paragraph 1 Environmental Code to describe the candidate operations and facilities. In particular, things that are important for their environmental impact are described. SKB's goal of the appendix is to describe the facilities, activities, pollution sources, land usage and more during construction, operation and decommissioning, to the extent and on a level of detail, so that the Environment Court without requiring additions can prepare the matter for the government's admissibility test

  7. Supra regional ground water modelling - in-depth analysis of the groundwater flow patterns in eastern Smaaland. Comparison with different conceptual descriptions; Storregional grundvattenmodellering - foerdjupad analys av floedesfoerhaallanden i oestra Smaaland. Jaemfoerelse av olika konceptuella beskrivningar

    Energy Technology Data Exchange (ETDEWEB)

    Ericsson, Lars O. [Lars O Ericsson Consulting AB, Stockholm (Sweden); Holmen, Johan [Golder Associates, Uppsala (Sweden); Rhen, Ingvar; Blomquist, Niklas [SWECO VIAK, Stockholm (Sweden)

    2006-05-15

    One of many geoscientific questions in connection with the siting of a final repository for spent nuclear fuel in Sweden has to do with understanding the large-scale flow patterns of the naturally circulating groundwater. The recharge and discharge of the groundwater is therefore a subject for both SKB's research activities and the interest of the regulatory authorities. This report aims at providing an in-depth scientific analysis of the groundwater flow pattern based on the criteria and suitability indicators which SKB has previously presented with respect to recharge and discharge aspects in a supra regional perspective. The analysis was conducted within the framework of a project whose goals were to: evaluate conceptual simplifications and model uncertainties in supra regional groundwater modelling, and to carry out an in-depth and comprehensive analysis of regional flow conditions in eastern Smaaland. Achieving these goals has required an approach based on the use of available geoscientific data on the Smaaland region combined with an analysis of different conceptual assumptions and system descriptions. The following general conclusions can be drawn from the study and the applied methodology: The factor of greatest importance for the regional flow pattern (from repository depth) is the topography. The discharge areas are mainly found in the low-lying parts of the topography, along valleys, and the recharge areas occur on the heights. The topographic undulation is of greater importance than the properties of the conductivity field. Different lithological units, regional deformation zones, local heterogeneity, Quaternary deposits etc are of less importance than the undulation of the topography. For areas described and analyzed with the most realistic assumptions, the groundwater flow pattern can be described as a primarily local flow process. The median flow path length in the study is on the order of 2 km, and the fraction of supra regional flow paths

  8. Safety analysis of final disposal of nuclear waste - significance, development and challenges; Saekerhetsanalys av slutfoervaring av kaernavfall - roll, utveckling och utmaning

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Kjell; Norrby, Soeren; Simic, Eva; Wene, Clas-Otto

    2007-05-15

    The report starts with a review of the role and development of safety assessments from the middle of the 70's up until today. Then follows a section on how the assessment is performed today. The demands from the licensing authorities is then described. The report ends with a chapter on conclusions and reflections.

  9. Katodisk beskyttelse av umbilicals

    OpenAIRE

    Mjølhus, Bjarte

    2008-01-01

    Ulike sider ved bruk av sinkbånd til korrosjonsbeskyttelse av karbonstål umbilical er evaluert. Det er utført litteraturstudie ved gjennomgang av tidligere rapporter, sammenligning av standarder og artikkelsøk. Langtidsforsøk med egne korrosjonsceller ble utført over 2 måneder for å undersøke korrosjonsbeskyttelse ved 4 ulike temperaturer. Det ble også gjort undersøkelser av korrosjonsbelegg i SEM for å undersøke og sammenligne med publiserte data. Åpen krets potensialet viste seg å ligge ...

  10. AVS on satellite

    Science.gov (United States)

    Zhao, Haiwu; Wang, Guozhong; Hou, Gang

    2005-07-01

    AVS is a new digital audio-video coding standard established by China. AVS will be used in digital TV broadcasting and next general optical disk. AVS adopted many digital audio-video coding techniques developed by Chinese company and universities in recent years, it has very low complexity compared to H.264, and AVS will charge very low royalty fee through one-step license including all AVS tools. So AVS is a good and competitive candidate for Chinese DTV and next generation optical disk. In addition, Chinese government has published a plan for satellite TV signal directly to home(DTH) and a telecommunication satellite named as SINO 2 will be launched in 2006. AVS will be also one of the best hopeful candidates of audio-video coding standard on satellite signal transmission.

  11. DESIGN AV FREMTIDENS KUMLOKK

    OpenAIRE

    Breien, William Topper

    2014-01-01

    Denne oppgavens mål har vært å utvikle et nytt design for kumlokk. Det nye designet skal være lettere enn utgangspunktet. Dette har blitt gjort ved hjelp av en iterativ designprosess, styrkeberegninger i Siemens NX 8, simuleringer av støp i Magmasofts MAGMA5, prøvestøping og testing ved støperiet til Ulefos Jernværk i Ulefoss. Denne rapporten inneholder teoretisk bakgrunn og beskrivelse av metoder tatt i bruk ved utvikling av nytt design, simulerin...

  12. Verdsetting av brukermedvirkning ved utforming av skoleanlegg

    Directory of Open Access Journals (Sweden)

    Else Margrethe Lefdal

    2015-03-01

    Full Text Available Ved planlegging av offentlige bygninger i Norge forutsettes det at brukerne medvirker i prosessen. Dette er forankret i lov- og avtaleverk og motiveres ved at brukerne innehar en kompetanse som er av betydning for byggenes funksjonalitet. I denne artikkelen vil jeg belyse brukermedvirkningsproblematikk i planleggingen av et skoleanlegg for videregående opplæring. Tilgjengelige plan- og byggesaksdokumenter i den aktuelle fylkeskommunens digitale og fysiske arkiver er blitt analysert. I referater fra brukermøtene fremmes det for eksempel ønsker fra brukerne om begrenset bruk av glass. Det ferdige skole-anlegget har imidlertid utstrakt bruk av innvendige glassvegger, men det er ikke dokumentert diskusjoner knyttet til bestemmelsen av dette. Et profesjons- og maktperspektiv er relevant for å forstå hva som blir verdsatt, og hvilke strukt-urer og mekanismer som har påvirket planleggings­prosessen. De sentrale aktørgruppene er skoleeier og representantene for lærer- og arkitekt-profesjonen. Omfattende bruk av innvendig glass i skoleanlegget tolker jeg som et kompromiss mellom skoleeiers ønske om åpenhet og kontroll, lærernes ønske om mindre støy og arkitektens ønske om å skape romfølelse og visuelle siktlinjer.AbstractWhen planning public buildings in Norway, it is expected that users are involved in the process. This is grounded in legislation and agreements, and motivated by the idea that users have an expertise which is significant for the planning of the building’s functionality. The aim of this article is to investigate user participation in planning the school facilities for a secondary school. I have analyzed planning and building documents available in government records, digital and physical. In the reports from meetings with user groups, it is for example stated that users want to limit the use of glass. However, the completed school building has extensive use of glass dividing walls, but any discussions leading to this

  13. Impact assessment of the impact on nature values of the construction and operation of the repository for spent nuclear fuel at Forsmark; Konsekvensbedoemning av paaverkan paa naturvaerden av anlaeggande och drift av slutfoervar foer anvaent kaernbraensle i Forsmark

    Energy Technology Data Exchange (ETDEWEB)

    Allmer, Johan (Ekologigruppen AB, Stockholm (Sweden))

    2011-03-15

    Construction and operation of a repository at Soederviken in Forsmark, Oesthammar municipality means impact, effects and consequences for the environment. This report describes the natural conditions and natural values in Forsmark with particular focus on Soederviken. Furthermore, an assessment of consequences for the natural environment in the development and operation of a repository at Soederviken. Assessment of impacts from water activities are treated in a special report.

  14. Framework for detailed studies on the construction and operation of repositories for spent nuclear fuel; Ramprogram foer detaljundersoekningar vid uppfoerande och drift av slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    2010-10-15

    This report presents a programme for the detailed investigations planned to be applied during construction and operation of the repository for spent nuclear fuel at Forsmark. The report is part of SKB's application according to the Nuclear Activities Act. The detailed investigations shall provide relevant data on and site-descriptive models for the bedrock, soil deposits and eco-system of the site in order to facilitate a step-wise design and construction of the final repository. This shall be implemented in a manner that all demands on long-term safety are fulfilled, including accurate documentation of the construction work, and so that assessments of the environmental impact of the repository can be made. For the operational phase, the detailed investigations should also provide support to the deposition process with related decisions, thereby enabling fulfilment of the design premises for the siting and construction of deposition tunnels and deposition holes, as well as for deposition of canisters, and for the subsequent backfilling and closure of the repository. The Observational Method will be applied during the construction of the repository. This method entails establishing in advance acceptable limits of behaviour regarding selected geoscientific parameters and preparing a plan with measures to keep the outcome within these limits. Predictions of expected rock properties are established for each tunnel section. The outcome after excavation is compared with the acceptable range of outcomes. Information from detailed characterization will be of essential importance for application of the Observational Method and for adapting the repository to the prevailing rock properties. SKB has for the past several decades developed methods for site characterisation, applying both above- and underground investigation techniques. Experiences from this work, put into practice during the site investigations, has resulted in a solid knowledge and understanding of the bedrock conditions at Forsmark. The detailed investigations will employ, apart from established and earlier practiced methods, also further refined and newly developed techniques and methods for investigations and modelling. The report describes the present status for investigation and modelling methodology and techniques and also provides an overview of currently planned method developments. The report also presents a proposed scenario for how the detailed investigations, in light of presently available knowledge and techniques, should be conducted. Starting points for the investigation programme in this context are the reference design of the facility and remaining uncertainties associated with the site descriptive model and underground design. The scenario high-lights those investigations which, more or less as a matter of routine work, will be performed closely coordinated with the progression of the underground excavation work. The investigations related to the development of the deposition areas will primarily be linked to the sequences pilot drilling followed by excavation of deposition tunnels, and pilot drilling with subsequent full-face drilling of deposition holes. Continuous supervision of the fulfilment of design premises and documentation of the facility are in this context important issues. Information acquired during the construction process will also provide the substantial basis for the assessment of the long-term safety of the final repository. Further, it is emphasised in the report that supplementary investigations will be performed, if the information in any respect is regarded as insufficient. Such investigations may as well be performed from the ground surface. The final repository will in different ways have an impact on the surrounding environment. Monitoring of such changes is therefore an important and integral part of the detailed investigations. Until the construction work for the final repository is initiated, the detailed investigation programme will be modified and made more circumstantial, including results of planned developments . These updates will be accounted for in ensuing versions of the programme

  15. Preservation of information about the repository for spent nuclear fuels - proposal for action plan; Bevarande av information om slutfoervar foer anvaent kaernbraensle - foerslag till handlingsplan

    Energy Technology Data Exchange (ETDEWEB)

    Bowen-Schrire, Monica; Eckerhall, Daniel; Jander, Hans; Waniewska, Katarina (Vattenfall Power Consultant AB, Stockholm (Sweden))

    2008-10-15

    This report is a proposal for an action plan with the ultimate aim of ensuring that information about the repository for spent nuclear fuel can be preserved and transferred for future generations. The purpose of the proposal for an action plan is to present ideas on tangible measures and guidelines for information preservation and transfer, in the short and long term. The report deals with a number of aspects relating to information preservation as well as risks that can lead to the loss of important information. The proposal for an action plan is based on reasoning about these subjects. The main emphasis is on measures that need to be implemented in the near future to ensure that successive and direct information transfer is handled in a suitable manner. It is suggested that the following measures should be implemented within a five-year period: - Designate a person responsible for information preservation. - Work out guidelines for information preservation and transfer. - Form a network with other organizations in Sweden. - Initiate a dialogue with other countries, especially USA and France. - Participate in seminars, conferences and workgroups on an international level within the IAEA and NEA. In a longer time perspective the following measures should also be implemented: - Implement guidelines for information preservation and transfer. - Document the archiving system. - Establish a communication plan. - Archive information about the repository. - Keep the action plan up to date

  16. Attitudes towards a final repository for the spent nuclear fuel. Structure and causes; Attityd till slutfoervar av anvaent kaernbraensle. Struktur och orsaker

    Energy Technology Data Exchange (ETDEWEB)

    Sjoeberg, Lennart (Stockholm School of Economics (Sweden). Center for Risk Research)

    2008-09-15

    This report presents the results of a questionnaire survey of attitudes towards a final repository for the spent nuclear fuel. The questionnaire was mailed to 3,000 persons. Participants were young and older people in Oskarshamn municipality and Oesthammar municipality as well as in the rest of the country. Fifty-one percent responded. The questionnaire included a large number of questions of possible relevance for understanding the structure of and reasons for the person's attitude towards a final repository. Questions concerning nuclear power were dealt with in a special section. Men were more positively disposed towards a repository than women, older people more than young. The gender differences are mainly attributable to the variation in attitude towards nuclear power and concern about nuclear accidents. In the case of older people, interest was also a factor. Young people were not as interested in the issue. The most important factor in determining the attitude towards a final repository was the benefit it was expected to bring to the municipality. Moral and emotional aspects were also important. Risk played a relatively subordinate role. Social aspects were very important: those who frequently spoke with people who were positively disposed tended to be positive themselves, and vice versa for those who were negative. This factor could explain some of the gender differences in attitude. Attitudes in Oskarshamn were slightly more positive than in Oesthammar, probably due to the fact that the residents in Oskarshamn had a greater sense of participation in the municipality's decision in the matter. Information from SKB was also found to be an important factor for the differences in attitude between the municipalities. Eight percentage points more people had received information in Oskarshamn than in Oesthammar. The difference may be small, but it exists and does appear to be of some importance. Attitudes in Oskarshamn and Oesthammar continued to be much more positive than in the rest of the country, which was probably due to the availability of information but also to the fact that many people in these municipalities worked in the nuclear industry. Despite the positive attitude, there had been some decrease in positivity since 2005, especially among young people, perhaps due to the incidents in Forsmark in the summer of 2006 and in February 2007. It is interesting that there does not seem to have been a corresponding decrease in positivity in attitudes towards nuclear power in the country as a whole. When it came to nuclear power, the results showed that people had a fairly positive attitude towards the Swedish nuclear power programme, whose benefit was the most important component of this attitude. There was, however, some concern, and attitudes had become less positive in Oskarshamn and Oesthammar since 2005. Men were more positive than women, and older people more than young. Risk played a less important role, but a factor of great importance for attitudes was whether the person believed that a substitute could be found for nuclear power or not. Emotional reactions were important, but general values were less important for the attitude towards nuclear power. Social aspects seemed to play an important role for both the attitude towards a final repository and the attitude towards nuclear power: those who spoke with people who were negatively disposed tended to share that attitude, and the same was true of those who were positive. This factor may be part of the explanation for the gender differences in the attitude towards nuclear power, as well as the attitude towards a final repository

  17. The public, experts and deliberations. Consultations about final disposal of nuclear waste; Allmaenhet, expertis och deliberation. Samraad om slutfoervar av kaernavfall

    Energy Technology Data Exchange (ETDEWEB)

    Soneryd, Linda [Stockholms Univ. (Sweden); Lidskog, Rolf [OerebrUniv. (Sweden). Man-Technology-Environment Research Centre

    2006-10-15

    The Swedish process for consultations are studied in order to gain knowledge about the relation between experts and the general public in processes that involve complex scientific and technological issues. The following questions are discussed: How to delimit and define 'the general public' and which methods are used for doing this? Which arenas for dialog are created, and which are the institutional conditions for participation. Are there mechanisms that support or counteract negotiations about the boundaries of the expertise? How do actors that participate in consultation activities relate to experts? How are local and cross-border environment consequences discussed in consultations? The empirical material used in the study consists of observation, formal and informal interviews and documents. Conclusions drawn are that the organisation of consultations puts a special focus on the municipalities, the local population and local environmental issues. SKB has, after advice from consultation participants taken measures to change the process. This has not, however, changed the institutional conditions for participating as given on the different arenas. SKB's local information and communication activity create good relationships but have only weak mechanisms to counteract the dominating role of SKB. The process holds mechanisms that both support and counteract discussions and negotiations about the expertise's boundaries. A counteracting mechanism is when participants relate to EIS as a legal tool and make references to law interpretations that support their own position. The expertise's boundaries are challenged through views and comments about the long time aspects that are involved in the repository question. During consultations, no systematic discussion is pursued about values related to different disposal solutions and images of the future or about which roles citizens have in the consultation process, in their function of municipality politicians, environment organisations or local population.

  18. Preservation of information about the repository for spent nuclear fuels - proposal for action plan; Bevarande av information om slutfoervar foer anvaent kaernbraensle - foerslag till handlingsplan

    Energy Technology Data Exchange (ETDEWEB)

    Bowen-Schrire, Monica; Eckerhall, Daniel; Jander, Hans; Waniewska, Katarina (Vattenfall Power Consultant AB, Stockholm (Sweden))

    2008-10-15

    This report is a proposal for an action plan with the ultimate aim of ensuring that information about the repository for spent nuclear fuel can be preserved and transferred for future generations. The purpose of the proposal for an action plan is to present ideas on tangible measures and guidelines for information preservation and transfer, in the short and long term. The report deals with a number of aspects relating to information preservation as well as risks that can lead to the loss of important information. The proposal for an action plan is based on reasoning about these subjects. The main emphasis is on measures that need to be implemented in the near future to ensure that successive and direct information transfer is handled in a suitable manner. It is suggested that the following measures should be implemented within a five-year period: - Designate a person responsible for information preservation. - Work out guidelines for information preservation and transfer. - Form a network with other organizations in Sweden. - Initiate a dialogue with other countries, especially USA and France. - Participate in seminars, conferences and workgroups on an international level within the IAEA and NEA. In a longer time perspective the following measures should also be implemented: - Implement guidelines for information preservation and transfer. - Document the archiving system. - Establish a communication plan. - Archive information about the repository. - Keep the action plan up to date

  19. Framework for detailed studies on the construction and operation of repositories for spent nuclear fuel; Ramprogram foer detaljundersoekningar vid uppfoerande och drift av slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    2010-10-15

    This report presents a programme for the detailed investigations planned to be applied during construction and operation of the repository for spent nuclear fuel at Forsmark. The report is part of SKB's application according to the Nuclear Activities Act. The detailed investigations shall provide relevant data on and site-descriptive models for the bedrock, soil deposits and eco-system of the site in order to facilitate a step-wise design and construction of the final repository. This shall be implemented in a manner that all demands on long-term safety are fulfilled, including accurate documentation of the construction work, and so that assessments of the environmental impact of the repository can be made. For the operational phase, the detailed investigations should also provide support to the deposition process with related decisions, thereby enabling fulfilment of the design premises for the siting and construction of deposition tunnels and deposition holes, as well as for deposition of canisters, and for the subsequent backfilling and closure of the repository. The Observational Method will be applied during the construction of the repository. This method entails establishing in advance acceptable limits of behaviour regarding selected geoscientific parameters and preparing a plan with measures to keep the outcome within these limits. Predictions of expected rock properties are established for each tunnel section. The outcome after excavation is compared with the acceptable range of outcomes. Information from detailed characterization will be of essential importance for application of the Observational Method and for adapting the repository to the prevailing rock properties. SKB has for the past several decades developed methods for site characterisation, applying both above- and underground investigation techniques. Experiences from this work, put into practice during the site investigations, has resulted in a solid knowledge and understanding of the bedrock conditions at Forsmark. The detailed investigations will employ, apart from established and earlier practiced methods, also further refined and newly developed techniques and methods for investigations and modelling. The report describes the present status for investigation and modelling methodology and techniques and also provides an overview of currently planned method developments. The report also presents a proposed scenario for how the detailed investigations, in light of presently available knowledge and techniques, should be conducted. Starting points for the investigation programme in this context are the reference design of the facility and remaining uncertainties associated with the site descriptive model and underground design. The scenario high-lights those investigations which, more or less as a matter of routine work, will be performed closely coordinated with the progression of the underground excavation work. The investigations related to the development of the deposition areas will primarily be linked to the sequences pilot drilling followed by excavation of deposition tunnels, and pilot drilling with subsequent full-face drilling of deposition holes. Continuous supervision of the fulfilment of design premises and documentation of the facility are in this context important issues. Information acquired during the construction process will also provide the substantial basis for the assessment of the long-term safety of the final repository. Further, it is emphasised in the report that supplementary investigations will be performed, if the information in any respect is regarded as insufficient. Such investigations may as well be performed from the ground surface. The final repository will in different ways have an impact on the surrounding environment. Monitoring of such changes is therefore an important and integral part of the detailed investigations. Until the construction work for the final repository is initiated, the detailed investigation programme will be modified and made more circumstantial, including results of planned developments

  20. Risk perspective on final disposal of nuclear waste. Individuals, society and communication; Riskperspektiv paa slutfoervaring av kaernavfall. Individ, samhaelle och kommunikation

    Energy Technology Data Exchange (ETDEWEB)

    Lindblad, Inga-Britt (ed.)

    2007-09-29

    This report tries to evaluate the importance of the risk perspective in connection with final storage of nuclear waste. The concept 'risk' has different importance for experts and general public, within different research directions and among stakeholders in the nuclear waste issue. The report has been published in order to give an interdisciplinary scientific perspective on the risk concept. The authors have their background in different disciplines: radiation physics, psychology, media- and communications-science. The report treats four different themes: The first theme concerns perspectives on the risk concept and describes various principles for how risks can be handled in the society. The next theme is about comparing various risks. This section shows that risk comparisons can to be done within the framework of a scientific attitude and during certain given conditions. The third theme elucidates results from research about subjective risk, and shows that a large number of factors influence how risks are considered by individuals, and can influence his risk behavior and also how the individual means that the society will make decisions in risk-related questions. The fourth and last theme is about risk communication. Since the risk concept contains many different aspects it is clear that risk should not only be informed about, but also communicated. If a purely mathematical definition of risk was the only valid form, such information, from experts to the citizens, would possibly be sufficient. But since there are other relevant factors to take into consideration (t.ex the individual's own values), a communicative process must take place, i.e. the citizens should have influence on how risks are compared and managed. In the final theme, the authors have chosen to reflect around the themes above, i.e. different perspectives on the risk concept, risk comparisons, subjective risk view and risk communication are discussed.

  1. AV dissociation, an inevitable response.

    Science.gov (United States)

    Wang, Kyuhyun; Benditt, David G

    2011-07-01

    The independent activation of the atria and ventricles, AV dissociation, is a common phenomenon that occurs during a wide variety of electrophysiologic circumstances. The clinical significance of AV dissociation is often misunderstood. This article examines the basis and clinical implications of AV dissociation. AV dissociation is often an obligatory, secondary phenomenon, and should not be construed as the primary disorder; it may be due to either the AV conduction system being completely blocked (3° AV block) or the P wave and the QRS complex being generated from separate sources (usually, the AV junction or ventricle) but occurring close together during the physiologic refractory period of each other. The latter may happen in junctional or ventricular arrhythmias including escape or accelerated rhythm, tachycardia, or premature beats. The crucial clinical point is not the AV dissociation itself, but that an underlying triggering primary disorder is present and should be identified. ©2011, Wiley Periodicals, Inc.

  2. Summer Student Report - AV Workflow

    CERN Document Server

    Abramson, Jessie

    2014-01-01

    The AV Workflow is web application which allows cern users to publish, update and delete videos from cds. During my summer internship I implemented the backend of the new version of the AV Worklow in python using the django framework.

  3. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  4. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  5. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  6. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  7. Introduction to AVS Audio

    Institute of Scientific and Technical Information of China (English)

    Hao-Jun Ai; Shui-Xian Chen; Rui-Min Hu

    2006-01-01

    This paper describes a general audio coding algorithm which has been recently standardized by AVS, China.The algorithm is based on a perceptual coding technique. The codec delivers near CD-quality audio at 128kb/s. This paper describes the coder structure in detail and discusses the reasons for specific design methods. A summary of the subjective test results are presented for the prototype codec. Comparison Mean Opinion Score (CMOS) test indicates that the quality of the AVS audio coder is comparable with MPEG Layer-3 audio coder. A real-time decoder was used for the characterization test,which is based on a 16-bit fixed-point DSP. The performance of the DSP solution was demonstrated, including computational complexity and storage characteristics.

  8. Negotiation Mechanism of AVS Standardization

    Institute of Scientific and Technical Information of China (English)

    Su Junbin

    2007-01-01

    @@ 1. Introduction The mission of the Audio Video Coding Standard (AVS) Working Group of China is to develop AVS standards drafts and deliver them to the national standardization administration authorities. Since its establishment in 2002, the AVS Working Group has developed rapidly, growing from 33 members in 2003 to 153 in 2006. By the end of 2006, it had put forward for approval nine standards drafts (Table 1) with Part 2 of the AVS 1.0 draft approved as a national standard in February 2006.

  9. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  10. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  11. Contents of a regulatory strategy for assessing future human actions in the safety evaluation of a repository for spent fuels; Innehaallet i en strategi foer myndighetsbedoemning av framtida maenskligt handlande vid vaerdering av saekerheten for slutfoervar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Wickham, S.M.; Galson, D.A. [Galson Sciences Ltd., Oakham (United Kingdom)

    2001-08-01

    The objective of this report is to discuss issues that should be considered in the development of a regulatory strategy for assessing future human actions in any forthcoming license application for a deep repository for spent fuel in Sweden and for sites of other repositories. The report comprises an outline of key issues concerning the treatment of future human actions in safety assessment, reviews of regulatory developments, recent safety assessments and supporting studies, and international initiatives on the treatment of future human actions in safety assessment, and the principal elements of a regulatory strategy. Performance assessments (PAs) are generally accepted as providing illustrations of system performance under given sets of assumptions. The results of PAs are clearer and easier to understand if certain large uncertainties are accounted for by determining performance under several different sets of assumptions or scenarios, each of which defines a possible evolution of the disposal system. A number of assumptions can be made that would restrict the scope of an assessment without reducing the credibility of the corresponding safety case. Reducing speculation about technological development, by assuming that the techniques used in future human activities are similar to those currently in use in the region or at similar sites, will simplify the assessment. A distinction is generally made between inadvertent and intentional intrusion, with intentional activities excluded because society cannot protect future populations from their own actions if they understand the potential consequences. A division of human activities into 'recent and ongoing' and 'future' activities considers not only the timing of the activities but also the degree of control or influence that can be imposed on them. Recent and ongoing human activities are those that affect an area beyond the immediate vicinity of the disposal facility and which neither the proponent nor the regulator can influence. Examples include anthropogenic climate change and activities that have recently taken place in the vicinity of the disposal site, such as groundwater abstraction. Future human activities are those that may take place in the vicinity of the disposal system at some time in the future and which may affect the performance of the disposal system by by-passing or affecting the characteristics of the engineered and natural barriers. Institutional controls can prevent or reduce the likelihood of any disruptive activities. It may be inappropriate to treat recent and ongoing human activities in the same way as future human activities. Scenarios that include the occurrence of future human activities are conditional and are used to illustrate the potential behaviour of the system. Scenarios including recent and ongoing human activities are not conditional and may provide a better estimate of system performance than those that exclude such activities. The focus of assessments of future human actions should be on longer-term doses received by groups of people who might anyway be considered in the Reference Scenario In particular, human intrusion assessments should include groups considered in assessments of groundwater releases who may receive additional doses from new pathways arising from future human actions, and groups consuming foodstuffs contaminated by radionuclides brought to the surface during or subsequent to an intrusion and dispersed into, the biosphere. Members of a drilling crew that intrude into a repository do not fulfil the definition of a potentially exposed group because any intrusion would be an isolated activity not occurring on a day-to-day basis. The dose received by one individual from a specific short-term event cannot be compared with a regulatory criteria expressed as an average annual dose. The following outline strategy is proposed as a basis for consultation on the treatment of future human actions. Assessments must include calculations of disposal system performance without any disruptive future human actions. These calculations should include the effects of any recent and ongoing human activities that might affect the performance of the disposal system. Additional calculations should illustrate the potential effects of disruptive human actions. Assessments of future human actions should be based on present-day conditions in the region of the disposal site and similar sites. Site-specific definitions of the region considered and the period examined for defining rates and frequencies should be provided by the proponent. Assessments should consider the long-term effects of disruption through the formation of new pathways and the dispersal of radioactive material in the biosphere. The proponent should develop and justify the scenarios analysed in an assessment. (abstract truncated)

  12. Present status and an appreciation of the consequences for recreation and outdoor leisure activities from siting a nuclear waste repository at Forsmark; Nulaegesanalys samt bedoemning av konsekvenser foer rekreation och friluftsliv av ett slutfoervar i Forsmark

    Energy Technology Data Exchange (ETDEWEB)

    Ottosson, Pia [Atrax Energi AB, Stockholm (Sweden)

    2007-07-15

    This report describes how the area around Forsmark is used with respect to recreation and outdoor life. It also describes the impact of the final repository on recreation and outdoor life if it is located in Forsmark. The studied area is situated in the parish of Forsmark in the municipality of Oesthammar. Forsmark nuclear power plant and the final repository for radioactive operational waste, SFR, are situated within the area and there are both houses and holiday houses. The area is used for leisure pursuit by inhabitants and employees at FKA and SKB, but also by a number of different associations and by tourists. Statistical data shows that the parish of Forsmark is sparsely populated. The area was previously dominated by one big landowner and the land surrounding the nuclear power plant was inaccessible to the general public during that period. The outdoor life is therefore less widespread here than along other parts of the east coast. The value of the area does not lie in paths and trails, bike tracks and bathing places, but in the unspoiled countryside, the wildlife and the bird life. Recreation such as hunting and fishing is very popular in the area. The construction of a final repository will increase traffic and hence increase noise and motion in the area. This will mainly impact the enjoyment value for the people spending time in the area. No other significant consequences are expected as the final repository will be mainly situated within the existing industrial complex and hence the character of the area should remain unchanged.

  13. Present status and an appreciation of the consequences for recreation and outdoor leisure activities from siting a nuclear waste repository at Oskarshamn; Nulaegesanalys samt bedoemning av konsekvenser foer rekreation och friluftsliv av ett slutfoervar i Oskarshamn

    Energy Technology Data Exchange (ETDEWEB)

    Dahlstroem, Kristina

    2007-07-15

    This report describes recreation and outdoor life in and around Simpevarp/Laxemar area. It also describes the impact of constructing a final repository for spent nuclear fuel on the outdoor life. The study area in this report is situated in the parish of Misterhult, in the municipality of Oskarshamn. Oskarshamn nuclear power plant (OKG) and the interim storage facility for spent nuclear fuel (Clab) are situated within the area. The parish of Misterhult is sparsely populated and includes both houses and holiday cottages. The area is used for various kinds of recreation by inhabitants from surrounding villages and employees at OKG and SKB (Swedish Nuclear Fuel and Waste Management Co), and also by a number of different associations and by tourists. Misterhult archipelago has the highest values for recreation and outdoor life in the study area. Many water related activities, such as swimming, sailing, fishing, diving, kayaking and canoeing are conducted in the region Hamnefjaerden, Kraakelund and a walking track called Ostkustleden are three other places in the study area which are popular for outdoor life. SKB and OKG facilities are also visited by many tourists. Disturbances to the recreation and outdoor life during construction and operation of a final repository and a interim storage facility will occur in the form of increased noise and movement in the area, mostly from the traffic. The consequences of these disturbances are: Decreased serenity, which will probably decrease the enjoyment value for the people spending time in the area. The final repository in Laxemar will likely require road access that will cross the walking track. Various prevention and compensation measures, such as noise restrictions and a new section of the walking track at Ostkustleden, are suggested to minimise and/or mitigate the consequences. Also measures that increase the value of recreation and outdoor life are listed, for example an exhibition about the areas nature and culture. Specific compensation and mitigation measures will be outlined in the next design step.

  14. Impact assessment of the effect of natural values of interim storage, encapsulation and disposal of spent nuclear fuel in Oskarshamn. Laxemar; Konsekvensbedoemning av paaverkan paa naturvaerden vid mellanlagring, inkapsling och slutfoervaring av anvaent kaernbraensle i Oskarshamn. Laxemar

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Magnus (Ekologigruppen AB, Stockholm (Sweden))

    2011-03-15

    The report describes the natural environment and its natural values in Laxemar Simpevarp, the final disposal facility's impacts on the natural environment and measures that can be taken to reduce these. Both terrestrial and aquatic environments are described. Impact on the natural environments of groundwater reduction is not discussed here but described in a separate report, together with consequences of radiation. The report shall serve as a basis for the Environmental Impact Assessment for the application according to the Environment Act.

  15. RDandD Programme 2010. Programme for research, development and demonstration of methods for the management and disposal of nuclear waste; Fud-program 2010. Program foer forskning, utveckling och demonstration av metoder foer hantering och slutfoervaring av kaernavfall

    Energy Technology Data Exchange (ETDEWEB)

    2010-09-15

    The RD and D programme 2010 gives an account of SKB's plans for research, development and demonstration during the period 2011-2016. SKB's activities are divided into two main areas - the programme for Low and Intermediate Level Waste (the Loma program) and the Nuclear Fuel Program. The RD and D Programme 2010 consists of five parts: Part I: Overall Plan, Part II: Loma program, Part III: Nuclear Fuel Program, Part IV: Research on analysis of long-term safety, Part V: Social Science Research. The 2007 RD and D programme was focused primarily on technology development to realize the final repository for spent nuclear fuel. The actions described were aimed at increasing awareness of long-term safety and to obtain technical data for application under the Nuclear Activities Act for the final repository for spent fuel and under the Environmental Code of the repository system. Many important results from these efforts are reported in this program. An overall account of the results will be given in the Licensing application in early 2011. The authorities' review of RD and D programme in 2007 and completion of the program called for clarification of plans and programs for the final repository for short-lived radioactive waste, SFR, and the final repository for waste, SFL. This RD and D program describes these plans in a more detailed way

  16. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  17. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  18. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  19. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  20. Store Stokkavatn. Beskrivelse av forurensningssituasjonen

    OpenAIRE

    Holtan, H.

    1985-01-01

    Rapporten, som er et ledd i arbeidet med en vannbruksplan for Store Stokkavatn ved Stavanger, sammenstiller og diskuterer data som er samlet inn fra innsjøen og dens tilløp av Byveterinæretaten i Stavanger. Store Stokkavatnet er reservevannkilde for Stavanger og dessuten er innsjøen sentral i rekreasjonsmessig sammenheng. På bakgrunn av de foreliggende data, er innsjøens forurensningstilstand på grensen av det akseptable hva algeproduksjon (eutrofiering) og bakteriologiske forhold angår. Fler...

  1. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  2. Optimering av bergtransporter i underjordsgruva

    OpenAIRE

    Abrahamsson, Magnus

    2015-01-01

    Detta examensarbete utfördes på LKAB, en mineralkoncern som tillverkar och levererar järnmalmsprodukter. Arbetet utfördes för företagets underjordsgruva i Malmberget och behandlar tillredningens bergtransporter. Tillredningen är den process som förbereder nya delar av gruvan för järnmalmsbrytning. Målsättningen med arbetet har varit att kartlägga hur transporterna av tillredningsberg styrs samt att kvantifiera en besparingspotential för dessa transporter. Om möjligt skulle även förbättringsfö...

  3. Institusjonelle felt og forståelser av evaluering – en analyse av evalueringen av NAV-reformen

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Hansen, Morten Balle

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av...... interessene som var involvert i evalueringen. I EVANAV ble dette blant annet ivaretatt i formuleringen av fire mål som tilgodeser ulike behov. Basert på evalueringsteori og teori om institusjonelle felt bidrar analysen til en bedre forståelse av hva evaluering er, og hvordan ulike utfordringer knyttet til...

  4. PAH i forurenset sediment: Utredning av egnethet av PAHkomponenter/ grupperinger for vurdering av tiltaksbehov

    OpenAIRE

    Ruus, Anders; Arp, Hans Petter Heinrich; Oen, Amy M.P.; Grung, Merete; Breedveld, Gijs D.

    2015-01-01

    I Norge er det utarbeidet klassegrenser for til sammen 16 PAH-forbindelser i sediment og vann. Grenseverdiene baserer seg på kunnskap om toksisitet av de ulike stoffene og hva som er akseptabel eksponering for miljøet. I tillegg til grenseverdiene for enkeltkomponentene av PAH opererer norske miljømyndigheter med klassegrenser for PAH-grupperingen SUM PAH-16 i sediment. Disse klassegrensene bygger på overkonsentrasjoner i forhold til bakgrunnsnivå, og ikke økotoksikologiske dat...

  5. Bruk av kartleggingsresultater i forbedringsarbeid

    DEFF Research Database (Denmark)

    Nordahl, Thomas; Hansen, Line Skov

    . Barnehagen har gjerne tilgang på informasjon fra kartlegginger, men det er ikke alltid denne informasjonen blir systematisk analysert og aktivt brukt i forbedringsarbeid. Forfatterne viser hvordan slike analyser kan gjennomføres på forskjellige nivåer i den enkelte barnehage, og vektlegger viktigheten av...

  6. Analyse av klimatilpasningstiltak : en casestudie av overvannsnettet på Bogafjell i Sandnes kommune

    OpenAIRE

    Bekkum, Ina

    2012-01-01

    For å simulere klimaendringenes effekt på avløpssystemet og klimatilpasningstiltakenes avbøtende virkning kan man benyttes seg av urbanhydrologiske avløpsmodeller. I denne oppgaven er det gjennomført et casestudie av overvannsnettet på Bogafjell i Sandnes kommune. Det er gjort simuleringer av enkeltregn i form av symmetriske nedbørshyetogram, med og uten klimatillegg – i Rosie/ArcGIS med MOUSE beregningsmotor – for å teste tiltaksprinsipper som frakopling av overvann, fordrøyning av ...

  7. Transmembrane potentials of canine AV junctional tissues.

    Science.gov (United States)

    Tse, W W

    1986-06-01

    The atrioventricular (AV) junction comprises the AV node, His bundle (HB), and specialized tissues proximal to the node called paranodal fibers (PNF). In the present study, an in vitro, dissection-exposed canine right atrial (RA), transitional fiber (TF), AV junctional preparation was used. The TF and PNF formed a pathway running along the base of the septal cusp of the tricuspid valve (SCTV). In the first experiment, impulses elicited at the RA were monitored to propagate sequentially through the TF, PNF, AV node, and then the HB. This functional evidence supports the concept that a conduction pathway connecting the RA and the AV node exists along the base of the SCTV. This internodal pathway is referred to as the septal cusp pathway. In another experiment, transmembrane potentials and Vmax were determined on each of the AV junctional tissues. Results showed that PNF had the lowest Vmax (2.5 V/sec), followed by AV node (7.0 V/sec) and HB (33 V/sec). This finding showed that PNF, and not the AV node, has the lowest Vmax, suggesting that the PNF has the lowest conductivity among the AV junctional tissues, and this study advances our understanding on the mechanism of AV conduction delay in dog hearts.

  8. Evaluering av ABW-filter

    OpenAIRE

    Ohren, J.A.

    1986-01-01

    Det er foretatt en evaluering av ABW-filteret basert på forskningsresultater og driftserfaringer fra USA. ABW-filteret er godt egnet med sand eller sand-antrasitt i konvensjonelle fullrenseanlegg med flokkulering, sedimentering og filtrering. Etter disse prosessene er filteret også egnet med aktivt kull. ABW-filteret er også interessant for etterbehandling i kommunale og industrielle avløpsrenseanlegg.

  9. Multimedia for læring av tallsystemer : utvikling av programvare for læring av og om tallsystemer

    OpenAIRE

    Idland, Terje

    2006-01-01

    Oppgaven har en teoretisk forankring innenfor Piagets konstruktivisme, Vygotskys sosialkonstruktivisme, Dienes teori for læring av posisjonssystemet og Mayer & Morenos teori for læring med multimedia. Primært har jeg brukt eksisterende teori som grunnlag for utvikling av pedagogisk programvare for læring av tallsystemer. Denne programvaren er todelt. En del er en interaktiv applett som er et utforskingsmiljø for posisjonssystemet. Den andre delen er en interaktiv multimediep...

  10. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  11. Effekten av karbohydrat- og proteininntak på restitusjon av utholdenhetskapasiteten etter et utmattende arbeid

    OpenAIRE

    Rustad, Per Inge

    2011-01-01

    Innledning: Dietten i etterkant av trening og konkurranser er av stor betydning for restitusjonsprosessen. Få studier har imidlertid undersøkt restitusjonseffekten av karbohydratog proteininntak etter et utmattende arbeid på utholdenhetskapasiteten dagen etter. I vår studie ble det gjennomført totalt tre diettintervensjoner for å undersøke følgende problemstillinger; 1) undersøke utholdenhetskapasiteten dagen etter et utmattende utholdenhetsarbeid etter inntak av en høy karbohy...

  12. AVS-M: From Standards to Applications

    Institute of Scientific and Technical Information of China (English)

    Ye-Kui Wang

    2006-01-01

    AVS stands for the Audio Video coding Standard Workgroup of China, who develops audio/video coding standards as well as system and digital right management standards. AVS-M is the AVS video coding standard targeting for mobile multimedia applications. Besides the coding specification, AVS also developed the file format and Real-time Transport Protocol (RTP) payload format specifications to enable the application of AVS-M video in various services. This paper reviews the high-level coding tools and features of the AVS-M coding standard as well as the file format and payload format standards.In particular, sixteen AVS-M high-level coding tools and features, which cover most of the high-level topics during AVS-M standardization, are discussed in some detail. After that, the error resilience tools are briefly reviewed before the file format and RTP payload format discussions. The coding efficiency and error resiliency performances of AVS-M are provided finally.H.264/AVC has been extensively used as a comparison in many of the discussions and the simulation results.

  13. The AV-8B Decision

    Science.gov (United States)

    1982-06-01

    isa csestudy of the debate overthdeionfte United States Gover mn to prc--u the McDonnell Douglas AV-8B Advanced Hrrier V/STOL jet aircraft for the U.S...Sciences 3 ABSTRACT This thesis is a case study of the debate over the decision of the United States Government to procure the McDonnell Douglas IT-8...a egrate4 dur nq the 1ive To r perIoo by the introduction of the moderNtely prcod F1-18 aircraft. The F/1 8 proqrts will, 0euce to*n uber and tpes of

  14. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  15. Syncope and Idiopathic (Paroxysmal) AV Block.

    Science.gov (United States)

    Brignole, Michele; Deharo, Jean-Claude; Guieu, Regis

    2015-08-01

    Syncope due to idiopathic AV block is characterized by: 1) ECG documentation (usually by means of prolonged ECG monitoring) of paroxysmal complete AV block with one or multiple consecutive pauses, without P-P cycle lengthening or PR interval prolongation, not triggered by atrial or ventricular premature beats nor by rate variations; 2) long history of recurrent syncope without prodromes; 3) absence of cardiac and ECG abnormalities; 4) absence of progression to persistent forms of AV block; 5) efficacy of cardiac pacing therapy. The patients affected by idiopathic AV block have low baseline adenosine plasma level values and show an increased susceptibility to exogenous adenosine. The APL value of the patients with idiopathic AV block is much lower than patients affected by vasovagal syncope who have high adenosine values. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Review of AVS Audio Coding Standard

    Institute of Scientific and Technical Information of China (English)

    ZHANG Tao; ZHANG Caixia; ZHAO Xin

    2016-01-01

    Audio Video Coding Standard (AVS) is a second⁃generation source coding standard and the first standard for audio and video coding in China with independent intellectual property rights. Its performance has reached the international standard. Its coding efficiency is 2 to 3 times greater than that of MPEG⁃2. This technical solution is more simple, and it can greatly save channel resource. After more than ten years ’develop⁃ment, AVS has achieved great success. The latest version of the AVS audio coding standard is ongoing and mainly aims at the increasing demand for low bitrate and high quality audio services. The paper reviews the history and recent develop⁃ment of AVS audio coding standard in terms of basic fea⁃tures, key techniques and performance. Finally, the future de⁃velopment of AVS audio coding standard is discussed.

  17. Tolkning av det verbala och det visuella

    Directory of Open Access Journals (Sweden)

    Barbro Sjöberg

    2011-12-01

    Full Text Available I en tidigare publicerad artikel i Techne serien (Sjöberg, 2005 gjordes en genre-beskrivning av fenomenet skissbok. Genrebeskrivningen baserade sig på en analys av sex formgivarstuderandes skissböcker. I den nu aktuella artikeln redogörs för hur genren tillämpats i en slöjdpedagogisk kontext inom två kurser i Konsthand-arbete under åren 2002 respektive 2004 inom de didaktikbaserade ämnesteknolo-giska studierna i slöjdpedagogik vid Åbo Akademi, Vasa. En av målsättningarna för kurserna var att testa skissboken i en slöjdpedagogisk kontext. Under kursens gång hade de studerande som uppgift att utforska och dokumentera ett givet tema i sina skissböcker. Efter avslutad kurs skannades skissböckerna in för att utgöra empiriskt material för tolkning och analys av hur de studerande utformat dokumen-tationen i sina skissböcker på basen av de instruktioner de fått under kursens gång. I föreliggande studie redogörs för bearbetning, tolkning och analys av det empiris-ka materialet med hjälp av NVivo 9, en version av NVivo som underlättar bearbet-ning och den vetenskapliga tolkningen av visuellt material. Resultaten visar att uppmuntran till horisontell mediering i samband med dokumentation i skissbok kan leda till en mångsidig och personlig utforskning av givet tema.Sökord: metod, slöjd, NVivo, skissbok, lärarutbildningURN:NBN:no-29968

  18. Påvising av aminoglykosidresistens ved hjelp av massespektrometri. Utvikling av metode for deteksjon, stabilitet av aminoglykosid og molekylær karakterisering av teststammer

    OpenAIRE

    Kvarekvål, Torunn

    2014-01-01

    Aminoglykosid er potente antibiotika som vert brukt til behandling av alvorlege infeksjonar med aerobe bakteriar. Dei er baktericide og verkar ved å binda til ribosoma i bakteriane og på denne måten forstyrra den normale peptidsyntesen. Aminoglykosida er verdifulle medikament, men som for mange andre antibiotika er resistens mot desse midla eit aukande problem. Den viktigaste resistensmekanismen er aminoglykosidmodifiserande enzym (AME). Desse enzyma inaktiverer ...

  19. Acceptance-criteria for the bedrock for deep geologic disposal of spent nuclear fuel. Proceedings from a seminar at Gothenburg University; Acceptanskriterier foer berggrunden vid djup geologisk slutfoervaring av anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The seminar was directed to Nordic participants, and discussed disposal in the Nordic crystalline bedrock. Criteria for the bedrock should include: It should give durable mechanical protection for the engineered barriers; give a stable and favorable chemical environment for these barriers; have a low turnover of ground water in the near field; be easy to characterize; give favorable recipient-conditions; not have valuable minerals in workable quantities. These general criteria raise several questions coupled to the safety analysis: e.g. the need for geological, hydrological and geochemical parameters. Which data are missing, which are most difficult to find? What should the site characterization program look like to focus on factors that are of the highest importance according to the safety analysis. The demands on the conditions at a site need to be translated into quantitative criteria, which should be expressed as values that can be measured at the site or deduced from such measurements. These questions were discussed at the seminar, and 21 contributions from Finnish, Norwegian and Swedish participants are reported in these proceedings under the chapters: Coupling to the safety analysis; Methodology and criteria for site selection in a regional geoscientific perspective; Rock as a building material - prognosis and result; Geoscientific criteria for the bedrock at the repository - Mechanical protection; Geoscientific criteria for the bedrock at the repository - Low ground water turnover, chemically favorable and stable environment in the near field; Geoscientific criteria for the bedrock at the repository - Demands on the bedrock concerning the migration of radionuclides.

  20. Final disposal of spent nuclear fuels - regulations and the roles of different stakeholders during the decision making process; Slutfoervaring av anvaent kaernbraensle. Regelsystem och olika aktoerers roller under beslutsprocessen

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-05-15

    In November 2006 Swedish Nuclear Fuels Co. applied for a license to build a plant for encapsulation of spent nuclear fuels at Oskarshamn, Sweden. The company also have plans to apply, in 2009, for a license to construct a underground repository for spent nuclear fuels. KASAM arranged a seminar in November 2006 in order to describe and discuss the licensing rules and regulations and the roles of different parties in the decision making. Another objective of the seminar was to point out possible ambiguities in this process. Another interesting question under discussion was in what ways the basic data for the decision should be produced. The seminar covered the part of the process beginning with the application for a license and ending with the government approval/rejection of the application. Most time was spent on the legal aspects of the process.

  1. Hearing on Systems Analysis for Final Disposal of Nuclear Waste? A report from hearings at the Council April 24 2008; Utfraagning om systemanalys foer slutfoervaring av kaernavfall. En rapport fraan Kaernavfallsraadets utfraagning den 24 april 2008

    Energy Technology Data Exchange (ETDEWEB)

    2009-04-22

    Oceanic excess radiocarbon data is widely used as a constraint for air-sea gas exchange. However, recent estimates of the global mean piston velocity (k) from Naegler et al., Krakauer et al., Sweeney et al. and Mueller et al. differ substantially despite the fact that they all are based on excess radiocarbon data from the GLODAP data base. Here I show that these estimates of (k) can be reconciled if first, the changing oceanic radiocarbon inventory due to net uptake of CO{sub 2} is taken into account; second, if realistic reconstructions of sea surface DELTA14C are used and third, if (k) is consistently reported with or without normalization to a Schmidt number of 660. These corrections applied, unnormalized estimates of (k) from these studies range between 15.1 and 18.2 cm/h. However, none of these estimates can be regarded as the only correct value for (k). I thus propose to use the 'average' of the corrected values of (k) presented here (16.5+-3.2 cm/h) as the best available estimate of the global mean unnormalized piston velocity (k), resulting in a gross ocean-to-atmosphere CO{sub 2} flux of 76 +- 15 PgC/yr for the mid-1990s

  2. Uptake of AV-1451 in meningiomas.

    Science.gov (United States)

    Bruinsma, Tyler J; Johnson, Derek R; Fang, Ping; Senjem, Matthew; Josephs, Keith A; Whitwell, Jennifer L; Boeve, Bradley F; Pandey, Mukesh K; Kantarci, Kejal; Jones, David T; Vemuri, Prashanthi; Murray, Melissa; Graff-Radford, Jonathan; Schwarz, Christopher G; Knopman, David S; Petersen, Ronald C; Jack, Clifford R; Lowe, Val J

    2017-09-08

    AV-1451 is an imaging agent labeled with the positron-emitting radiolabel Fluorine-18. 18F-AV-1451 binds paired helical filament tau (PHF-tau), a pathology related to Alzheimer's disease. In our study of AV-1451 uptake in the brains of cognitively normal subjects, we noted a case of a meningioma with visually significant uptake of AV-1451. We initiated the present retrospective study to further examine cases of meningioma that underwent AV-1451 imaging. We searched the patient records of 650 patients who had undergone AV-1451 at our institution for the keyword "meningioma" to identify potential cases. PET/CT and MRI results were visually reviewed and semi-quantitative analysis of PET was performed. A paired student's t test was run between background and tumor standard uptake values. Fisher's exact test was used to examine the association between AV-1451 uptake and presence of calcifications on CT. We identified 12 cases of meningioma, 58% (7/12) of which demonstrated uptake greater than background using both visual analysis and tumor-to-normal cortex ratios (T/N + 1.90 ± 0.83). The paired student's t test revealed no statistically significant difference between background and tumor standard uptake values (p = 0.09); however, cases with a T/N ratio greater than one showed statistically higher uptake in tumor tissue (p = 0.01). A significant association was noted between AV-1451 uptake and presence of calcifications (p = 0.01). AV-1451 PET imaging should be reviewed concurrently with anatomic imaging to prevent misleading interpretations of PHF-tau distribution due to meningiomas.

  3. Portering av programvara – metodik och fallstudie

    OpenAIRE

    Ståhl, Nils

    2012-01-01

    Carasoft AB är ett företag som specialiserat sig på utveckling av dokumenthanteringssystem. Man erbjuder bland annat ett Windowsbaserat dokumenthanteringssystem vid namn Caradoc. Systemet består av flertalet DLL:er skrivna i Delphi och har inte ändrats eller kompilerats sedan 2004. Det här examensarbetet har i syfte att utreda om det finns möjlighet att inom rimlig tid portera Caradoc till Windows 7, med hjälp av den nya Delphi-versionen XE2. Efter en förstudie i ämnet portering, programspråk...

  4. Basic Considerations on AVS DRM Architecture

    Institute of Scientific and Technical Information of China (English)

    Tie-Jun Huang; Yong-Liang Liu

    2006-01-01

    Digital Rights Management (DRM) is an important infrastructure for the digital media age. It is a part of the AVS (Audio and Video coding Standard) of China. AVS Trusted Decoder (ATD) that plays back digital media program according to rights conditions is the core of AVS DRM architecture. Adaptation layers are responsible for translating or negotiating between ATD and peripheral systems. The Packaging Adaptation Layer (PAL), Licensing Adaptation Layer (LAL) and Rendering Adaptation Layer (RAL) will help ATD to gain the interoperability in various DRM environments.

  5. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients.

    Science.gov (United States)

    Schmelter, Christopher; Raab, Udo; Lazarus, Friedrich; Ruppert, Volker; Vorwerk, Dierk

    2015-08-01

    The study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients. 63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5%), followed by complications of angioplasty with vessel rupture or dissection (31.8%). A high rate of procedural success was achieved (98.5%). The most frequent location of the deployed stent-graft was the draining vein (66.7%). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5% at 6 month, 31.3% at 12 month and 19.2% at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1%), followed by stenosis at the AV access (29.5%) and the deployed stent-graft (23.5%). Re-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  6. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  7. Integrasjon av vindkraft i energisystemet : effekten av variabilitet på markedsverdien

    OpenAIRE

    Brekken, Tormod Ween

    2014-01-01

    Klimapolitikken bidrar til å fase ut termisk kraftproduksjon basert på fossile kilder. Dette kan føre til at en mindre andel av kraftproduksjonen kan respondere på prissignaler. Det er planlagt å øke andelen vindkraft i flere kraftmarkeder. Vindkraft er avhengig av været, og er karakterisert av varierende produksjon. Dette påvirker inntekten til hva produsenter av vindkraft vil tjene i kraftmarkedet. Studier har funnet at markedsverdien til vindkraft reduseres ved økte andeler vindkraft i ma...

  8. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  9. En norsk pilotstudie av helsesøstres oppfatninger av pasienters health literacy: helsefremmende allmenndannelse

    OpenAIRE

    Hanne Søberg Finbråten; Kjell Sverre Pettersen

    2012-01-01

    Bakgrunn Uttrykket “ansvar for egen helse” innebærer også evnen til kritisk evaluering av helseinformasjon. Slike kunnskaper og ferdigheter reflekterer health literacy (HL) – på norsk; helsefremmende allmenndannelse, som handler om å forstå, kunne skaffe seg tilgang på, kritisk vurdere og adekvat anvende helseinformasjon for ervervelse av god helse. Hensikt Formålet var å kartlegge helsesøstres oppfatninger av brukeres tre hierarkiske nivåer av HL (Nutbeam 2000): functional HL (FHL), inte...

  10. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  11. Kartlegging av PCB i sedimenter fra Indre Sørfjord

    OpenAIRE

    Skei, J.; Klungsøyr, J

    1990-01-01

    Som følge av forhøyede nivåer av PCB i fiskelever innerst i Sørfjorden er det gjennomført en sedimentundersøkelse for om mulig å finne kilden til PCB. Det ble ikke registrert høye nivåer av PCB i sedimentene. Høyeste konsentrasjoner ble målt i munningen av Eitrheimsvågen. Analyser av trafooljer brukt i Tyssedalsområdet viste spor av PCB.

  12. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  13. Utvärdering av event marketing

    OpenAIRE

    Fransson, Erik; Törnqvist, Johan

    2001-01-01

    Event marketing är en marknadsföringsform som har växt ordentligt under senare delen av 90-talet och det börjar bli ett naturligt inslag i företagens marknadskommunikation. Trots denna tillväxt har event marketing under en längre tid sammankopplats med brist på utvärderingsmetoder. En avsaknad av utvärderingsmetoder leder till svårigheter att avgöra vilka effekter en event marketing-satsning resulterar i, hur genomförandet kan förbättras samt huruvida event marketing är en lämplig form av mar...

  14. Eksakte metodar for analyse av tovegstabellar

    OpenAIRE

    Aaberge, Rolf

    1980-01-01

    Dei fleste matematisk-statistiske metodane som er utvikla til analyse av tabellar, byggjer på føresetnader om at talet på observasjonar i tabellcellene er "stort. Haldorsen (1977a) og (1977b) omtalar metodar som kviler på dette kravet. I denne rapporten skal vi presentere eksakte metodar for analyse av to-vegstabel lar, dvs. metodar som er gyldige sjølv om vi har småe observasjonstal i tabellcellene. I mange undersøkingar vil observasjonane ofte gi uttrykk for kva slags ...

  15. Grafisk presentasjon av GPenSim-simulering

    OpenAIRE

    2009-01-01

    GPenSim er et verktøy for modellering og simulering av diskret hendelsesystemer (DES). GPenSim er integrert i Matlab-plattformen, og har dermed tilgang til innebygde Matlabfunksjoner som plot etc. I GPenSim blir Petri net-grafen definert i Petri netdefinisjonsfiler. Resultatet av en simulering blir vist i tekst. Oppgaven gikk ut på å utvikle et verktøy som skulle presentere både Petri net-grafen og simuleringsresultatet grafisk. En grafisk presentasjon viser tydeligere sammenhe...

  16. AVS Intellectual Property Rights (IPR) Policy

    Institute of Scientific and Technical Information of China (English)

    Cliff Reader

    2006-01-01

    The AVS Workgroup has developed an IPR Policy to facilitate the adoption of standards in the marketplace.The policy is based on consideration of IPR issues in parallel with the technical work for drafting the standard. The paper describes the relationship between IPR and the standard, and how the goals for the standard must be complemented by goals for the IPR. The existing IPR policies of the ITU and ISO are outlined, and then the AVS IPR policy is described,organized by its three main components: commitment to license on declared basic terms, disclosure of intellectual property,and protection of IPR.

  17. Bruk av landstrøm for reduksjon av NOX og CO2 i norske havner

    OpenAIRE

    Frengstad, Åsmund Møll

    2014-01-01

    Bruk av Smart Grid og landstrøm for reduksjon av NOX- og CO2- utslipp i norske havner. I dag slippes det ut mye avgasser fra marine næringer i havner. Disse gassene bidrar både til internasjonale miljøutslipp i form av CO2, men også til lokal luftforurensing. Dette kan føre til redusert livskvalitet for befolkningen og besøkende til havnebyene. For å belyse problemet er Hurtigruten ASA benyttet som eksempel med de havnene den besøker på sin rute opp langs norskekysten. Rapporten gir en...

  18. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  19. Ishockeykjelke - Innfesting av spilleren: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  20. Instrumentering av Bergsøysundbrua og Gjemnesundbrua

    OpenAIRE

    Dahlen, Adrian; Lystad, Tor Martin

    2013-01-01

    Gjemnessundbrua og Bergsøysundbrua på Europavei E39 i Møre og Romsdal, skal instrumenteres for identifikasjon av strukturelle og dynamiske egenskaper. Denne rapporten omhandler dokumentasjon og beskrivelse av det utførte arbeidet ved monteringen av måleutstyret. Det er også gjort analyser av de ulike konstruksjonsdelene akselerometersensorer og anemometre er montert på. Til slutt er de initielle responssignalene fra systemet behandlet, der egenfrekvenser og ...

  1. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  2. Depth statistics

    OpenAIRE

    2012-01-01

    In 1975 John Tukey proposed a multivariate median which is the 'deepest' point in a given data cloud in R^d. Later, in measuring the depth of an arbitrary point z with respect to the data, David Donoho and Miriam Gasko considered hyperplanes through z and determined its 'depth' by the smallest portion of data that are separated by such a hyperplane. Since then, these ideas has proved extremely fruitful. A rich statistical methodology has developed that is based on data depth and, more general...

  3. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  4. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  5. Acid volatile sulfide (AVS)- a comment

    NARCIS (Netherlands)

    Meysman, F.J.R.; Middelburg, J.J.

    2005-01-01

    The review by Rickard and Morse (this volume) adequately summarizes our current understanding with respect to acid-volatile sulfides (AVS). At the same time, this review addresses some of the misunderstandings with regard to measurements and dynamics of this important sedimentary sulfur pool. In

  6. Risikostyring av jetfuelprisen med futureskontrakter : en studie av hedgingstrategier for flyselskaper

    OpenAIRE

    Marker, Sebastian

    2013-01-01

    Denne oppgaven undersøker risikostyring av jetfuelprisen gjennom hedgingstrategier med WTI- og fyringsoljefutures som sikringsinstrument. Analysen tar sikte på å estimere minimum varians hedgingrater for ulike hedgingstrategier. Formålet er å finne hedgingstrategier som gir høyest hedgingeffektivitet, og dermed gir størst reduksjon i jetfuelprisrisiko. Første del av analysen vil estimere hedgingrater med utgangspunkt i flere analysemetoder under en klassisk lineær regresjonsmodell (CLRM). Hed...

  7. Aktivitetsbasert pedagogikk; en studie av bachelorstudenters utvikling av handlingskompetanse gjennom aktivitetsbasert pedagogikk

    Directory of Open Access Journals (Sweden)

    Kari Margrete Hjelle

    2012-06-01

    Full Text Available Målet med artikkelen er å synliggjøre hvordan bachelorstudenter i ergoterapi kan utvikle profesjonell handlingskompetanse gjennom aktivitetsbasert pedagogikk. På bakgrunn av dette gjennomførte vi kvalitative fokusgruppeintervju med 12 ergoterapeutstudenter som hadde deltatt i undervisningsopplegget “Aktivitetsgrupper-lede og delta”. Datamaterialet ble analysert etter retningslinjer for fenomenologisk basert meningskondensering. Studentene diskuterte sine erfaringer og det kom tydelig fram at undervisningsopplegget ga dem muligheter til å bruke sitt engasjement og sin kreativitet i valg av aktiviteter for sin simulerte aktivitetsgruppe. Videre fikk de muligheter til å oppdage sider ved anvendelse av aktiviteter for ulike pasienter, som de ikke kunne forstå uten integrering av teori i praktisk ferdighetstrening. Ved planlegging, gjennomføring og refleksjon over å lede og delta i aktivitetsgrupper, oppøvet de evnen til handlingsrefleksjon. Aktivitetsbasert pedagogikk kan bidra til utvikling av profesjonell handlingskompetanse og det er behov for både teoretiske og praktiske læringsformer. Funnene ble diskutert i lys av pedagogisk handlingsteori.

  8. Low-Complexity Tools in AVS Part 7

    Institute of Scientific and Technical Information of China (English)

    Feng Yi; Qi-Chao Sun; Jie Dong; Lu Yu

    2006-01-01

    Audio Video coding Standard (AVS) is established by the AVS Working Group of China. The main goal of AVS part 7 is to provide high compression performance with relatively low complexity for mobility applications. There are 3 main low-complexity tools: deblocking filter, context-based adaptive 2D-VLC and direct intra prediction. These tools are presented and analyzed respectively. Finally, we compare the performance and the decoding speed of AVS part 7 and H.264 baseline profile. The analysis and results indicate that AVS part 7 achieves similar performance with lower cost.

  9. Overview of AVS-video: tools, performance and complexity

    Science.gov (United States)

    Yu, Lu; Yi, Feng; Dong, Jie; Zhang, Cixun

    2005-07-01

    Audio Video coding Standard (AVS) is established by the Working Group of China in the same name. AVS-video is an application driven coding standard. AVS Part 2 targets to high-definition digital video broadcasting and high-density storage media and AVS Part 7 targets to low complexity, low picture resolution mobility applications. Integer transform, intra and inter-picture prediction, in-loop deblocking filter and context-based two dimensional variable length coding are the major compression tools in AVS-video, which are well-tuned for target applications. It achieves similar performance to H.264/AVC with lower cost.

  10. Varmepumper i hushald. Analyse av endringar i effektforbruket hos hushald med panelomnar og vedfyring ved installasjon av ulike typar varmepumper

    OpenAIRE

    Øvrebotten, Kristian

    2015-01-01

    Sidan oljekrisa på 1970-talet som førte til ein gradvis overgang frå bruk av oljekjelar og parafinkaminar til panelomnar og varmepumper, har andelen elektrisitet stadig auka mens andelen av olje har vore redusert. Andelen av elektrisitet hos hushalda utgjer i dag om lag 79 % av den samla energibruken hos hushalda i Noreg. Dette høge forbruket av elektrisitet hos hushalda bidreg til å skape problem med høge effekttoppar i kraftnettet som igjen skapar problem for kraftdistributørar og er med...

  11. Depth relief

    NARCIS (Netherlands)

    Kappers, A.M.L.; Koenderink, J.J.; Doorn, A.J. van

    1995-01-01

    A study is reported of the depth relief in a simple three-dimensional scene consisting of a white, rough sphere on a planar support, illuminated in a natural manner. Viewing conditions included monocular and binocular as well as 'synoptical' viewing. In the synoptical condition the eyes are

  12. A Novel MBAFF Scheme of AVS

    Institute of Scientific and Technical Information of China (English)

    Jian-Wen Chen; Guo-Ping Li; Yun He

    2006-01-01

    Adaptive frame/field coding techniques have been adopted in many international video standards for interlaced sequence coding. When the frame/field adaptation is applied on the picture level, the coding efficiency is improved greatly,compared with the pure frame coding or the pure field coding. The picture-level adaptive frame/field coding (PAFF) selects frame coding or field coding once for one picture. If this frame/field adaptation is extended to Macro Block (MB) level, the coding efficiency will be further increased. In this paper, a novel MB-level adaptive frame/field (MBAFF) coding scheme is proposed. In the proposed MBAFF scheme, the top field of the current picture is used as a reference. The experiments are implemented on the platforms of Audio Video coding Standard (AVS) base profile and H.264/AVC, respectively. On the AVS platform, 0.35dB gain can be achieved averagely, compared with AVS1.0 anchor. On the H.264/AVC platform, 0.16dB gain can be achieved averagely, compared with MBAFF scheme of H.264/AVC. Additionally, an extensive subjective quality enhancement can be achieved by the proposed scheme.

  13. Utveckling av ett webbforum med innehållshanteringssystemet Drupal

    OpenAIRE

    Lindqvist, Christoffer

    2010-01-01

    Detta examensarbete består av två huvuddelar. Den första delen är en teoretisk analys av innehållshanteringssystem i allmänhet och en forskning i hur det populära innehållshanteringsverktyget Drupal är uppbyggt. Den andra delen av arbetet är en praktisk genomgång av hur funktionalitet för ett webbforum kan byggas upp med hjälp av Drupals ramverk. Den teoretiska analysen undersöker vad ett innehållshanteringsverktyg är, vad det används till och vilka huvuddrag det i allmänhet består av. Sed...

  14. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  15. Kvinnors upplevelser av komplicerad förlossning

    OpenAIRE

    Samuelsson, Magdalena; Wahlberg, Christina

    2006-01-01

    Att vänta och föda barn beskrivs som en av de viktiga övergångsperioderna i livet och innebär ofta en personlig utveckling för den födande kvinnan. Då graviditeten och förlossningen av någon anledning kompliceras, kan denna process störas, och kvinnan kan istället få både fysiska och psykiska men i efterförloppet. Syftet med denna studie var att belysa kvinnors upplevelser av en komplicerad förlossning. Metoden var en granskning i form av en innehållsanalys av sju artiklar som utgjordes av fy...

  16. AVS 3D Video Coding Technology and System

    Institute of Scientific and Technical Information of China (English)

    Siwei Ma; Shiqi Wang; Wen Gao

    2012-01-01

    Following the success of the audio video standard (AVS) for 2D video coding, in 2008, the China AVS workgroup started developing 3D video (3DV) coding techniques. In this paper, we discuss the background, technical features, and applications of AVS 3DV coding technology. We introduce two core techniques used in AVS 3DV coding: inter-view prediction and enhanced stereo packing coding. We elaborate on these techniques, which are used in the AVS real-time 3DV encoder. An application of the AVS 3DV coding system is presented to show the great practical value of this system. Simulation results show that the advanced techniques used in AVS 3DV coding provide remarkable coding gain compared with techniques used in a simulcast scheme.

  17. Analyse av klimatilpassningstiltak : en casestudie av avløpsnettet i Veumdalen, Fredrikstad kommune

    OpenAIRE

    Myking, Jakob Severin Eide

    2012-01-01

    Økt forståelse av fortidens klimaendringer og klimasystemet i sin helhet, har gitt forskerne mulighet til å anta fremtidens klimaendringer. Denne økte forståelsen har gitt sikre tegn på at klimaendringene er knyttet til en stor grad av usikkerhet. Det eneste som er sikkert, er at klimaendringer kommer til å skje, og at det er umulig å si med sikkerhet når eller med hvilken kraft de vil inntreffe. Det som derimot kan sies med sikkerhet, er at befolkningen kommer til å øke. Dette vil føre til ø...

  18. Optimering av FISH- teknik för detektion av Laktobaciller

    OpenAIRE

    Hamidi, Helaleh

    2008-01-01

    Sammanfattning Syftet med den här studien var att utveckla och optimera FISH (Fluorescense In Situ Hybridisation) tekniken som en snabb och ganska billig metod för detektion av laktobaciller. Det vill säga att kunna på objektsglas använda FISH tekniken för att identifiera laktobaciller på artnivå med fluorescensmärkta prober mot 16S och 23S RNA. FISH är en allmän och användbar metod för att detektera och lokalisera mikroorganismer eller en specifik grupp av mikroorganismer i provet (1). Metod...

  19. Kunnskapsutvikling i et profesjonsperspektiv - En kvantitativ studie av sosialarbeideres bruk av kunnskapsressurser i arbeidslivet

    OpenAIRE

    2014-01-01

    Problemområde Profesjoner betraktes gjerne som grupper som rår over store deler av samfunnets ressurser. Som velferdsstatens portvakter anses de gjerne som grupper med definisjonsmakt og forvaltere av kunnskap (Molander og Smeby, 2013). Det moderne kunnskapssamfunnet byr imidlertid på nye utfordringer for profesjonsfeltet. Det stilles i økende grad krav til at profesjonsutøvere skal være faglig oppdaterte, utøve en kunnskapsbasert praksis og til en hver tid inneha nødvendig kompetanse. Sosial...

  20. Functional mathematical model of dual pathway AV nodal conduction.

    Science.gov (United States)

    Climent, A M; Guillem, M S; Zhang, Y; Millet, J; Mazgalev, T N

    2011-04-01

    Dual atrioventricular (AV) nodal pathway physiology is described as two different wave fronts that propagate from the atria to the His bundle: one with a longer effective refractory period [fast pathway (FP)] and a second with a shorter effective refractory period [slow pathway (SP)]. By using His electrogram alternance, we have developed a mathematical model of AV conduction that incorporates dual AV nodal pathway physiology. Experiments were performed on five rabbit atrial-AV nodal preparations to develop and test the presented model. His electrogram alternances from the inferior margin of the His bundle were used to identify fast and slow wave front propagations. The ability to predict AV conduction time and the interaction between FP and SP wave fronts have been analyzed during regular and irregular atrial rhythms (e.g., atrial fibrillation). In addition, the role of dual AV nodal pathway wave fronts in the generation of Wenckebach periodicities has been illustrated. Finally, AV node ablative modifications have been evaluated. The model accurately reproduced interactions between FP and SP during regular and irregular atrial pacing protocols. In all experiments, specificity and sensitivity higher than 85% were obtained in the prediction of the pathway responsible for conduction. It has been shown that, during atrial fibrillation, the SP ablation significantly increased the mean HH interval (204 ± 39 vs. 274 ± 50 ms, P AV node mechanisms and should be considered as a step forward in the studies of AV nodal conduction.

  1. AV nodal dual pathway electrophysiology and Wenckebach periodicity.

    Science.gov (United States)

    Zhang, Youhua; Mazgalev, Todor N

    2011-11-01

    The precise mechanism(s) governing the phenomenon of AV nodal Wenckebach periodicity is not fully elucidated. Currently 2 hypotheses, the decremental conduction and the Rosenbluethian step-delay, are most frequently used. We have provided new evidence that, in addition, dual pathway (DPW) electrophysiology is directly involved in the manifestation of AV nodal Wenckebach phenomenon. AV nodal cellular action potentials (APs) were recorded from 6 rabbit AV node preparations during standard A1A2 and incremental pacing protocols. His electrogram alternans, a validated index of DPW electrophysiology, was used to monitor fast (FP) and slow (SP) pathway conduction. The data were collected in intact AV nodes, as well as after SP ablation. In all studied hearts the Wenckebach cycle started with FP propagation, followed by transition to SP until its ultimate block. During this process complex cellular APs were observed, with decremental foot formations reflecting the fading FP and second depolarizations produced by the SP. In addition, the AV node cells exhibited a progressive loss in maximal diastolic membrane potential (MDP) due to incomplete repolarization. The pause created with the blocked Wenckebach beat was associated with restoration of MDP and reinitiation of the conduction cycle via the FP wavefront. DPW electrophysiology is dynamically involved in the development of AV nodal Wenckebach periodicity. In the intact AV node, the cycle starts with FP that is progressively weakened and then replaced by SP propagation, until block occurs. AV nodal SP modification did not eliminate Wenckebach periodicity but strongly affected its paradigm. © 2011 Wiley Periodicals, Inc.

  2. Legemiddelbivirkninger – forekomst og vurdering av årsakssammenhenger.

    Directory of Open Access Journals (Sweden)

    Tone Westergren

    2009-09-01

    Full Text Available En gjennomgang av spontanrapportene fra den norske bivirkningsdatabasen viser en betydelig geografisk variasjon når det gjelder innrapportering av bivirkninger. I Norge blir disse meldingene evaluert ved RELIS (Regionale legemiddelinformasjonssentre av tverrfaglige team bestående av leger og farmasøyter. Bivirkningsarbeidet ved RELIS gjøres på oppdrag fra Statens legemiddelverk, som har det overordnede ansvar for legemiddelovervåkningen i Norge. Vurderingene baseres på kjent risikoprofil for mistenkte legemidler, indikasjon, dosering, tidsmessig sammenheng mellom reaksjon og medikamentinntak, effekt av seponering og eventuelle andre risikofaktorer. 3345 legemiddel/bivirkningskombinasjoner ble vurdert på bakgrunn av 1408 rapporter i 2006. De fleste mistenkte bivirkningene ble klassifisert som mulige, ettersom andre faktorer også kunne ha spilt en rolle. Få bivirkninger ble klassifisert som sikre. Informasjon om bivirkninger i litteratur og databaser er i flere tilfeller preget av manglende homogenitet, tilfeldige sammentreff i tid, manglende data og lite vurdering av sammenhengen mellom reaksjonen og medisinbruken. Kliniske studier har begrenset mulighet til å påvise annet enn de vanligste bivirkningene. Det kan ta år etter markedsføring å fastslå sammenhengen med mer sjeldne bivirkninger. Frekvenstabeller for bivirkninger er anslag basert på et begrenset antall pasienter, spesielt for nye legemidler. Evaluering av bivirkningsrapporter fra helsepersonell kan avdekke mangel på lett tilgjengelig informasjon og bidra til ny kunnskap om et legemiddels bivirkningsprofil

  3. Russisk oljetransport gjennom Barentshavet : En tilfellestudie av den norske responsen

    OpenAIRE

    Aasen, Kari

    2010-01-01

    Oppgaven er en tilfellestudie av den norske responsen på økningen av russisk oljetransport gjennom Barentshavet. Oljetransporten fra Nordvest-Russland tok seg plutselig dramatisk opp i 2002, noe som kom svært overraskende på norske myndigheter. Hensikten med oppgaven har derfor vært å kartlegge den norske responsen, for å finne ut hva som har preget den. På bakgrunn av kjennetegnene ved responsen har jeg deretter forsøkt å sannsynliggjøre hvilke oppfatninger av Russland som vært dominerende. ...

  4. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  5. Pollen transmission of asparagus virus 2 (AV-2) may facilitate mixed infection by two AV-2 isolates in asparagus plants.

    Science.gov (United States)

    Kawamura, Ryusuke; Shimura, Hanako; Mochizuki, Tomofumi; Ohki, Satoshi T; Masuta, Chikara

    2014-09-01

    Asparagus virus 2 (AV-2) is a member of the genus Ilarvirus and thought to induce the asparagus decline syndrome. AV-2 is known to be transmitted by seed, and the possibility of pollen transmission was proposed 25 years ago but not verified. In AV-2 sequence analyses, we have unexpectedly found mixed infection by two distinct AV-2 isolates in two asparagus plants. Because mixed infections by two related viruses are normally prevented by cross protection, we suspected that pollen transmission of AV-2 is involved in mixed infection. Immunohistochemical analyses and in situ hybridization using AV-2-infected tobacco plants revealed that AV-2 was localized in the meristem and associated with pollen grains. To experimentally produce a mixed infection via pollen transmission, two Nicotiana benthamiana plants that were infected with each of two AV-2 isolates were crossed. Derived cleaved-amplified polymorphic sequence analysis identified each AV-2 isolate in the progeny seedlings, suggesting that pollen transmission could indeed result in a mixed infection, at least in N. benthamiana.

  6. Coding efficiency of AVS 2.0 for CBAC and CABAC engines

    Science.gov (United States)

    Cui, Jing; Choi, Youngkyu; Chae, Soo-Ik

    2015-12-01

    In this paper we compare the coding efficiency of AVS 2.0[1] for engines of the Context-based Binary Arithmetic Coding (CBAC)[2] in the AVS 2.0 and the Context-Adaptive Binary Arithmetic Coder (CABAC)[3] in the HEVC[4]. For fair comparison, the CABAC is embedded in the reference code RD10.1 because the CBAC is in the HEVC in our previous work[5]. The rate estimation table is employed only for RDOQ in the RD code. To reduce the computation complexity of the video encoder, therefore we modified the RD code so that the rate estimation table is employed for all RDO decision. Furthermore, we also simplify the complexity of rate estimation table by reducing the bit depth of its fractional part to 2 from 8. The simulation result shows that the CABAC has the BD-rate loss of about 0.7% compared to the CBAC. It seems that the CBAC is a little more efficient than that the CABAC in the AVS 2.0.

  7. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  8. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  9. Bochdalek Hernia As A Cause Of Intermittent AV Block

    OpenAIRE

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-01-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  10. Depth keying

    Science.gov (United States)

    Gvili, Ronen; Kaplan, Amir; Ofek, Eyal; Yahav, Giora

    2003-05-01

    We present a new solution to the known problem of video keying in a natural environment. We segment foreground objects from background objects using their relative distance from the camera, which makes it possible to do away with the use of color for keying. To do so, we developed and built a novel depth video camera, capable of producing RGB and D signals, where D stands for the distance to each pixel. The new RGBD camera enables the creation of a whole new gallery of effects and applications such as multi-layer background substitutions. This new modality makes the production of real time mixed reality video possible, as well as post-production manipulation of recorded video. We address the problem of color spill -- in which the color of the foreground object is mixed, along its boundary, with the background color. This problem prevents an accurate separation of the foreground object from its background, and it is most visible when compositing the foreground objects to a new background. Most existing techniques are limited to the use of a constant background color. We offer a novel general approach to the problem with enabling the use of the natural background, based upon the D channel generated by the camera.

  11. Introduction to AVS2 Scene Video Coding Techniques

    Institute of Scientific and Technical Information of China (English)

    Jiaying Yan; Siwei Dong; Yonghong Tian; Tiejun Huang

    2016-01-01

    The second generation Audio Video Coding Standard (AVS2) is the most recent video coding standard. By introducing several new coding techniques, AVS2 can provide more efficient compression for scene videos such as surveillance videos, conference videos, etc. Due to the limited scenes, scene videos have great redundancy especially in background region. The new scene video coding techniques applied in AVS2 mainly focus on reducing redundancy in order to achieve higher compression. This paper introduces several important AVS2 scene video coding techniques. Experimental results show that with scene video coding tools, AVS2 can save nearly 40%BD⁃rate (Bjøntegaard⁃Delta bit⁃rate) on scene videos.

  12. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  13. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  14. Bioseguridad en granjas avícolas

    Directory of Open Access Journals (Sweden)

    Sandra L. Ricaurte Galindo

    2005-02-01

    Full Text Available La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extraños a la granja, limpieza y desinfección de los galpones, control de visitas, evitar el stress en las aves encasetadas, evitar la contaminación del pienso, control de vacunaciones y medicaciones y control de deyecciones, cadáveres, etc.The biosecurity is the group of practical of handling designed to prevent the entrance and agents' pathologies transmission that can affect the sanity in the poultry farms. The biosecurity is since a fundamental part of any poultry company it provides an increase of the productivity of the chickens and hens and an increase in the economic yield. In general lines, the localization of the farm should be contemplated, characteristic constructive of the ship, control of strange chickens and hens to the farm, cleaning and disinfection of the ship, control of visits, to avoid the stress in the birds housed, to avoid the contamination of the I think, control of vaccinations and medications and dejections control, cadavers, etc.

  15. Phase 4 paroxysmal AV block in a patient with scleroderma.

    Science.gov (United States)

    Butschek, Ross; Powell, Brian D; Littmann, Laszlo

    2013-01-01

    A 72-year-old man with limited cutaneous systemic scleroderma was hospitalized for two episodes of witnessed syncope. The baseline 12-lead electrocardiogram was normal but on telemetry there were numerous episodes of paroxysmal AV block with asystolic periods of up to 7.5 s duration. Analysis of the rhythm strips revealed phase 4 intra-His bundle block characterized by critical P-P intervals that triggered the AV block, and a narrow range of junctional escape to subsequent P wave intervals that were required to release the AV block. A dual chamber pacemaker was implanted. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Ishockeykjelke - Understell: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndter...

  17. "Oktober i lederstolen" og "Harlekins Alle hjerters dag" : to noveller av Neil Gaiman : oversatt og kommentert

    OpenAIRE

    Eilertsen, Helle Elisabet Jæger

    2011-01-01

    Oppgaven består av oversettelser av to noveller skrevet av Neil Gaiman, og en kommentardel. Novellene er innenfor sjangeren fantastisk litteratur. Kommentardelen tar for seg relevante problemstillinger, blant annet oversettelse av navn, særegne uttrykk og dobbeltbetydning. Den tar også for seg hjemliggjøring/fremmedgjøring og valg av stil. Dette er knyttet til oversettelsesteoretikere som Schleiermacher, Nida, Koller og Berman.

  18. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  19. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  20. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  1. EST Table: AV399431 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399431 NV120218 10/09/28 91 %/131 aa ref|NP_047488.1| CG30 [Bombyx mori NPV] gb|A...AC63757.1| CG30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  2. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  3. EST Table: AV404175 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404175 pg--0560 10/09/28 100 %/209 aa ref|NP_040587.1| capsid component [Enteroba...EFF06860.1| phage major capsid protein E [Escherichia coli B185] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404434 pg-- ...

  4. EST Table: AV399451 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399451 NV120246 10/09/28 94 %/223 aa ref|NP_047521.1| AcMNPV orf124 [Bombyx mori ...NPV] gb|AAC63790.1| AcMNPV orf124 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399564 NV12 ...

  5. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  6. AV-95 Sun Devil: High-Speed Military Rotorcraft

    Science.gov (United States)

    1996-01-01

    The AV-95 Sun Devil must combine helicopter capabilities, such as vertical takeoff and landings (VTOL) and rotor-powered flight, along with long-duration cruise and high-speed dash capabilities unobtainable by conventional helicopters. To be able to perform both tasks, and perform them well, the AV-95 Sun Devil design incorporates several unconventional devices; the AV-95 uses two convertible turbofan engines, able to provide both shaft power for the main rotor and tall fan as well as jet thrust either separately or simultaneously. Other devices used for the AV-95 include a variable diameter main rotor and a blown flap. In helicopter mode, the AV-95 Sun Devil performs like a winged helicopter. The addition of wings to an attack helicopter results in two significant advantages. First, the addition of wings makes a helicopter more maneuverable than a wingless, but otherwise similar helicopter. Second, since the wings produce lift, rotor stall and compressibility effects can be significantly delayed at high tip velocities. In fixed-wing mode, the main rotor is completely off-loaded but slightly powered, and the rotor diameter has been minimized. The AV-95 Sun Devil has many advantages over other VTOL aircraft. The conversion process is simple and fast; conversion does not make the AV-95 vulnerable to enemy attack during conversion such as a tilt-wing or a tilt-rotor. Stop-rotor aircraft and a stowed rotor aircraft require heavy breaking of the rotor for conversion; this adds time for conversion and weight to the aircraft. Because the AV-95 never stops the rotor in flight, much weight is spared, and conversion is much simpler and faster.

  7. EST Table: AV404360 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404360 pg--0892 11/12/09 n.h 10/09/28 61 %/132 aa sp|P03764.2|STF_LAMBD RecName: ...Full=Side tail fiber protein 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404360 pg-- ...

  8. EST Table: AV399747 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399747 NV120691 10/09/28 89 %/128 aa ref|YP_950793.1| gp41 [Maruca vitrata MNPV] ...gb|ABL76015.1| gp41 [Maruca vitrata MNPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399524 NV12 ...

  9. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  10. Gradering av kvaliteten på dokumentasjonen

    Directory of Open Access Journals (Sweden)

    Gunn E. Vist

    2013-11-01

    Full Text Available Hva menes med at noe er ”godt dokumentert”? I hvilken grad kan vi stole på forskningsresultater? Den mest brukte metoden for å vurdere kvalitet på dokumentasjon og styrke på anbefalinger er GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE brukes i systematiske oversikter og i retningslinjer der man vurderer effekten av og gir anbefalinger om ulike behandlingsalternativer. I GRADE gjøres et klart skille mellom kvaliteten på dokumentasjonen og styrken på anbefalingene. For å vurdere kvaliteten på dokumentasjonen tar GRADE utgangspunkt i en godt utført systematisk oversikt som omfatter den aktuelle problemstillingen. Både randomiserte forsøk og observasjonsstuder kan inngå. GRADE benytter fem kriterier som vurderes for eventuell nedgradering av kvaliteten på dokumentasjonen: studiekvalitet, konsistens mellom studiene, direkthet, presisjon og rapporteringsskjevheter. I tillegg kan observasjonsstudier vurderes for oppgradering ved følgende tre kriterier: sterke assosiasjoner, dose-responseffekter og forvekslingsfaktorer. Alle vurderingene noteres og presenteres sammen med resultatene i oppsummeringstabeller.Vist GE, Sæterdal I, Vandvik PO, Flottorp SA. Grading the quality of the evidence. Nor J Epidemiol 2013; 23 (2: 151-156.ENGLISH SUMMARY What is meant by the claim that something is “well documented”? How much confidence can we have in the results? The most commonly used method to grade the quality of the evidence is GRADE (Grading of Recommendations Assessment, Development and Evaluation. GRADE is used in systematic reviews, where the effects of different treatments or options are being compared, and in guidelines with recommendations about the competing options. GRADE makes a clear distinction between the quality of the evidence and the strength of recommendation. When grading the quality of the evidence with GRADE, the starting point is a well conducted systematic review of research on the

  11. Problemstillingar rundt framføring av transkribert musikk - Ei analyse av Bach/Busoni: Chaconne i d-moll

    OpenAIRE

    Flem, Kato Nogva

    2014-01-01

    Ei samanlikning og analyse av Busoni sin transkripsjon av Bach sin Chaconne frå partita nr. 2 for solofiolin. Partita for Violin No. 2 was written by Johann Sebastian Bach during 1717-1723 and consists of five movements; Allemande, Courante, Sarabande, Gigue and Chaconne. The chaconne is longer than the rest of the piece combined, and is frequently played separately. Yehudi Menuhin calls the Chaconne "the greatest structure for solo violin that exists." (Menuhin, 1997, p. 236) Violinist...

  12. Enhanced A-V nodal conduction (Lown-Ganong-Levine syndrome) by congenitally hypoplastic A-V node.

    Science.gov (United States)

    Ometto, R; Thiene, G; Corrado, D; Vincenzi, M; Rossi, L

    1992-11-01

    The basic anatomical substrate of enhanced A-V nodal conduction, manifesting or not as Lown-Ganong-Levine syndrome, is still a controversial issue. We describe the case of a 34-year-old man who presented episodes of ventricular fibrillation. Electrophysiological studies showed that the AH interval was 55 ms, and increased by only 20 ms at paced cycle lengths of 300 ms; atrial pacing induced atrial fibrillation, with a shortest RR interval of 240 ms. Despite verapamil therapy, this patient died suddenly at home. Histological study disclosed a severe A-V node hypoplasia that was evidently congenital in nature; the rest of the conduction system was normal, and no accessory A-V pathways were present. We suggest that enhanced A-V nodal conduction in this patient was due to the developmental defect in the A-V node; this abnormality caused a loss of specific impulse-delaying function, and thus allowed rapid, unfiltered atrial impulses to reach the lower A-V junction and ventricles.

  13. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  14. 快速 AVS 帧内预测算法%FAST AVS INTRA PREDICTION ALGORITHM

    Institute of Scientific and Technical Information of China (English)

    王双龙

    2015-01-01

    As to the complexity process of choosing best probable encoding mode in AVS intra prediction,we proposed a fast intra predic-tion encoding algorithm.With the analysis of AVS intra prediction encoding theory and its implementation in reference software GDM2.1,we derived the threshold of zero coefficient block determination.The fast algorithm determines whether or not the current block is a zero coeffi-cient block according to its threshold discriminant condition.For zero coefficient block,it encodes cbp element directly and terminates intra prediction encoding in advance,which avoids the consequent complex process.As for the non-zero coefficient blocks,the fast selection algo-rithm associating the time domain SAD and the frequency domain SATD is used,which excludes 40% to 80% impossible prediction modes, and the rate distortion function is applied to the remained prediction modes to select the best prediction mode.It was verified through experi-ment that when PSNR (peak signal-to-noise ratio)decreased within 0.25db and bits rate increased within 2%,the time of AVS encoding de-creased over 40%,and the encoding efficiency was largely improved as well.%针对 AVS(Audio Video code Standard)帧内预测中选择最优编码模式流程复杂的问题,提出一种快速帧内预测编码的算法。通过分析 AVS 帧内预测编码的原理及其在参考软件 GDM2.1中的代码实现,推导出判定零系数块的阈值。该快速算法根据零系数块的判定阈值条件判定当前块,对于零系数块,直接编码 cbp 元素,提前中止帧内预测编码,避免了后续的复杂流程;对于非零系数块,采用时域 SAD(Sum of Absolute Difference)与频域 SATD(Sum of Absolute Transformed Difference)相联合的快速选择算法,排除了40%~80%的不可能预测模式,对余下的模式采用率失真代价函数的方法选取最佳预测模式。经实验验证,在 PSNR(Peak Sig-nal to Noise Ratio)降低0

  15. Kortisonskepsis : En studie om holdninger til kortisonkrem blant foreldre av barn med atopisk eksem

    OpenAIRE

    Gustavsen, Hanne Engstrøm

    2010-01-01

    Bakgrunn: Kortisonkremer er en viktig del av behandlingen mot atopisk eksem. Mange foreldre er skeptiske til bruken av kortisonkremer, fordi de har lest eller hørt om bivirkninger. Pasienters og pårørendes holdninger til bruk av kortisonkrem kan påvirke gjennomføringen av behandlingen. Formål: Vi ønsket å undersøke holdninger til bruk av kortisonkrem blant foreldre og pårørende av barn med atopisk eksem. Vi ville også undersøke om det er en sammenheng mellom kunnskapsnivå om kortisonkreme...

  16. Utviklingen av Noark-standarden 1984 – 2008

    Directory of Open Access Journals (Sweden)

    Trond Sirevåg

    2014-11-01

    Full Text Available Artikkelen behandler utviklingen av Noark – standarden for elektronisk arkivdanning i norsk offentlig forvaltning – fra versjon 1 (1984 til versjon 5 (2008. Den beskriver omstendighetene som medførte at standarden ble til i 1984, og søker å forklare hvorfor og hvordan det lyktes å utbre standarden slik at Noark-systemer ble enerådende i offentlig forvaltning i løpet av 1990-årene. Riksarkivarens strategier i Noark-utviklingen behandles, – de som fra først av fikk Riksarkivaren til å engasjere seg i standardiseringsarbeidet, de som deretter fikk Riksarkivaren til å overta forvalteransvaret for Noark, og de som senere er endret eller justert som resultat av erfaringer med Noark-baserte systemer og av nyåpnede teknologiske muligheter. Særlig vekt legges på å belyse Riksarkivarens motiver for å overta ansvaret for Noark-standarden fra 1990. Noark plasseres også i det internasjonale bildet, og sammenholdes med andre standarder som ISO 15489 og EU-standarden MoReq. Da Noark-utviklingen startet i 1984, pågikk tilsvarende utviklingsprosjekter både i Danmark og i Sverige. Artikkelen søker forklaringer på at en journal- og sakarkivstandard bare ble en realitet i Norge.

  17. Kartläggning av byggprocessen hos Peab med hjälp av SCOR

    OpenAIRE

    Johansson, Robin

    2012-01-01

    Detta är ett examensarbete utfört på Institutionen för teknik och naturvetenskap (ITN) i Norrköping som är en del av Linköpings Universitet i samarbete med Peab som intressent. Historiskt sett har byggbranschens intresse för logistik varit svalt vilket har lett till att logistiken inom denna bransch har halkat efter i förhållande till övriga branscher. Syftet med detta examensarbete är att utifrån ett logistiskt synsätt tillhandahålla anpassningsförslag till SCOR-processerna ”Make” och ”Retur...

  18. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  19. Solmoduler på balkongfronter : Renovering av flerbostadshus i miljonprogrammet

    OpenAIRE

    Persson, Maria

    2015-01-01

    Under det senaste seklet har en intensiv energianvändning orsakat stora utsläpp av koldioxid och andra växthusgaser i atmosfären med negativa miljöeffekter som följd. Den alltjämt ökade efterfrågan på elektricitet runtom i världen måste mötas av förnybara energikällor i kombination med energieffektiviseringar för att inte riskera ytterligare miljöförstöring. I Sverige är bostads- och servicesektorn en intensiv energianvändare och några av de byggnader som förbrukar mest energi finns i miljonp...

  20. En kartläggning av stereoskopisk 3D

    OpenAIRE

    Holmström, Benny

    2011-01-01

    Det här lärdomsprovet är en genomgång av ett av den moderna tidens största modeord: stereoskopisk 3D och syskontermen autostereoskopisk 3D. Kort sagt de tekniker som går ut på att leverera en bild till vardera av människans två ögon och därmed simulera djup i tvådimensionella bilder. Det här kan göras på en mängd olika sätt, och i detta examensarbete går jag igenom de vanligaste teknikerna och förklarar dem kortfattat, en och en. Utöver tekniken analyserar jag även dagens marknad, teknikernas...

  1. Brachial artery aneurysms following brachio-cephalic AV fistula ligation.

    Science.gov (United States)

    Khalid, Usman; Parkinson, Frances; Mohiuddin, Kamran; Davies, Paula; Woolgar, Justin

    2014-01-01

    Peripheral artery aneurysms proximal to a long-standing arteriovenous (AV) fistula can be a serious complication. It is important to be aware of this and manage it appropriately. Vascular access nurses input all data regarding patients undergoing dialysis access procedures into a securely held database prospectively. This was retrospectively reviewed to identify cases of brachial artery aneurysms over the last 3 years. In Morriston Hospital, around 200 forearm and arm AV fistulas are performed annually for vascular access in renal dialysis patients. Of these, approximately 15 (7.5%) are ligated. Three patients who had developed brachial artery aneurysms following AV fistula ligation were identified. All 3 patients had developed brachial artery aneurysms following ligation of a long-standing brachio-cephalic AV fistula. Two patients presented with pain and a pulsatile mass in the arm, and one presented with pins and needles and discoloration of fingertips. Two were managed with resection of the aneurysm and reconstruction with a reversed long saphenous vein interposition graft, the third simply required ligation of a feeding arterial branch. True aneurysm formation proximal to an AV fistula that has been ligated is a rare complication. There are several reasons for why these aneurysms develop in such patients, the most plausible one being the increase in blood flow and resistance following ligation of the AV fistula. Of note, all the patients in this study were on immunosuppressive therapy following successful renal transplantation. Vigilance by the vascular access team and nephrologists is paramount to identify those patients who may warrant further evaluation and investigation by the vascular surgeon.

  2. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  3. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_3_ORF2 E26799A422BE33BE PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) NA ? IPR015500 unintegrated ...

  4. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  5. Modellering og dimensjonering av kaianlegg etter Eurokode 2

    OpenAIRE

    Lilleaker, Tore; Tvervåg, Henrik

    2010-01-01

    Dette er sluttrapporten for masteroppgaven på en kaikonstruksjon utført ved NTNU, institutt for konstruksjonsteknikk. Det er i oppgaven gjennomført en prosjektering og dimensjonering av en betongkai etter NS-EN 1992-1-1. Det er også gjennomført et litteraturstudie med en tilhørende teoridel om bestandighet for betongkonstruksjoner i et marint miljø, samt at det er gjennomført en sannsynlighetsbasert bestandighetsanalyse av denne konstruksjonen. Avslutningsvis er det drøftet litt rundt teori, ...

  6. EST Table: AV403981 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available terminase large subunit (DNA packaging protein A) from bacteriophage origin [Escherichia coli UMN026] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403981 pg-- ... ...AV403981 pg--0297 11/12/09 n.h 10/09/28 100 %/265 aa ref|YP_002411376.1| terminase large subunit (DNA packag...ing protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1|

  7. Modellering av nedslagsfeltet- Veumdalen i Fredrikstad med programmet SWMM

    OpenAIRE

    2015-01-01

    Fredrikstad kommune har hatt store prosjekter pågang i de siste årene i forbindelse med opprustning av ledningsnettet. Oppfylte kjellere har vært en viktig tema for kommunen, og de har en intensjon om å redusere faren for oversvømmelser i utsatte steder. En av de utsatte stedene i Fredrikstad er Veumdalen som har problemer med oversvømmelser nesten hvert år. Som en forebyggende tiltak har kommunen i samarbeid med COWI bygget en tunnel fra Veumveien/Veumbekken til Seutelva. Det ...

  8. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  9. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  10. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  11. EST Table: AV399757 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399757 NV120719 11/12/09 n.h 10/09/28 83 %/234 aa ref|NP_047435.1| AcMNPV orf30 [...Bombyx mori NPV] gb|AAC63704.1| AcMNPV orf30 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399757 NV12 ...

  12. Prosjektering og analyse av Nordøyvegen bru 3

    OpenAIRE

    Lauknes, Andreas; Arild, Audun

    2016-01-01

    Rapporten tar for seg prosjektering av en etteroppspent betongbru, der beregninger og dimensjoneringen er i henhold til det Europeiske regelverket, nasjonale tillegg og Håndbøker fra Statens vegvesen. Brua som skal dimensjoneres og bli gjort kapasitetskontroll for er Nordøyvegen bru 3, som skal bygges som en del av et større fastlandsprosjekt for nordøyene i Haram kommune. Brua skal bygges som en bjelke-/platebru, og konstruksjonsmetoden er fritt frambygg med totalt syv byggefaser. Den består...

  13. Fysisk aktivitet inom rehabiliteringen av anorexi : - En systematisk litteraturstudie

    OpenAIRE

    Högnäs, Maria

    2011-01-01

    Studiens syfte var att undersöka hur fysisk aktivitet påverkar unga flickor (12-24 år) med anorexi, i samband med rehabilitering. Skribenten vill dessutom ytterligare få specificerat vilken typ av fysisk aktivitet som kan vara lämplig för denna målgrupp. Frågeställningarna besvaras genom en systematisk litteraturstudie. Genom databassökning och frisökning hittades 14 relevanta artiklar som genomgick en kvalitetsgranskning, enligt en modifierad metod för kvalitetsgranskning av Forsberg & Wengs...

  14. Norsk passivhusstandard og Passivhauskonzept: en sammenlignende analyse av krav og kriterier

    DEFF Research Database (Denmark)

    Anton, Karin; Vestergaard, Inge

    kriterier som omfattes av passivhuskonseptet med tilhørende sertifisering og kriterier i Norsk Standard 3701. Gjennom analysen ønsker vi å systematisere og sammenlikne de forskjellige kriteriene i standarden: optimalisering, kuldebroer, lufttetthet og trykktesting, utnyttelse av passiv solenergi, bruk av...

  15. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...

  16. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  17. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  18. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  19. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  20. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  1. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  2. EST Table: AV405806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405806 wdV30260 10/09/28 65 %/199 aa ref|NP_001119709.1| transformer 2 isoform E ...[Bombyx mori] gb|AAX47003.1| transformer-2 protein E [Bombyx mori] 10/08/28 low homology 10/08/27 low homolo

  3. EST Table: AV400604 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400604 br--1517 10/09/28 48 %/208 aa ref|XP_001863389.1| wolfram syndrome 1 [Cule...x quinquefasciatus] gb|EDS38516.1| wolfram syndrome 1 [Culex quinquefasciatus] 10/08/28 50 %/173 aa FBpp0291

  4. EST Table: AV398407 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398407 NV021774 10/09/28 100 %/186 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...507-PA 10/09/10 48 %/236 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  5. EST Table: AV398495 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398495 NV021874 10/09/28 91 %/209 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 54 %/213 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 NV02 ...

  6. EST Table: AV401468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401468 e96h0771 10/09/28 87 %/171 aa ref|NP_001040215.1| stathmin [Bombyx mori] gb|ABD36259.1| stathmin...07-PA 10/09/10 55 %/166 aa gi|91083957|ref|XP_975021.1| PREDICTED: similar to stathmin [Tribolium castaneum] FS915193 e96h ...

  7. EST Table: AV403752 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403752 pg--0009 10/09/28 100 %/257 aa ref|YP_002411376.1| terminase large subunit (DNA packaging... protein A) from bacteriophage origin [Escherichia coli UMN026] emb|CAR11828.1| terminase large subunit (DNA packaging

  8. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  9. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  10. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  11. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  12. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  13. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  14. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  15. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  16. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  17. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  18. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  19. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  20. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  1. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  2. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  3. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  4. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  5. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  6. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  7. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  8. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  9. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  10. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  11. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  12. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  13. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  14. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  15. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  16. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  17. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  18. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  19. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  20. EST Table: AV399507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399507 NV120319 10/09/28 70 %/144 aa ref|YP_803401.1| baculovirus repeated ORF-b [Anticars...ia gemmatalis nucleopolyhedrovirus] gb|ABI13791.1| baculovirus repeated ORF-b [Anticarsia gemmatali

  1. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  2. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  3. EST Table: AV403894 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ref|XP_001605691.1| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/08/28 52...%/206 aa gi|189241712|ref|XP_968082.2| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] AV403894 pg-- ...

  4. Centralized Library Services for Audiovisual Media. AV in Action 4.

    Science.gov (United States)

    Nederlands Bibliotheek en Lektuur Centrum, The Hague (Netherlands).

    Designed to provide assistance to countries in developing centralized services to their libraries for nonbook materials, this pamphlet contains examples from five countries that have succeeded in establishing such services. Those examples include: (1) "The Central Library Service for AV-Materials in Denmark" (Suzanne Hemmeth…

  5. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  6. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  7. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something about...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  8. EST Table: AV398194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398194 NV021231 10/09/28 38 %/170 aa ref|NP_724426.2| vulcan, isoform D [Drosophi...la melanogaster] gb|AAM68355.2| vulcan, isoform D [Drosophila melanogaster] 10/08/28 38 %/170 aa FBpp0289730

  9. EST Table: AV406060 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406060 wdV30561X 10/09/28 99 %/122 aa gb|ACN86367.1| troponin T transcript varian...006588#locus:tnt- 3#status:Partially_confirmed#UniProt:B9WRS6#protein_id:AC M46022.1 10/09/10 81 %/122 aa AG

  10. EST Table: AV405690 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405690 wdV30118 10/09/28 93 %/225 aa ref|NP_001040124.1| exuperantia [Bombyx mori] gb|ABD36117.1| exuperan...9360-PA 10/09/10 53 %/220 aa gi|91085815|ref|XP_974770.1| PREDICTED: similar to exuperantia [Tribolium castaneum] FS919769 wdV3 ...

  11. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  12. EST Table: AV401871 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401871 heS00267 11/12/09 GO hit GO:0046872(metal ion binding) 10/09/28 65 %/194 aa gb|ACR61720.1| triglyce...ride lipase [Manduca sexta] 10/08/28 48 %/206 aa FBpp0147001|DgriGH13095-PA 10/08/2

  13. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  14. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  15. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  16. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  17. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  18. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  19. EST Table: AV405516 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405516 wdV10864 10/09/28 33 %/180 aa ref|XP_969213.1| PREDICTED: similar to artemis...0768|ref|XP_969213.1| PREDICTED: similar to artemis protein [Tribolium castaneum] FS920671 wdV1 ...

  20. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  1. Forskerskoler som modeller for forskerutdanning: Progresjon og utvikling av ekspertise

    Directory of Open Access Journals (Sweden)

    Sten Ludvigsen

    2013-12-01

    Full Text Available I de senere årene har forskerskoler blitt fremhevet som en mulig løsning på ulike utfordringer innenfor forskerutdanningen. På bakgrunn av erfaringer med to forskerskoler innenfor utdanningsvitenskap, vil vi i denne artikkelen belyse to problemstillinger: Hvordan kan man organisere læringsforløpet til ph.d.-kandidatene slik at det støtter deres progresjon? Og hva må forskerutdanningen inneholde for at ph.d.-kandidatene skal utvikle tilstrekkelig ekspertise innenfor et avgrenset kunnskapsområde?For å skape progresjon, bør utdanningsprogrammet bidra til å gi struktur og angi faglig retning. Videre må utdanningselementene være relevante for avhandlingsarbeidet. I tillegg kan progresjon fremmes gjennom seminarer, der utviklingen av tekster og artikler følges opp. Argumentet om at forskerskoler bør bygge på gode forskningsmiljøer har stått sentralt i utredningen av ulike modeller for forskerutdanning i Norge. Ett aspekt som har fått økende oppmerksomhet er betydningen av å oppnå en tilstrekkelig grad av spesialisering. Uten utvikling av en slik ekspertise, vil ph.d.-kandidatene ikke kunne publisere internasjonalt og delta i forskningsfellesskap.Ved Det utdanningsvitenskapelige fakultet har man de siste 10 årene utviklet flere typer forskerskoler. I denne artikkelen tar vi utgangspunkt i den UiO-finansierte, tematisk avgrensede forskerskolen «Læring, kommunikasjon og IKT» (2004–2008 og den NFR-finansierte nasjonale forskerskolen i utdanningsvitenskap, NATED (2008–2016, hvor ph.d.-kandidatene deltar i faglige aktiviteter organisert i fire spor.Metodene som brukes for å besvare problemstillingene omfatter intervjuer, spørreskjema og refleksjoner vedrørende de to ulike forskerskolene.Resultatene viser at man kan oppnå nødvendig spesialisering, høy kvalitet, høy tilfredshet og høy relevans ved bruk av forskerskoler som virkemiddel i forskerutdanningen. Begge forskerskolene har tilrettelagt for internasjonal

  2. Minimizing ventricular pacing by a novel atrioventricular (AV) delay hysteresis algorithm in patients with intact or compromised intrinsic AV conduction and different atrial and ventricular lead locations.

    Science.gov (United States)

    Pakarinen, Sami; Toivonen, Lauri

    2013-09-01

    To investigate if an advanced AV search hysteresis (AVSH) algorithm, Ventricular Intrinsic Preference (VIP(™)), reduces the incidence of ventricular pacing (VP) in sinus node dysfunction (SND) with both intact and compromised AV conduction and with intermittent AV block regardless of the lead positions in the right atria and the ventricle. Patients were classified as having intact AV (AVi) conduction if the PR interval was ≤ 210 ms on ECG and 1:1 AV conduction during atrial pacing up to 120 bpm with PR interval ≤ 350 ms. Otherwise the AV conduction was classified as compromised (AVc). Both AVi and AVc patients were randomized to VIP ON or OFF. VIP performed an intrinsic AV conduction search every 30 s for three consecutive atrial cycles with the extension of the sensed and paced AV (SAV/PAV) delays from basic values of 150/200 ms to 300/350 ms. Extended AV intervals were allowed for three cycles when VP occurred before returning to basic AV delays. The primary end-point was %VP at 12 months. Among 389 patients, 30.1% had intact and 69.9% had compromised AV conduction. The mean %VP at 12 months was 9.6% by VIP compared to 51.8% with standard AV settings in patients with AVi (P < 0.0001) and 28.0% versus 78.9% (P < 0.0001) with AVc. With VIP, excessive %VP among most used lead positions was not seen. Conversely, when VIP was off %VP was low only in patients who had leads in the RA septal-RV septal position (23.0%). VIP feature reduces VP both in patients with SND and with intermittent heart block regardless of the lead positions in the right atria and the ventricle.

  3. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  4. Fra strømfordeling til pengestrøm? : Statnett fra forvaltningsbedrift til statsforetak : en konsekvensanalyse av omorganiseringen av Statnett seks år etter

    OpenAIRE

    Knudsen, Halvor Gillund

    1998-01-01

    Fra strømfordeling til pengestrøm? Statnett fra forvaltningsbedrift til statsforetak en konsekvensanalyse av omorganiseringen av Statnett seks år etter. Tema for oppgaven er konsekvenser av endrete tilknytningsformer i staten. Temaet er kommet frem gjennom tilknytning til et samarbeidsprosjekt mellom Universitetet i Oslo ved Vitenskapsbutikken og Arbeids- og administrasjonsdepartementet. Årsaken til at man ønsker å se på slike forhold er den stadige kritikken mot en etter sigende alt for...

  5. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  6. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  7. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  8. Forbuden frukt smaker best en studie av nordmenns spise- og drikkemønster av sjokolade, søtsaker, salt snacks, sukkerholdige leskedrikker og lignende

    OpenAIRE

    Bugge, Annechen Bahr

    2010-01-01

    Denne studien er en del av forskningsprosjektene Young Food og HealthMeal. Begge prosjektene er finansiert av Norges forskningsråd. Temaet i rapporten er nordmenns spise- og drikkemønster av en type mat og drikke som helsemyndighetene ønsker at befolkningen skal redusere forbruket sitt av – slik som sjokolade, søtsaker, søte bakervarer, salt snacks og sukkerholdige drikker. Selv om forbruksutviklingen de seneste par årene har vist positive tendenser, har altså nordmenn fremdeles et langt høye...

  9. En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap

    OpenAIRE

    2014-01-01

    Abstrakt Utvecklingsarbetet ”En handlingsmodell för förebyggandet av psykologiska komplikationer hos kvinnor som genomgår avbrytande av havandeskap”, är en fortsättning på examensarbetet ”Abort - En systematisk översikt av kvinnornas upplevelser och av vårdpersonalens betydelse” som publicerades och presenterades våren 2013. Syftet med utvecklingsarbetet är att producera en handlingsmodell för hälsovårdspersonalen. Handlingsmodellen kommer att ge råd och tips på hur man som hälsovårdspe...

  10. Cloning and characterization of a novel apolipoprotein gene, apolipoprotein AV, in tree shrews.

    Science.gov (United States)

    Li, Guoping; Luo, Huairong; Sun, Guotao; Wu, Guisheng; Wu, Gang; Wang, Yan; Man, Yong; Wang, Shu; Li, Jian; Chen, Baosheng

    2013-09-01

    Apolipoprotein AV (apoAV) modulates plasma triglyceride levels, which is an independent risk factor for cardiovascular disease. ApoAV is also involved in atherosclerosis lesion formation. In order to systematically evaluate the apolipoprotein-related gene profile in tree shrew, a model for its insusceptibility to atherosclerosis, we performed apoAV cloning and characterization. The full-length cDNA of apoAV was identified using SMART-RACE. ApoAV cDNA sequence revealed two transcripts, 1,948 and 1,397 base pairs, due to alternative polyadenylation. These two transcripts share the same open reading frame (ORF), which encodes a 369-amino acid protein with high identity to human apoAV (75 %), including a 23-amino acid N-terminal signal peptide. ApoAV is expressed exclusively in the liver. Mature apoAV was expressed in E. coli BL21(DE3) and purified by Ni-chelated resin. Lipoprotein lipase activity was significantly stimulated by this recombinant protein. The full-length ORF of apoAV was cloned into pDsRed-monomer-N1 vector with a red fluorescent protein tag and was primarily localized in cytoplasm of hepG2 cells. The successful cloning, expression and localization of apoAV in tree shrew has laid down the foundation for further investigation on its structure and functions.

  11. Site selection for disposal of nuclear waste - on what grounds? A report from hearings at the Council June 4-5 2008; Platsval foer slutfoervar av kaernavfall - paa vilka grunder? En rapport fraan kaernavfallsraadets utfraaning den 4-5 juni 2008

    Energy Technology Data Exchange (ETDEWEB)

    2009-07-01

    As part of the Nuclear Waste Council's own knowledge-building on site selection, the Council organized a hearing on the what grounds site selection will be made. The public hearing, had several objectives: to contribute to knowledge building on site selection for Nuclear Waste Council and other actors, to contribute to an improved basis for site selection by clarifying the factors and values of importance, to clarify the different actors' expectations SKB's future accounting, to highlight how to deal with different aspects (safety, geological, environmental, infrastructural, socio-economic and democratic) instruments for site selection, and to identify operators of critical issues. The report is divided into the following sections: The Government's View on the upcoming Site Selection; the Site Selection Process, The View of the Local Communities on the Site Selection; the Current Status of the Selection Process, SKB's plans, the Site-Selection Factors; he Authorities' perspective; the Environmental Organizations perspective; Reflections of the Council on the Hearings; Discussion and Analysis of Key Issues related to Groundwater Flow, Final Discussion

  12. Viktigheten av fysisk aktivitet og trening blant eldre

    Directory of Open Access Journals (Sweden)

    Hilde Lohne-Seiler

    2012-11-01

    Full Text Available Regelmessig fysisk aktivitet er viktig for eldres helse. Sammenhengen mellom en fysisk aktiv livsstil og helsegevinster som forebygging av sykdom, opprettholdelse av uavhengighet og økt livskvalitet er godt dokumentert (ACSM's Position Stand 1998; Spirduso & Cronin, 2001; Taylor et al., 2004. Hensikten med denne oversiktsartikkelen er derfor å redegjøre for viktigheten av regelmessig fysisk aktivitet og trening i aldringsprosessen, samt utdype sammenhengen mellom en fysisk aktiv livsstil og fysisk funksjon blant eldre. Basert på en nasjonal multisenterstudie (Anderssen et al., 2009, tilfredsstilte 20% voksne og eldre (20-85 år de nasjonale anbefalinger om 30 minutter med daglig fysisk aktivitet. Kun 12% i den eldste aldersgruppen (80-85 år tilfredsstilte anbefalingene. Totalt fysisk aktivitetsnivå, målt ved hjelp av akselerometer, ble redusert med økende alder, hvor de eldste (80-85 år hadde 50% lavere aktivitetsnivå sammenlignet med de yngste (65-69 år (Lohne-Seiler et al., 2012. Fra 25-års alder reduseres utholdenhet og muskelstyrke med 10% per 10 år dersom individet er inaktiv (Heath et al., 1981; Wilmore, 1991. Systematisk utholdenhets- og styrketrening ser derimot ut til å redusere tapet med inntil halvparten, det vil si en reduksjon tilsvarende 5% per 10 år hos fysisk aktive individer (Heath et al., 1981. Eldre individer ser ut til å ha de samme treningsinduserte effekter som yngre, det vil si at man får effekt av økt aktivitet uansett alder, og da også lik prosentvis fremgang (Hagberg et al., 1989. Studier har vist at det er mulig å øke maksimalt oksygenopptak og maksimal muskelstyrke med inntil 10-20% i løpet av en 12 ukers intervensjon (Hagberg et al., 1989; Reeves et al., 2003; Lohne-Seiler et al, in press. Da muskelstyrke ser ut til å ha en sterk sammenheng med individets funksjonsevne/mobilitet, er det viktig å kunne tilrettelegge for systematisk styrketrening for eldre for på den måten å oppnå

  13. Kartlegging av læreres kunnskap er ikke enkelt

    Directory of Open Access Journals (Sweden)

    Reidar Mosvold

    2015-05-01

    Full Text Available Læreres kunnskap har betydning for elevenes læring, og som et ledd i prosessen for styrking av kvaliteten i norsk skole har politikere i senere tid ytret ønske om å kartlegge læreres kunnskap. Kartlegging av læreres kunnskap er imidlertid ikke enkelt, og i denne artikkelen undersøker vi hvordan de samme lærernes undervisningskunnskap i matematikk kan se ut til å være forskjellig når den måles ved hjelp av oppgaver med ulikt format. Deltakerne i studien var 30 praktiserende lærere, og instrumentet besto av 28 flervalgsoppgaver med tilhørende åpne oppgaver. Sammenhengen mellom lærernes kunnskap slik den måles ved hjelp av flervalgsoppgavene og de åpne oppgavene er ikke alltid klar. Det er derfor nødvendig å tilnærme seg måling av læreres undervisnings-kunnskap i matematikk med stor varsomhet. Nærmere undersøkelser er nødvendig for å finne ut hva slags type kunnskap som kan måles med ulike typer oppgaver og hva slags måleinstrumenter som kan brukes til hvilke formål.Nøkkelord: Undervisningskunnskap i matematikk, kartlegging, måleinstrument-er, flervalgsoppgaver AbstractTeachers’ knowledge influence students’ learning, and as part of their attempts to increase the quality of Norwegian schools, politicians have announced their intentions to measure the knowledge of teachers. Measuring teacher knowledge is not straightforward, however, and this article investigates how a group of mathematics teachers’ knowledge might appear different when measured by items of different formats. The participants in this study were 30 in-service teachers, and the instrument consisted of 28 multiple-choice items with associated open-response items. The connection between the teachers’ know-ledge as measured by multiple-choice items and open-response items is not always straightforward. As an implication, it is necessary to approach measure-ment of teachers’ mathematical knowledge for teaching with great care. Further studies are

  14. Avsluttende studentevaluering i Bachelorutdanningen : avgangsstudenters vurdering av undervisning og utdanning ved Politihøgskolen, Kull 05–08

    OpenAIRE

    Hove, Kjersti

    2010-01-01

    Denne rapporten inneholder en oppsummering og enkle analyser av studenters evaluering av utdanningen ved slutten av studiet. Evalueringen bygger delvis på spørsmål hentet fra StudData, og en tilsvarende rapport fra HiO ( Hatlevik, Ida Katrine Riksaasen: Avgangsstudenten – Studentenes vurdering av undervisning, praksis, studieforhold, tilegnet kompetanse, studieatferd og fremtidig utdanning. HiO-notat nr 2 -2009) hvor analyser av flere studentgruppers evalueringer er sammenstilt. Rapporten fra...

  15. Wirevagn : Utvecklingen av en utrullare för hisslinor

    OpenAIRE

    Rehnsfeldt, Patrik

    2014-01-01

    Kandidatexamensarbetet som utgick från en förfrågan från företaget Irongrip AB hade som mål att utveckla ett produktförslag på en utlindare av stålvajer för hissmontörer. Irongrip AB som tillverkar och säljer verktyg för hantering av stålvajer hade uppmärksammat att en efterfrågan på en sådan produkt fanns på marknaden då befintliga lösningar var bristfälliga och inte hade alla de funktioner som är önskvärda hos en sådan produkt.Arbetet inleddes med en förstudie där studiebesök vid lindragnin...

  16. EST Table: AV400562 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400562 br--1452X 10/09/28 59 %/160 aa ref|XP_001843664.1| neuroendocrine protein ...7b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 41 ...47 %/159 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  17. EST Table: AV400244 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400244 br--1010 10/09/28 53 %/100 aa ref|XP_001654557.1| neuroendocrine protein 7...b2 [Aedes aegypti] gb|EAT46754.1| neuroendocrine protein 7b2 [Aedes aegypti] 10/08/28 n.h 10/08/27 n.h 10/09/10 low homology 10/09/10 n.h 10/09/10 n.h BP115163 br-- ...

  18. EST Table: AV398380 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398380 NV021745 10/09/28 70 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV02 ...

  19. EST Table: AV399091 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399091 NV060650 10/09/28 71 %/209 aa ref|XP_001648944.1| dendritic cell protein [...hort=eIF3m gb|EAT44291.1| dendritic cell protein [Aedes aegypti] 10/08/28 66 %/206 aa FBpp0276999|DpseGA2097...P_968265.1| PREDICTED: similar to dendritic cell protein [Tribolium castaneum] FS916297 NV06 ...

  20. EST Table: AV399252 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399252 NV060970 10/09/28 62 %/104 aa ref|NP_001119705.1| transformer 2 isoform A ...[Bombyx mori] gb|AAT42220.2| transformer-2 protein A [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 low homology 10/09/10 low homology NM_001126237 NV06 ...

  1. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  2. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  3. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  4. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  5. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  6. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  7. EST Table: AV398139 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398139 NV021172 10/09/28 46 %/243 aa ref|XP_001661901.1| DNA mismatch repair protein muts... [Aedes aegypti] gb|EAT36110.1| DNA mismatch repair protein muts [Aedes aegypti] 10/08/28 43 %/238 a...el|GB10970-PA 10/09/10 42 %/247 aa gi|91082687|ref|XP_971522.1| PREDICTED: similar to DNA mismatch repair protein muts [Tribolium castaneum] BY922838 NV02 ...

  8. Effekter av endringer i finansieringsansvaret for TNF-hemmere

    OpenAIRE

    Hagen, Terje P.; Bjarkum, Irina; Hobbel, Silje; Orderdalen, Karianne

    2009-01-01

    Tumor necreosis factor alfa (TNF-a) - hemmere, og andre biologiske inflammatoriske modifiserende legemidler blir brukt innen reumatologi, gastroenterologi og dermatologi. I denne rapporten analyseres effekter av endringer i finansieringssystemet for seks legemidler som faller innenfor disse legemiddelgruppene og som langt på vei er substitutter: Humira, Enbrel og Remicade som er TNF-hemmere, Raptiva og Orencia som er registrert under kategorien selektive immunsuppressiver og MabThera som er r...

  9. EST Table: AV401797 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401797 heS00172 10/09/28 94 %/235 aa ref|NP_001036831.1| saposin-related [Bombyx ...9/10 low homology 10/09/10 low homology 10/09/10 41 %/191 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 heS0 ...

  10. EST Table: AV401078 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401078 e96h0200 10/09/28 42 %/112 aa ref|XP_001648294.1| Juvenile hormone-inducib...le protein, putative [Aedes aegypti] gb|EAT44634.1| Juvenile hormone-inducible protein, putative [Aedes aegy... 10/09/10 36 %/106 aa gi|91080979|ref|XP_974925.1| PREDICTED: similar to Juvenile hormone-inducible protein, putative [Tribolium castaneum] FS808716 e96h ...

  11. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    skull". Trots stora framsteg inom medicinen finns det skäl att stanna upp och fråga: Vad håller vi på med egentligen? Redaktörerna och författarna till denna bok lyfter fram behovet av att reflektera över medicinsk praktik och att kritiskt granska de teorier som ligger till grund för vad vi gör. I boken...

  12. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  13. Toward robust AV conferencing on next-generation networks

    Science.gov (United States)

    Liu, Haining; Cheng, Liang; El Zarki, Magda

    2005-01-01

    In order to enable a truly pervasive computing environment, next generation networks (including B3G and 4G) will merge the broadband wireless and wireline networking infrastructure. However, due to the tremendous complexity in administration and the unreliability of the wireless channel, provision of hard-guarantees for services on such networks will not happen in the foreseeable future. This consequently makes it particularly challenging to offer viable AV conferencing services due to their stringent synchronization, delay and data fidelity requirements. We propose in this paper a robust application-level solution for wireless mobile AV conferencing on B3G/4G networks. Expecting no special treatment from the network, we apply a novel adaptive delay and synchronization control mechanism to maintain the synchronization and reduce the latency as much as possible. We also employ a robust video coding technique that has better error-resilience capability. We investigate the performance of the proposed solution through simulations using a three-state hidden Markov chain as the generic end-to-end transport channel model. The results show that our scheme yields tight synchronization performance, relatively low end-to-end latency and satisfactory presentation quality. The scheme successfully provides a fairly robust AV conferencing service.

  14. Synliggörande av tyst kunskap i gymnasial yrkesutbildning

    Directory of Open Access Journals (Sweden)

    Mats Lundgren

    2012-04-01

    Full Text Available Yrkesutbildning skiljer sig från andra former av gymnasieutbildning genom att den innehåller praktisk kunskap som kan vara svårfångad, ofta benämnd som tyst kunskap. Tyst kunskap utgör en förutsättning för att yrkeselever ska kunna tillägna sig ett yrkes kultur, praxis och kunskapstradition. Med utgångspunkt i yrkeslärares berättelser beskrivs i artikeln med stöd av tre definierade kompetensområden, 1 yrkesfältet, 2 handlag i yrket samt 3 interaktion och social kompetens, hur yrkeslärare arbetar för att möjliggöra att ett yrkes tysta kunskaper kan läras i en skolmiljö. Resultatet visar betydelsen av att yrkeslärares tysta kunskaper blottläggs för eleverna genom att de i sin undervisning, berättar, visar och ställer frågor. Det är i dessa möten som den tysta kunskapens betydelse i yrkesutövning kan bli synlig för eleverna.

  15. Bruk av ordlæringsstrategier blant norske tyskelever

    Directory of Open Access Journals (Sweden)

    Anna Gausland

    2011-05-01

    Full Text Available Interessen for forskning på læringsstrategier er økende i Norge. Det finnes likevel ennå ingen publiserte empiriske studier som fokuserer på læringsstrategier i andre fremmedspråk. Hensikten med den foreliggende artikkelen er å gi et første innblikk i 54 norske tyskelevers bruk av ordlæringsstrategier. Studien er gjennomført som en skriftlig spørreundersøkelse hvor elevene beskrev hvordan de hadde arbeidet for å lære en liste med tysk-norske ordpar. Samlet sett ser vi at elevene behersker ordlæringsstrategier av ulik art, men at noen få strategier er hyppig forekomne hos de fleste elevene. Det viser seg at elevene i hovedsak bruker ordlæringsstrategier som inneholder element av repetisjon, altså strategier som krever lite kognitiv bearbeiding. Dernest blir metakognitive strategier som organiserer og planlegger læringen mest brukt. Artikkelens siste del sammenligner funn fra undersøkelsen med internasjonale studier og skisserer videre forskningsbehov innen feltet.

  16. Särhållning av gruvavfall med avseende på syrabildande potential : en studie av svenska sulfidmalmsgruvor

    OpenAIRE

    Sellin, Jessica

    2016-01-01

    Gruvavfall utgör över 80 % av den totala mängden avfall i Sverige. Avfallet från gruvindustrin kan påverka våra ekosystem negativt om tungmetaller och försurande ämnen lämnar materialet. I Sverige utgör avfall från sulfidmalmer störst risk för miljön eftersom det innehåller mineral som genom kontakt med luft vittrar och producerar surt och metallhaltigt lakvatten. Efterbehandling av dessa material är viktigt för att förhindra läckage till omgivningen. Eftersom efterbehandli...

  17. Oxygen depth profiling with subnanometre depth resolution

    Energy Technology Data Exchange (ETDEWEB)

    Kosmata, Marcel [Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, D-01314 Dresden (Germany); Munnik, Frans, E-mail: f.munnik@hzdr.de [Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, D-01314 Dresden (Germany); Hanf, Daniel; Grötzschel, Rainer [Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, D-01314 Dresden (Germany); Crocoll, Sonja [X-FAB Dresden GmbH and Co. KG, Grenzstraße 28, D-01109 Dresden (Germany); Möller, Wolfhard [Helmholtz-Zentrum Dresden-Rossendorf, P.O. Box 510119, D-01314 Dresden (Germany)

    2014-10-15

    A High-depth Resolution Elastic Recoil Detection (HR-ERD) set-up using a magnetic spectrometer has been taken into operation at the Helmholtz-Zentrum Dresden-Rossendorf for the first time. This instrument allows the investigation of light elements in ultra-thin layers and their interfaces with a depth resolution of less than 1 nm near the surface. As the depth resolution is highly influenced by the experimental measurement parameters, sophisticated optimisation procedures have been implemented. Effects of surface roughness and sample damage caused by high fluences need to be quantified for each kind of material. Also corrections are essential for non-equilibrium charge state distributions that exist very close to the surface. Using the example of a high-k multilayer SiO{sub 2}/Si{sub 3}N{sub 4}O{sub x}/SiO{sub 2}/Si it is demonstrated that oxygen in ultra-thin films of a few nanometres thickness can be investigated by HR-ERD.

  18. Mellom bibel og menneskerettigheter : en studie av Vårt Land og Dagens vinkling av Palestina/Israel-konflikten

    OpenAIRE

    2005-01-01

    Sammendrag Tittel: Israel og Palestina mellom bibel og menneskerettigheter. - Vinkling av Palestina/Israelkonflikten i avisene Vårt Land og Dagens lederartikler Spørsmålsstilling: Hvilke holdninger til Palestina/Israel-konflikten reflekterer lederartikler i de to kristne dagsavisene Dagen og Vårt Land? Er det mulig å spore en endring i vinklingen over tid? Hvordan kan disse lederartiklene gi oss innblikk i en debatt om Palestina/Israel-konflikten blant kristne i Norge? Metode...

  19. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  20. Har forhold under svangerskapet betydning for utviklingen av otitis media?

    Directory of Open Access Journals (Sweden)

    Kari J. Kværner

    2009-10-01

    Full Text Available  SAMMENDRAGMed utgangspunkt i data fra et populasjonsbasert utvalg av 7 992 norske tvillinger ble sammenhengenmellom gjentatte ørebetennelser og forhold under svangerskapet studert. Som parametre på intrauterinevekstforhold ble informasjon om fødselsvekt og gestasjonsalder fra Medisinsk Fødselsregister benyttet.Informasjon om rapporterte øreinfeksjoner ble basert på spørreskjemaer som ble besvart av tvillingene ialderen 18–25 år. Først studerte vi individuelle effekter av fødselsvekt og gestasjonsalder på forekomsten avotitis media (OM. Rapportert fødselsvekt hos individer med OM var signifikant lavere enn hos kontrollene,med en gjennomsnittsforskjell på 86 gram. Hos de som rapporterte OM var gjennomsnittlig gestasjonsalder3 dager kortere enn i kontrollmaterialet. Deretter beregnet vi effekten av fødselsvekt ved bruk av co-twinkontroll metoden. Blant monozygote (MZ tvillingpar gjenspeiler fødselsvektforskjeller innenfor tvillingparetintra-uterine miljøforskjeller. Blant dizygote (DZ par kan vektforskjellen være både genetiske ogmiljøbetinget. Ved sammenligning av fødselsvektforskjeller innenfor tvillingparene er tvillingen som ikkehar gjentatte øreinfeksjoner en matchet kontroll blant OM diskordante par. Resultatene antyder at lavfødselsvekt er en risikofaktor for otitis media. Gjennomsnittlig vektforskjell blant par diskordante for OMvar 48 gram, og den av tvillingen som ikke rapporterte OM hadde signifikant høyere fødselsvekt.Kværner KJ, Tambs K, Harris J, Magnus P. Do pregnancy-related factors influence the development ofotitis media? Nor J Epidemiol 1997; 7 (1: 55-58.  ENGLISH SUMMARYThe association between intrauterine growth, as measured by weight and gestational age, and the occurrenceof recurrent ear infections was studied using data from a population based sample of 7992 Norwegian twins.Perinatal measures were collected from the Medical Birth Registry, and reports of recurrent ear infectionswere based on

  1. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  2. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  3. Implementering av nye GOLD-stadier hos pasienter med KOLS i allmennpraksis

    OpenAIRE

    Storaker, Marit Aarvaag; Nerwey, Ibrahim; Kierulf-Strømme, Kirsten; Tengesdal, Randi Hauge; Wyller, Nora Guttormsgaard; Skårn, Elling Skeide; Cagrici, Ufuk

    2014-01-01

    Bakgrunn: GOLD (Global Initiative for Chronic Obstructive Lung Disease) lanserte i 2011 nye kriterier for gradering av alvorlighetsgrad av KOLS, der man i tillegg til FEV1 ved spirometri også tar hensyn til antall eksaserbasjoner og pasientens symptombyrde. Mange pasienter havner i en lavere risikogruppe etter den nye inndelingen, og er følgelig overbehandlet med f.eks. inhalasjonssteroider. Andre kan identifiseres tidligere som høyrisikopasienter for hyppige eksaserbasjoner og raskt tap av l...

  4. STUDY ON EFFICIENT COMPUTATION AND PERFORMANCE OF AV-BASED REDUCED-RANK FILTERING

    Institute of Scientific and Technical Information of China (English)

    Xu Bin; Yang Chenyang; Mao Shiyi

    2005-01-01

    In this paper, the complexity and performance of the Auxiliary Vector (AV) based reduced-rank filtering are addressed. The AV filters presented in the previous papers have the general form of the sum of the signature vector of the desired signal and a set of weighted AVs,which can be classified as three categories according to the orthogonality of their AVs and the optimality of the weight coefficients of the AVs. The AV filter with orthogonal AVs and optimal weight coefficients has the best performance, but requires considerable computational complexity and suffers from the numerical unstable operation. In order to reduce its computational load while keeping the superior performance, several low complexity algorithms are proposed to efficiently calculate the AVs and their weight coefficients. The diagonal loading technique is also introduced to solve the numerical unstability problem without complexity increase. The performance of the three types of AV filters is also compared through their application to Direct Sequence Code Division Multiple Access (DS-CDM A) systems for interference suppression.

  5. Utveckling av mjukglassomrörare : En studie för ökad luftinblandning

    OpenAIRE

    2010-01-01

    Den här rapporten är ämnad som underlag till ett fortsatt utvecklingsarbete av en omrörare för mjukglassmaskiner. I en mjukglassmaskin kyls glassen under kontinuerlig omrörning, på så vis blandas luft in och ger glassen fluffighet. Omrörarens huvudfunktioner är luftinblandning, avskrapning av iskristaller längs innerhöljet av kylcylindern samt utmatning av mjukglass mot öppningsdörr. Med en ny utformning ska omröraren bidra till en mer kostnadseffektiv mjukglass-maskin samt ge en godare glass...

  6. Handlingsplan för ägare av transformatorer med korrosiv olja

    OpenAIRE

    Weidemann, Stephan

    2016-01-01

    Sedan början av 2000-talet har ett stort antal transformatorer havererat av en initialt, okänd anledning. Problemet visade sig vara att en antioxidationstillsats i oljan, dibensyl disulfid (DBDS), reagerat med kopparen i lindningarna och vilket gett upphov till avlagringar på isolationspapperet i form av kopparsulfid. Kopparsulfiden i sin tur försvagade papperets isolationsförmåga och allvarliga driftstörningar eller driftstopp på grund av kortslutningar kan ske. Ett stort antal studier har g...

  7. NATO i krigen mot terror : En analyse av NATOs rolle i Afghanistan etter 11. september

    OpenAIRE

    Berg-Hansen, Susanne

    2007-01-01

    Denne oppgaven studerer NATOs rolle i den USA-ledede Operation Enduring Freedom i Afghanistan. Noen timer etter terrorangrepet mot USA 11. september 2001, påkalte NATO for første gang i historien sin grunnpilar, Artikkel 5 i NATO-traktaten, som fastslår at et angrep på ett av medlemmene er et angrep på alle NATO-landene. Til tross for alliansens påkallelse av Artikkel 5, ble NATO stående på sidelinjen i hovedfasen av "Operation Enduring Freedom". USA valgte å gjennomføre mesteparten av kamp...

  8. Tibetanisering : religiøs og etnisk utdanning av tibetanske flyktningbarn i Nord-India

    OpenAIRE

    Lind, Trude

    2007-01-01

    Religiøs sosialisering og nasjonal identitet blant tibetanske flyktningbarn i Nord-India er tema for denne oppgaven. Mye av materialet bygger på feltarbeidet jeg utførte ved Tibetan Children’s Village (TCV) Dharamsala høsten 2003. TCV regnes som en av de viktigste sekulære utdanningsinstitusjonene for tibetanerne i eksil. Siden den kinesiske invasjonen av Tibet i 1950 har mer en 100 000 tibetanere flyktet over fjellene i Himalaya til India, Nepal og Bhutan. Et av Dalai Lamas og eksilregje...

  9. Complexity and Dynamical Depth

    Directory of Open Access Journals (Sweden)

    Terrence Deacon

    2014-07-01

    Full Text Available We argue that a critical difference distinguishing machines from organisms and computers from brains is not complexity in a structural sense, but a difference in dynamical organization that is not well accounted for by current complexity measures. We propose a measure of the complexity of a system that is largely orthogonal to computational, information theoretic, or thermodynamic conceptions of structural complexity. What we call a system’s dynamical depth is a separate dimension of system complexity that measures the degree to which it exhibits discrete levels of nonlinear dynamical organization in which successive levels are distinguished by local entropy reduction and constraint generation. A system with greater dynamical depth than another consists of a greater number of such nested dynamical levels. Thus, a mechanical or linear thermodynamic system has less dynamical depth than an inorganic self-organized system, which has less dynamical depth than a living system. Including an assessment of dynamical depth can provide a more precise and systematic account of the fundamental difference between inorganic systems (low dynamical depth and living systems (high dynamical depth, irrespective of the number of their parts and the causal relations between them.

  10. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  11. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  12. Overvåking av vassdrag i Ringsaker - Undersøkelser av innsjøer og bekker i 2012

    OpenAIRE

    Løvik, J.; Brettum, Pål

    2013-01-01

    Rapporten omhandler vannkvalitet og miljøtilstand i fire innsjøer og fem mindre vassdrag i Ringsaker kommune i 2012. Hovedvekten er lagt på effekter av næringsstoffer, dvs. overgjødsling. Basert på mengder og sammensetning av planteplankton, sammensetning av dyreplankton samt fysisk/kjemiske støtteparametre vurderes innsjøenes økologiske tilstand mht. overgjødsling som følger: Ljøsvatnet: moderat, Sjusjøen: moderat, men nær grensen til god og Næra og Botsenden: god. Vurderingene bør betraktes...

  13. An uncommon case of spontaneous conversion from AV re-entry tachycardia to AV nodal re-entry tachycardia in a patient with dual tachycardia.

    Science.gov (United States)

    Zeljković, Ivan; Benko, Ivica; Manola, Šime; Radeljić, Vjekoslav; Pavlović, Nikola

    2015-01-01

    We report the case of a 46-year old patient in whom an electrophysiology study (EP) was performed due to paroxysmal supraventricular tachycardia documented in 12-lead ECG. During the EP study, supraventricular tachycardia was induced easily and it corresponded to orthodromic AV reentry tachycardia (AVRT) using a concealed left free wall accessory pathway. However, during the study AVRT spontaneously and repeatedly converted to the typical slow-fast AV node reentry tachycardia (AVNRT). Both accessory and AV nodal slow pathways were ablated, due to the finding that both AVRT and AVNRT were independently inducible during the EP study.

  14. Karakterisering av vannkjemisk status i bekker og innsjøer før utbygging av E 18 Grimstad-Kristiansand

    OpenAIRE

    Hindar, A.

    2005-01-01

    Førtilstanden er kartlagt for i alt 25 bekke- og innsjølokaliteter som blir krysset av planlagt E 18 fra Grimstad til Kristiansand. Forsuring har stått i fokus fordi deler av vegstrekningen vil gå gjennom sulfidgneis, og fordi det er avdekket omfattende problemer med avrenningsvann ved utsprengning i slik berggrunn. Det har vært et mål å forsøke å skille effekten av sur nedbør fra den påvirkning ueksponert og eksponert sulfidgneis gir. Naturtilstand i kombinasjon med sur nedbør gir sulfatkons...

  15. Harmonikk for det indre øret : En studie av harmonikk som assosiasjonsgiver i Bernard Herrmanns musikk til filmen Vertigo av Alfred Hitchcock

    OpenAIRE

    Bøe, Brynjar

    2012-01-01

    I denne oppgaven tar jeg for meg Bernard Herrmanns musikk til filmen Vertigo fra 1958, regissert av Alfred Hitchcock. Jeg vil forsøke å finne sammenhenger mellom komponistens bruk av harmonikk og filmfortellingen for øvrig. Jeg vil se hvilke hvordan filmkomponisten være med på å fortelle historien i filmen, og hvilke musikalske virkemidler, med vekt på harmonikkrelaterte sådan, han/hun har til rådighet for å gjøre dette. Jeg vil se på noen av de musikalske valgene Herrmann har tatt...

  16. Sensorisk realisme i Carlos Reygadas' Post Tenebras Lux (2012) - En undersøkelse av tilskuerhenvendelsen i lys av nyere realismeteori og filmfenomenologi

    OpenAIRE

    Johnson, Silja Espolin

    2015-01-01

    I dette prosjektet undersøker den meksikanske filmregissøren Carlos Reygadas fjerde og nyeste spillefilm Post Tenebras Lux (2012) i lys av den nærværsbaserte og "fysiske" tilskueropplevelsen den produserer. Prosjektet består av fire kapitler. I det første kapittelet presenterer jeg filmen i konteksten av en tendens som har markert seg på filmfestivaler verden over de siste to tiårene som går under flere navn, blant andre: slow cinema, hybridfilm og, det begrepet jeg har funnet mest fruktbart...

  17. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  18. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  19. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  20. Posthumanisme /nymaterialisme og nomadisme - affektive brytninger av barnehagens observasjonspraksiser

    Directory of Open Access Journals (Sweden)

    Ann Merete Otterstad

    2015-09-01

    Full Text Available This article challenges observation as a method in early childhood, justified as a mapping tool for creating knowledge about children. Observation as data material is about writing down already known categorisation about children and their development. Categories and categorisation make a foundation for correspondence and coherence   - connections that might create generalising knowledge about children in early years. The article is about a research project conducted in a child-centre over a two-year period. We had an on-going conversation with the personnel around theories about ‘child development’. In the article we experiment with observation based on posthuman/newmaterial theories. Our specific interests are to explore the complexities around observation by asking; why observations, what do we expect through observation, and what might observation as datamaterial be/become? We are inspired by the Norwegian film “Kitchen Stories” (Salmer fra Kjøkkenet, Hamer, 2003 both as affect/provocation and desire (Koro-Ljungberg & MacLure, 2013. We search for affective bending and messiness (Lather, 2007; Law, 2004 to disturb and challenge observation as dominating paradigm in the field of early years, to break some patterns around the positioning of data material. Artikkelen utfordrer observasjon i barnehagen ut fra at metoden brukes som verktøy for å kartlegge og danne grunnlaget for utvikling av kunnskap om barn.  Observasjon som datamateriale innebærer iakttagelser og nedtegnelser av allerede gitte kategoriseringer om barn og barns utvikling.  Kategorier og kategorisering legger grunnlag for mønster som har i seg ideer om korrespondanse og koherens – sammenhenger som kan bidra til generaliserende kunnskap om barna i barnehagen. Omrisset av artikkelen dreies rundt et forskningsarbeid gjort i en barnehage over en toårs-periode, der vi sammen med de ansatte diskuterer teorier om barn og barns ’utvikling’. Vi bruker posthumane

  1. EST Table: AV401818 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401818 heS00196 10/09/28 77 %/219 aa ref|NP_001103813.1| P-element somatic inhibi...tor [Bombyx mori] dbj|BAF91871.1| Bombyx homolog of P-element somatic inhibitor [Bombyx mori] 10/08/28 35 %/...irmed#UniProt: Q9BLA0#protein_id:AAK09071.1 10/09/10 33 %/182 aa AGAP011446-PA Pr...otein|3L:24763465:24770148:-1|gene:AGAP011446 10/09/10 47 %/174 aa gnl|Amel|GB18145-PA 10/09/10 46 %/184 aa gi|18

  2. EST Table: AV400561 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400561 br--1451 10/09/28 62 %/198 aa ref|XP_001843664.1| neuroendocrine protein 7...b2 [Culex quinquefasciatus] gb|EDS33875.1| neuroendocrine protein 7b2 [Culex quinquefasciatus] 10/08/28 42 %.../196 aa FBpp0240992|DwilGK11849-PA 10/08/27 54 %/104 aa T03D8.3#CE18921#WBGene00011392#locus:sbt-1#neuroendocrine...45-PA 10/09/10 51 %/199 aa gi|91081787|ref|XP_973692.1| PREDICTED: similar to neuroendocrine protein 7b2 [Tribolium castaneum] BP115163 br-- ...

  3. EST Table: AV405781 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405781 wdV30227 10/09/28 88 %/272 aa ref|NP_001106136.1| Annexin IX isoform B [Bo...mbyx mori] dbj|BAA92810.1| annexin IX-B [Bombyx mori] 10/08/28 71 %/270 aa FBpp0280989|DpseGA19090-PA 10/08/...9 10/09/10 62 %/270 aa gnl|Amel|GB16448-PA 10/09/10 73 %/271 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 wdV3 ...

  4. EST Table: AV402401 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402401 heS00969 10/09/28 85 %/225 aa dbj|BAB16697.1| annexin [Bombyx mori] dbj|BAB16698.1| anne...a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein_id:CAA 82571.2 10/09/1... %/220 aa gnl|Amel|GB16448-PA 10/09/10 73 %/220 aa gi|91092420|ref|XP_967931.1| PREDICTED: similar to Annexin IX CG5730-PC [Tribolium castaneum] NM_001043376 heS0 ...

  5. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  6. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  7. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  8. Framväxten av koncernfackligt samarbete inom metallindustrin

    OpenAIRE

    Kjellberg, Anders

    2006-01-01

    The chapter "Framväxten av koncernfackligt samarbete inom metallindustrin" (pp. 177-239) by Anders Kjellberg analyzes the rise and development of trade union cooperation within groups in Swedish metal industry. Special attention is paid to the two large metal enterprises in Finspång, situated in the northern part of the province of Östergötland: (1) the turbine company (for a long period of time called STAL), which were owned by the following groups: Asea, ABB, Alstom and today ...

  9. Gulliver's Travels av Jonathan Swift : fra politisk satire til barnebok

    OpenAIRE

    Krog, Kira Katarina

    2004-01-01

    Denne oppgaven tar for seg Jonathan Swifts bok Gulliver’s Travels’ (1727) utvikling fra politisk satire til barnebok. Med utgangspunkt i opplysningstidens tro på menneskets suverene fornuft og tradisjonen fra antikkens greske satire har oppgaven en historisk problemstilling. Den følger satirens og barnebokens utvikling gjennom tidene og ender i en lesning av en norsk barnebokversjon, utgitt nærmere 300 år etter førsteutgaven. Oppgaven har tre hoveddeler. Den første tar for seg hvordan bok...

  10. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  11. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  12. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  13. Fysiologiske effekter av delvis okklusjon under ettbeins utholdenhetsarbeid

    OpenAIRE

    Henriksen, Bjørnar Sandland

    2009-01-01

    Unilateral perifer aterosklerose i beinet har tidligere vist å gi en fysiologisk adaptasjon til sykdommen ved å endre den oksidative kapasiteten i muskelen (Jansson, 1988; Henriksson et al., 1980). Denne observasjonen er blitt fulgt opp med treningsstudier som har undersøkt effekten av ischemi ved sykkelarbeid hos friske (Sundberg, 1994), samt intervalltrening på tredemølle med okklusjon på begge beina (Abe et al., 2006). Det er imidlertid ikke utført noen treningsstudier med ett – beins knee...

  14. Depth perception after prolonged usage of night vision goggles.

    Science.gov (United States)

    Sheehy, J B; Wilkinson, M

    1989-06-01

    The present study was initiated following a report that a few helicopter pilots had failed a test of stereoscopic depth perception after a prolonged training flight employing night vision goggles (NVGs). In order to determine the cause of the loss, 12 helicopter pilots/copilots were assessed for depth perception, lateral and vertical phoria, and contrast sensitivity before and after training flights requiring the pilots to wear night vision goggles for the duration of the flight. Pilots flew one to three missions while wearing either PVS-5A or AN/AVS-6 goggles. Mission duration ranged from 1 to 4 h. The results indicate that contrast sensitivity and depth perception when monocular cues are present did not degrade over the course of the mission. Lateral phoria, however, did demonstrate an average exophoric shift of 1.5 prism diopters for 12 out of the 24 missions. The results indicate that the original report of a loss of depth perception based on a test of depth requiring stereopsis might have been caused by a shift in lateral phoria. It would be expected that as additional fusional effort is required, the minimum resolvable disparity degrades due to the increase in accommodation brought about through vergence accommodation. Possible causes for the phoria shift and future testing are discussed.

  15. Endogenous RGS proteins modulate SA and AV nodal functions in isolated heart: implications for sick sinus syndrome and AV block.

    Science.gov (United States)

    Fu, Ying; Huang, Xinyan; Piao, Lin; Lopatin, Anatoli N; Neubig, Richard R

    2007-05-01

    G protein-coupled receptors play a pivotal role in regulating cardiac automaticity. Their function is controlled by regulator of G protein signaling (RGS) proteins acting as GTPase-activating proteins for Galpha subunits to suppress Galpha(i) and Galpha(q) signaling. Using knock-in mice in which Galpha(i2)-RGS binding and negative regulation are disrupted by a genomic Galpha(i2)G184S (GS) point mutation, we recently (Fu Y, Huang X, Zhong H, Mortensen RM, D'Alecy LG, Neubig RR. Circ Res 98: 659-666, 2006) showed that endogenous RGS proteins suppress muscarinic receptor-mediated bradycardia. To determine whether this was due to direct regulation of cardiac pacemakers or to alterations in the central nervous system or vascular responses, we examined isolated, perfused hearts. Isoproterenol-stimulated beating rates of heterozygote (+/GS) and homozygote (GS/GS) hearts were significantly more sensitive to inhibition by carbachol than were those of wild type (+/+). Even greater effects were seen in the absence of isoproterenol; the potency of muscarinic-mediated bradycardia was enhanced fivefold in GS/GS and twofold in +/GS hearts compared with +/+. A(1)-adenosine receptor-mediated bradycardia was unaffected. In addition to effects on the sinoatrial node, +/GS and GS/GS hearts show significantly increased carbachol-induced third-degree atrioventricular (AV) block. Atrial pacing studies demonstrated an increased PR interval and AV effective refractory period in GS/GS hearts compared with +/+. Thus loss of the inhibitory action of endogenous RGS proteins on Galpha(i2) potentiates muscarinic inhibition of cardiac automaticity and conduction. The severe carbachol-induced sinus bradycardia in Galpha(i2)G184S mice suggests a possible role for alterations of Galpha(i2) or RGS proteins in sick sinus syndrome and pathological AV block.

  16. InterProScan Result: AV398327 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398327 AV398327_4_ORF1 65C8DA7FC6C4D303 PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.3e-109 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium sym

  17. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523:SF15 SODIUM/POTASSIUM-D...EPENDENT ATPASE BETA SUBUNIT, INSECT NA ? IPR000402 unintegrated Molecular Function: sodium:potassium-exchan...ss: potassium ion transport (GO:0006813)|Biological Process: sodium ion transport (GO:0006814)|Cellular Component: membrane (GO:0016020) ...

  18. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523 SODIUM/POTASSIUM-DEPEND...ENT ATPASE BETA SUBUNIT 1.1e-19 T IPR000402 ATPase, P-type cation exchange, beta subunit Molecular Function: sodiu...006754)|Biological Process: potassium ion transport (GO:0006813)|Biological Process: sodiu

  19. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  20. InterProScan Result: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 AV399953_3_ORF1 920D8122A6A51D76 PFAM PF00175 NAD_binding_1 2.5e-08 T IPR001433 Oxido...reductase FAD/NAD(P)-binding Molecular Function: oxidoreductase activity (GO:0016491)|Biological Process: oxidation reduction (GO:0055114) ...

  1. InterProScan Result: AV398312 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398312 AV398312_1_ORF2 384AC61A6604E3FD PANTHER PTHR10795:SF30 SITE-1 PROTEASE (STEROL...-REGULATED, CLEAVES STEROL REGULATORY ELEMENT BINDING PROTEINS) 1.8e-17 T IPR015500 unintegrated ...

  2. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  3. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  4. Pilot Implementation and Preliminary Evaluation of START:AV Assessments in Secure Juvenile Correctional Facilities.

    Science.gov (United States)

    Desmarais, Sarah L; Sellers, Brian G; Viljoen, Jodi L; Cruise, Keith R; Nicholls, Tonia L; Dvoskin, Joel A

    2012-01-01

    The Short-Term Assessment of Risk and Treatability: Adolescent Version (START:AV) is a new structured professional judgment guide for assessing short-term risks in adolescents. The scheme may be distinguished from other youth risk assessment and treatment planning instruments by its inclusion of 23 dynamic factors that are each rated for both vulnerability and strength. In addition, START:AV is also unique in that it focuses on multiple adverse outcomes-namely, violence, self-harm, suicide, unauthorized leave, substance abuse, self-neglect, victimization, and general offending-over the short-term (i.e., weeks to months) rather than long-term (i.e., years). This paper describes a pilot implementation and preliminary evaluation of START:AV in three secure juvenile correctional facilities in the southern United States. Specifically, we examined the descriptive characteristics and psychometric properties of START:AV assessments completed by 21 case managers on 291 adolescent offenders (250 boys and 41 girls) at the time of admission. Results provide preliminary support for the feasibility of completing START:AV assessments as part of routine practice. Findings also highlight differences in the characteristics of START:AV assessments for boys and girls and differential associations between the eight START:AV risk domains. Though results are promising, further research is needed to establish the reliability and validity of START:AV assessments completed in the field.

  5. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  6. Third-degree AV block sensitive to prednisolone 72 hours post AVNRT ablation.

    Science.gov (United States)

    Parwani, Abdul S; Schröder, Anna I; Blaschke, Daniela; Blaschke, Florian; Huemer, Martin; Attanasio, Philipp; Pieske, Burkert; Boldt, Leif-Hendrik; Haverkamp, Wilhelm

    2017-05-01

    A patient developed a transient first-degree AV block during a radiofrequency ablation of an atrioventricular nodal reentrant tachycardia. Three days later the patient presented with a third-degree AV block. It resolved within 24 h under antiphlogistic therapy. Patient was asymptomatic without necessity for pacemaker implantation at 12 months follow-up.

  7. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  8. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  9. InterProScan Result: AV399740 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399740 AV399740_3_ORF2 7A42A41D4F3F6388 PFAM PF00067 p450 1.2e-19 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  10. InterProScan Result: AV404187 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404187 AV404187_4_ORF1 AB84B56694D3FC58 PFAM PF00267 Porin_1 3.5e-13 T IPR001702 Por...in, Gram-negative type Molecular Function: transporter activity (GO:0005215)|Biological Process: transport (GO:0006810)|Cellular Component: membrane (GO:0016020) ...

  11. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 NA ? IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  12. InterProScan Result: AV404181 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404181 AV404181_1_ORF1 F6474B68BA8D3768 PANTHER PTHR10783:SF4 XENOTROPIC AND POLY...TROPIC MURINE LEUKEMIA VIRUS RECEPTOR XPR1 1.4e-114 T IPR004342 unintegrated Cellular Component: integral to membrane (GO:0016021) ...

  13. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  14. InterProScan Result: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 AV399741_2_ORF2 F87D90D9B5BA6C11 PFAM PF02778 tRNA_int_endo_N 5.4e-08 T IPR006678 tRNA intro...n endonuclease, N-terminal Molecular Function: tRNA-intron endonuclease activity (GO:0000213) ...

  15. InterProScan Result: AV405061 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405061 AV405061_3_ORF2 400BDC036077591E PANTHER PTHR10590 SODIUM/NUCLEOSIDE COTRA...NSPORTER 1.8e-12 T IPR008276 Concentrative nucleoside transporter Molecular Function: nucleoside:sodium symp

  16. InterProScan Result: AV398727 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398727 AV398727_2_ORF2 9953252ABA69E49B PFAM PF00762 Ferrochelatase 8.4e-28 T IPR001015 Ferroche...latase Molecular Function: ferrochelatase activity (GO:0004325)|Biological Process: heme biosynthetic process (GO:0006783) ...

  17. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  18. InterProScan Result: AV403947 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403947 AV403947_3_ORF2 9625723E9868C46D PANTHER PTHR13768:SF2 GAMMA-SOLUBLE NSF A...TTACHMENT PROTEIN (SNAP-GAMMA) 8.7e-75 T IPR011990 unintegrated Molecular Function: binding (GO:0005488) ...

  19. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PROFILE PS50141 A_DEAMIN_EDITASE 15.862 T IPR002466 Adenosine deam...inase/editase Molecular Function: RNA binding (GO:0003723)|Molecular Function: adenosine deam

  20. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE NA ? IPR0...01365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  1. InterProScan Result: AV401295 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401295 AV401295_2_ORF2 87FC32DE014A3D18 PANTHER PTHR10910:SF17 ADENOSINE DEAMINAS...ular Function: adenosine deaminase activity (GO:0004000)|Biological Process: RNA processing (GO:0006396) ...

  2. InterProScan Result: AV401829 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401829 AV401829_3_ORF1 B72A6A008C2EBEA4 PANTHER PTHR11359 AMP DEAMINASE 6e-56 T I...PR001365 unintegrated Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)|Molecular Function: deaminase activity (GO:0019239) ...

  3. InterProScan Result: AV401888 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401888 AV401888_3_ORF1 2F04E8AA567F7BCF PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 1.5e-119 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  4. InterProScan Result: AV402282 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402282 AV402282_2_ORF1 D1F0DCC6A8296985 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 5e-97 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  5. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  6. Selvbestemmelse og oppdragelse : en teoretisk analyse av oppdragelsens påvirkning på utviklingen av selvbestemmelse

    OpenAIRE

    2007-01-01

    1) Problemstilling Hensikten med oppgaven er å rette fokus mot oppdragelse som en påvirkningsfaktor på utviklingen av selvbestemmelsen, og hvilken betydning behovstilfredsstillelse har for individets subjektive velvære. Oppdragelse er et populært tema som stadig blir debattert i mediene. Det diskuteres blant annet hvorfor oppdragelse er viktig, hvordan det er mulig å oppdra barn på best mulig måte og hvem som er viktige oppdragere i dagens samfunn. Vår oppgave handler om individets selvbes...

  7. 中国新一代图像编码格式"AVS"%Chinese new Video coding format AVS

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ 中国在光盘、无线LAN、家庭内部网络等各种领域不断推出自己的规格.其中,包括中国计划2004年实现标准化的新一代图像编码格式"AVS".中国科学院有关负责人将在NAB2004技术论坛"Leading Edge Tech for TV"上,就定位相当于"MPEG"的AVS规格发表演讲.

  8. Endrer motivasjonen seg i løpet av de fire første ukene av livsstilsendringskurset EasyLife?

    OpenAIRE

    Strand, Hanne Embretsen; Nordengen, Solveig

    2011-01-01

    Vi har undersøkt motivasjonsregulering hos deltagere i et livsstilsendringsprogram. Teoretisk har vi benyttet oss av Helseoppfatningsmodellen (The Health Belief Model; Rosenstock, 1966), Den transteoretiske modellen (The Transtheoretical Model; DiClemente & Prochaska, 1982; Marcus & Simkin, 1994), Selvbestemmelsesteorien (Self-Determination Theory; Deci & Ryan, 2000) og Rosenstocks fire modeller for ansvar. For å kartlegge motivasjonsregulering har vi benyttet oss av BREQ-2 (Markland & Tobin ...

  9. Kosttilskudd og doping : metabolisme av synefrin og oktopamin og utskillelse i urin etter inntak av tilsvarende kosttilskuddsprodukter hhv. et spesielt matinntak

    OpenAIRE

    Stensrud, Linda Sørvang

    2010-01-01

    Etter at efedrin ble forbudt som tilsetningsstoff i kosttilskuddsprodukter på grunn av faren for uheldige bivirkninger, har det de senere årene dukket opp flere produkter med innhold av synefrin. Synefrin er et stimulerende stoff med lignende struktur som efedrin, men den sentralstimulerende effekten er mindre. En vanlig kilde til synefrin, som blir brukt som tilsetningsstoff i kosttilskuddspreparater og næringsmidler, er Citrus aurantium (bitterappelsin). Et annet stimulerende stoff med lign...

  10. Skolebasert forebygging av røyking blant ungdom

    Directory of Open Access Journals (Sweden)

    Ola Jøsendal m.fl

    2009-10-01

    Full Text Available SAMMENDRAGI første del av denne artikkelen gjennomgås en del utvalgte studier av skolebaserte tiltak mot røyking. Utviklingenhar gått gjennom tre faser der den siste generasjonen er de omfattende tiltakene som baserer seg på ensosial påvirkningsmodell. Godt planlagte tiltak som er basert på denne modellen har vist seg å føre til at færrebegynner å røyke. I artikkelens andre del presenteres et prosjekt som gjennomføres av Den NorskeKreftforening og som omfatter 4 441 elever fra 195 klasser ved 99 ungdomsskoler. Valg av undervisningstemaog pedagogiske tilnærminger er begrunnet i aktuelle sosialpsykologiske begreper og modeller ogerfaringer fra tidligere forskning. Intervensjonen bygger et stykke på vei på en sosial påvirkningsmodell.Skolene er delt i fire grupper. Gruppe A er kontrollgruppe. Elevene i gruppe B gjennomgår et undervisningsprogram,foreldrene involveres og lærerne gjennomgår kurser i hvordan de skal gjennomføre intervensjonen.I gruppe C gjør en det samme som i gruppe B, men lærerne kurses ikke. I gruppe D gjør en det samme som igruppe B, men foreldrene involveres ikke. Underveis gjennomføres det blant annet spørreskjemaundersøkelserblant elevene for å studere endringer i røykevaner, hvilke grupper av elever en lykkes best i å nå,hvordan elevene reagerer på tiltakene og hva som kan forklare eventuelle positive virkninger av intervensjonene.Foreløpige analyser av resultatene etter et halvt års oppfølging tyder på at det er færrest sombegynner å røyke i gruppe B, med andre ord at virkningene av tiltakene er best der lærerne kurses ogforeldrene involveres.Jøsendal O, Aarø LE, Bergh IH. School-based prevention of smoking among youths.Nor J Epidemiol ENGLISH SUMMARYThe first part of this article presents selected studies of school-based intervention programmes againstsmoking. Historically it can be distinguished between three phases in the development of such programmes.The last generation are the

  11. Examination of office visit patient preferences for the after-visit summary (AVS).

    Science.gov (United States)

    Neuberger, Marolee; Dontje, Katherine; Holzman, Greg; Corser, Bill; Keskimaki, Abigail; Chant, Ericka

    2014-01-01

    The federal government advocates the practice of routinely providing an after-visit summary (AVS) to patients after each office-based visit as an element of stage 1 meaningful use. A significant potential benefit of the AVS is improved patient engagement achieved by enabling patients and family members to better understand and retain key health information. The methodology for this study was a mixed-methods pilot study to examine, through the perspectives of adult primary care patients, how relevant and actionable data can be better formatted in the AVS. Results of this study suggest that the goal of the AVS to serve as a communication tool to engage and support patients is frequently not being met. Further study is needed to understand, from the viewpoints of patients and providers, what barriers are keeping them from optimally providing and using the information on the AVS.

  12. Extreme skin depth waveguides

    CERN Document Server

    Jahani, Saman

    2014-01-01

    Recently, we introduced a paradigm shift in light confinement strategy and introduced a class of extreme skin depth (e-skid) photonic structures (S. Jahani and Z. Jacob, "Transparent sub-diffraction optics: nanoscale light confinement without metal," Optica 1, 96-100 (2014)). Here, we analytically establish that figures of merit related to light confinement in dielectric waveguides are fundamentally tied to the skin depth of waves in the cladding. We contrast the propagation characteristics of the fundamental mode of e-skid waveguides and conventional waveguides to show that the decay constant in the cladding is dramatically larger in e-skid waveguides, which is the origin of sub-diffraction confinement. Finally, we propose an approach to verify the reduced skin depth in experiment using the decrease in the Goos-H\\"anchen phase shift.

  13. 77 FR 12163 - Airworthiness Directives; 328 Support Services GmbH (Type Certificate Previously Held by AvCraft...

    Science.gov (United States)

    2012-02-29

    ... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier... Services GmbH (Type Certificate Previously Held by AvCraft Aerospace GmbH; Fairchild Dornier GmbH; Dornier...: 2012-04-06 328 Support Services GmbH (Type Certificate Previously Held by AvCraft Aerospace...

  14. Vurdering av andrespråksinnlærere - en utfordring i skolen

    Directory of Open Access Journals (Sweden)

    Kirsten Palm

    2014-06-01

    Full Text Available Vurdering av andrespråkselevers språkkompetanse og språkutvikling er en sentral del av læreres arbeid, og forskning har vist at dette er en utfordring for skolene. Det er stor variasjon i vurderingsformer, og skolene mangler ofte vurderingskompetanse. På bakgrunn av dette utarbeidet Utdanningsdirektoratet i 2007 vurderingsverktøyet Kartleggingsmateriell. Språkkompetanse i grunnleggende norsk for språklige minoriteter. Materiellet er utarbeidet blant annet med referanse til Common European Framework of Reference for Languages (CEFR. I artikkelen redegjør vi for en undersøkelse der målet var å finne ut hvorvidt dette kartleggingsmateriellet er hensiktsmessig for å vurdere andrespråkselevers språkkompetanse. Hoveddataene er innhentet gjennom kasusstudier ved tre grunnskoler, der vi intervjuet skoleledelse og lærere samt observerte kartleggingssituasjoner og klasseromsundervisning. Kasusstudiene ble senere fulgt opp av to spørreundersøkelser, én til de samme skolene, og én til et større antall skoler for å få bredere innsikt i kartleggingspraksis og skolers oppfatninger av denne formen for vurdering. Undersøkelsen viser at flere av informantene mener verktøyet kan bidra til mer tilpasset og systematisk andrespråkopplæring og bedre vurdering av andrespråkselevenes språkkompetanse. Samtidig er det utfordringer knyttet til å bruke vurderingsverktøyet, dette skyldes blant annet mangelfull kompetanse i skolen når det gjelder andrespråkstilegnelse og vurdering av elevenes språkkompetanse. Det er ikke tidligere forsket på bruk av et slikt konkret kartleggingsverktøy i norsk grunnskole. Undersøkelsen kan gi et bidrag til økt kunnskap om vurdering av andrespråkskompetanse og tilpasset undervisning for andrespråksinnlærere.

  15. [(18) F]AV-1451 tau positron emission tomography in progressive supranuclear palsy.

    Science.gov (United States)

    Whitwell, Jennifer L; Lowe, Val J; Tosakulwong, Nirubol; Weigand, Stephen D; Senjem, Matthew L; Schwarz, Christopher G; Spychalla, Anthony J; Petersen, Ronald C; Jack, Clifford R; Josephs, Keith A

    2017-01-01

    The [(18) F]AV-1451 positron emission tomography ligand allows the in vivo assessment of tau proteins in the brain. It shows strong binding in Alzheimer's dementia, but little is known about how it performs in progressive supranuclear palsy, a primary 4R tauopathy. The objectives of this study were to determine whether [(18) F]AV-1451 uptake can be observed in progressive supranuclear palsy and to characterize the regional distribution when compared with controls and Alzheimer's dementia. [(18) F]AV-1451 positron emission tomography was performed in 10 patients with probable progressive supranuclear palsy. These patients were age- and gender-matched to 50 controls and 10 Alzheimer's dementia patients who had undergone identical [(18) F]AV-1451 imaging. Regional comparisons of [(18) F]AV-1451 uptake were performed across the whole brain using region-of-interest and voxel-level analyses, and correlations between regional [(18) F]AV-1451 and the progressive supranuclear palsy rating scale were assessed. An elevated [(18) F]AV-1451 signal was observed in progressive supranuclear palsy when compared with controls in the pallidum, midbrain, dentate nucleus of the cerebellum, thalamus, caudate nucleus, and frontal regions. Signal in the cerebellar dentate and pallidum were also greater in progressive supranuclear palsy when compared with Alzheimer's dementia. Conversely, the [(18) F]AV-1451 signal across the cortex was higher in Alzheimer's dementia when compared with progressive supranuclear palsy. The [(18) F]AV-1451 signal in a number of regions correlated with the progressive supranuclear palsy rating scale. Progressive supranuclear palsy is associated with an elevated [(18) F]AV-1451 signal in a characteristic and distinct regional pattern that correlates with disease severity and differs from the patterns observed in Alzheimer's dementia. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  16. In vivo retention of (18)F-AV-1451 in corticobasal syndrome.

    Science.gov (United States)

    Smith, Ruben; Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer; Hansson, Oskar

    2017-08-22

    To study the usefulness of (18)F-AV-1451 PET in patients with corticobasal syndrome (CBS). We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, (18)F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent (18)F-FDG-PET. In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of (18)F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using (18)F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of (18)F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where (18)F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased (18)F-fluorodeoxyglucose uptake were more widespread than (18)F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. This study provides Class III evidence that (18)F-AV-1451 PET distinguishes between CBS and AD or PSP. Copyright © 2017 The Author(s). Published by Wolters Kluwer Health, Inc. on behalf of the American Academy of Neurology.

  17. In vivo retention of 18F-AV-1451 in corticobasal syndrome

    Science.gov (United States)

    Schöll, Michael; Widner, Håkan; van Westen, Danielle; Svenningsson, Per; Hägerström, Douglas; Ohlsson, Tomas; Jögi, Jonas; Nilsson, Christer

    2017-01-01

    Objective: To study the usefulness of 18F-AV-1451 PET in patients with corticobasal syndrome (CBS). Methods: We recruited 8 patients with CBS, 17 controls, 31 patients with Alzheimer disease (AD), and 11 patients with progressive supranuclear palsy (PSP) from the Swedish BioFINDER study. All patients underwent clinical assessment, 18F-AV-1451 PET, MRI, and quantification of β-amyloid pathology. A subset of participants also underwent 18F-FDG-PET. Results: In the 8 patients with CBS, 6 had imaging findings compatible with the corticobasal degeneration pathology and 2 with typical AD pathology. In the 6 patients with CBS without typical AD pathology, there were substantial retentions of 18F-AV-1451 in the motor cortex, corticospinal tract, and basal ganglia contralateral to the most affected body side. These patients could be clearly distinguished from patients with AD dementia or PSP using 18F-AV-1451. However, cortical atrophy was more widespread than the cortical retention of 18F-AV1451 in these CBS cases, and cortical AV-1451 uptake did not correlate with cortical thickness or glucose hypometabolism. These results are in sharp contrast to AD dementia, where 18F-AV-1451 retention was more widespread than cortical atrophy, and correlated well with cortical thickness and hypometabolism. Conclusions: Patients with CBS without typical AD pathology exhibited AV-1451 retention in the motor cortex, corticospinal tract, and basal ganglia contralateral to the affected body side, clearly different from controls and patients with AD dementia or PSP. However, cortical atrophy measured with MRI and decreased 18F-fluorodeoxyglucose uptake were more widespread than 18F-AV-1451 uptake and probably represent earlier, yet less specific, markers of CBS. Classification of evidence: This study provides Class III evidence that 18F-AV-1451 PET distinguishes between CBS and AD or PSP. PMID:28754841

  18. Value of the adenosine test for diagnosis of dual AV nodal physiology in patients with AV nodal reentrant tachycardia

    Institute of Scientific and Technical Information of China (English)

    周斌全; 胡申江; 鲁端; 王建安

    2002-01-01

    Objectives: This study was aimed at assessing the value of the adenosine test for noninvasive diagnosis of dual AV nodal physiology(DAVNP) in patients with AV nodal reentrant tachycardia (AVNRT). Methods: 53 patients with paroxysmal supraventricular tachycardia (PSVT) were given incremental doses of adenosine intravenously during sinus rhythm before electrophysiological study. The adenosine test was repeated on a subset of 18 patients with AVNRT after radiofrequency catheter ablation. Results: Sudden increments of PR interval of more than 60 msec between two consecutive beats were observed in 26(83.9%) of 31 patients with typical AVNRT and 2 (9.1%) of 22 patients with AVRT and AT (P<0.01). The maximal PR increment between 2 consecutive beats in the AVNRT group(105±45ms) was significantly greater than that in the AVRT and AT group (20±13ms) (P<0.01).In postablation adenosine test, DAVNP was eliminated in all 8 patients who underwent slow pathway abolition that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS showed the slow pathway persisted. Six of 10 patients who exhibited persistent duality showed a marked reduction in the number of beats conducted in the slow pathway after adenosine injection(P<0.01).Conclusions: Administration of adenosine during sinus rhythm may be a useful bedside test for diagnosis of DAVNP in high percentage of patients with typical AVNRT and additionally for evaluating the effects of radiofrequency ablation.

  19. Depth as randomness deficiency

    NARCIS (Netherlands)

    Antunes, L.; Matos, A.; Souto, A.; Vitányi, P.

    2008-01-01

    Depth of an object concerns a tradeoff between computation time and excess of program length over the shortest program length required to obtain the object. It gives an unconditional lower bound on the computation time from a given program in absence of auxiliary information. Variants known as

  20. Depth as Randomness Deficiency

    NARCIS (Netherlands)

    L.F. Antunes (Luis); A. Matos; A. Souto (Andre); P.M.B. Vitányi (Paul)

    2009-01-01

    htmlabstractDepth of an object concerns a tradeoff between computation time and excess of program length over the shortest program length required to obtain the object. It gives an unconditional lower bound on the computation time from a given program in absence of auxiliary information. Variants

  1. Depth as randomness deficiency

    NARCIS (Netherlands)

    Antunes, L.; Matos, A.; Souto, A.; Vitányi, P.

    2009-01-01

    Depth of an object concerns a tradeoff between computation time and excess of program length over the shortest program length required to obtain the object. It gives an unconditional lower bound on the computation time from a given program in absence of auxiliary information. Variants known as

  2. Realization of AVS +DVB -S2 Professional Integrated Receiver Decoder%AVS +DVB -S2专业解码器的实现方法

    Institute of Scientific and Technical Information of China (English)

    周钦光; 杨雪松

    2015-01-01

    AVS +是我国自主创新的视频编码技术,可解决广播电视行业面临的频道资源问题。介绍了一种具备 DVB -S2专业多流接收和多节目再复用解密功能的 AVS +专业高清解码器的实现方法,该设备不仅能完成传统专业数字卫星解码器的所有功能,而且能进行 DVB -S2专业接收、再复用、多节目的CI 接口任意组合解密和 AVS +高清解码,为广电运营商提供了一种成本低、功能强大的 DVB -S2专业AVS +解码设备,将为早日实现 AVS +端到端应用的全覆盖做出一定的贡献。%AVS +is a Chinese independent innovative technology for video encoding.Its objective is to solve frequency resource problem in broadcasting television industry.This article shows the realization of AVS +high definition Integrated Receiver decoder,which can not only all functions of traditional and professional digital satellite decoder,but also the functions of DVB -S2 professional receiving,re-multiplexing for CI combination decrypting of multiple programs,and AVS +high definition decoding.In other words,this decoder provides op-erators with a low-cost but powerful functioning DVB -S2 professional receiving and AVS +high definition de-coding solution,making a certain contribution to the overall coverage of AVS +end -to -end application.

  3. BMP2 expression in the endocardial lineage is required for AV endocardial cushion maturation and remodeling.

    Science.gov (United States)

    Saxon, Jacob G; Baer, Daniel R; Barton, Julie A; Hawkins, Travis; Wu, Bingruo; Trusk, Thomas C; Harris, Stephen E; Zhou, Bin; Mishina, Yuji; Sugi, Yukiko

    2017-10-01

    Distal outgrowth, maturation and remodeling of the endocardial cushion mesenchyme in the atrioventricular (AV) canal are the essential morphogenetic events during four-chambered heart formation. Mesenchymalized AV endocardial cushions give rise to the AV valves and the membranous ventricular septum (VS). Failure of these processes results in several human congenital heart defects. Despite this clinical relevance, the mechanisms governing how mesenchymalized AV endocardial cushions mature and remodel into the membranous VS and AV valves have only begun to be elucidated. The role of BMP signaling in the myocardial and secondary heart forming lineage has been well studied; however, little is known about the role of BMP2 expression in the endocardial lineage. To fill this knowledge gap, we generated Bmp2 endocardial lineage-specific conditional knockouts (referred to as Bmp2 cKO(Endo)) by crossing conditionally-targeted Bmp2(flox/flox) mice with a Cre-driver line, Nfatc1(Cre), wherein Cre-mediated recombination was restricted to the endocardial cells and their mesenchymal progeny. Bmp2 cKO(Endo) mouse embryos did not exhibit failure or delay in the initial AV endocardial cushion formation at embryonic day (ED) 9.5-11.5; however, significant reductions in AV cushion size were detected in Bmp2 cKO(Endo) mouse embryos when compared to control embryos at ED13.5 and ED16.5. Moreover, deletion of Bmp2 from the endocardial lineage consistently resulted in membranous ventricular septal defects (VSDs), and mitral valve deficiencies, as evidenced by the absence of stratification of mitral valves at birth. Muscular VSDs were not found in Bmp2 cKO(Endo) mouse hearts. To understand the underlying morphogenetic mechanisms leading to a decrease in cushion size, cell proliferation and cell death were examined for AV endocardial cushions. Phospho-histone H3 analyses for cell proliferation and TUNEL assays for apoptotic cell death did not reveal significant differences between control

  4. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing.

  5. Monocular transparency generates quantitative depth.

    Science.gov (United States)

    Howard, Ian P; Duke, Philip A

    2003-11-01

    Monocular zones adjacent to depth steps can create an impression of depth in the absence of binocular disparity. However, the magnitude of depth is not specified. We designed a stereogram that provides information about depth magnitude but which has no disparity. The effect depends on transparency rather than occlusion. For most subjects, depth magnitude produced by monocular transparency was similar to that created by a disparity-defined depth probe. Addition of disparity to monocular transparency did not improve the accuracy of depth settings. The magnitude of depth created by monocular occlusion fell short of that created by monocular transparency.

  6. Ansatte perspektiver på utvikling av tverrfaglighet i ny sykehusavdeling

    Directory of Open Access Journals (Sweden)

    Hildfrid V. Brataas

    2009-02-01

    Full Text Available Artikkelen omhandler en følgestudie om ansattes perspektiver på teamorganisert og brukerinvolvert tverrfaglig samarbeid i en ny rehabiliteringsavdeling i et norsk sykehus. Studiens formål var å bringe frem mer kunnskap om forhold av betydning ved utvikling av tverrfaglige arbeidsformer i sammensatte helsetjenester.Metode: Undersøkelsen var kvalitativt beskrivende og fortolkende med bruk av fokusgruppeintervjuer tre og fem år etter oppstart av rehabiliteringsavdelingen.Resultater: Over en femårsperiode var praksis erfart å endre karakter, fra flerfaglig samarbeid til funksjonelt tverrfaglig samarbeid. Profesjonsoverbyggende teori om rehabiliterings-virksomheten og ledelsens kvalitetsorientering var erfart som hjelp for teamenes utvikling av funksjonell tverrfaglighet.Konklusjon: Langsiktighet, kvalitetsorientert ledelse og teamorganisert rehabiliteringsarbeid basert på profesjonsoverbyggende teoriramme synes å underbygge utvikling av funksjonell tverrfaglighetsforståelse og praksis. Denne kunnskapen er relevant ved omlegging til teamorganisert rehabiliteringsvirksomhet i eksisterende og nye virksomheter. Det er behov for mer forskning om betydning av personfaktorer og motivasjon, ledelse og overbyggende teorirammeverk for samarbeidsutvikling og kvalitet i praksis.

  7. Nodal recovery, dual pathway physiology, and concealed conduction determine complex AV dynamics in human atrial tachyarrhythmias.

    Science.gov (United States)

    Masè, Michela; Glass, Leon; Disertori, Marcello; Ravelli, Flavia

    2012-11-15

    The genesis of complex ventricular rhythms during atrial tachyarrhythmias in humans is not fully understood. To clarify the dynamics of atrioventricular (AV) conduction in response to a regular high-rate atrial activation, 29 episodes of spontaneous or pacing-induced atrial flutter (AFL), covering a wide range of atrial rates (cycle lengths from 145 to 270 ms), were analyzed in 10 patients. AV patterns were identified by applying firing sequence and surrogate data analysis to atrial and ventricular activation series, whereas modular simulation with a difference-equation AV node model was used to correlate the patterns with specific nodal properties. AV node response at high atrial rate was characterized by 1) AV patterns of decreasing conduction ratios at the shortening of atrial cycle length (from 236.3 ± 32.4 to 172.6 ± 17.8 ms) according to a Farey sequence ordering (conduction ratio from 0.34 ± 0.12 to 0.23 ± 0.06; P AV block patterns occurring during regular atrial tachyarrhythmias. The characterization of AV nodal function during different AFL forms constitutes an intermediate step toward the understanding of complex ventricular rhythms during atrial fibrillation.

  8. Baseline HV-interval predicts complete AV-block secondary to transcatheter aortic valve implantation.

    Science.gov (United States)

    Shin, Dong-In; Merx, Marc W; Meyer, Christian; Kirmanoglou, Kiriakos; Hellhammer, Katharina; Ohlig, Jan; Katsani, Dimitra; Zeus, Tobias; Westenfeld, Ralf; Eickholt, Christian; Linke, Axel; Kelm, Malte

    2015-10-01

    Development of AV-block is a frequent complication associated with transcatheter aortic valve implantation (TAVI). To date little is known about the predictive value of the HV-interval prior to TAVI with respect to the risk of AV-block development. HV-interval was determined in 25 consecutive elderly patients with severe aortic valve stenosis (AS) before and immediately after TAVI. All patients subsequently underwent TAVI and 8 of these 25 patients (32%) developed complete AV-block during the TAVI procedure requiring permanent pacemaker implantation. Six of these 8 patients (75%) had marked HV prolongation (>54 ms). Pre-procedural HV-interval was significantly prolonged in the subgroup developing complete AV-block (62.1 ms±13.0 vs 49.2 ms±12.9; P=0.029). Prolongation of the HV-interval above 54 ms was associated with a higher rate of complete AV-block (sensitivity 75.0%, specificity 77.8%, P=0.01). HV-interval was prolonged in approximately one third of our elderly patients with aortic valve stenosis and associated with a high rate of complete AV-block following TAVI. HV-interval is easily obtained during TAVI screening procedures, thus facilitating identification of patients at risk for complete AV-block due to TAVI and consequently enabling bespoke risk management.

  9. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  10. Performance Comparison of AVS and H.264/AVC Video Coding Standards

    Institute of Scientific and Technical Information of China (English)

    Xin-Fu Wang; De-Bin Zhao

    2006-01-01

    A new audio and video compression standard of China, known as advanced Audio Video coding Standard (AVS),is emerging. This standard provides a technical solution for many applications within the information industry such as digital broadcast, high-density laser-digital storage media, and so on. The basic part of AVS, AVS1-P2, targets standard definition (SD) and high definition (HD) format video compression, and aims to achieve similar coding efficiency as H.264/AVC but with lower computational complexity. In this paper, we first briefly describe the major coding tools in AVS1-P2, and then perform the coding efficiency comparison between AVS1-P2 Jizhun profile and H.264/AVC main profile. The experimental results show that the AVS1-P2 Jizhun profile has an average of 2.96% efficiency loss relative to H.264/AVC main profile in terms of bit-rate saving on HD progressive-scan sequences, and an average of 28.52% coding loss on interlace-scan sequences.Nevertheless, AVS1-P2 possesses a valuable feature of lower computational complexity.

  11. Developing a computational model of human hand kinetics using AVS

    Energy Technology Data Exchange (ETDEWEB)

    Abramowitz, Mark S. [State Univ. of New York, Binghamton, NY (United States)

    1996-05-01

    As part of an ongoing effort to develop a finite element model of the human hand at the Institute for Scientific Computing Research (ISCR), this project extended existing computational tools for analyzing and visualizing hand kinetics. These tools employ a commercial, scientific visualization package called AVS. FORTRAN and C code, originally written by David Giurintano of the Gillis W. Long Hansen`s Disease Center, was ported to a different computing platform, debugged, and documented. Usability features were added and the code was made more modular and readable. When the code is used to visualize bone movement and tendon paths for the thumb, graphical output is consistent with expected results. However, numerical values for forces and moments at the thumb joints do not yet appear to be accurate enough to be included in ISCR`s finite element model. Future work includes debugging the parts of the code that calculate forces and moments and verifying the correctness of these values.

  12. EST Table: AV398400 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398400 NV021766 10/09/28 97 %/109 aa ref|NP_001091759.1| annexin isoform 2 [Bomby.../27 47 %/107 aa T07C4.9a#CE23956#WBGene00003589#locus:nex- 2#Annexin#status:Confirmed#UniProt:Q27512#protein...1|gene:ANXB10B 10/09/10 low homology 10/09/10 48 %/104 aa gi|91090858|ref|XP_967143.1| PREDICTED: similar to annexin B13a isoform 1 [Tribolium castaneum] NM_001098288 NV02 ... ...x mori] gb|ABD36280.1| annexin isoform 2 [Bombyx mori] 10/08/28 67 %/103 aa FBpp0123640|DanaGF20448-PA 10/08

  13. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  14. EST Table: AV404143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404143 pg--0524 11/12/09 n.h 10/09/28 100 %/131 aa pdb|3FZB|A Chain A, Crystal Structure... Of The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|B Chain B, Crystal Structure Of T...he Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|C Chain C, Crystal Structure Of The Tail Term...inator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|D Chain D, Crystal Structure O...f The Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|E Chain E, Crystal Structure Of The Tail T

  15. En språkfundert kompetansemodell for planlegging av undervisning

    Directory of Open Access Journals (Sweden)

    Erik Knain

    2016-04-01

    Full Text Available I utdanningsvitenskapelig litteratur er ulike former for ”literacy” et vedvarende fokus både teoretisk og empirisk. I engelskspråklig naturfagdidaktisk litteratur brukes betegnelsen ”scientific literacy”. Jeg skisserer i denne artikkelen et planleggingsverktøy for undervisning som bygger på en eksplisitt teoretisk modell for deltakelse gjennom språk. Modellen er bindeledd mellom et generalisert kompetansebegrep og planlegging av undervisning ved at den knytter sammen de didaktiske spørsmålene hva, hvem, hvordan og hvorfor med en modell for funksjonell deltakelse. Modellen er spesielt relevant for et allmenndannende ”naturfag for alle”, men favner også et naturfag som fokuserer på utdanning av framtidas naturvitere. Artikkelen retter seg mot naturfag i skolen, men modellen bør kunne anvendes også i andre skolefag. Modellen peker mot et situert og transformativt kompetansebegrep.Nøkkelord: naturfag , kompetanse , diskurs , deltakelse, undervisning og læringAbstractVarious forms of literacy have long been the focus of educational discourses, not the least in science education where the term “scientific literacy” has been an enduring concern for decades. In this article I describe a tool for designing teaching based on a theoretical perspective on participation through language. The model connects a general conception of competence with the planning of teaching. To do so it drowe on the didactical questions of “what, who, how and why”. The model is particularly relevant in a “science for all” perspective but also for the educating of future science specialists. Although school science is the primary focus in this article, the model should be applicable to other school subjects as well. The model opens for a situated and transformative notion of competence.Keywords: scientific literacy, discourse, participation, teaching and learning

  16. Stöttning av skrivande i ett digitalt diskussionsforum

    Directory of Open Access Journals (Sweden)

    Stina Hållsten

    2017-07-01

    Full Text Available Vi vet att studenter ofta upplever akademiskt skrivande som svårt. Att skrivandet dessutom förläggs till en digital lärplattform underlättar kanske inte alltid. Större studentgrupper och minskade resurser, parallellt med ett större utbud av distanskurser, gör att digitala lärplattformar blir än viktigare inom högre utbildning. Forskning visar dock att vi i första hand använder lärplattformar i administrativt syfte, trots möjligheter till en mer pedagogisk användning, exempelvis genom mer interaktion och ett större fokus på skrivandet. Hur kan lärplattformens design och användning utvecklas pedagogiskt, närmare bestämt med ett genrepedagogiskt upplägg?Empirin för artikeln är en distanskurs i kriminologi, där all kursaktivitet skedde över utbildningens lärplattform. Kursdesignen och lärarnas aktivitet (instruktioner, responsgivande och annan stöttning analyserades tillsammans med ett mindre antal studenters användande av lärplattformen i arbetet med uppgiften Lärandedialogen. Vilka genrepedagogiska drag uppvisas redan i kursdesignen, och vilka skulle kunna förstärkas? Genrepedagogiken tar fasta på den muntliga dialogen kring text och innehåll. Därför diskuteras även hur man kan se den skriftliga, asynkrona diskussionen som något liknande det muntliga seminariesamtalet.

  17. MANIFEST OF DEPTH SOCIOPSYCHOLOGY

    OpenAIRE

    ZELITCHENKO ALEXANDER

    2013-01-01

    The observations of motives of activity of big groups (nations, confessions etc.) as a whole result in discovery of the part of unconscious mind that is common for all members of big group a collective unconscious. Two parts of collective unconscious may be determined: the collective superconscious known first as a group archetype and the collective subconscious, which manifest itself for example in phenomenon of collective trauma. Depth sociopsychology is a science about the collective uncon...

  18. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  19. Subcortical (18) F-AV-1451 binding patterns in progressive supranuclear palsy.

    Science.gov (United States)

    Cho, Hanna; Choi, Jae Yong; Hwang, Mi Song; Lee, Seung Ha; Ryu, Young Hoon; Lee, Myung Sik; Lyoo, Chul Hyoung

    2017-01-01

    Accumulation of cortical and subcortical tau pathology is the primary pathological substrate for progressive supranuclear palsy (PSP). (18) F-AV-1451, a radiotracer that binds to the pathological tau protein, may be helpful for in vivo visualization and quantitation of tau pathology in PSP. The objectives of this study were to investigate cortical and subcortical (18) F-AV-1451 binding patterns in patients with PSP. We recruited 14 PSP patients and compared their cortical and subcortical binding patterns in (18) F-AV-1451 positron emission tomography (PET) studies with those of 15 Parkinson's disease (PD) patients and 15 healthy controls. In both the PD and PSP groups, subcortical (18) F-AV-1451 binding did not correlate with the severity of motor dysfunctions, and cortical binding did not differ between the controls and each patient group. However, the PSP patients showed greater (18) F-AV-1451 binding in the putamen, globus pallidus, subthalamic nucleus, and dentate nucleus when compared with the controls, whereas the PD patients showed lower (18) F-AV-1451 binding in the substantia nigra than controls. The PSP and PD patients showed distinct subcortical (18) F-AV-1451 binding patterns reflecting subcortical tau pathology in PSP and reduced nigral neuromelanin in PD. However, there was no correlation with the severity of motor dysfunction, no cortical regions with increased binding in PSP patients, and variable degrees of subcortical binding even in the controls. Therefore, the (18) F-AV-1451 PET may be less than ideal for assessing tau pathology in PSP. Further studies will be required to validate the clinical correlation and to understand the clinical utility of (18) F-AV-1451 PET for PSP patients. © 2016 International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  20. Pathological correlations of [F-18]-AV-1451 imaging in non-alzheimer tauopathies.

    Science.gov (United States)

    Marquié, Marta; Normandin, Marc D; Meltzer, Avery C; Siao Tick Chong, Michael; Andrea, Nicolas V; Antón-Fernández, Alejandro; Klunk, William E; Mathis, Chester A; Ikonomovic, Milos D; Debnath, Manik; Bien, Elizabeth A; Vanderburg, Charles R; Costantino, Isabel; Makaretz, Sara; DeVos, Sarah L; Oakley, Derek H; Gomperts, Stephen N; Growdon, John H; Domoto-Reilly, Kimiko; Lucente, Diane; Dickerson, Bradford C; Frosch, Matthew P; Hyman, Bradley T; Johnson, Keith A; Gómez-Isla, Teresa

    2017-01-01

    Recent studies have shown that positron emission tomography (PET) tracer AV-1451 exhibits high binding affinity for paired helical filament (PHF)-tau pathology in Alzheimer's brains. However, the ability of this ligand to bind to tau lesions in other tauopathies remains controversial. Our goal was to examine the correlation of in vivo and postmortem AV-1451 binding patterns in three autopsy-confirmed non-Alzheimer tauopathy cases. We quantified in vivo retention of [F-18]-AV-1451 and performed autoradiography, [H-3]-AV-1451 binding assays, and quantitative tau measurements in postmortem brain samples from two progressive supranuclear palsy (PSP) cases and a MAPT P301L mutation carrier. They all underwent [F-18]-AV-1451 PET imaging before death. The three subjects exhibited [F-18]-AV-1451 in vivo retention predominantly in basal ganglia and midbrain. Neuropathological examination confirmed the PSP diagnosis in the first two subjects; the MAPT P301L mutation carrier had an atypical tauopathy characterized by grain-like tau-containing neurites in gray and white matter with heaviest burden in basal ganglia. In all three cases, autoradiography failed to show detectable [F-18]-AV-1451 binding in multiple brain regions examined, with the exception of entorhinal cortex (reflecting incidental age-related neurofibrillary tangles) and neuromelanin-containing neurons in the substantia nigra (off-target binding). The lack of a consistent significant correlation between in vivo [F-18]-AV-1541 retention and postmortem in vitro binding and tau measures in these cases suggests that this ligand has low affinity for tau lesions primarily made of straight tau filaments. AV-1451 may have limited utility for in vivo selective and reliable detection of tau aggregates in these non-Alzheimer tauopathies. ANN NEUROL 2017;81:117-128. © 2016 American Neurological Association.

  1. AV interval optimization using pressure volume loops in dual chamber pacemaker patients with maintained systolic left ventricular function.

    Science.gov (United States)

    Eberhardt, Frank; Hanke, Thorsten; Fitschen, Joern; Heringlake, Matthias; Bode, Frank; Schunkert, Heribert; Wiegand, Uwe K H

    2012-08-01

    Atrioventricular (AV) interval optimization is often deemed too time-consuming in dual-chamber pacemaker patients with maintained LV function. Thus the majority of patients are left at their default AV interval. To quantify the magnitude of hemodynamic improvement following AV interval optimization in chronically paced dual chamber pacemaker patients. A pressure volume catheter was placed in the left ventricle of 19 patients with chronic dual chamber pacing and an ejection fraction >45 % undergoing elective coronary angiography. AV interval was varied in 10 ms steps from 80 to 300 ms, and pressure volume loops were recorded during breath hold. The average optimal AV interval was 152 ± 39 ms compared to 155 ± 8 ms for the average default AV interval (range 100-240 ms). The average improvement in stroke work following AV interval optimization was 935 ± 760 mmHg/ml (range 0-2,908; p AV interval changes the average stroke work by 207 ± 162 mmHg/ml. AV interval optimization also leads to improved systolic dyssynchrony indices (17.7 ± 7.0 vs. 19.4 ± 7.1 %; p = 0.01). The overall hemodynamic effect of AV interval optimization in patients with maintained LV function is in the same range as for patients undergoing cardiac resynchronization therapy for several parameters. The positive effect of AV interval optimization also applies to patients who have been chronically paced for years.

  2. Den blivande förskollärarens formering. En studie av verksamhetsförlagda handledningssamtal, argumentationstraditioner och metaforik

    Directory of Open Access Journals (Sweden)

    Marie-Louise Hjort

    2014-06-01

    Full Text Available I denna studie analyserar vi hur erfarna förskollärare i rollen som handledare introducerar förskollärarstudenter i professionen. Studien genomförs mot bakgrund av ett delvis nytt uppdrag som förskolan fått under senare år, som bland annat yttrar sig i att förskolan nu är en del av utbildningssystemet. Med utgångspunkt i det teoretiska begreppet argumentationstraditioner och genom att analysera metaforiken i deltagarnas resonerande, studeras hur erfarna och blivande förskollärare navigerar spänningar centrala för professionen. Deltagarnas betoning av vissa argumentationstraditioner och användningen av viss metaforik diskuteras i termer av vad de implicerar för utvecklingen av de barn som deltar i en förskoleverksamhet som formas av dessa.

  3. LNG tidscertepartier : En innføring generelt og regulering av boil-off spesielt

    OpenAIRE

    Bull, Johan Storm

    2005-01-01

    Oppgaven gir en innføring i langsiktige LNG tidscertepartier. Den tar for seg både hva som er særegent for denne kontraktstypen generelt, og gir en oversikt over typiske sider ved den konkrete reguleringen av et utvalg certepartier. Som et spesialemne, tar oppgaven for seg reguleringen av ansvaret for boil-off mellom partene. Dette er et fenomen som er spesielt for LNG farten. LNG certepartier tar for seg transport av LNG med skip. LNG står for Liquefied Natural Gas, eller flytende naturg...

  4. Måleegenskaper ved den norske versjonen av Teacher's Report Form (TRF)

    OpenAIRE

    Kornør, Hege; Drugli, May Britt

    2011-01-01

    Beskrivelse. TRF inngår som én av tre tester i Achenbach System of Empirically Based Assessment (ASEBA). Thomas Achenbach og Leslie Rescorla står bak denne testen, som kom ut i sin originalversjon på engelsk 2001. Torunn S. Nøvik og Sonja Heyerdahl publiserte den norske oversettelsen av TRF i 2002. TRF skal besvares av lærere for å kartlegge faglig fungering, tilpasning og problemområder hos barn og ungdom i skolealder. Problemdelen har én totalskåre som danner utgangspunkt for...

  5. "The Power of Christ Compels You". En studie av eksorsisme i tre filmer.

    OpenAIRE

    Morland, Espen Steensnæs

    2014-01-01

    Denne oppgaven er en studie av fenomenet eksorsisme i de tre filmene The Exorcist (1973), The Exorcist III (1990) og The Exorcism of Emily Rose (2005). Målet har vært å finne ut hvilke roller eksorsisme, kjønnsroller, det overnaturlige og Den katolske kirke spiller i disse tre filmene. I tillegg inneholder oppgaven en sammenligning av de tre filmene. De tre filmene er både like og forskjellige når det gjelder deres tilnærming til eksorsisme. En viktig del av det katolske eksorsismeritualet...

  6. [The functional dissociation of conduction within the human AV-node (author's transl)].

    Science.gov (United States)

    Runge, M; Narula, O S; Ehlers, E; Luckmann, E; Pantlen, H

    1980-07-15

    The functional dissociation (FD) of conduction within the AV-node is characterized by sudden prolongations and/or shortenings of the AH-time during stimulation. Examples for FD are presented during regular atrial stimulation and atrial extrastimulus technique. The appearance of FD is no proof for functional impairment of the AV-node. The blockade of the parasympathetic nervous system abolishes FD and leads to the well known continuous and regular adaptation of the AH-time with the various kinds of stimulation examined. It is recommended to replace the term "pathways" by the more comprehensive concept of functional dissociation with the AV-node.

  7. Om inflammatorisk tarmsykdom, samt protokollutvikling for isolasjon av enkeltceller fra colonslimhinnebiopsier

    OpenAIRE

    Dahl, Jim André; Krokstrand, Tobias Tysnes

    2011-01-01

    Inflammatorisk tarmsykdom (IBD) omfatter primært de to tilstandene, ulcerøs kolitt (UC) og morbus Crohn (MbC). Begge tilstandene karakteriseres ved kronisk inflammasjon i fordøyelseskanalen. Etiologien er ukjent, men en teori som har blitt fremmet er dysregulasjon av immunresponsen mot den kommensale tarmflora hos genetisk predisponerte individer. Insidensen av IBD er høyere i den vestlige verden enn i utviklingsland, og Norge er et av landene med høyest registrert insidens. Tilstanden kan...

  8. Langtidseffekten av kalking på lystgassemisjonen frå dyrka organisk jord

    OpenAIRE

    Hovlandsdal, Linn

    2011-01-01

    Kultivert jord er den viktigaste antropogene kjelda til dinitrogenoksid (N2O), også kalla lystgass. N2O er ein klimagass og bidreg til øydelegging av stratosfærisk ozon. Dyrka myrjord har ein større emisjon av N2O enn mineraljord. Sjølv om dyrka myrjord berre utgjer 7 – 8 % av det totale dyrka arealet i Noreg, kan dei potensielt vere ein stor bidragsytar til N2O - emisjonen frå norsk jordbruk. pH i jord er ein nøkkelvariabel for dei fleste biologiske prosessane i jorda. Kalking kan føre ti...

  9. Religion, visdom och humanism : en teologisk läsning av Hermann Hesses Siddhartha

    OpenAIRE

    Sandström, Henning E.

    2007-01-01

    Hermann Hesse (1877-1962) er en av 1900-tallets mest leste og innflytelserike forfattere. Hele hans forfatterskap kan sies å være historien om hans egen søken etter sannhet. Han var influert av Freud, Jung, mystikk og østerlandsk filosofi, men ønsket ikke å bli plassert under en etikette. I flere av sine mest berømte verker forteller han om en person som samtidig er han selv og en representant for menneskeheten. Denne personen søker sannheten om seg selv og den absolutte sannheten, men kan i...

  10. Vad vill kvinnor ha? : En undersökning av en lokaltidnings bilaga i form av ett livsstilsmagasin.

    OpenAIRE

    Heurling, Åsa; Lovisa, Lesse

    2011-01-01

    Folkbladet är en dagstidning i Norrköping med en stark lokal prägel vars prenumeranter till största delen är sportintresserade män. För att försöka bredda sin läsekrets har man sedan 2009 gett ut en tidning kallad Trend, som vänder sig till kvinnor i åldern 20 - 50 år. Denna tidning med lokal prägel, i form av ett livsstilsmagasin för kvinnor, handlar om mode, skönhet, heminredning och resor. Maga- sinet ges ut i fyra nummer per år och delas ut gratis till alla hushåll i Norrköping med omnejd...

  11. Value of the adenosine test for diagnosis of dual AV nodal physiology in patients with AV nodal reentrant tachycardia

    Institute of Scientific and Technical Information of China (English)

    周斌全; 胡申江; 等

    2002-01-01

    Objectives:This study was aimed at assessing the value of the adenosine test for noninvasive diagnosis of dual AV nodal physiology(DAVNP) in patients with AV nodal reentrant tachycardia(VANRT).Methods:53 patients with paroxysmal supraventricular tachycardia(PSVT) were given incremental doses of adenosine intravenously during sinus rhythm before electrophysiological study.The adenosine test was repeated on a subset of 18 patients with AVNRT after radiofrequency catheter ablation.Results:Sudden increments of PR interval of more than 60 msec between two consecutive beats were observed in 26(83.9%) of 31 patients with typical AVNRT and 2(9.1%) of 22 patients with AVRT and AT(P<0.01),The maximal PR increment between 2 consecutive beats in the AVNRT group(105±45ms) was significantly greater than that in the AVRT and AT group[(20±13ms) (P<0.01),In postablation adenosine test,DAVNP was eliminated in all 8 patients who underwent slow pathway abolition that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS showed the slow pathway disappeared and 4 of 10 patients who underwent slow pathway modification that EPS whosed the slow pathway persisted.Six of 10 patients whw exhibited persistent duality showed a marked reduction in the number of beats conducted in the slow pathway after adenosine injection(P<0.01),COnclusions:Administration of adenosine during sinus rhythm may be a useful bedside test for diagnosis of DAVNP in high percentage of patients with typical AVNRT and additionally for evaluating the effects of radiofrequency ablation.

  12. Värdering och redovisning till verkligt värde av finansiella instrument : en studie av IAS 39 och SFAS 157

    OpenAIRE

    Campner, Britta; Liang, Yucong; Melkersson, Rickard

    2009-01-01

    Bakgrund och problem: Som ett steg i konvergeringsprocessen med FASB startade IASB år2006 ett projekt med syfte att skapa en enhetlig standard för värdering till verkligt värde i helaIFRS. I den inledande fasen av projektet utformades ett discussion paper, där denamerikanska motsvarigheten för värdering till verkligt värde, SFAS 157, användes somutgångspunkt. En av de standarder som i hög grad innefattar värdering till verkligt värde ochsåledes berörs i stor utsträckning av projektet är IAS 3...

  13. Utveckling av fryssäker vaccinväska : För transport av vaccin till svårtillgängliga områden

    OpenAIRE

    TILLQVIST, VIKTOR; Sandqvist, Viktor

    2014-01-01

    Detta projekt fokuserar på att förhindra att vaccinet förstörs vid transport, samt underlätta för vårdpersonal som arbetar för att transportera vaccin till otillgängliga områden. Vaccin måste förvaras kylt. Därför utgörs transporten av vaccin av en så kallad kylkedja. Projektet behandlar den sista delen i kylkedjan, den så kallade last miltransportation. Idag varierar kunskapen hos arbetarna vilket medför variationer i utförandet av de rutiner som är utvecklade för att på ett säkert sätt pake...

  14. Analys av miljöanpassad ogräsbekämpning

    OpenAIRE

    2013-01-01

    Svenska Kraftnät är ett statligt affärsverk vars huvuduppgift är drift och underhåll av det svenska elstamnätet. Bekämpningen av oönskad vegetation är en del i underhållsarbetet i anläggningarna och sker i dagsläget med det kemiska bekämpningsmedlet Roundup. Svenska Kraftnät önskar att minska eller ersätta den kemiska ogräsbekämpningen med en miljöanpassad metod och rapporten syftar till att undersöka den möjligheten.  En av de möjliga metoderna, NCC Spuma, testades i ett fältförsök i en av S...

  15. Transformasjon av Lækjargata : fra transportåre til en levende bygate

    OpenAIRE

    Pétursdóttir, Tinna Rut

    2016-01-01

    Lækjargata, en av de viktigste bygatene i Reykjavík, og temaet for dette prosjektet, er et eksempel på en gate som har blitt overtatt av privatbiler med lite fokus på myke trafikanter. Gaten er et svært viktig innslag i bybildet, har stor historisk betydning og en sterk identitet, som man dessverre ikke kan nyte på grunn av bilene. Målet med oppgaven er å finne en måte å transformere Lækjargata til å bli en levende bygate ved hjelp av blå og grønne strukturer og samtidig bidra til å skape en ...

  16. Eksklusive fellesskap: Et kritisk blikk på nyurbanismen i lys av Kentlands, USA

    Directory of Open Access Journals (Sweden)

    Bengt Andersen

    2008-10-01

    Full Text Available Denne artikkelen tar utgangspunkt i nyurbanismen, en amerikansk byplanleggingsbevegelse, og deres byutviklingsprosjekt Kentlands i Maryland, USA. Deres påstand er at en gjennom de rette designprinsippene vil få det ønskede samfunnet. Her argumenteres det for at den fysiske determinismen som ligger til grunn for den nyurbanistiske ideologien er for enkel. Mens nyurbanistene hevder at de skaper heterogene og lokaliserte fellesskap gjennom realiseringen av deres egne designprinsipper, hevdes det her med støtte i en sosialantropologisk studie av Kentlands at dannelsen av slike fellesskap er noe mer komplisert. Innbyggerne viste seg i praksis til og med å handle mot et slikt ideal. Sosial praksis, de nyurbanistiske designreglene, samt den felles interessen for å opprettholde eiendomsverdiene, førte til etableringen av en "eksklusiv enklave" snarere enn et inkluderende bomiljø.Nøkkelord: Nyurbanisme, byplanlegging, designregler, eksklusive enklaver

  17. InterProScan Result: AV400452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400452 AV400452_2_ORF2 5E62868E5F66D93B PANTHER PTHR11523:SF15 SODIUM/POTASSIUM-D...EPENDENT ATPASE BETA SUBUNIT, INSECT 1.1e-19 T IPR000402 unintegrated Molecular Function: sodium:potassium-e...Process: potassium ion transport (GO:0006813)|Biological Process: sodium ion transport (GO:0006814)|Cellular Component: membrane (GO:0016020) ...

  18. The Galactic NH - AV Relation and its Application to Historical Galactic SNRs

    CERN Document Server

    Tian, Wen-Wu; Xiang, F Y

    2013-01-01

    We refine a classic relation between the hydrogen column density (NH) and optical extinction (Av) by employing 39 Galactic Supernova Remnants (SNRs) with X-rays, optical and/or infra-red data available. We find NH = (1.69+/-0.07)*10^21 Av cm^(-2) mag^(-1) . Applying this relation to three Galactic SNRs with good historical records allows us to further constrain either their progenitor's distances or magnitudes, which is independent access to their distances.

  19. [(18)F]AV-1451 binding to neuromelanin in the substantia nigra in PD and PSP.

    Science.gov (United States)

    Coakeley, Sarah; Cho, Sang Soo; Koshimori, Yuko; Rusjan, Pablo; Ghadery, Christine; Kim, Jinhee; Lang, Anthony E; Houle, Sylvain; Strafella, Antonio P

    2017-09-07

    This study investigated binding of [(18)F]AV-1451 to neuromelanin in the substantia nigra of patients with Parkinson's disease (PD) and progressive supranuclear palsy (PSP). [(18)F]AV-1451 is a positron emission tomography radiotracer designed to bind pathological tau. A post-mortem study using [(18)F]AV-1451 discovered off-target binding properties to neuromelanin in the substantia nigra. A subsequent clinical study reported a 30% decrease in [(18)F]AV-1451 binding in the midbrain of PD patients. A total of 12 patients and 10 healthy age-matched controls were recruited. An anatomical MRI and a 90-min PET scan, using [(18)F]AV-1451, were acquired from all participants. The standardized uptake value ratio (SUVR) from 60 to 90 min post-injection was calculated for the substantia nigra, using the cerebellar cortex as the reference region. The substantia nigra was delineated using automated region of interest software. An independent samples ANOVA and LSD post hoc testing were used to test for differences in [(18)F]AV-1451 SUVR between groups. Substantia nigra SUVR from 60 to 90 min was significantly greater in HC compared to both PSP and PD groups. Although the PD group had the lowest SUVR, there was no significant difference in substantia nigra uptake between PD and PSP. [(18)F]AV-1451 may be the first PET radiotracer capable of imaging neurodegeneration of the substantia nigra in parkinsonisms. Further testing must be done in PD and atypical parkinsonian disorders to support this off-target use of [(18)F]AV-1451.

  20. Dynamics of AV coupling during human atrial fibrillation: role of atrial rate.

    Science.gov (United States)

    Masè, M; Marini, M; Disertori, M; Ravelli, F

    2015-07-01

    The causal relationship between atrial and ventricular activities during human atrial fibrillation (AF) is poorly understood. This study analyzed the effects of an increase in atrial rate on the link between atrial and ventricular activities during AF. Atrial and ventricular time series were determined in 14 patients during the spontaneous acceleration of the atrial rhythm at AF onset. The dynamic relationship between atrial and ventricular activities was quantified in terms of atrioventricular (AV) coupling by AV synchrogram analysis. The technique identified n:m coupling patterns (n atrial beats in m ventricular cycles), quantifying their percentage, maximal length, and conduction ratio (= m/n). Simulations with a difference-equation AV model were performed to correlate the observed dynamics to specific atrial/nodal properties. The atrial rate increase significantly affected AV coupling and ventricular response during AF. The shortening of atrial intervals from 185 ± 32 to 165 ± 24 ms (P AV patterns with progressively decreasing m/n ratios (from conduction ratio = 0.34 ± 0.09 to 0.29 ± 0.08, P AV block and coupling instability at higher atrial rates were associated with increased ventricular interval variability (from 123 ± 52 to 133 ± 55 ms, P AV pattern transitions and coupling instability in patients were predicted, assuming the filtering of high-rate irregular atrial beats by the slow recovery of nodal excitability. These results support the role of atrial rate in determining AV coupling and ventricular response and may have implications for rate control in AF. Copyright © 2015 the American Physiological Society.

  1. Utilization of Electrocardiographic P-wave Duration for AV Interval Optimization in Dual-Chamber Pacemakers.

    Science.gov (United States)

    Sorajja, Dan; Bhakta, Mayurkumar D; Scott, Luis Rp; Altemose, Gregory T; Srivathsan, Komandoor

    2010-09-05

    Empiric programming of the atrio-ventricular (AV) delay is commonly performed during pacemaker implantation. Transmitral flow assessment by Doppler echocardiography can be used to find the optimal AV delay by Ritter's method, but this cannot easily be performed during pacemaker implantation. We sought to determine a non-invasive surrogate for this assessment. Since electrocardiographic P-wave duration estimates atrial activation time, we hypothesized this measurement may provide a more appropriate basis for programming AV intervals. A total of 19 patients were examined at the time of dual chamber pacemaker implantation, 13 (68%) being male with a mean age of 77. Each patient had the optimal AV interval determined by Ritter's method. The P-wave duration was measured independently on electrocardiograms using MUSE® Cardiology Information System (version 7.1.1). The relationship between P-wave duration and the optimal AV interval was analyzed. The P-wave duration and optimal AV delay were related by a correlation coefficient of 0.815 and a correction factor of 1.26. The mean BMI was 27. The presence of hypertension, atrial fibrillation, and valvular heart disease was 13 (68%), 3 (16%), and 2 (11%) respectively. Mean echocardiographic parameters included an ejection fraction of 58%, left atrial index of 32 ml/m(2), and diastolic dysfunction grade 1 (out of 4). In patients with dual chamber pacemakers in AV sequentially paced mode and normal EF, electrocardiographic P-wave duration correlates to the optimal AV delay by Ritter's method by a factor of 1.26.

  2. Tungstate and Carbonate Ions Sorption Using Anion Exchangers AV-17-8 and Purolite A400

    Directory of Open Access Journals (Sweden)

    Chegrintsev S.

    2016-01-01

    Full Text Available The current paper shows the results of tungstate and carbonate ion sorption using strongly basic anion exchangers AV-17-8 and Purolite A400. It has been established that anion exchanger AV-17-8 in the chloride form with parameters of 168 g of tungstate ion and 157 g of carbonate ion per 1 kg of anion exchanger has the maximum capacity for the tungstate and carbonate ions.

  3. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  4. InterProScan Result: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 AV399741_2_ORF2 F87D90D9B5BA6C11 SUPERFAMILY SSF55267 tRNA-intron endonucl...ease N-terminal domain-like 8.3e-06 T IPR006678 tRNA intron endonuclease, N-terminal Molecular Function: tRNA-intron endonuclease activity (GO:0000213) ...

  5. Kvalitetsutvärdering av biomedicin och närliggande huvudområden

    DEFF Research Database (Denmark)

    Leffler, Hakon; Fex Svenningsen, Åsa; Emgård, Mia

    2014-01-01

    UKÄ:s utvärdering av biomedicinutbildningar visar på en mycket varierad kvalitet. Nio av 21 utbildningar håller toppklass medan mer än hälften bedöms vara bristande. 21 utbildningar inom biomedicin har satts under lupp. Kvaliteten bedöms som vanligt efter en tregradig skala: mycket hög kvalitet...

  6. [F-18]-AV-1451 binding correlates with postmortem neurofibrillary tangle Braak staging.

    Science.gov (United States)

    Marquié, Marta; Siao Tick Chong, Michael; Antón-Fernández, Alejandro; Verwer, Eline E; Sáez-Calveras, Nil; Meltzer, Avery C; Ramanan, Prianca; Amaral, Ana C; Gonzalez, Jose; Normandin, Marc D; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-06-13

    [F-18]-AV-1451, a PET tracer specifically developed to detect brain neurofibrillary tau pathology, has the potential to facilitate accurate diagnosis of Alzheimer's disease (AD), staging of brain tau burden and monitoring disease progression. Recent PET studies show that patients with mild cognitive impairment and AD dementia exhibit significantly higher in vivo [F-18]-AV-1451 retention than cognitively normal controls. Importantly, PET patterns of [F-18]-AV-1451 correlate well with disease severity and seem to match the predicted topographic Braak staging of neurofibrillary tangles (NFTs) in AD, although this awaits confirmation. We studied the correlation of autoradiographic binding patterns of [F-18]-AV-1451 and the stereotypical spatiotemporal pattern of progression of NFTs using legacy postmortem brain samples representing different Braak NFT stages (I-VI). We performed [F-18]-AV-1451 phosphor-screen autoradiography and quantitative tau measurements (stereologically based NFT counts and biochemical analysis of tau pathology) in three brain regions (entorhinal cortex, superior temporal sulcus and visual cortex) in a total of 22 cases: low Braak (I-II, n = 6), intermediate Braak (III-IV, n = 7) and high Braak (V-VI, n = 9). Strong and selective [F-18]-AV-1451 binding was detected in all tangle-containing regions matching precisely the observed pattern of PHF-tau immunostaining across the different Braak stages. As expected, no signal was detected in the white matter or other non-tangle containing regions. Quantification of [F-18]-AV-1451 binding was very significantly correlated with the number of NFTs present in each brain region and with the total tau and phospho-tau content as reported by Western blot and ELISA. [F-18]-AV-1451 is a promising biomarker for in vivo quantification of brain tau burden in AD. Neuroimaging-pathologic studies conducted on postmortem material from individuals imaged while alive are now needed to confirm these observations.

  7. Adaptationer av Esaias Tegnérs Frithiofs saga

    DEFF Research Database (Denmark)

    Nordenfors, Ola

    2008-01-01

    Tegnérs versepos över urnordiska myter hade länge ett starkt om den nordiska läsande allmänheten - därtill starkt understött av Bernhard Crusells omtyckta tonsättningar av dikterna. Men också i Tyskland har Frithiofs saga haft en påfallande genomslagskraft. I uppsatsen granskas särskilt tonsättar...

  8. Et sosiologisk blikk på mobbing. En teoretisk studie av paradigmet og fenomenet mobbing

    OpenAIRE

    Stemland, Linn

    2007-01-01

    Mobbing er et tema som har fått stadig mer oppmerksomhet i samfunnsdebatten. Det er gjort lite sosiologisk forskning omkring fenomenet mobbing. Forskningsfeltet mobbing er i dag konstruert og dominert av psykologiens begreper og forståelse. I denne oppgaven prøver jeg å nærme meg en sosiologisk forståelse av begrepet og fenomenet mobbing.

  9. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  10. Phylogenetic position and replication kinetics of Heliothis virescens ascovirus 3h (HvAV-3h isolated from Spodoptera exigua.

    Directory of Open Access Journals (Sweden)

    Guo-Hua Huang

    Full Text Available Insect-specific ascoviruses with a circular genome are distributed in the USA, France, Australia and Indonesia. Here, we report the first ascovirus isolation from Spodoptera exigua in Hunan, China. DNA-DNA hybridization to published ascoviruses demonstrated that the new China ascovirus isolate is a variant of Heliothis virescens ascovirus 3a (HvAV-3a, thus named HvAV-3h. We investigated the phylogenetic position, cell infection, vesicle production and viral DNA replication kinetics of HvAV-3h, as well as its host-ranges. The major capsid protein (MCP gene and the delta DNA polymerase (DNA po1 gene of HvAV-3h were sequenced and compared with the available ascovirus isolates for phylogenetic analysis. This shows a close relationship with HvAV-3g, originally isolated from Indonesia, HvAV-3e from Australia and HvAV-3c from United States. HvAV-3h infection induced vesicle production in the SeE1 cells derived from S. exigua and Sf9 cells derived from S. frugiperda, resulting in more vesicles generated in Sf9 than SeE1. Viral DNA replication kinetics of HvAV-3h also demonstrated a difference between the two cell lines tested. HvAV-3h could readily infect three important insect pests Helicoverpa armigera (Hübner, Spodoptera exigua (Hübner and Spodoptera litura (Fabricius from two genera in different subfamilies with high mortalities.

  11. First-degree AV block-an entirely benign finding or a potentially curable cause of cardiac disease?

    Science.gov (United States)

    Holmqvist, Fredrik; Daubert, James P

    2013-05-01

    First-degree atrioventricular (AV) block is a delay within the AV conduction system and is defined as a prolongation of the PR interval beyond the upper limit of what is considered normal (generally 0.20 s). Up until recently, first-degree AV block was considered an entirely benign condition. In fact, some complain that it is a misnomer since there is only delay and no actual block in the AV conduction system (usually within the AV node). However, it has long been acknowledged that extreme forms of first-degree AV block (typically a PR interval exceeding 0.30 s) can cause symptoms due to inadequate timing of atrial and ventricular contractions, similar to the so-called pacemaker syndrome. Consequently, the current guidelines state that permanent pacemaker implantation is reasonable for first-degree AV block with symptoms similar to those of pacemaker syndrome or with hemodynamic compromise, but also stresses that there is little evidence to suggest that pacemakers improve survival in patients with isolated first-degree AV block. Recent reports suggest that it may be time to revisit the impact of first-degree AV block. Also, several findings in post hoc analyses of randomized device trials give important insights in possible treatment options. The present review aims to provide an update on the current knowledge concerning the impact of first-degree AV block and also to address the issue of pacing in patients with this condition. ©2013, Wiley Periodicals, Inc.

  12. Patients' and procedural characteristics of AV-block during slow pathway modulation for AVNRT-single center 10year experience.

    Science.gov (United States)

    Wasmer, Kristina; Dechering, Dirk G; Köbe, Julia; Leitz, Patrick; Frommeyer, Gerrit; Lange, Phillip S; Kochhäuser, Simon; Reinke, Florian; Pott, Christian; Mönnig, Gerold; Breithardt, Günter; Eckardt, Lars

    2017-10-01

    Permanent AV-block is a recognized and feared complication of slow pathway modulation for AVNRT. We aimed to assess incidence of transient and permanent AV-block as well as consequences of transient AV-block in a large contemporary AVNRT ablation cohort. We searched our single center prospective ablation database for occurrence of transient and permanent AV-block during slow pathway modulation between January 2004 and October 2015. We analyzed patients' and procedural characteristics as well as outcome of patients in whom transient or permanent AV-block occurred. Of 9170 patients who underwent a catheter ablation at our institution between January 2004 and October 2015, 2101 patients (64% women, mean age 50±18years) underwent slow pathway modulation. In three patients, permanent AV-block occurred during RF application. Additional two patients had transient AV-block that recovered (after a few minutes and 25min), but recurred within two days of the procedure. All five patients underwent dual chamber pacemaker implantation (0.2%). Transient AV-block related to RF delivery occurred in 44 patients (2%). Transient mechanical AV-block occurred in additional 17 patients (0.8%). In 12 patients, ablation was continued despite transient AV-block. One of these patients developed permanent AV-block. Permanent AV-block following slow pathway modulation is a rare event, occurring in 0.2% of patients in a large contemporary single center cohort. Transient AV-block is more frequent (2%). Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Amyloid deposition after cerebral hypoperfusion: evidenced on [(18)F]AV-45 positron emission tomography.

    Science.gov (United States)

    Huang, Kuo-Lun; Lin, Kun-Ju; Ho, Meng-Yang; Chang, Yeu-Jhy; Chang, Chien-Hung; Wey, Shiaw-Pyng; Hsieh, Chia-Ju; Yen, Tzu-Chen; Hsiao, Ing-Tsung; Lee, Tsong-Hai

    2012-08-15

    Animal studies have shown that cerebral hypoperfusion may be associated with amyloid plaque accumulation. Amyloid plaque is known to be associated with dementia and [(18)F]AV-45 is a positron emission tomography (PET) ligand that binds to extracelluar plaques. We hypothesized that demented patients with cerebral hypoperfusion may have increased [(18)F]AV-45 uptake. Five demented patients with cerebral hypoperfusion due to unilateral carotid artery stenosis (CAS) were examined with [(18)F]AV-45 PET, and the results were compared with six elderly controls. The standard uptake value ratio (SUVR) of each region of interest (ROI) was created using whole cerebellum as the reference region. All subjects underwent magnetic resonance imaging (MRI) for obtaining structural information. Patients with dementia and unilateral CAS had a higher global [(18)F]AV-45 SUVR (1.34 ± 0.06) as compared with controls (1.10 ± 0.04, p=0.0043), especially over the frontal, temporal, precuneus, anterior cingulate and occipital regions. The statistical distribution maps revealed a significantly increased [(18)F]AV-45 SUVR in the medial frontal, caudate, thalamus, posterior cingulate, occipital and middle and superior temporal regions ipsilateral to the side of CAS (pAV-45 binding is increased in demented patients with CAS, and its distribution is lateralized to the CAS side, suggesting that amyloid-related dementia may occur under cerebral hypoperfusion. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Science.gov (United States)

    Inai, Kei; Burnside, Jessica L; Hoffman, Stanley; Toole, Bryan P; Sugi, Yukiko

    2013-01-01

    Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV) valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM) components, versican and hyaluronan (HA), and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH) stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC) aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  15. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Directory of Open Access Journals (Sweden)

    Kei Inai

    Full Text Available Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM components, versican and hyaluronan (HA, and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  16. Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family

    DEFF Research Database (Denmark)

    Nilsson, Stefan K; Lookene, Aivar; Beckstead, Jennifer A;

    2007-01-01

    Apolipoprotein A-V is a potent modulator of plasma triacylglycerol levels. To investigate the molecular basis for this phenomenon we explored the ability of apolipoprotein A-V, in most experiments complexed to disks of dimyristoylphosphatidylcholine, to interact with two members of the low densit...... to receptor-covered sensor chips. Our results indicate that apolipoprotein A-V may influence plasma lipid homeostasis by enhancing receptor-mediated endocytosis of triacylglycerol-rich lipoproteins. Udgivelsesdato: 2007-Mar-27......Apolipoprotein A-V is a potent modulator of plasma triacylglycerol levels. To investigate the molecular basis for this phenomenon we explored the ability of apolipoprotein A-V, in most experiments complexed to disks of dimyristoylphosphatidylcholine, to interact with two members of the low density...... lipoprotein receptor family, the low density lipoprotein receptor-related protein and the mosaic type-1 receptor, SorLA. Experiments using surface plasmon resonance showed specific binding of both free and lipid-bound apolipoprotein A-V to both receptors. The binding was calcium dependent and was inhibited...

  17. Dementia care mapping – en mulig metode for utvikling av demensomsorg i sykehjem

    Directory of Open Access Journals (Sweden)

    Anne Marie Mork Rokstad

    2009-02-01

    Full Text Available Artikkelen omhandler en studie av Dementia Care Mapping (DCM anvendt i et norsk sykehjem. Hensikten med studien var å undersøke om det skjer et perspektivskifte i personalgruppen ved bruk av DCM-metoden, og om dette får konsekvenser for praksis. I studien inngikk fokusgruppeintervju med personalet i sykehjemsavdelingen. Bakgrunnsopplysningene som sykepleierne reflekterte over, var kartlegging av trivsel og velvære hos pasientene innsamlet gjennom DCM-metoden, og meldt tilbake til personalet. Personalet opplevde at tilbakemeldingene førte til økt bevissthet i samhandling med pasientene. Ifølge deres utsagn medførte prosjektet flere konkrete endringer i måten de møtte pasientene på. Kartleggingen foretatt etter tre måneder viste større grad av trivsel og velvære i pasientgruppen. Dette peker i retning av at DCM kan være en nyttig metode for kvalitetsutvikling av demensomsorgen i sykehjem. Det er imidlertid behov for videre forskning med et strammere design og et større utvalg for å bekrefte funnene.

  18. ADVANCED VITRIFICATION SYSTEM (RIC AVS) RESEARCH AND DEVELOPMENT PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    J.R. Powell; M. Reich

    2003-06-30

    The objective of this AVS testing program is to use bench-scale test equipment to produce a vitrified product at maximum waste loading from the specified AZ-101 waste simulant and conduct a TTT analysis using laboratory scale melts to show compliance with the DOE Waste Acceptance Product Specifications for Vitrified High-Level Waste Forms (WAPS). The vitrified product complies with the following WAPS. A borosilicate glass with a waste loading of 60.9-wt% was produced from a slurry feed of AZ101 simulant. Glass durability testing, glass characterization testing, and testing methodology were performed in accordance with the Department of Energy approved Test Plan. The glass has two crystalline phases and good uniformity of composition. The Product Consistency Test on the 6 location-specific samples are at least 1 to 2 orders of magnitude below the mean PCT results for the EA glass. Standard deviations were less than 10% of measured values. The glass transition temperature averaged 658 {+-} 9 C. A TTT diagram was produced. There was measured cesium loss of about 2%, and compliance with the Universal Treatment Standards.

  19. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  20. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  1. Offshore Wind Technology Depth Zones

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Coastal bathymetric depth, measured in meters at depth values of: -30, -60, -900 Shallow Zone (0-30m): Technology has been demonstrated on a commercial scale at...

  2. Whether noninvasive optimization of AV and VV delays improves the response to cardiac resynchronization therapy.

    Science.gov (United States)

    Urbanek, Bożena; Chudzik, Michał; Klimczak, Artur; Rosiak, Marcin; Lewek, Joanna; Wranicz, Jerzy Krzysztof

    2013-01-01

    Device optimization is not routinely performed in patients who underwent cardiac resynchronization therapy (CRT) device implantation. Noninvasive optimization of CRT devices by measurement of cardiac output (CO) can be used as a simple method to assess ventricular systolic performance. The aim of this study was to assess whether optimization of atrioventricular (AV) and interventricular (VV) delay can improve hemodynamic response to CRT and whether this optimization should be performed for each patient individually. Twenty patients with advanced heart failure New York Heart Association (NYHA) class III/IV, left ventricular ejection fraction ≤ 35% and left bundle branch block (QRS ≥ 120 ms) in sinus rhythm were evaluated from 24 h to 48 h after implantation of a CRT device by means of impedance cardiography (ICG). CO was first measured at each patient's intrinsic rhythm. Patients then underwent adjustments of AV and VV delay from 80 ms to 140 ms and from -60 ms to +60 ms, respectively in 20 ms increment steps and CO at each setting was measured by ICG. Both AV and VV delays were programmed according to the greatest improvement in CO compared to intrinsic rhythm. There was a statistically signifi cant increase in CO measured at the intrinsic rhythm compared to different AV delay by mean of 21% (3.8 ± 1.0 vs. 4.6 ± 0.1 L/min, p AV/VV delays with left ventricle-preexcitation or simultaneous biventricular pacing caused additional increased CO from intrinsic rhythm by mean of 32.6% (3.8 ± 1.0 vs. 5.04 ± ± 1.0 L/min, p AV/VV setting delays also resulted in improved hemodynamic responses compared to VV factory setting delay. Both AV and VV delay optimization should be performed in clinical practice. Optimal AV delay improved outcome. However, combination of optimized AV/VV delays provided the best hemodynamic response. Optimized AV/VV delays with left ventricle-preexcitation or simultaneous biventricular pacing increased hemodynamic output compared to intrinsic

  3. Universell utforming og den vanskelige avgrensingen av «alle»

    Directory of Open Access Journals (Sweden)

    Lars Christian Risan

    2013-12-01

    Full Text Available Universell utforming er et prinsipp hvor målsetningen er at «utforming av produkter og omgivelser [skal skje] på en slik måte at de kan brukes av alle mennesker, i så stor utstrekning som mulig, uten behov for tilpassing og en spesiell utforming.» (Aslaksen mfl, 1997, den første norske definisjonen I løpet av de siste 15 årene har dette prinsippet blitt fremmet i Norge som et utvetydig fremskritt. Det kan imidlertid være farlig å tro at en ren teknisk løsning kan bygge bro over politiske kontroverser (Imrie 2012, og i denne artikkelen vil vi vise hvordan viktige ideologiske premisser er skjult under paraplyen om universalitet. Vårt empiriske felt er norsk boligpolitikk fra etterkrigstiden og fram til i dag. Innenfor dette feltet ser vi at det har vært argumentert for ulike versjoner av «universell utforming» de siste 40 årene, selv om navnet «universell utforming» er av nyere dato. Vi vil vise hvordan prinsippet har endret seg fra å ha et sosialdemokratisk innhold – før det ble omdøpt til «universell utforming» – for å bli inkorporert i et nyliberalt boligpolitisk paradigme de siste 15 årene. De sosialdemokratiske forgjengerne til «universell utforming» ble til dels formulert som videreutviklinger av en boligpolitikk for sosial rettferdighet og økonomisk likhet. Med innføringen av begrepet «universell utforming» har denne brede sosiale rammen forsvunnet, men under dekke av universalitet og entydig framskrittsoptimisme har denne politiske endringen blitt underkommunisert.[i] [i] Prosjektet er finansiert av Husbanken. Prosjektmedarbeiderne har bestått av NIBR-forskerne Erik Henningsen, Siri Nørve og Lars Risan. Underveis har disse forskerne intervjuet og snakket med en rekke personer innenfor feltene funksjonshemming- og boligpolitikk. Vi takker også Jon Guttu, Olav Rand Bringa, Tore Lange for mange konstruktive innspill. 

  4. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p AV node (p AV node during AF by saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  5. 阿弗菌素链霉菌突变株AV-m-481发酵产物的研究%Fermentation Products of AV-m-481, A Mutant Strain of Streptomyces avermitilis

    Institute of Scientific and Technical Information of China (English)

    叶少兵; 冯军; 赵文杰; 程晴华; 林纲

    2003-01-01

    高产菌株Streptomyces avermitilis AV-h-169用亚硝基胍进行处理后得到了一不产阿弗菌素的突变株AV-m-481,从该突变株的发酵产物中分离纯化出化合物AV-L-1和AV-L-2.质谱和核磁共振谱等测定表明它们分别为阿弗菌素A1a和A2a的糖苷配基.

  6. Flåtten Ixodes ricinus som sykdomsvektor i Sør-Norge. Etablering og utvikling av PCR-baserte påvisningsmetoder og påvisning av Babesia, Borrelia og Anaplasma

    OpenAIRE

    2004-01-01

    NORSK SAMMENDRAG: Hensikten med denne undersøkelsen var å undersøke flåtten Ixodes ricinus som smittebærer av Ehrlichia/ Anaplasma, Borrelia burgdorferi sensu lata og Babesia i Sør-Norge, og å etablere DNA-basert metode for påvisning av Babesia og forbedre metode for påvisning av Ehrlichia/ Anaplasma. For å kontrollere variasjon i følsomheten av Ehrlichia/ Anaplasma PCR med 16s rDNA primere Ehr 521/747, ble en internkontroll konstruert. Internkontrollen er et DNA-fragment so...

  7. A Practical ECG Criterion to Unmask Left Accessory AV Connections in Patients With Subtle Preexcitation.

    Science.gov (United States)

    Thompson, J Jenkins; Shah, Jignesh; Charnigo, Richard; Tackett, Andrea; Darrat, Yousef H; Bailey, Alison; Delisle, Brian; Kakavand, Bahram; DI Biase, Luigi; Natale, Andrea; Morales, Gustavo; Elayi, Claude S

    2015-05-20

    Accessory AV-connections capable of antegrade conduction need to be recognized because of the potential for life-threatening arrhythmias. However, the preexcited ECG pattern may be subtle, especially among left-sided AV-connections. We explored whether additional ECG criteria might help identify left-sided AV-connections. We analyzed 156 patients who underwent an electrophysiology study (EPS) and ablation for paroxysmal supraventricular tachycardias (PSVT). Patients were divided into 2 groups: those with left-sided AV-connections (Group 1) and all other PSVT (Group 2). Various ECG parameters were compared before and after ablation in both groups. The EPS identified left-sided AV-connections among 43 patients (Group 1) and excluded it among 113 (Group 2). Baseline ECG in Group 1 demonstrated obvious preexcitation among 24/43 patients (55.8%), the remaining 19/43 missing obvious preexcitation. R/S ratio > 0.5 in V1 was noted in 38/43 (88.4%) patients in Group 1 before ablation (median 1.00; IQR 0.58-2.20), including 16/19 (84.2%) patients lacking obvious left-sided AVconnections. Conversely, only 10/113 (8.8%) patients in Group 2 had R/S ratios in V1 ≥ 0.5 (0.20; 0.10-0.31), P AV-connections (sensitivity 93.0%). The negative predictive value of this combined criterion was 103/106 (97.2%). In symptomatic patients, combining the R/S ratio (≥ 0.5) in lead V1 with the classic preexcitation pattern on ECG markedly improved the sensitivity to diagnose left-sided AV-connections. This ratio may be particularly useful among patients lacking obvious preexcitation. © 2015 Wiley Periodicals, Inc.

  8. A novel curve fitting method for AV optimisation of biventricular pacemakers.

    Science.gov (United States)

    Dehbi, Hakim-Moulay; Jones, Siana; Sohaib, S M Afzal; Finegold, Judith A; Siggers, Jennifer H; Stegemann, Berthold; Whinnett, Zachary I; Francis, Darrel P

    2015-09-01

    In this study, we designed and tested a new algorithm, which we call the 'restricted parabola', to identify the optimum atrioventricular (AV) delay in patients with biventricular pacemakers. This algorithm automatically restricts the hemodynamic data used for curve fitting to the parabolic zone in order to avoid inadvertently selecting an AV optimum that is too long.We used R, a programming language and software environment for statistical computing, to create an algorithm which applies multiple different cut-offs to partition curve fitting of a dataset into a parabolic and a plateau region and then selects the best cut-off using a least squares method. In 82 patients, AV delay was adjusted and beat-to-beat systolic blood pressure (SBP) was measured non-invasively using our multiple-repetition protocol. The novel algorithm was compared to fitting a parabola across the whole dataset to identify how many patients had a plateau region, and whether a higher hemodynamic response was achieved with one method.In 9/82 patients, the restricted parabola algorithm detected that the pattern was not parabolic at longer AV delays. For these patients, the optimal AV delay predicted by the restricted parabola algorithm increased SBP by 1.36 mmHg above that predicted by the conventional parabolic algorithm (95% confidence interval: 0.65 to 2.07 mmHg, p-value = 0.002).AV optima selected using our novel restricted parabola algorithm give a greater improvement in acute hemodynamics than fitting a parabola across all tested AV delays. Such an algorithm may assist the development of automated methods for biventricular pacemaker optimisation.

  9. Increased basal ganglia binding of (18) F-AV-1451 in patients with progressive supranuclear palsy.

    Science.gov (United States)

    Smith, Ruben; Schain, Martin; Nilsson, Christer; Strandberg, Olof; Olsson, Tomas; Hägerström, Douglas; Jögi, Jonas; Borroni, Edilio; Schöll, Michael; Honer, Michael; Hansson, Oskar

    2017-01-01

    Progressive supranuclear palsy (PSP) is difficult to diagnose accurately. The recently developed tau PET tracers may improve the diagnostic work-up of PSP. Regional tau accumulation was studied using (18) F-AV-1451 PET in 11 patients with PSP and 11 age-matched healthy controls in the Swedish BioFinder study. (18) F-AV-1451 standard uptake volume ratios were significantly higher in the basal ganglia in PSP patients when compared with controls (globus pallidus 1.75 vs 1.50; putamen 1.51 vs 1.35). Retention in the basal ganglia was correlated with age in both groups (r = .43-.78, P AV-1451 retention was observed in the cerebral cortex or white matter of either PSP patients or controls, and autoradiography did not reveal any specific binding of AV-1451 to PSP tau aggregates. We found higher (18) F-AV-1451 retention in the basal ganglia of PSP patients when compared with healthy elderly controls, but also increases with age in both controls and patients. As a result of the overlap in retention between diagnostic groups and the age-dependent increase present also in controls, (18) F-AV-1451 PET might not reliably distinguish individual patients with PSP from controls. However, further studies are needed to evaluate whether (18) F-AV-1451 PET might be useful as a progression marker in clinical PSP trials. © The Authors. Movement Disorders published by Wiley Periodicals, Inc. on behalf of International Parkinson and Movement Disorder Society. © 2016 International Parkinson and Movement Disorder Society.

  10. Integrated rate-dependent and dual pathway AV nodal functions: principles and assessment framework.

    Science.gov (United States)

    Billette, Jacques; Tadros, Rafik

    2014-01-15

    The atrioventricular (AV) node conducts slowly and has a long refractory period. These features sustain the filtering of atrial impulses and hence are often modulated to optimize ventricular rate during supraventricular tachyarrhythmias. The AV node is also the site of a clinically common reentrant arrhythmia. Its function is assessed for a variety of purposes from its responses to a premature protocol (S1S2, test beats introduced at different cycle lengths) repeatedly performed at different basic rates and/or to an incremental pacing protocol (increasingly faster rates). Puzzlingly, resulting data and interpretation differ with protocols as well as with chosen recovery and refractory indexes, and are further complicated by the presence of built-in fast and slow pathways. This problem applies to endocavitary investigations of arrhythmias as well as to many experimental functional studies. This review supports an integrated framework of rate-dependent and dual pathway AV nodal function that can account for these puzzling characteristics. The framework was established from AV nodal responses to S1S2S3 protocols that, compared with standard S1S2 protocols, allow for an orderly quantitative dissociation of the different factors involved in changes in AV nodal conduction and refractory indexes under rate-dependent and dual pathway function. Although largely based on data from experimental studies, the proposed framework may well apply to the human AV node. In conclusion, the rate-dependent and dual pathway properties of the AV node can be integrated within a common functional framework the contribution of which to individual responses can be quantitatively determined with properly designed protocols and analytic tools.

  11. Left-sided approach of AV junction ablation for drug refractory atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yoga Yuniadi

    2006-06-01

    Full Text Available AV junction ablation has been proven effective to treat symptomatic atrial fibrillation refractory to antiarrhythmias or fail of pulmonary vein isolation. However, about 15% of conventional right-sided approach AV junction ablation failed to produce complete heart block. This study aimed to characterize His bundle potential at ablation site during conventional or left-sided approach of AV junction ablation. Twenty symptomatic AF patient (age of 60.5 ± 9.28 and 11 are females underwent conventional AV junction ablation. If 10 applications of radiofrequency energy are failed, then the ablation was performed by left-sided approach. Seventeen patients are successfully ablated by conventional approach. In 3 patients, conventional was failed but successfully ablated by left-sided approach. The His bundle amplitude at ablation site was significantly larger in left-sided than correspondence right-sided (16.0 ± 4.99 mm vs. 6.9 ± 4.02 mm respectively, p = 0.001, 95% CI -14.0 to -4.3. ROC analysis of His bundle potential amplitude recorded from right-sided revealed that cut off point of > 4.87 mm given the sensitivity of 81.3% and specificity of 53.8% for successful right-sided approach of AV junction ablation. In case of failed conventional approach, the left-sided approach is effective for AV junction ablation. An early switch to the left-sided approach may avoid multiple RF applications in patients with a low amplitude His-bundle potential (< 4.87 mm. (Med J Indones 2006; 15:109-14Keywords: Atrial fibrillation, AV junction ablation, left-sided approach

  12. Tensor-based projection depth

    CERN Document Server

    Hu, Yonggang; Wu, Yi; 10.3150/10-BEJ317

    2012-01-01

    The conventional definition of a depth function is vector-based. In this paper, a novel projection depth (PD) technique directly based on tensors, such as matrices, is instead proposed. Tensor projection depth (TPD) is still an ideal depth function and its computation can be achieved through the iteration of PD. Furthermore, we also discuss the cases for sparse samples and higher order tensors. Experimental results in data classification with the two projection depths show that TPD performs much better than PD for data with a natural tensor form, and even when the data have a natural vector form, TPD appears to perform no worse than PD.

  13. Mygg och Bti i nedre Dalälven : Utvärdering av ett vetenskapligt uppföljningsprogram

    OpenAIRE

    Nilsson, Christer; Malm-Renöfält, Birgitta

    2009-01-01

    Denna rapport redovisar uppdraget att granska den vetenskapliga uppföljningen avmyggkontrollprogrammet i nedre Dalälven. Rapporten beskriver hur frågorna iuppföljningsprogrammet besvarats samt diskuterar relevansen av de frågor somingått i uppdraget. Det konstateras att den vetenskapliga uppföljningen av eventuellaeffekter av spridning av Bti brustit i försöksdesign och analys. Det insamladematerialet ger inte underlag för de slutsatser som dragits. De frågor som ingått iuppdraget har därmed ...

  14. Videodokumentasjon ved gjennomføring av praktisk eksamen i sykepleie - hvordan kan dette forbedre studentens praksiske ferdigheter?

    Directory of Open Access Journals (Sweden)

    Gjertrud Husøy

    2014-02-01

    Full Text Available Hensikten med studiet var å belyse hvordan videodokumentasjon av praktiske handlinger i sykepleie kunne brukes som evalueringordning av studenter. Artikkelen tar utgangspunkt i et forskningsprosjekt for utprøving av nye lærings og evalueringsformer i bachelorutdanningen i sykepleie, der 13 studentgrupper gjennomførte sin praktiske eksamen ved innlevering av video av 16 utvalgte øvelser. Tradisjonell praktisk eksamen i samme studentkull ble gjennomført for 10 studentgrupper. Prosjektet er en kvalitativ kasusstudie og analyse er gjort etter inspirasjon av Giorgi‘s empiriske fenomenologi. Diskusjonen tar utgangspunkt i Vygotsky‘s sosiokulturelle syn på læring og Dewey‘s prinsipp om at all læring er basert på erfaring. Funnene er presentert i følgende deler: Første del omhandler videodokumentasjon og refleksjon. De to neste delene viser funn i forhold til mesterlæring og situert læring på vei mot forståelse av hva sykepleie er. Deretter er teknisk utfordringer belyst, og til slutt en drøfting av forhold ved oppøving av praktiske sykepleieferdigheter. Konklusjonen her er at video egner seg til å dokumentere sykepleiehandlinger. Dette har størst verdi for læring og refleksjon, i mindre grad som eksamensform.

  15. Vannkjemisk og økologisk tilstand i sidevassdrag til Orkla. - Undersøkelser av vannkvalitet, bunndyr, yngel-/ungfisk og hydromorfologiske påvirkninger

    OpenAIRE

    Bergan, M.

    2011-01-01

    Det er foretatt vannkjemiske og biologiske undersøkelser i tilsammen 12 vannforekomster i Vannområde Orkla høsten 2010. Vannforekomstene er typifisert på bakgrunn av kalsiuminnhold og fargetall i henhold til ny vannforskrift. Det er foretatt en klassifisering og vurdering av vannkjemisk tilstand på bakgrunn av punktprøvenes innhold av fosfor, nitrogen, KOF og TKB. Økologisk tilstand er klassifisert ved bruk av bunndyr som kvalitetselement i 10 vannforekomster, der 9 av 10 har en tilstand som ...

  16. Hvor moralsk tenker fotballspillere? – en empirisk studie av toppfotball

    Directory of Open Access Journals (Sweden)

    Lars Tore Ødegård

    2015-11-01

    Full Text Available Det er en utbredt oppfatning at det økende prestasjonskravet i toppfotball fører til en svekkelse av moral og fair play-holdninger. Men hvordan tenker toppfotballspillere i forhold til ulike dilemmaer som oppstår på banen, og er det forskjeller mellom toppfotballspillere og spillere på lavere nivå?  For å avklare dette gjennomførte vi en empirisk undersøkelse der vi intervjuet spillere og trener i én toppklubb og én breddeklubb. Vi var interessert i to hovedproblemstillinger:  1 Hva tenker fotballspillere på ulike prestasjonsnivå om etikk og moralske dilemmaer i fotball? 2 Hvilke faktorer påvirker spillerne, direkte og indirekte, i deres vurderinger og handlinger? Resultatene fra undersøkelsen viser at det er store forskjeller mellom de to prestasjonsnivåene. Spillerne på breddenivået føler generelt et større ansvar for å opptre ærlig på banen enn hva som er tilfelle på toppnivået. Vi fant 4 spesifikke faktorer i toppfotballen som bidrar til umoralsk opptreden. For det første opplever spillerne en forventning om at de prioriterer resultat foran fair play. For det andre bidrar tilstedeværelsen av supportere på kamper til en slik prioritering. For det tredje vil handlinger som er i strid med fair play signaliseres som akseptable internt i miljøet, selv om de ofte signaliseres som uakseptable overfor media og omverdenen. For det fjerde kan spillere oppleve det som vanskelig å gå i mot trenerens oppfordringer til en pragmatisk og resultatfokusert opptreden.Nøkkelord: moral, etikk, fair play, footballEnglish summary: How morally do football players think? – an empirical study of moral dilemmas in elite footballIt is a common view that the increasing focus on achievement and success in elite football leads to a weakening of moral and fair play attitudes. But how do elite players think and what do they think about different dilemmas that appear on the field, and is there a difference between elite players and lower

  17. Forecasts and restrictions on vibrations from rock excavation and transportation. Encapsulation Plant and Repository for spent nuclear fuel, Laxemar; Prognoser och restriktioner foer vibrationer fraan bergschaktning och transporter. Inkapslingsanlaeggning och slutfoervar foer anvaent kaernbraensle, Laxemar

    Energy Technology Data Exchange (ETDEWEB)

    Lind, Carl; Johansson, Sven-Erik (Nitro Consult AB (Sweden))

    2010-12-15

    This study describes the impact on the surroundings that may occur during rock excavation activities for the final repository for spent nuclear fuel in Laxemar and the encapsulation facility in Simpevarp. The study also includes vibrations created by heavy shipments related to activities at the final repository. The study will provide input to the environmental impact assessment and future design work. The survey area for buildings and facilities covered by the study extends approximately 1,000 metres from the proposed location of the final repository. For the encapsulation facility the survey area has been limited to residential buildings and summer houses within 1,000 metres of the proposed location. In addition, residential buildings along road 743 have been surveyed with regard to the impact of heavy shipments between Laxemar and Faarbo. The results of the surveys and information on planned rock excavation activities have been used to formulate preliminary restrictions and predictions of vibrations and air shock waves from blasting, as well as noise from rock drilling. Predictions have also been made of vibrations from heavy shipments, and a reference survey has been carried out in a residential building near road 743. The predictions of vibrations from blasting rounds reveal low or very low levels. No risk of damage to buildings or equipment is expected. Vibrations from blasting may, however, be perceptible within large parts of the study area, since the human perception threshold for vibration is very low. They will hardly be regarded as disturbing, however. When the accesses to the final repository have been built and rock excavation continues at repository level, the impact on the surroundings is expected to be minimal. The main reason for this is that the blasting will then occur at a depth of about 500 metres, at an ample distance to buildings at surface level. Predictions of air shock waves from blasting rounds indicate low levels. There is no risk of

  18. 18F-AV-1451 positron emission tomography in Alzheimer's disease and progressive supranuclear palsy.

    Science.gov (United States)

    Passamonti, Luca; Vázquez Rodríguez, Patricia; Hong, Young T; Allinson, Kieren S J; Williamson, David; Borchert, Robin J; Sami, Saber; Cope, Thomas E; Bevan-Jones, W Richard; Jones, P Simon; Arnold, Robert; Surendranathan, Ajenthan; Mak, Elijah; Su, Li; Fryer, Tim D; Aigbirhio, Franklin I; O'Brien, John T; Rowe, James B

    2017-03-01

    The ability to assess the distribution and extent of tau pathology in Alzheimer's disease and progressive supranuclear palsy in vivo would help to develop biomarkers for these tauopathies and clinical trials of disease-modifying therapies. New radioligands for positron emission tomography have generated considerable interest, and controversy, in their potential as tau biomarkers. We assessed the radiotracer 18F-AV-1451 with positron emission tomography imaging to compare the distribution and intensity of tau pathology in 15 patients with Alzheimer's pathology (including amyloid-positive mild cognitive impairment), 19 patients with progressive supranuclear palsy, and 13 age- and sex-matched controls. Regional analysis of variance and a support vector machine were used to compare and discriminate the clinical groups, respectively. We also examined the 18F-AV-1451 autoradiographic binding in post-mortem tissue from patients with Alzheimer's disease, progressive supranuclear palsy, and a control case to assess the 18F-AV-1451 binding specificity to Alzheimer's and non-Alzheimer's tau pathology. There was increased 18F-AV-1451 binding in multiple regions in living patients with Alzheimer's disease and progressive supranuclear palsy relative to controls [main effect of group, F(2,41) = 17.5, P AV-1451 binding was significantly increased in patients with Alzheimer's disease, relative to patients with progressive supranuclear palsy and with control subjects, in the hippocampus and in occipital, parietal, temporal, and frontal cortices (t's > 2.2, P's AV-1451 binding was elevated in the midbrain (t = 2.1, P AV-1451 uptake in the putamen, pallidum, thalamus, midbrain, and in the dentate nucleus of the cerebellum (t's > 2.7, P's AV-1451 strongly bound to Alzheimer-related tau pathology, but less specifically in progressive supranuclear palsy. 18F-AV-1451 binding to the basal ganglia was strong in all groups in vivo. Postmortem histochemical staining showed absence of

  19. Kjøring med mistanke om påvirkning av andre rusmidler enn alkohol

    Directory of Open Access Journals (Sweden)

    Asbjørg S. Christophersen

    2009-10-01

    Full Text Available  SAMMENDRAGStatens rettstoksikologiske institutt har i løpet av de siste år registrert en stor økning av prøver fra bilføreremistenkt for kjøring under påvirkning av andre rusmidler enn alkohol. Antall positive saker økte 42% fra1994 til 1995. De hyppigste påviste stoffer er tetrahydrocannabinol, amfetamin, benzodiazepiner og opiater(morfin/kodein. Bruk av tyngre narkotiske stoffer har blitt mer vanlig i trafikksammenheng og antall positivetilfeller har økt betydelig mer enn totalt antall saker. Fra 1994 til 1995 økte antall positive amfetaminprøvermed 75% (fra 533 til 937 og antall positive prøver som følge av heroininntak økte med 87% (fra 92 til 172.Bruk av flere stoffer samtidig er vanlig, over 60 % av sakene i 1995 var positive på mer enn ett stoff, alkoholikke medregnet. De fleste tilfeller var representert av menn i alderen 25-32 år (37%. Kvinner var representerti ca. 11% av sakene.Christophersen AS, Skurtveit S, Mørland J. Drivers suspected to drive under the influence of drugs otherthan alcohol. Nor J Epidemiol 1996; 6 (1: 45-48.ENGLISH SUMMARYThe National Institute of Forensic Toxicology has registered a large increase in the number of samples fromdrivers suspected to drive under influence of drugs other than alcohol. The number of drug positive casesincreased 42% from 1994 to 1995. The most frequent drugs detected are tetrahydrocannabinol, amphetamine,benzodiazepines and opiates (morphine/codeine. The frequency of hard narcotic drug use has increased morethan the total number of cases. From 1994 to 1995, the number of amphetamine positive samples increased75% (from 533 to 937 and the number of samples positive due to heroin use (detection of the metabolite 6-monoacetylmorphine in urine increased 87%. Multi-drug use is common and more than one drug wasdetected in more than 60% of the cases from 1995, alcohol not included. Most of the cases were representedby men 25-32 years old (37%. Women were represented in about

  20. Vorticity-divergence semi-Lagrangian global atmospheric model SL-AV20: dynamical core

    Science.gov (United States)

    Tolstykh, Mikhail; Shashkin, Vladimir; Fadeev, Rostislav; Goyman, Gordey

    2017-05-01

    SL-AV (semi-Lagrangian, based on the absolute vorticity equation) is a global hydrostatic atmospheric model. Its latest version, SL-AV20, provides global operational medium-range weather forecast with 20 km resolution over Russia. The lower-resolution configurations of SL-AV20 are being tested for seasonal prediction and climate modeling. The article presents the model dynamical core. Its main features are a vorticity-divergence formulation at the unstaggered grid, high-order finite-difference approximations, semi-Lagrangian semi-implicit discretization and the reduced latitude-longitude grid with variable resolution in latitude. The accuracy of SL-AV20 numerical solutions using a reduced lat-lon grid and the variable resolution in latitude is tested with two idealized test cases. Accuracy and stability of SL-AV20 in the presence of the orography forcing are tested using the mountain-induced Rossby wave test case. The results of all three tests are in good agreement with other published model solutions. It is shown that the use of the reduced grid does not significantly affect the accuracy up to the 25 % reduction in the number of grid points with respect to the regular grid. Variable resolution in latitude allows us to improve the accuracy of a solution in the region of interest.

  1. An av-RGD integrin inhibitor toolbox: drug discovery insight, challenges and opportunities.

    Science.gov (United States)

    Hatley, Richard; Macdonald, Simon; Slack, Robert; Le, Joelle; Ludbrook, Steve; Lukey, Pauline

    2017-09-25

    There is a requirement for efficacious and safe medicines to treat diseases with high unmet need. The resurgence in av RGD integrin inhibitor drug discovery is poised to contribute to this requirement. However, drug discovery in the av integrin space is notoriously difficult due to the receptors being structurally very similar as well as the polar zwitterionic nature of the pharmacophore. This review aims to guide drug discovery research in this field through an av inhibitor toolbox, consisting of small molecules and antibodies. Small molecule av tool compounds with extended profiles in avb1, 3, 5, 6 and 8 cell adhesion assays, with key physicochemical properties, have been collated to assist in the selection of the right tool for the right experiment. This should also facilitate an understanding of partial selectivity profiles of compounds generated in different assays across research institutions. Prospects for further av integrin research and the critical importance of target validation are discussed, where increased knowledge of the selectivity for individual RGD v integrins is key. Insights into the design of small molecule RGD chemotypes for topical or oral administration are provided and clinical findings on advanced molecules are examined. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Electrocardiographic and chronobiological features of paroxysmal AV block recorded by ambulatory electrocardiography.

    Science.gov (United States)

    Saito, Ken; Takeda, Shiho; Saito, Yuko; Kawamura, Mami; Yoshikawa, Yoko; Yano, Hayato; Sata, Masataka

    2014-01-01

    The goal of this study was to investigate the electrocardiographic and chronobio-logical features of paroxysmal atrioventricular (AV) block (PAVB) using data from ambulatory electrocardiography (AECG). The study population consisted of five men and six women aged from 47 to 82 years of age. Main presenting symptoms were pre-syncope in five patients (45.5%) and syncope in three patients (27.3%). Organic cardiovascular diseases were seen in eight patients (72.7%), and AV conduction disturbances were seen in six patients (54.5%), such as right bundle branch block, first to second degree AV block on standard 12-lead electrocardiography. Incidence of PAVB events were 1-329 (37.9 ± 98.0) episodes/patient/day, and the maximum pause during Holter recordings was 3.3-12.4 (6.39 ± 3.09) seconds. This maximum pause caused by intrinsic AV block was longer than that of vagally mediated AV block (8.4 ± 3.2 sec vs 4.7 ± 1.0 sec, p<0.05). In chronobiological analysis, episodes of PAVB exhibited a circadian rhythm characterized by a peak between 2:00 am and 4:00 am and a trough between 0:00 pm and 2:00 pm. AECG is a useful tool to detect the maximum pause occurring during sleep and provides critical data necessary to prevent the sudden cardiac death caused by PAVB.

  3. sugE: A gene involved in tributyltin (TBT) resistance of Aeromonas molluscorum Av27.

    Science.gov (United States)

    Cruz, Andreia; Micaelo, Nuno; Félix, Vitor; Song, Jun-Young; Kitamura, Shin-Ichi; Suzuki, Satoru; Mendo, Sónia

    2013-01-01

    The mechanism of bacterial resistance to tributyltin (TBT) is still unclear. The results herein presented contribute to clarify that mechanism in the TBT-resistant bacterium Aeromonas molluscorum Av27. We have identified and cloned a new gene that is involved in TBT resistance in this strain. The gene is highly homologous (84%) to the Aeromonas hydrophila-sugE gene belonging to the small multidrug resistance gene family (SMR), which includes genes involved in the transport of lipophilic drugs. In Av27, expression of the Av27-sugE was observed at the early logarithmic growth phase in the presence of a high TBT concentration (500 μM), thus suggesting the contribution of this gene for TBT resistance. E. coli cells transformed with Av27-sugE become resistant to ethidium bromide (EtBr), chloramphenicol (CP) and tetracycline (TE), besides TBT. According to the Moriguchi logP (miLogP) values, EtBr, CP and TE have similar properties and are substrates for the sugE-efflux system. Despite the different miLogP of TBT, E. coli cells transformed with Av27-sugE become resistant to this compound. So it seems that TBT is also a substrate for the SugE protein. The modelling studies performed also support this hypothesis. The data herein presented clearly indicate that sugE is involved in TBT resistance of this bacterium.

  4. Gjenstand for saksbehandling og verdi som dokumentasjon – analyse av journalføringskriteriene i arkivforskriften

    Directory of Open Access Journals (Sweden)

    Trine Nesland

    2014-11-01

    Full Text Available Artikkelen handler om hvordan journalføringskriteriene «gjenstand for saksbehandling» og «verdi som dokumentasjon» er ment å skulle forstås, basert på hvordan kriteriene er omtalt og definert i eksisterende teori og litteratur.Artikkelen viser at det ikke eksisterer en omforent forståelse av kriterienes innhold, det vil si at kriteriene er tillagt ulik betydning i ulike tekster. Det har tegnet seg et bilde av at de relativt få tekstene som faktisk inneholder beskrivelser av journalføringskriteriene og begrepene kriteriene er bygget opp av, i hovedsak nærmer seg kriteriene enten på en dialektisk-relasjonell eller på en semiotisk-relasjonell måte, hvilket gir to tilsynelatende ulike tolkningsresultater. Det foreligger med andre ord en viss tolkningsmotstrid, hvilket nødvendigvis innebærer at det fortsatt er vanskelig å svare entydig på spørsmålet om hvordan journalføringskriteriene er ment å skulle forstås, og samtidig gir grunn til kritikk av det etablerte systemet.

  5. Context-Aware UPnP-AV Services for Adaptive Home Multimedia Systems

    Directory of Open Access Journals (Sweden)

    Roland Tusch

    2008-01-01

    Full Text Available One possibility to provide mobile multimedia in domestic multimedia systems is the use of Universal Plug and Play Audio Visual (UPnP-AV devices. In a standard UPnP-AV scenario, multimedia content provided by a Media Server device is streamed to Media Renderer devices by the initiation of a Control Point. However, there is no provisioning of context-aware multimedia content customization. This paper presents an enhancement of standard UPnP-AV services for home multimedia environments regarding context awareness. It comes up with context profile definitions, shows how this context information can be queried from the Media Renderers, and illustrates how a Control Point can use this information to tailor a media stream from the Media Server to one or more Media Renderers. Moreover, since a standard Control Point implementation only queries one Media Server at a time, there is no global view on the content of all Media Servers in the UPnP-AV network. This paper also presents an approach of multimedia content integration on the Media Server side that provides fast search for content on the network. Finally, a number of performance measurements show the overhead costs of our enhancements to UPnP-AV in order to achieve the benefits.

  6. Jupiter Clouds in Depth

    Science.gov (United States)

    2000-01-01

    [figure removed for brevity, see original site] 619 nm [figure removed for brevity, see original site] 727 nm [figure removed for brevity, see original site] 890 nmImages from NASA's Cassini spacecraft using three different filters reveal cloud structures and movements at different depths in the atmosphere around Jupiter's south pole.Cassini's cameras come equipped with filters that sample three wavelengths where methane gas absorbs light. These are in the red at 619 nanometer (nm) wavelength and in the near-infrared at 727 nm and 890 nm. Absorption in the 619 nm filter is weak. It is stronger in the 727 nm band and very strong in the 890 nm band where 90 percent of the light is absorbed by methane gas. Light in the weakest band can penetrate the deepest into Jupiter's atmosphere. It is sensitive to the amount of cloud and haze down to the pressure of the water cloud, which lies at a depth where pressure is about 6 times the atmospheric pressure at sea level on the Earth). Light in the strongest methane band is absorbed at high altitude and is sensitive only to the ammonia cloud level and higher (pressures less than about one-half of Earth's atmospheric pressure) and the middle methane band is sensitive to the ammonia and ammonium hydrosulfide cloud layers as deep as two times Earth's atmospheric pressure.The images shown here demonstrate the power of these filters in studies of cloud stratigraphy. The images cover latitudes from about 15 degrees north at the top down to the southern polar region at the bottom. The left and middle images are ratios, the image in the methane filter divided by the image at a nearby wavelength outside the methane band. Using ratios emphasizes where contrast is due to methane absorption and not to other factors, such as the absorptive properties of the cloud particles, which influence contrast at all wavelengths.The most prominent feature seen in all three filters is the polar stratospheric haze that makes Jupiter bright near the pole

  7. Brain uptake of a non-radioactive pseudo-carrier and its effect on the biodistribution of [(18)F]AV-133 in mouse brain.

    Science.gov (United States)

    Wu, Xianying; Zhou, Xue; Zhang, Shuxian; Zhang, Yan; Deng, Aifang; Han, Jie; Zhu, Lin; Kung, Hank F; Qiao, Jinping

    2015-07-01

    9-[(18)F]Fluoropropyl-(+)-dihydrotetrabenazine ([(18)F]AV-133) is a new PET imaging agent targeting vesicular monoamine transporter type II (VMAT2). To shorten the preparation of [(18)F]AV-133 and to make it more widely available, a simple and rapid purification method using solid-phase extraction (SPE) instead of high-pressure liquid chromatography (HPLC) was developed. The SPE method produced doses containing the non-radioactive pseudo-carrier 9-hydroxypropyl-(+)-dihydrotetrabenazine (AV-149). The objectives of this study were to evaluate the brain uptake of AV-149 by UPLC-MS/MS and its effect on the biodistribution of [(18)F]AV-133 in the brains of mice. The mice were injected with a bolus including [(18)F]AV-133 and different doses of AV-149. Brain tissue and blood samples were harvested. The effect of different amounts of AV-149 on [(18)F]AV-133 was evaluated by quantifying the brain distribution of radiolabelled tracer [(18)F]AV-133. The concentrations of AV-149 in the brain and plasma were analyzed using a UPLC-MS/MS method. The concentrations of AV-149 in the brain and plasma exhibited a good linear relationship with the doses. The receptor occupancy curve was fit, and the calculated ED50 value was 8.165mg/kg. The brain biodistribution and regional selectivity of [(18)F]AV-133 had no obvious differences at AV-149 doses lower than 0.1mg/kg. With increasing doses of AV-149, the brain biodistribution of [(18)F]AV-133 changed significantly. The results are important to further support that the improved radiolabelling procedure of [(18)F]AV-133 using an SPE method may be suitable for routine clinical application. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. The Unusual Resistance of Avian Defensin AvBD7 to Proteolytic Enzymes Preserves Its Antibacterial Activity

    Science.gov (United States)

    Bailleul, Geoffrey; Kravtzoff, Amanda; Joulin-Giet, Alix; Lecaille, Fabien; Labas, Valérie; Meudal, Hervé; Loth, Karine; Teixeira-Gomes, Ana-Paula; Gilbert, Florence B.; Coquet, Laurent; Jouenne, Thierry; Brömme, Dieter; Schouler, Catherine; Landon, Céline; Lalmanach, Gilles; Lalmanach, Anne-Christine

    2016-01-01

    Defensins are frontline peptides of mucosal immunity in the animal kingdom, including birds. Their resistance to proteolysis and their ensuing ability to maintain antimicrobial potential remains questionable and was therefore investigated. We have shown by bottom-up mass spectrometry analysis of protein extracts that both avian beta-defensins AvBD2 and AvBD7 were ubiquitously distributed along the chicken gut. Cathepsin B was found by immunoblotting in jejunum, ileum, caecum, and caecal tonsils, while cathepsins K, L, and S were merely identified in caecal tonsils. Hydrolysis product of AvBD2 and AvBD7 incubated with a panel of proteases was analysed by RP-HPLC, mass spectrometry and antimicrobial assays. AvBD2 and AvBD7 were resistant to serine proteases and to cathepsins D and H. Conversely cysteine cathepsins B, K, L, and S degraded AvBD2 and abolished its antibacterial activity. Only cathepsin K cleaved AvBD7 and released Ile4-AvBD7, a N-terminal truncated natural peptidoform of AvBD7 that displayed antibacterial activity. Besides the 3-stranded antiparallel beta-sheet typical of beta-defensins, structural analysis of AvBD7 by two-dimensional NMR spectroscopy highlighted the restricted accessibility of the C-terminus embedded by the N-terminal region and gave a formal evidence of a salt bridge (Asp9-Arg12) that could account for proteolysis resistance. The differential susceptibility of avian defensins to proteolysis opens intriguing questions about a distinctive role in the mucosal immunity against pathogen invasion. PMID:27561012

  9. Evaluation of Depth of Field for depth perception in DVR

    KAUST Repository

    Grosset, A.V.Pascal

    2013-02-01

    In this paper we present a user study on the use of Depth of Field for depth perception in Direct Volume Rendering. Direct Volume Rendering with Phong shading and perspective projection is used as the baseline. Depth of Field is then added to see its impact on the correct perception of ordinal depth. Accuracy and response time are used as the metrics to evaluate the usefulness of Depth of Field. The onsite user study has two parts: static and dynamic. Eye tracking is used to monitor the gaze of the subjects. From our results we see that though Depth of Field does not act as a proper depth cue in all conditions, it can be used to reinforce the perception of which feature is in front of the other. The best results (high accuracy & fast response time) for correct perception of ordinal depth occurs when the front feature (out of the two features users were to choose from) is in focus and perspective projection is used. © 2013 IEEE.

  10. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    GintasView ver 1.3 includes the possibility for time tagging using a mobile device. After simulation the time tagged file is exported to the AV software on the laptop and appears as an integrated video feed/timeline. Conclusions We have found that it is possible to deliver multi-camera video assisted......In situ simulation is simulation done in the actual clinical environment exceeding the simulation immersion compared to that of the embedded simulation centers and facilitating an increased realistic learning experience. Doing this without compromising (all) the educational principals used...... in simulation centers, we sought to include an audio-visual (AV) system for video assisted debriefing (VAD). The difference being that components must be portable and adaptable to a range of clinical environments. A mobile AV system would ideally feature: • Multi camera video capture capability. • Time tagging...

  11. Kvinnans upplevelser under tredje trimestern av sin första graviditet

    OpenAIRE

    Oscarsson, Nathalie

    2011-01-01

    Syftet med studien var att nå en djupare förståelse i hur kvinnan upplever sin första graviditet. Det teoretiska perspektivet var Katie Erikssons ontologiska hälsomodell där ”hälsa som görande- varande-vardande” har används. Designen är kvalitativ och som metod har innehållsanalys används. Materialet består av fem böcker, där kvinnor skriver om sina upplevelser om graviditeten. Frågeställning: Hur upplever kvinnan slutskedet av sin första graviditet? Studien är deduktiv i av...

  12. Samling, sökning och visualisering av loggfiler från testenheter

    OpenAIRE

    Rosenqvist, Fredrik; Henriksson, Thomas

    2015-01-01

    Idag genererar företag stora mängder av loggfiler vilket gör det svårt att hitta och undersöka felmeddelanden i alla loggfiler. En loggsamlare med Logstash, Elasticsearch och Kibana som bas har implementerats hos Ericsson Linköping. Loggsamlarens syfte är att samla loggar från testenheter och möjliggöra sökning och visualisering av dem. En utvärdering av Elasticsearch har genomförts för att se i vilken grad söktiden för sökfrågor ökar med ökad datamängd. Utvärderingen gav en indikation om att...

  13. Spectroscopic studies of Cepheids in Circinus (AV Cir, BP Cir) and Triangulum Australe (R TrA, S TrA, U TrA, LR TrA)

    Science.gov (United States)

    Usenko, I. A.; Kniazev, A. Yu.; Berdnikov, L. N.; Kravtsov, V. V.

    2014-12-01

    Based on high-resolution spectra taken with the 1.9-m telescope of the South African Astronomical Observatory, we have determined the atmospheric parameters and chemical composition for three small-amplitude (AV Cir, BP Cir, and LR TrA), two classical (R TrA and S TrA), and one double-mode (U TrA) Cepheids. The averaged atmospheric parameters have been estimated for three Cepheids (AV Cir, BP Cir, and U TrA) observed at various pulsation phases. In all Cepheids, except U TrA, the metallicity has turned out to be higher than the solar one by 0.1-0.2 dex. The abundances of the key elements of the evolution of yellow supergiants (C, O, Na, Mg, Al) show that these objects have already passed the first dredge-up, while those of the remaining elements are nearly solar. Comparison of our results on the Cepheids from the list (except U TrA) with those of other authors shows significant differences in C and O abundance estimates for AV Cir, R TrA, S TrA, and LR TrA. For AV Cir and BP Cir, the H α line profiles are symmetric but with a slight asymmetry in the core at approximately the same phase near 0{·/ P } 7: on the "blue" side for AV Cir and on the "red" one for BP Cir. BP Cir exhibits a distinct asymmetry in the absorption lines of neutral atoms and ions at various pulsation phases, which can be explained by nonradial first-overtone pulsations. The constancy of the H α absorption line profiles with pulsation phase for AV Cir and BP Cir may suggest the presence of a hydrogen envelope around them. For the double-mode Cepheid U TrA, an asymmetry is observed in the cores of the H α line and the absorption lines of neutral atoms and ions at various pulsation phases, which can be explained by nonradial pulsations in the Cepheid's atmosphere. The absorption lines of neutral atoms and ions of metals in LR TrA closely resemble those in the well-known Cepheid BG Cru: secondary "blue" and "red" components whose line depths vary with pulsation phase are noticeable. This Cepheid

  14. Optimization of the depth resolution for deuterium depth profiling up to large depths

    Science.gov (United States)

    Wielunska, B.; Mayer, M.; Schwarz-Selinger, T.

    2016-11-01

    The depth resolution of deuterium depth profiling by the nuclear reaction D(3He,p)α is studied theoretically and experimentally. General kinematic considerations are presented which show that the depth resolution for deuterium depth profiling using the nuclear reaction D(3He,p)α is best at reaction angles of 0° and 180° at all incident energies below 9 MeV and for all depths and materials. In order to confirm this theoretical prediction the depth resolution was determined experimentally with a conventional detector at 135° and an annular detector at 175.9°. Deuterium containing thin films buried under different metal cover layers of aluminum, molybdenum and tungsten with thicknesses in the range of 0.5-11 μm served as samples. For all materials and depths an improvement of the depth resolution with the detector at 175.9° is achieved. For tungsten as cover layer a better depth resolution up to a factor of 18 was determined. Good agreement between the experimental results and the simulations for the depth resolution is demonstrated.

  15. Shallow burial of district heating pipes; Grund foerlaeggning av fjaerrvaermeledningar

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Stefan; Saellberg, Sven-Erik; Bergstroem, Gunnar [Swedish National Testing and Research Inst., Boraas (Sweden)

    2006-07-28

    Previous studies have shown that the investment costs for district heating installations in suburban areas can be lowered with more rational construction work. This project has studied the possibilities of decreasing the laying depth for pipes in residential-area roads without risking damage on neither pipe nor road surface. An inventory of regulations from national and local authorities and district heating companies in Sweden was done. The larger cities have specific requirements regarding laying depth in road structures. In most places, however, the guidelines issued by the Swedish District Heating Association are followed. And in smaller cities, the question is handled directly by the municipal district heating company. In some places, e.g., Goeteborg, Joenkoeping and Luleaa, the local authorities and the district heating company have agreed on a smaller laying depth under certain circumstances. An analysis of the costs related to the excavation work, backfilling and asphalt laying showed that the costs can be reduced with about 30 % by decreasing the laying depth from 600 mm to 350 mm. A field trial was done with four twin pipes of dimension 2 x DN 32/160 laid 600 mm, 380 mm, 280 mm and 180 mm below the asphalt surface in a road with heavy traffic. Apart from the laying depth, the installation work was done in accordance with the guidelines from the Swedish District Heating Association. During traffic loading, measurements of internal deformations of the pipes, wheel-track depths in the asphalt surface and load-bearing capacity of the road structure were made. The deformation of the pipes is negligible at all laying depths. This is likely due to an arching action from the backfill which supports most of the forces from the traffic load. Significant wheel-tracks were measured, but they seem to correspond directly to settlements in the new soil. Hence, a shallower pipe trench leads to less prominent wheel-tracks. Shallow pipe burial yields slightly larger heat

  16. Utvärdering av arbetsmiljön på en träbränslemottagning : En studie om spridning av trämögelsporer

    OpenAIRE

    Svensson-Höök, Anders

    2015-01-01

    Karlstads Energi AB:s vågstation vid Hedenverket i Karlstad är en anläggning där invägning och analys av träbränsle utförs. Provtagning och hantering av träbränsle hör till de dagliga arbetsuppgifterna för personalen. Vid nära hantering av trämaterial finns risken att exponeras för trämögelsporer. Exponering av mikrobiologiska luftföroreningar kan orsaka hälsobesvär på lungor och luftvägar hos människor. Efter utförd riskbedömning av vågstationen noterades en oro att trämögelsporer och dammpa...

  17. Multinational evaluation of the interpretability of the iterative method of optimisation of AV delay for CRT.

    Science.gov (United States)

    Raphael, Claire E; Kyriacou, Andreas; Jones, Siana; Pabari, Punam; Cole, Graham; Baruah, Resham; Hughes, Alun D; Francis, Darrel P

    2013-09-20

    AV delay optimisation of biventricular pacing devices (cardiac resynchronisation therapy, CRT) is performed in trials and recommended by current guidelines. The Doppler echocardiographic iterative method is the most commonly recommended. Yet whether it can be executed reliably has never been tested formally. 36 multinational specialists, familiar with using the echocardiographic iterative method of CRT optimisation, were shown 20-40 sets of transmitral Doppler traces at 6-8 AV settings and asked to select the optimal AV delay. Unknown to the specialists, some Doppler datasets appeared in duplicate, allowing assessment of both inter and intra-specialist interpretation. On the Kappa scale of agreement (1 = perfect agreement, 0 = chance alone), the agreement regarding optimal AV delay between specialists was poor (kappa=0.12 ± 0.08). More importantly, agreement of specialists with themselves (i.e. viewing identical sets of traces, twice) was also poor, with Kappa=0.23 ± 0.07 and mean absolute difference in optimum AV delay of 83 ms between first and second viewing of the same traces. Iterative AV optimisation is not executed reliably by experts, even in an artificially simplified context where biological variability and variation in image acquisition are eliminated by use of identical traces. This cannot be blamed on insufficient skills of some experts or discordant methods of selecting the optimum, because operators also showed poor agreement with themselves when assessing the same trace. Instead, guidelines should retract any recommendation for this algorithm. Guideline-development processes might usefully begin with a rudimentary check on proposed algorithms, to establish at least minimal credibility. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  18. AV-1451 tau and β-amyloid positron emission tomography imaging in dementia with Lewy bodies.

    Science.gov (United States)

    Kantarci, Kejal; Lowe, Val J; Boeve, Bradley F; Senjem, Matthew L; Tosakulwong, Nikki; Lesnick, Timothy G; Spychalla, Anthony J; Gunter, Jeffrey L; Fields, Julie A; Graff-Radford, Jonathan; Ferman, Tanis J; Jones, David T; Murray, Melissa E; Knopman, David S; Jack, Clifford R; Petersen, Ronald C

    2017-01-01

    Patients with probable dementia with Lewy bodies (DLB) often have Alzheimer's disease (AD)-related pathology. Our objective was to determine the pattern of positron emission tomography (PET) tau tracer AV-1451 uptake in patients with probable DLB, compared to AD, and its relationship to β-amyloid deposition on PET. Consecutive patients with clinically probable DLB (n = 19) from the Mayo Clinic Alzheimer's Disease Research Center underwent magnetic resonance imaging, AV-1451, and Pittsburgh compound-B (PiB) PET examinations. Age- and sex-matched groups of AD dementia (n = 19) patients and clinically normal controls (n = 95) from an epidemiological cohort served as a comparison groups. Atlas- and voxel-based analyses were performed. The AD dementia group had significantly higher AV-1451 uptake than the probable DLB group, and medial temporal uptake completely distinguished AD dementia from probable DLB. Patients with probable DLB had greater AV-1451 uptake in the posterior temporoparietal and occipital cortex compared to clinically normal controls, and in probable DLB, the uptake in these regions correlated with global cortical PiB uptake (Spearman rho = 0.63; p = 0.006). Medial temporal lobe AV-1451 uptake distinguishes AD dementia from probable DLB, which may be useful for differential diagnosis. Elevated posterior temporoparietal and occipital AV-1451 uptake in probable DLB and its association with global cortical PiB uptake suggest an atypical pattern of tau deposition in DLB. ANN NEUROL 2017;81:58-67. © 2016 The Authors. Annals of Neurology published by Wiley Periodicals, Inc. on behalf of American Neurological Association.

  19. Litterær kompetanse - portrett av tre lesarar

    Directory of Open Access Journals (Sweden)

    Hallvard Kjelen

    2015-08-01

    Full Text Available Artikkelen drøfter eit sentralt problemfelt innom litteraturdidaktikken, nemleg tilhøvet mellom litterær lesing som fagleg kompetanse og litterær lesing som oppleving. Problemfeltet er særleg knytt til Louise Rosenblatts arbeid. Ho viser ved hjelp av omgrepa efferent og estetisk lesing korleis det er ei utfordring for litteraturlæraren å utvikle ei litteraturundervisning som i tilstrekkeleg grad tek omsyn til kjensler og røynsler. I ein litteraturteoretisk kontekst er subjektive responsar på litterære tekstar irrelevante, men i ein litteraturdidaktisk kontekst er subjektive responsar høgst relevante. Denne artikkelen bidrar inn i diskusjon-en mellom anna ved å trekkje inn meir empirisk basert litteraturteori som referanseramme. Artikkelen presenterer tre lesarars litterære responsar, og viser korleis kunnskap om individuelle lesarresponsar kan vere utgangspunkt for ei litteraturundervisning som balanserer ei fagleg tilnærming til litteratur opp mot ei meir opplevingsbasert tilnærming.Emneord: Litteraturundervisning, litterær kompetanse, empirisk litteraturteori, lesarresponsAbstractThe article discusses a key issue in literature didactics, namely the relation between literary reading as an academic competence, and literary reading as an experience. The discussion draws heavily on Louise Rosenblatt’s work. By using the concepts efferent and aesthetic reading, she shows how it is a challenge for the teacher of literature to develop literature teaching that adequately takes emotions and experience into account. In a literature-theoretical context, subjective responses to literary texts are irrelevant; but in a didactics context, the subjective responses are highly relevant.  This article contributes to the discussion by bringing in a more empirically based literature theory as a frame of reference. The article presents three readers’ literary responses, and shows how knowledge of individual reader responses can be the basis for

  20. 77 FR 41400 - AV Solar Ranch 1, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request...

    Science.gov (United States)

    2012-07-13

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AV Solar Ranch 1, LLC; Supplemental Notice That Initial Market- Based Rate...-referenced proceeding of AV Solar Ranch 1, LLC's application for market-based rate authority, with an...

  1. Norsk pelsdyrhold – bærekraftig utvikling eller styrt avvikling? — Gjennomgang av pelsdyrnæringen

    DEFF Research Database (Denmark)

    Hamre, Anne Karin; Steine, Torstein; Tveito, Guri

    2014-01-01

    Utvalget for gjennomgang av pelsdyrnæringen i Norge ble oppnevnt ved kongelig resolusjon 4. oktober 2013. Utvalget gir med dette sin utredning.......Utvalget for gjennomgang av pelsdyrnæringen i Norge ble oppnevnt ved kongelig resolusjon 4. oktober 2013. Utvalget gir med dette sin utredning....

  2. Pseudobegivenheter i nyhetsmediene : Hvilke faktorer påvirker publiseringen av arrangerte PR-nyheter?

    OpenAIRE

    2013-01-01

    I 1961 navngav den amerikanske kulturhistorikeren Daniel J. Boorstin et fenomen han kalte «pseudobegivenheter». Pseudobegivenheter er arrangerte begivenheter som først og fremst er tilrettelagt for mediedekning. Denne masteroppgavens tar for seg hvilke faktorer som påvirker publiseringen av slike arrangerte PR-nyheter i nyhetsmediene. De relevante faktorene ble funnet gjennom grundige undersøkelser av tre forskningsspørsmål med vekt på hvilke nyhetsverdier som har betydning for publiseringen,...

  3. Rate-adaptive AV delay and exercise performance following cardiac resynchronization therapy.

    Science.gov (United States)

    Shanmugam, Nesan; Prada-Delgado, Oscar; Campos, Ana Garcia; Grimster, Alex; Valencia, Oswaldo; Baltabaeva, Aigul; Jones, Sue; Anderson, Lisa

    2012-11-01

    Physiological shortening of the atrioventricular (AV) interval with increasing heart rate is well documented in normal human beings and is an established component of dual-chamber pacing for bradycardia. To assess the effect of exercise on optimal AV delay and the impact of a patient-specific rate-adaptive AV delay (RAAVD) on exercise capacity in patients with heart failure following cardiac resynchronization therapy. Phase 1: We performed iterative AV optimization at rest and exercise in 52 cardiac resynchronization therapy patients in atrial-sensed mode (mean age 71.6 ± 9.2 years, 25% females). Phase 2: Subsequently, 20 consecutive volunteers from this group (mean age 69.2 ± 9.6 years, 15% females) underwent cardiopulmonary exercise testing with RAAVD individually programmed ON (RAAVD-ON) or OFF (RAAVD-OFF). Phase 1: In 94% of the patients, there was a marked reduction (mean 50%) in optimal AV delay with exercise. The optimal resting vs exercise AV delay was 114.2 ± 29 ms at a heart rate of 64.4 ± 7.1 beats/min vs 57 ± 31 ms at a heart rate of 103 ± 13 beats/min (P AV delay with exercise, and 3 (6%) showed no change. Phase 2: With RAAVD-ON, significantly better exercise times were achieved (8.7 ± 3.2 minutes) compared with RAAVD-OFF (7.9 ± 3.2 minutes; P = .003), and there was a significant improvement in Vo(2)max (RAAVD-ON 16.1 ± 4.0 vs RAAVD-OFF 14.9 ± 3.7 mL/(kg · min); P = .024). There was a dramatic reduction in optimal AV delay with physiological exercise in the majority of this heart failure cardiac resynchronization therapy cohort. Replicating this physiological response with a programmable RAAVD translated into a 10% improvement in exercise capacity. Copyright © 2012 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  4. Framtagning av ny lyftytrystning för gasturbin SGT-600/700

    OpenAIRE

    Sjöberg, Emma

    2008-01-01

    I detta Examensarbete har en ny lyftutrustning till gasturbin SGT-600/700 olika moduler tagits fram. Examensarbetet har utförts på Siemens Industrial Turbomachinery AB i Finspång på avdelningen GPTP (leverans gasturbin teknik package installation). Målet med arbetet har varit att skapa en lyftutrustning som är mer flexibel än den befintliga lyftutrustningen och klarar samlyft (lyft med hjälp av två kranar). Arbetet har utförts med hjälp av olika metoder som QFD, funktionsmedel-träd och morpho...

  5. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    Directory of Open Access Journals (Sweden)

    Arne Rognmo

    2013-03-01

    Full Text Available Forsøkene (viste at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre første ukene etter kalving. Det ble heller ikke på noe punkt funnet signifikante forskjeller gruppene imellom når det gjelder kalvenes klimatiske toleranse. Det er dog bemerkelsesverdig at det var stor dødelighet blant de små kalvene etter unge små simler i GRUPPE L. Dette funn er interessant sett i sammenheng med resultatene fra Røros (se bidrag fra Dag Lenvik, side som viser at avkastningen fra en flokk kan økes markant om man konsentrerte slakteuttaket på små kalver og forhindrer bedekning av små, unge simler gjennom fjerning av eldre, store bukker. Med det forbehold at våre forsøk er utført på dyr i innhegning med et lavt aktivitetsnivå, kan man fra våreforsøk foreløpig konkludere med at tillegsfor ing av simler i siste halvdel av drektighetsperioden har effekt på kalvenes fødselsvekt, men at vektutviklingen for kalven er uavhengig av simlenes ernæringshistorie, om sistnevnte tilbys høyverdig ernæring etter kalving. Da små kalver etter underernærte simler viste høy dødelighet like etter fødselen, vil imidlertid tilleggsforing kunne øke avkastningen om det er mange unge simler i flokken. Resultatene fra Røros tyder imidlertid på at dette resultat normalt kan oppnås uten ekstra omkostninger gjennom et selektivt slakteuttak.

  6. Kriminalromanen: En undersøkelse av dens popularitet og kvalitet

    OpenAIRE

    Hopland, Maria Lüpke

    2013-01-01

    De siste årene har kriminalromanen oppnådd enorm popularitet hos det norske publikum. Samtidig blir den til tider svært hardt angrepet av akademikere og intellektuelle i dagspressen. Denne oppgaven utforsker forskjellene i denne mottakelsen. To forskjellige teoretiske tilnærminger ser ut til å bli brukt i lesningen og forståelsen av kriminalromanen. Den ene forstår kriminalromanen som en type formellitteratur, som har som mål å følge sin formel på best mulig måte, mens de...

  7. Når eplet faller langt fra stammen ... : en studie av voksne utenlandsadopterte i Norge

    OpenAIRE

    Rasmussen, Mariann

    2000-01-01

    Utenlandsadopsjon er et tema som stort sett har blitt drøftet og undersøkt i forhold til foreldre og barn. Ettersom den første generasjonen av adopterte nå har blitt voksne er det verdifull kunnskap å hente ut fra deres egne erfaringer og tanker rundt det å være adoptert. Det viser seg at deres formidling av erfaringer kan være med på å sette utenlandsadopsjon i et nytt perspektiv og rette fokus mot problemstillinger som ikke har blitt gitt så mye oppmerksomhet tidligere. Jeg har vært i ...

  8. Kilgore Trout - He Tried : en tematisk analyse av Kilgore Trouts rolle i forfatterskapet til Kurt Vonnegut

    OpenAIRE

    Glomsrød, Jannicke Storm

    2007-01-01

    Hvilke roller og funksjoner innehar Kilgore Trout-karakteren i Kurt Vonneguts forfatterskap? Hvilken betydning har han og hva ligger til grunn for denne gjennomgangsfigurens ankomst og endelige avgang i litteraturen? I denne oppgaven søker jeg å undersøke og finne svaret på disse spørsmålene. Kilgore Trout går igjen i syv av Vonneguts fjorten romaner og er en gjennomgangsfigur i drøye 32 år av dennes forfatterskap, som strekker seg over 53 år med Player Piano fra 1952 i den ene enden og A ...

  9. Correlliansk Wicca -En analyse av et nyreligiøst trossamfunn i vekst-

    OpenAIRE

    Johansen, Monica Frankrig

    2015-01-01

    Correlliansk wicca er en tradisjon innenfor wicca som baserer sin praksis på læren til High- Correll familien. Den correllianske wicca- tradisjonen ble grunnlagt av Caroline High- Correll. Correllianere anser seg selv for å være åpne for mange ulike livssyn og praksiser. De tror at det guddommelige kommer innenfra oss selv, og at religion eksisterer for å hjelpe oss til å finne det guddommelige i hver av oss, og ikke for å forsøke å erstatte denne guddommeligheten. Correllianere mener at alle...

  10. Gaskromatografisk metod för analys av GHB i urin

    OpenAIRE

    2009-01-01

    En metod för detektering och kvantifiering av gamma-hydroxysmörsyra (GHB) i urin med gaskromatografi (GC) är framtagen på Sahlgrenska universitetssjukhuset. Metoden är relativt unik då den inte kräver upparbetning i form av derivatisering, indunstning eller extraktion. Urinen surgörs med koncentrerad saltsyra och internstandard, gamma-valerolakton, tillsätts. GHB övergår då till laktonformen, gamma-butyrolakton (GBL). Därefter injiceras provet direkt på en GC-FID med en kapillärkolonn för gly...

  11. Overvåking av Tokke-Vinje-vassdraget 2009-2011

    OpenAIRE

    Kaste, Ø.; Skancke, L.; Eriksen, T.; Kile, M.; Nylend, Anne

    2012-01-01

    Rapporten viser resultater fra vanndirektiv-relatert overvåking i 2009-2011 i Tokke-Vinje-vassdraget i Telemark. Omfanget av overvåkingen har variert mellom årene, men kvalitetselementene planteplankton, dyreplankton, påvekstalger og bunndyr, samt vannkjemiske og bakteriologiske støtteparametre har inngått i minst ett av årene. Målet med overvåkingen var å klassifisere tilstanden i utvalgte vannforekomster i forhold til vanndirektivets bestemmelser, samt identifisere lokaliteter hvor det er b...

  12. Implementering av NSAID-profylakse mot post-ERCP pankreatitt - et kvalitetsforbedringsprosjekt ved Gastrolab, Drammen sykehus

    OpenAIRE

    Brummenæs, Kristine Aase; Dahl, Kamilla Haug; Giske, Anna Havnevik; Hovind, Magrit Jarlsdatter; Nordberg, Eva Kibsgaard; Xalid, Mahabad

    2014-01-01

    Bakgrunn: Bakgrunn for valg av oppgave var spørsmålet om pankreatitt som komplikasjon til ERCP (endoskopisk retrograd cholangiopankreatografi) kunne forebygges svært enkelt med en engangsdose NSAID gitt i forbindelse med prosedyren. Selv om pasientgruppen som årlig gjennomgår ERCP er liten, og komplikasjoner relativ sjelden, kan noen av disse likevel bli svært alvorlig og i verste fall livstruende. Kunnskapsgrunnlaget/Metode: Det ble gjort søk i McMasterPlus, PubMed, og retningslinjer. Innfør...

  13. Kartlegging og overvåking av eremitt Osmoderma eremita i Norge 2012

    OpenAIRE

    Endrestøl, Anders; Flåten, Magne*; Hanssen, Oddvar

    2013-01-01

    Eremitten Osmoderma eremita er en stor, brunsvart bille i familien skarabider. Den lever i gamle, hule løvtrær og er vurdert som truet i store deler av Europa. I Norge ble den antatt å være utdødd inntil den ble gjenfunnet i Tønsberg i 2008. Den er listet i kategori kritisk truet (CR) i Norsk rødliste for arter 2010, og er en prioritert art (fredet) i Norge. I tillegg er den vurdert som nær truet (NT) på global rødliste. Handlingsplanen for eremitt ble publisert av Direktoratet fo...

  14. Metal detector depth estimation algorithms

    Science.gov (United States)

    Marble, Jay; McMichael, Ian

    2009-05-01

    This paper looks at depth estimation techniques using electromagnetic induction (EMI) metal detectors. Four algorithms are considered. The first utilizes a vertical gradient sensor configuration. The second is a dual frequency approach. The third makes use of dipole and quadrapole receiver configurations. The fourth looks at coils of different sizes. Each algorithm is described along with its associated sensor. Two figures of merit ultimately define algorithm/sensor performance. The first is the depth of penetration obtainable. (That is, the maximum detection depth obtainable.) This describes the performance of the method to achieve detection of deep targets. The second is the achievable statistical depth resolution. This resolution describes the precision with which depth can be estimated. In this paper depth of penetration and statistical depth resolution are qualitatively determined for each sensor/algorithm. A scientific method is used to make these assessments. A field test was conducted using 2 lanes with emplaced UXO. The first lane contains 155 shells at increasing depths from 0" to 48". The second is more realistic containing objects of varying size. The first lane is used for algorithm training purposes, while the second is used for testing. The metal detectors used in this study are the: Geonics EM61, Geophex GEM5, Minelab STMR II, and the Vallon VMV16.

  15. Indexing Depth and Retrieval Effectiveness

    Science.gov (United States)

    Seely, Barbara J.

    1972-01-01

    There are six major studies of the effect of indexing depth on retrieval performance. They differ in purpose, methodology, measures, indexing language, field of study, and data base--nevertheless, all have found depth of indexing to have the same effect upon information retrieval. (13 references) (Author/NH)

  16. Motion-Adaptive Depth Superresolution.

    Science.gov (United States)

    Kamilov, Ulugbek S; Boufounos, Petros T

    2017-04-01

    Multi-modal sensing is increasingly becoming important in a number of applications, providing new capabilities and processing challenges. In this paper, we explore the benefit of combining a low-resolution depth sensor with a high-resolution optical video sensor, in order to provide a high-resolution depth map of the scene. We propose a new formulation that is able to incorporate temporal information and exploit the motion of objects in the video to significantly improve the results over existing methods. In particular, our approach exploits the space-time redundancy in the depth and intensity using motion-adaptive low-rank regularization. We provide experiments to validate our approach and confirm that the quality of the estimated high-resolution depth is improved substantially. Our approach can be a first component in systems using vision techniques that rely on high-resolution depth information.

  17. Byte av kommunikationsstrategi när nationsobligatoriet faller : En fallstudie av hur nationerna i Uppsala bör agera om nationsobligatoriet faller

    OpenAIRE

    Rantakokko, Elin

    2008-01-01

    Abstract Title: Change of communication strategy when the compulsory nation membership falls (Byte av kommunikationsstrategi när nationsobligatoriet faller) Number of pages: 51 (58 including enclosures) Author: Elin Rantakokko Tutor: Peder Hård af Segerstad Course: Media and Communication Studies 30 hp Period: Spring of 2008 University: Division of Media and Communication, Department of Information Science, Uppsala University Purpose/Aim: This essay will result in some guidelines how the nati...

  18. Påvising og karakterisering av PGE2 reseptorar med omsyn på regulering av matriks metalloproteinasar frå osteosarkomcellelinjer

    OpenAIRE

    Oma, Hildegunn

    2007-01-01

    Enkelte kroniske inflammatoriske sjukdommar er kjent å disponere for utvikling av kreft. Ettersom fleire COX-2 hemmarar har synt kjemoterapeutisk effekt er det skapt stor interesse kring PGE2 si generelle rolle, og relevans i høve til kreft. PGE2 regulerer ei rekkje cellulære prosessar gjennom binding til fire prostaglandin E reseptorar (EP reseptorar). Matriks metalloproteinsar (MMPar) er ei gruppe enzym som er vist å vere involvert mellom anna ved tumorinvasjon, metastasering og angiogense....

  19. On evaluation of depth accuracy in consumer depth sensors

    Science.gov (United States)

    Abd Aziz, Azim Zaliha; Wei, Hong; Ferryman, James

    2015-12-01

    This paper presents an experimental study of different depth sensors. The aim is to answer the question, whether these sensors give accurate data for general depth image analysis. The study examines the depth accuracy between three popularly used depth sensors; ASUS Xtion Prolive, Kinect Xbox 360 and Kinect for Windows v2. The main attention is to study on the stability of pixels in the depth image captured at several different sensor-object distances by measuring the depth returned by the sensors within specified time intervals. The experimental results show that the fluctuation (mm) of the random selected pixels within the target area, increases with increasing distance to the sensor, especially on the Kinect for Xbox 360 and the Asus Xtion Prolive. Both of these sensors provide pixels fluctuation between 20mm and 30mm at a sensor-object distance beyond 1500mm. However, the pixel's stability of the Kinect for Windows v2 not affected much with the distance between the sensor and the object. The maximum fluctuation for all the selected pixels of Kinect for Windows v2 is approximately 5mm at sensor-object distance of between 800mm and 3000mm. Therefore, in the optimal distance, the best stability achieved.

  20. Literacy i naturfag og fysikk. Hva kreves av grunnleggende ferdigheter? [VISIONS 2011: Teaching

    Directory of Open Access Journals (Sweden)

    Bente Aamotsbakken

    2012-10-01

    Full Text Available Artikkelen drøfter læreplanens vekt på grunnleggende ferdigheter og argumenterer for at grunnleggende ferdigheter lesing og skriving kan studeres som én ferdighet: literacy. Lærerens rolle blir ansett å være avgjørende for innlæring og styrking av denne ferdigheten, også i fag som naturfag og fysikk. Funnene fra to større forskningsprosjekter finansiert av Forskningsrådet ligger til grunn for valg av to case som vi presenterer og analyserer. I prosjektene har lesing og skriving vært undersøkt, og vi har i begge prosjekt sett på sammenhengen mellom de to ferdighetene. Den er så tett at vi derfor argumenterer for én grunnleggende ferdighet: literacy. Muntlighet inntar en viktig plass i undervisningen, og i artikkelen er det særlig lærerens rolle som modellerer og mediator som knyttes til betydningen av muntlig kommunikasjon.

  1. Specialized treatment for Avoidant personality disorder (AvPD): Treatment rationales and preliminary results

    DEFF Research Database (Denmark)

    Simonsen, Sebastian

    and preliminary results from a specialized psychotherapy program developed for patients with AvPD treated at Stolpegaard Psychotherapy Centre, Capital Region of Denmark. Methods: Treatment consists of individual therapy based on Metacognitive Interpersonal Therapy (MIT) while group therapy is a modified form...

  2. In Vivo cortical tau in Parkinson's disease using 18F-AV-1451 positron emission tomography.

    Science.gov (United States)

    Hansen, Allan K; Damholdt, Malene Flensborg; Fedorova, Tatyana D; Knudsen, Karoline; Parbo, Peter; Ismail, Rola; Østergaard, Karen; Brooks, David J; Borghammer, Per

    2017-06-01

    Alzheimer's disease copathology is common in PD at autopsy. In non-PD subjects with mild cognitive impairment, tau depositions can be detected using 18F-AV-1451 PET. We hypothesized that 18F-AV-1451 PET would show tau aggregation in PD with mild cognitive impairment and correlate with cognitive dysfunction. To describe tau aggregation in PD patients. Twenty-six PD patients and 23 controls had 18F-AV-1451 PET and neuropsychological assessment to detect mild cognitive impairment. Nine PD patients (35%) were identified with mild cognitive impairment. Regional analyses showed no significant differences between groups. Voxel-wise analyses showed no correlation with cognitive domain z-scores within patients. One patient with mild cognitive impairment was estimated Braak tau stage 5; all other patients were stage 0. Our results indicate that tau pathology, as detected by 18F-AV-1451, is uncommon in PD with mild cognitive impairment and shows no significant correlation with cognitive dysfunction at this stage. © 2017 International Parkinson and Movement Disorder Society. © 2017 International Parkinson and Movement Disorder Society.

  3. ECG of the "Newborn" Mouse (Mus domesticus) with Specific Reference to Comparative AV Transmission

    NARCIS (Netherlands)

    Tweel, L.H. van der; Strackee, J.; Stokhof, A.A.; Wassenaar, C.; Meijler, F.L.

    1999-01-01

    The objective of this study was to record the ECG of the smallest living mammal to extend the domain of data for comparative AV-nodal electrophysiologic purposes. These data are needed to establish the relationship between the PR interval and heart size in mammalian species of all sizes. Methods

  4. Impact of e-AV Biology Website for Learning about Renewable Energy

    Science.gov (United States)

    Nugraini, Siti Hadiati; Choo, Koo Ah; Hin, Hew Soon; Hoon, Teoh Sian

    2013-01-01

    This paper considers the design and development of a Website for Biology in senior high schools in Indonesia. The teaching media, namely e-AV Biology, was developed with the main features of video lessons and other features in supporting the students' learning process. Some video lessons describe the production process of Biofuel or Renewable…

  5. The role of variant histone H2AV in Drosophila melanogaster larval hematopoiesis.

    Science.gov (United States)

    Grigorian, Melina; DeBruhl, Heather; Lipsick, Joseph S

    2017-04-15

    Replication-independent histone variants can replace the canonical replication-dependent histones. Vertebrates have multiple H2A variant histones, including H2AZ and H2AX that are present in most eukaryotes. H2AZ regulates transcriptional activation as well as the maintenance of gene silencing, while H2AX is important in DNA damage repair. The fruit fly Drosophila melanogaster has only one histone H2A variant (H2AV), which is a chimera of H2AZ and H2AX. In this study we found that lack of H2AV led to the formation of black melanotic masses in Drosophila third instar larvae. The formation of these masses was found in conjunction with a loss of the majority of the primary lymph gland lobes. Interestingly, the cells of the posterior signaling center were preserved in these mutants. Reduction of H2AV levels by RNAi knockdown caused a milder phenotype that preserved the lymph gland structure but that included precocious differentiation of the prohemocytes located within the medullary zone and the secondary lobes of the lymph gland. Mutant rescue experiments suggest that the H2AZ-like rather than the H2AX-like function of H2AV is primarily required for normal hematopoiesis. © 2017. Published by The Company of Biologists Ltd.

  6. Trace metals in floodplain lake sediments : SEM/AVS as indicator of bioavailability and ecological effects

    NARCIS (Netherlands)

    Griethuysen, van C.

    2006-01-01

    This thesis addresses the geochemical aspects of AVS (Acid Volatile Sulfide) and SEM (Simultaneously Extracted Metals) in floodplain lake sediment, its spatial distribution in floodplain lakes and dynamics over time, the link with effects on single species (bioassays), as well as the impact of

  7. ECG of the "Newborn" Mouse (Mus domesticus) with Specific Reference to Comparative AV Transmission

    NARCIS (Netherlands)

    Tweel, L.H. van der; Strackee, J.; Stokhof, A.A.; Wassenaar, C.; Meijler, F.L.

    1999-01-01

    The objective of this study was to record the ECG of the smallest living mammal to extend the domain of data for comparative AV-nodal electrophysiologic purposes. These data are needed to establish the relationship between the PR interval and heart size in mammalian species of all sizes. Methods and

  8. Longer Left Ventricular Electric Delay Reduces Mitral Regurgitation After Cardiac Resynchronization Therapy: Mechanistic Insights From the SMART-AV Study (SmartDelay Determined AV Optimization: A Comparison to Other AV Delay Methods Used in Cardiac Resynchronization Therapy).

    Science.gov (United States)

    Chatterjee, Neal A; Gold, Michael R; Waggoner, Alan D; Picard, Michael H; Stein, Kenneth M; Yu, Yinghong; Meyer, Timothy E; Wold, Nicholas; Ellenbogen, Kenneth A; Singh, Jagmeet P

    2016-11-01

    Mitral regurgitation (MR) is associated with worse survival in those undergoing cardiac resynchronization therapy (CRT). Left ventricular (LV) lead position in CRT may ameliorate mechanisms of MR. We examine the association between a longer LV electric delay (QLV) at the LV stimulation site and MR reduction after CRT. QLV was assessed retrospectively in 426 patients enrolled in the SMART-AV study (SmartDelay Determined AV Optimization: A Comparison to Other AV Delay Methods Used in CRT). QLV was defined as the time from QRS onset to the first large peak of the LV electrogram. Linear regression and logistic regression were used to assess the association between baseline QLV and MR reduction at 6 months (absolute change in vena contracta width and odds of ≥1 grade reduction in MR). At baseline, there was no difference in MR grade, LV dyssynchrony, or LV volumes in those with QLV above versus below the median (95 ms). After multivariable adjustment, increasing QLV was an independent predictor of MR reduction at 6 months as reflected by an increased odds of MR response (odds ratio: 1.13 [1.03-1.25]/10 ms increase QLV; P=0.02) and a decrease in vena contracta width (P<0.001). At 3 months, longer QLV (≥median) was associated with significant decrease in LV end-systolic volume (ΔLV end-systolic volume -28.2±38.9 versus -4.9±33.8 mL, P<0.001). Adjustment for 3-month ΔLV end-systolic volume attenuated the association between QLV and 6-month MR reduction. In patients undergoing CRT, longer QLV was an independent predictor of MR reduction at 6 months and associated with interval 3-month LV reverse remodeling. These findings provide a mechanistic basis for using an electric-targeting LV lead strategy at the time of CRT implant. © 2016 American Heart Association, Inc.

  9. Archetypal Depth Criticism and Melville.

    Science.gov (United States)

    Maud, Ralph

    1983-01-01

    Applies psychologist James Hillman's idea of soul-making to literary studies. Uses the works of Melville to discuss the terms (1) depth, (2) image, and (3) archetype as they relate to the concept of soul-making. (MM)

  10. Formation depths of Fraunhofer lines

    CERN Document Server

    Gurtovenko, E A

    2015-01-01

    We have summed up our investigations performed in 1970--1993. The main task of this paper is clearly to show processes of formation of spectral lines as well as their distinction by validity and by location. For 503 photospheric lines of various chemical elements in the wavelength range 300--1000 nm we list in Table the average formation depths of the line depression and the line emission for the line centre and on the half-width of the line, the average formation depths of the continuum emission as well as the effective widths of the layer of the line depression formation. Dependence of average depths of line depression formation on excitation potential, equivalent widths, and central line depth are demonstrated by iron lines.

  11. Archetypal Depth Criticism and Melville.

    Science.gov (United States)

    Maud, Ralph

    1983-01-01

    Applies psychologist James Hillman's idea of soul-making to literary studies. Uses the works of Melville to discuss the terms (1) depth, (2) image, and (3) archetype as they relate to the concept of soul-making. (MM)

  12. PHOTOMETRIC PROPERTIES FOR SELECTED ALGOL-TYPE BINARIES. IV. AV HYDRAE AND DZ CASSIOPEIAE

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Y.-G.; Dai, H.-F. [School of Physics and Electronic Information, Huaibei Normal University, 235000 Huaibei, Anhui Province (China); Li, L.-H., E-mail: yygcn@163.com [National Astronomical Observatories, Chinese Academy of Sciences, 100012 Beijing (China)

    2012-08-15

    We present BVR photometric observations and several eclipsing times for AV Hya and DZ Cas from 2004 to 2011. Using the Wilson-Devinney method, the photometric solutions with hot spots were deduced from their asymmetric light curves. The results indicate that both stars are Algol-type binaries, whose mass ratio, q{sub ph}, and fill-out factor of the primary, f{sub 1}, are q{sub ph} = 0.255({+-} 0.002) and f{sub 1} = 81.2({+-} 0.2)% for AV Hya, and q{sub ph} = 0.093({+-} 0.003) and f{sub 1} = 98.7({+-} 0.3)% for DZ Cas. Based on all available light minimum times, it is discovered that the O - C curve of each star could be described by a light-time orbit overlying on a downward parabola. Their periods and amplitudes are P{sub 3} = 37.2({+-} 0.7) yr and A = 0fd0095({+-}0fd0006) for AV Hya, and P{sub 3} = 62.5({+-} 1.0) yr and A = 0fd0183({+-}0fd0007) for DZ Cas. Cyclic variations may result from the light-time effect due to the third body. The secular period decrease rates are dP/dt = -1.47({+-} 0.04) Multiplication-Sign 10{sup -7} days yr{sup -1} for AV Hya and dP/dt = -0.92({+-} 0.04) Multiplication-Sign 10{sup -7} days yr{sup -1} for DZ Cas. This may be interpreted using mass and angular momentum loss from the system. With decreasing period, the fill-out factor of the primary increases and it may finally fill its inner Roche lobe. Therefore, AV Hya and DZ Cas with a secular period decrease will evolve from semi-detached configurations into contact ones.

  13. A Heart too Drunk to Drive; AV Block following Acute Alcohol Intoxication.

    Science.gov (United States)

    van Stigt, Arthur H; Overduin, Ruben J; Staats, Liza C; Loen, Vera; van der Heyden, Marcel A G

    2016-02-29

    Acute excessive alcohol consumption is associated with heart rhythm disorders like atrial fibrillation but also premature ventricular contractions, collectively known as the "holiday heart syndrome". More rarely but clinically significant are reports of atrioventricular (AV) conduction disturbances in binge drinkers with no underlying heart disease or chronic alcohol consumption. To obtain better insights into common denominators and the potential underlying mechanisms we collected and compared individual case reports of AV block following acute alcohol intoxication in otherwise healthy people. By screening PubMed, Google Scholar, Scopus and JSTOR, fifteen cases were found of which eight were sufficiently documented for full analysis. Blood alcohol levels ranged from 90 to 958 mg/dl (19 to 205 mM). Second and third degree AV block was observed most (6/8) albeit that in two of these patients a vagal stimulus led to deterioration from first into higher order AV block. In all cases, patients reverted to normal sinus rhythm upon becoming sober again. Mildly lowered body temperature (35.9 ± 0.5°C) was observed but can be excluded as a major cause of conduction blockade. We hypothesize that ethanol induced partial inhibition of calcium and potentially also sodium currents in conductive tissue structures may be one of the mechanisms of conduction slowing and block that may become exaggerated upon increased vagal tone. An impairment of gap junction function cannot be excluded as a contributing factor. In conclusion, cases of documented alcohol induced AV block are very rare but events can occur at relatively low serum alcohol levels which should prompt to awareness of this phenomenon in alcohol intoxicated patients.

  14. AV-1451 PET imaging of tau pathology in preclinical Alzheimer disease: Defining a summary measure.

    Science.gov (United States)

    Mishra, Shruti; Gordon, Brian A; Su, Yi; Christensen, Jon; Friedrichsen, Karl; Jackson, Kelley; Hornbeck, Russ; Balota, David A; Cairns, Nigel J; Morris, John C; Ances, Beau M; Benzinger, Tammie L S

    2017-07-26

    Utilizing [18F]-AV-1451 tau positron emission tomography (PET) as an Alzheimer disease (AD) biomarker will require identification of brain regions that are most important in detecting elevated tau pathology in preclinical AD. Here, we utilized an unsupervised learning, data-driven approach to identify brain regions whose tau PET is most informative in discriminating low and high levels of [18F]-AV-1451 binding. 84 cognitively normal participants who had undergone AV-1451 PET imaging were used in a sparse k-means clustering with resampling analysis to identify the regions most informative in dividing a cognitively normal population into high tau and low tau groups. The highest-weighted FreeSurfer regions of interest (ROIs) separating these groups were the entorhinal cortex, amygdala, lateral occipital cortex, and inferior temporal cortex, and an average SUVR in these four ROIs was used as a summary metric for AV-1451 uptake. We propose an AV-1451 SUVR cut-off of 1.25 to define high tau as described by imaging. This spatial distribution of tau PET is a more widespread pattern than that predicted by pathological staging schemes. Our data-derived metric was validated first in this cognitively normal cohort by correlating with early measures of cognitive dysfunction, and with disease progression as measured by β-amyloid PET imaging. We additionally validated this summary metric in a cohort of 13 Alzheimer disease patients, and showed that this measure correlates with cognitive dysfunction and β-amyloid PET imaging in a diseased population. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Photometric Properties for Selected Algol-type Binaries. IV. AV Hydrae and DZ Cassiopeiae

    Science.gov (United States)

    Yang, Y.-G.; Li, L.-H.; Dai, H.-F.

    2012-08-01

    We present BVR photometric observations and several eclipsing times for AV Hya and DZ Cas from 2004 to 2011. Using the Wilson-Devinney method, the photometric solutions with hot spots were deduced from their asymmetric light curves. The results indicate that both stars are Algol-type binaries, whose mass ratio, q ph, and fill-out factor of the primary, f 1, are q ph = 0.255(± 0.002) and f 1 = 81.2(± 0.2)% for AV Hya, and q ph = 0.093(± 0.003) and f 1 = 98.7(± 0.3)% for DZ Cas. Based on all available light minimum times, it is discovered that the O - C curve of each star could be described by a light-time orbit overlying on a downward parabola. Their periods and amplitudes are P 3 = 37.2(± 0.7) yr and A = 0fd0095(±0fd0006) for AV Hya, and P 3 = 62.5(± 1.0) yr and A = 0fd0183(±0fd0007) for DZ Cas. Cyclic variations may result from the light-time effect due to the third body. The secular period decrease rates are dP/dt = -1.47(± 0.04) × 10-7 days yr-1 for AV Hya and dP/dt = -0.92(± 0.04) × 10-7 days yr-1 for DZ Cas. This may be interpreted using mass and angular momentum loss from the system. With decreasing period, the fill-out factor of the primary increases and it may finally fill its inner Roche lobe. Therefore, AV Hya and DZ Cas with a secular period decrease will evolve from semi-detached configurations into contact ones.

  16. (18)F-AV-1451 binds to motor-related subcortical gray and white matter in corticobasal syndrome.

    Science.gov (United States)

    Cho, Hanna; Baek, Min Seok; Choi, Jae Yong; Lee, Seung Ha; Kim, Joong Seok; Ryu, Young Hoon; Lee, Myung Sik; Lyoo, Chul Hyoung

    2017-09-12

    To investigate tau distribution in patients with corticobasal syndrome (CBS) using (18)F-AV-1451 PET. Six consecutively recruited patients with CBS and 20 age-matched healthy controls underwent 2 PET scans with (18)F-AV-1451 (for tau) and (18)F-florbetaben (for β-amyloid). We compared standardized uptake value ratio maps of the (18)F-AV-1451 PET images between the patients with CBS and controls. Compared to controls, patients with CBS exhibited asymmetrically increased (18)F-AV-1451 binding in the putamen, globus pallidus, and thalamus contralateral to the clinically more affected side and in the ipsilateral globus pallidus and dentate nucleus. Voxel-based comparison additionally showed asymmetrically increased (18)F-AV-1451 binding in the focal regions of the precentral gray and white matter and in the midbrain, predominantly in the contralateral side. (18)F-AV-1451 binding in the precentral white matter correlated with motor severity. (18)F-AV-1451 asymmetrically binds to motor-related subcortical gray and white matter structures in patients with CBS. This pattern corresponds to tau pathology distribution in postmortem studies, and motor deficit in patients with CBS may be associated with tau accumulation predominantly in the subcortical white matter underlying the motor cortex, leading to disruptions in motor-related networks. © 2017 American Academy of Neurology.

  17. Non-physiological increase of AV conduction time in sinus disease patients programmed in AAIR-based pacing mode.

    Science.gov (United States)

    Mabo, Philippe; Cebron, Jean-Pierre; Solnon, Aude; Tassin, Aude; Graindorge, Laurence; Gras, Daniel

    2012-11-01

    The EVOCAV(DS) trial aimed to quantify the paradoxal atrioventricular (AV) conduction time lengthening in sinus node (SD) patients (pts) paced in AAIR-based pacing mode. SD pts, implanted with dual-chamber pacemaker programmed in AAIR-based pacing mode, were randomized in two arms for a 1-month period: the low atrial pacing (LAP; basic rate at 60 bpm, dual sensor with minimal slope) and the high atrial pacing (HAP; basic rate at 70 bpm, dual sensor with optimized slope, overdrive pacing) arm. At 1 month, crossover was performed for an additional 1-month period. AV conduction time, AV block occurrence and AV conduction time adaptation during exercise were ascertained from device memories at each follow-up. Seventy-nine pts participated to the analysis (75 ± 8 years; 32 male; PR = 184 ± 38 ms; bundle branch block n = 12; AF history n = 36; antiarrhythmic treatment n = 53; beta-blockers n = 27; class III/Ic n = 18; both n = 8). The mean AV conduction time was significantly greater during the HAP (275 ± 51 ms) vs. LAP (263 ± 49 ms) period (p AV blocks occurred in 49 % of pts in the HAP vs. 19 % in the LAP period (p AV conduction time during exercise. AAIR-based pacing in SD pts may induce a significant lengthening of pts' AV conduction time, including frequent abnormal adaptation of AV conduction time during exercise.

  18. Cardiac resynchronization therapy and AV optimization increase myocardial oxygen consumption, but increase cardiac function more than proportionally.

    Science.gov (United States)

    Kyriacou, Andreas; Pabari, Punam A; Mayet, Jamil; Peters, Nicholas S; Davies, D Wyn; Lim, P Boon; Lefroy, David; Hughes, Alun D; Kanagaratnam, Prapa; Francis, Darrel P; Whinnett, Zachary I

    2014-02-01

    The mechanoenergetic effects of atrioventricular delay optimization during biventricular pacing ("cardiac resynchronization therapy", CRT) are unknown. Eleven patients with heart failure and left bundle branch block (LBBB) underwent invasive measurements of left ventricular (LV) developed pressure, aortic flow velocity-time-integral (VTI) and myocardial oxygen consumption (MVO2) at 4 pacing states: biventricular pacing (with VV 0 ms) at AVD 40 ms (AV-40), AVD 120 ms (AV-120, a common nominal AV delay), at their pre-identified individualised haemodynamic optimum (AV-Opt); and intrinsic conduction (LBBB). AV-120, relative to LBBB, increased LV developed pressure by a mean of 11(SEM 2)%, p=0.001, and aortic VTI by 11(SEM 3)%, p=0.002, but also increased MVO2 by 11(SEM 5)%, p=0.04. AV-Opt further increased LV developed pressure by a mean of 2(SEM 1)%, p=0.035 and aortic VTI by 4(SEM 1)%, p=0.017. MVO2 trended further up by 7(SEM 5)%, p=0.22. Mechanoenergetics at AV-40 were no different from LBBB. The 4 states lay on a straight line for Δexternal work (ΔLV developed pressure × Δaortic VTI) against ΔMVO2, with slope 1.80, significantly >1 (p=0.02). Biventricular pacing and atrioventricular delay optimization increased external cardiac work done but also myocardial oxygen consumption. Nevertheless, the increase in cardiac work was ~80% greater than the increase in oxygen consumption, signifying an improvement in cardiac mechanoenergetics. Finally, the incremental effect of optimization on external work was approximately one-third beyond that of nominal AV pacing, along the same favourable efficiency trajectory, suggesting that AV delay dominates the biventricular pacing effect - which may therefore not be mainly "resynchronization". © 2013. Published by Elsevier Ireland Ltd. All rights reserved.

  19. Atorvastatin and fenofibrate increase apolipoprotein AV and decrease triglycerides by up-regulating peroxisome proliferator-activated receptor-α

    Science.gov (United States)

    Huang, Xian-sheng; Zhao, Shui-ping; Bai, Lin; Hu, Min; Zhao, Wang; Zhang, Qian

    2009-01-01

    Background and purpose: Combining statin and fibrate in clinical practice provides a greater reduction of triglycerides than either drug given alone, but the mechanism for this effect is poorly understood. Apolipoprotein AV (apoAV) has been implicated in triglyceride metabolism. This study was designed to investigate the effect of the combination of statin and fibrate on apoAV and the underlying mechanism(s). Experimental approach: Hypertriglyceridaemia was induced in rats by giving them 10% fructose in drinking water for 2 weeks. They were then treated with atorvastatin, fenofibrate or the two agents combined for 4 weeks, and plasma triglyceride and apoAV measured. We also tested the effects of these two agents on triglycerides and apoAV in HepG2 cells in culture. Western blot and reverse transcription polymerase chain reaction was used to measure apoAV and peroxisome proliferator-activated receptor-α (PPARα) expression. Key results: The combination of atorvastatin and fenofibrate resulted in a greater decrease in plasma triglycerides and a greater increase in plasma and hepatic apoAV than either agent given alone. Hepatic expression of the PPARα was also more extensively up-regulated in rats treated with the combination. A similar, greater increase in apoAV and a greater decrease in triglycerides were observed following treatment of HepG2 cells pre-exposed to fructose), with the combination. Adding an inhibitor of PPARα (MK886) abolished the effects of atorvastatin on HepG2 cells. Conclusions and implications: A combination of atorvastatin and fenofibrate increased apoAV and decreased triglycerides through up-regulation of PPARα. PMID:19694729

  20. Clinical feasibility of exercise-based A-V interval optimization for cardiac resynchronization: a pilot study.

    Science.gov (United States)

    Choudhuri, Indrajit; MacCarter, Dean; Shaw, Rachael; Anderson, Steve; St Cyr, John; Niazi, Imran

    2014-11-01

    One-third of eligible patients fail to respond to cardiac resynchronization therapy (CRT). Current methods to "optimize" the atrio-ventricular (A-V) interval are performed at rest, which may limit its efficacy during daily activities. We hypothesized that low-intensity cardiopulmonary exercise testing (CPX) could identify the most favorable physiologic combination of specific gas exchange parameters reflecting pulmonary blood flow or cardiac output, stroke volume, and left atrial pressure to guide determination of the optimal A-V interval. We assessed relative feasibility of determining the optimal A-V interval by three methods in 17 patients who underwent optimization of CRT: (1) resting echocardiographic optimization (the Ritter method), (2) resting electrical optimization (intrinsic A-V interval and QRS duration), and (3) during low-intensity, steady-state CPX. Five sequential, incremental A-V intervals were programmed in each method. Assessment of cardiopulmonary stability and potential influence on the CPX-based method were assessed. CPX and determination of a physiological optimal A-V interval was successfully completed in 94.1% of patients, slightly higher than the resting echo-based approach (88.2%). There was a wide variation in the optimal A-V delay determined by each method. There was no observed cardiopulmonary instability or impact of the implant procedure that affected determination of the CPX-based optimized A-V interval. Determining optimized A-V intervals by CPX is feasible. Proposed mechanisms explaining this finding and long-term impact require further study. ©2014 Wiley Periodicals, Inc.

  1. Gjenåpningen av Veumbekken fra kulvert til åpen kanal : hydraulisk analyse og modellering i SWMM

    OpenAIRE

    2016-01-01

    Klimaendringene medfører at vi får et stadig varmere og mer ekstremt klima. De siste årene har det vært en økning i både temperatur, nedbørsmengder og nedbørintensitet i Norge, og denne trenden vil fortsette dersom man ikke klarer å redusere utslipp av klimagasser. For håndtering av overvann byr dette på store problemer da overvannsystemene ikke er dimensjonert for å takle den økende avrenningen forårsaket av kraftigere regnbyger, urbanisering og fortetting. Veumbekken renner igjennom Veum...

  2. Å finne en å elske : En kvalitativ studie av TV-serien Jakten på kjærligheten

    OpenAIRE

    Normandbo, Siw Lindtjerndal

    2010-01-01

    Denne oppgaven handler om tosomhetens innledende faser, et valg av partner. Prosjektet gjennomfører en kvalitativ studie av realityserien "Jakten på kjærligheten" (JPK) som et uttrykk for hvordan et konkret partnervalg kan utspilles i vår moderne tid. Serien er en av TV2s største seersuksesser noensinne og gir enkelt sagt fire bønder mulighet til å lete etter en kjæreste blant et utvalg interesserte friere. I denne oppgaven har jeg valgt å rette søkelyset mot en gruppe mennesker som ...

  3. Transnasjonale helsepraksiser. Bruk av helsetjenester blant polske arbeidsinnvandrere i Norge

    Directory of Open Access Journals (Sweden)

    Jakub Stachowski

    2017-02-01

    The article discusses the use of health-care services among Polish labor migrants in Norway. We apply theories of patient–physician relationship, trust, and transnationalism to analyze a material of qualitative in-depth interviews with eleven Polish labor migrants about their health practices. The material demonstrates how and why many Polish labor migrants evaluate Norwegian primary health care negatively. Their main reason for doing so is the non-paternalistic doctor–patient relationship. They therefore supplement Norwegian health services with health services available in their home country. However, the labor migrants tend to evaluate the Norwegian health system more favorably as time passes. In total, the Poles establish creative, reflexive, competent, and dynamic health practices that go beyond national state borders and combine elements of two health-care systems. We argue that these practices enable migrants to enhance the total quality of their health care.

  4. Anterior chamber depth during hemodialysis

    Directory of Open Access Journals (Sweden)

    Gracitelli CPB

    2013-08-01

    Full Text Available Carolina Pelegrini Barbosa Gracitelli,1 Francisco Rosa Stefanini,1 Fernando Penha,1 Miguel Ângelo Góes,2 Sérgio Antonio Draibe,2 Maria Eugênia Canziani,2 Augusto Paranhos Junior1 1Ophthalmology Department, 2Division of Nephrology, Federal University of São Paulo – UNIFESP, São Paulo, Brazil Background: Exacerbation of chronic glaucoma or acute glaucoma is occasionally observed in patients undergoing hemodialysis (HD because of anterior chamber depth changes during this therapy. Purpose: To evaluate anterior chamber depth and axial length in patients during HD sessions. Methods: A total of 67 eyes of 35 patients were prospectively enrolled. Axial length and anterior chamber depth were measured using ultrasonic biometry, and these measures were evaluated at three different times during HD sessions. Body weight and blood pressure pre- and post-HD were also measured. Results: There was no difference in the axial length between the three measurements (P = 0.241. We observed a significantly decreased anterior chamber depth (P = 0.002 during HD sessions. Conclusion: Our results support the idea that there is a change in anterior chamber depth in HD sessions. Keywords: anterior chamber, hemodialysis, axial length, acute angle-closure glaucoma

  5. Vad var det som hände? Efterbearbetning av en simulering för utvecklande av professionell kunskap hos polisstudenter

    Directory of Open Access Journals (Sweden)

    David Sjöberg

    2014-11-01

    Full Text Available Att öva för att lära sig att hantera polisiära situationer utgör ett viktigt inslag i polisstudenters utbildning. Lärandet sker genom praktiska övningar t.ex. drillövningar och övningar av specifika moment men även via simuleringar där studenter agerar som polis i mera komplexa situationer. Simuleringar är inte unika för polisutbildning utan utgör ett vanligt inslag i professionsutbildning genom sin koppling till "verkliga" situationer (Peters och Vissers, 2004; Lederman, 1984. Under de senaste årtiondena har simuleringar använts för utbildning inom så skilda professionsfält som medicin och hälsovård, flyg och blåljusverksamhet. Simuleringar kan vara av skiftande karaktär t.ex. fysiska i form av rollspel men även datorbaserade. Simuleringar kan syfta till att utveckla en specifik färdighet (se t.ex. Windsor, 2009; Stefanidis, Acker, och Heniford, 2008; Wallin, Meurling, Hedman, Hedengård, och Felländer-Tsai, 2007, som t ex att lära sig hur man avläser röntgenbilder (se t.ex. Söderström, Häll, Nilsson, och Ahlqvist 2012 eller till att lära hur man ska agera i komplexa situationer (Andersson, Carlström, och Berlin, 2013; Bauman, Gohm och Bonner, 2011, t.ex. vid svåra olyckshändelser med många personer inblandade (se t.ex. McConnell och Drennan, 2006. Simuleringar av komplexa situationer med många inblandade brukar benämnas som fullskaliga (se t.ex. Andersson, Carlström, och Berlin, 2013. Simuleringar antas träna och utveckla professionell kunskap genom att förbereda studenter på att hantera komplexa och ibland farliga situationer som de kan komma att ställas inför i en kommande yrkespraktik. Användningen av simuleringar i utbildningar bygger således på ett antagande om överföring av erfarenheter och kunskaper från ett sammanhang till ett annat (se t.ex. Söderström, Åström, Anderson och Bowles, 2014. I den här artikeln utgår vi från simulering som en utbildningsresurs där deltagarna

  6. Sociala mediers roll i formandet av kroppsuppfattningen och förekomsten av ätstörningar bland flickor och unga kvinnor : En systematisk litteraturstudie

    OpenAIRE

    Reuter, Fanny

    2016-01-01

    Detta examensarbete inkluderas i ett forskningsprojekt inom e-hälsa vid Yrkeshögskolan Arcada. Tidigare forskning har visat att traditionell media och bilder på idealiserade kroppar kan kopplas till negativ kroppsuppfattning. Syftet med examensarbetet är att genom en systematisk litteraturstudie kartlägga forskning som fokuserar på sociala mediers påverkan på flickor och unga kvinnors kroppsuppfattning och förekomsten av ätstörningar. Examensarbetet är avgränsat till västerländska flickor och...

  7. Definiering av nyckeltal på Saab Aerostructures : Mätning av logistisk effektivitet i materialförsörjningen

    OpenAIRE

    Säberg, Mikael; Stjärnesund, Carl

    2008-01-01

    Examensarbetet har utförts på Saab Aerostructures och avdelningen Logistik på Institutionen för industriell och ekonomisk utveckling vid Linköpings universitet. Saab Aerostructures arbetar med utveckling, industrialisering och tillverkning av flygande strukturer, vilket innebär bland annat helikopterkabiner till NH90, vingbalkar till Airbus A380, dörrar till Boeing 787 Dreamliner och kompletta skrov till JAS 39 Gripen. Traditionellt har fokus legat på att ha en störningsfri produktion, men fö...

  8. EXCHANGE OF BALDE OF AV90-15 AXIAL FLOW FAN%AV90-15轴流风机叶片更换

    Institute of Scientific and Technical Information of China (English)

    艾中华

    2013-01-01

    高炉鼓风机作为高炉的供风设备,一旦出现故障直接影响高炉的生产.详细介绍了瑞士曼公司AV90-15轴流风机叶片现场更换、组装,机组机械性能测试过程的技术要领,为今后同类型机组的检修提供了参考.

  9. Sampling Depths, Depth Shifts, and Depth Resolutions for Bi(n)(+) Ion Analysis in Argon Gas Cluster Depth Profiles.

    Science.gov (United States)

    Havelund, R; Seah, M P; Gilmore, I S

    2016-03-10

    Gas cluster sputter depth profiling is increasingly used for the spatially resolved chemical analysis and imaging of organic materials. Here, a study is reported of the sampling depth in secondary ion mass spectrometry depth profiling. It is shown that effects of the sampling depth leads to apparent shifts in depth profiles of Irganox 3114 delta layers in Irganox 1010 sputtered, in the dual beam mode, using 5 keV Ar₂₀₀₀⁺ ions and analyzed with Bi(q+), Bi₃(q+) and Bi₅(q+) ions (q = 1 or 2) with energies between 13 and 50 keV. The profiles show sharp delta layers, broadened from their intrinsic 1 nm thickness to full widths at half-maxima (fwhm's) of 8-12 nm. For different secondary ions, the centroids of the measured delta layers are shifted deeper or shallower by up to 3 nm from the position measured for the large, 564.36 Da (C₃₃H₄₆N₃O₅⁻) characteristic ion for Irganox 3114 used to define a reference position. The shifts are linear with the Bi(n)(q+) beam energy and are greatest for Bi₃(q+), slightly less for Bi₅(q+) with its wider or less deep craters, and significantly less for Bi(q+) where the sputtering yield is very low and the primary ion penetrates more deeply. The shifts increase the fwhm’s of the delta layers in a manner consistent with a linearly falling generation and escape depth distribution function (GEDDF) for the emitted secondary ions, relevant for a paraboloid shaped crater. The total depth of this GEDDF is 3.7 times the delta layer shifts. The greatest effect is for the peaks with the greatest shifts, i.e. Bi₃(q+) at the highest energy, and for the smaller fragments. It is recommended that low energies be used for the analysis beam and that carefully selected, large, secondary ion fragments are used for measuring depth distributions, or that the analysis be made in the single beam mode using the sputtering Ar cluster ions also for analysis.

  10. CORBA A/V Streams服务的实现及其在远程教育中的应用%Implementation of CORBA A/V Streams Specification and its Application in Remote Education System

    Institute of Scientific and Technical Information of China (English)

    黎富刚; 沈卓炜; 冯名正; 杨鹏

    2003-01-01

    文章详细介绍了CORBA A/V Streams规范,提出了基于ORBUS系统和RSVP资源预留的实现模型,并依据该模型实现了CORBA A/V Streams原型系统.利用该原型系统,设计并实现了一个实用的远程教育系统.

  11. "... because I'm Batman" : En undersökning av maskulinitet i Frank Millers Batman: The Dark Knight Returns

    OpenAIRE

    Nilsson, Kristina

    2015-01-01

    I detta arbete kommer jag att undersöka hur maskulinitet gestaltas i Frank Millers Batman: The Dark Knight Returns. Det jag vill fokusera på är de olika maskulina drag som går att urskilja i serien. Warner Bros. Animation gav 2012 ut den första delen av en animerad filmatisering av Millers Batman-serie, som senare följdes av den andra och avslutande delen 2013. I min undersökning kommer jag även att ta hjälp av de båda animeringarna för att se på vilka sätt maskuliniteten gestaltas hos de oli...

  12. Studier av radioaktivt cesium i svenska renar. Oversikt over pågående undersokningar 1986

    Directory of Open Access Journals (Sweden)

    Gustaf Åhman

    1986-06-01

    Full Text Available I samband med den forskning och forsöksverksamhet som bedrivits vid renforsöksavdelningen har vi arbetat med metodik och teknik som kan tillämpas vid studier av radioaktivt cesium i renbetesväxter och i renar. På betessidan har vi bl.a. arbetat med kontaminering av tungmetaller från gruvindustrin och nitrat efter kvävegödsling. Omfattande studier har utförts av renens mineralstatus och mineralämnesomsättning. Erfarenheter och kunskaper från dessa områden har utnyttjats for planering och genomförande av de studier som nu pågår beträffande radioaktivt cesium i renbetesväxter och renar.

  13. Konstruktion av interaktiv mobil underhållningsplattform - med animerad lyskub, Klannlänksframdrivning och Twitterstyrning

    OpenAIRE

    Bülow, Sebastian; Larsson, Thomas; Lourdodoss, Ilango; Nydahl, Oskar; Zaimovic, Nedim

    2013-01-01

    Kursen ”Fördjupningsarbete i Mekatronik” är indelad tre delar. Under den första delen av kursen bekantade samtliga medlemmar sig med mikroprocessorn AVR ATmega16 genom att utföra tillgängliga laborationsuppgifter. Den andra delen bestod av en individuell specialisering där en fördjupning inom ett visst område utfördes. Del tre, som denna rapport behandlar, utgörs av ett grupparbete där gruppens medlemmar har valts ut utefter valda områden i del två av kursen. På så sätt skall gruppens medlemm...

  14. En socialpsykologisk analys av samkönat partnervåld ur ett makt- och normativitetsperspektiv

    OpenAIRE

    von Braun, Thérèse

    2009-01-01

    Uppsatsens syfte var att nå en större teoretisk förståelse av samkönat partnervåld, genom att analysera olika forskningsartiklars narrativa konstruktioner av våldet. De två frågeställningarna var: 1. Hur diskuterar forskningslitteraturen samkönat partnervåld med fokus på temana relationsdynamik, karaktär hos parterna, kön, genus och sexualitet samt betydelsen av social kontext? 2. Hur diskuterar forskningslitteraturen det professionella bemötandet av samkönat partnervåld? De 21 valda primärdo...

  15. Depth estimation via stage classification

    NARCIS (Netherlands)

    Nedović, V.; Smeulders, A.W.M.; Redert, A.; Geusebroek, J.M.

    2008-01-01

    We identify scene categorization as the first step towards efficient and robust depth estimation from single images. Categorizing the scene into one of the geometric classes greatly reduces the possibilities in subsequent phases. To that end, we introduce 15 typical 3D scene geometries, called

  16. A variable depth search branching

    OpenAIRE

    Cornillier, Fabien; Pécora, José Eduardo; Charles, Vincent

    2017-01-01

    We introduce a variable depth search branching, an extension to the local branching for solving Mixed-Integer Programs. Two strategies are assessed, a best improvement strategy and a first improvement strategy. The extensive computational assessment evidences a significant improvement over the local branching for both strategies. This record was migrated from the OpenDepot repository service in June, 2017 before shutting down.

  17. Apolipoprotein AV Accelerates Plasma Hydrolysis OfTriglyceride-Rich Lipoproteins By Interaction With Proteoglycan BoundLipoprotein Lipase

    Energy Technology Data Exchange (ETDEWEB)

    Merkel, Martin; Loeffler, Britta; Kluger, Malte; Fabig, Nathalie; Geppert, Gesa; Pennacchio, Len A.; Laatsch, Alexander; Heeren, Joerg

    2005-02-22

    Apolipoprotein A5 (APOA5) is associated with differences intriglyceride levels and familial combined hyperlipidemia. In genetically engineered mice, apoAV plasma levels are inversely correlated with plasmatriglycerides. To elucidate the mechanism by which apoAV influences plasma triglycerides, metabolic studies and in vitro assays resembling physiological conditions were performed. In hAPOA5 transgenic mice(hAPOA5tr), catabolism of chylomicrons and VLDL was accelerated due to a faster plasma hydrolysis of triglycerides by lipoprotein lipase (LPL).Hepatic VLDL and intestinal chylomicron production were not affected. The functional interplay between apoAV and LPL was further investigated by crossbreeding a human LPL transgene with the apoa5 knockout, and the hAPOA5tr to an LPL deficient background. Increased LPL activity completely normalized hypertriglyceridemia of apoa5 deficient mice,however, over expression of human apoAV modulated triglyceride levels only slightly when LPL was reduced. To reflect the physiological situation in which LPL is bound to cell surface proteoglycans, we examined hydrolysis in the presence or absence of proteoglycans. Without proteoglycans, apoAV derived either from triglyceride-rich lipoproteins, hAPOA5tr HDL, or a recombinant source did not alter the LPL hydrolysis rate. In the presence of proteoglycans, however, apoAV led to a significant and dose-dependent increase in LPL mediated hydrolysis of VLDL triglycerides. These results were confirmed in cell culture using a proteoglycan-deficient cell line.A direct interaction between LPL and apoAV was found by ligand blotting.It is proposed, that apoAV reduces triglyceride levels by guiding VLDL and chylomicrons to proteoglycans bound LPL for lipolysis.

  18. Molecular characterization of LvAV in response to white spot syndrome virus infection in the Pacific white shrimp (Litopenaeus vannamei).

    Science.gov (United States)

    He, Shulin; Song, Lei; Qian, Zhaoying; Hou, Fujun; Liu, Yongjie; Wang, Xianzong; Peng, Zhangming; Sun, Chengbo; Liu, Xiaolin

    2015-07-01

    Litopenaeus vannamei is the most important farmed shrimp species globally, but its production is affected by several factors, including infectious disease. White spot syndrome virus (WSSV), in particular, causes significant shrimp losses. To understand the shrimp's immune response against WSSV, we cloned LvAV from L. vannamei and analyzed its expression pattern in different tissues, in addition to its expression following infection. We employed dsRNA and recombinant (r)LvAV to explore the potential role of LvAV in shrimp immunity when infected with WSSV. We find that LvAV is a C-type Lectin composed of 176 amino acids with a signal peptide and a specific C-type Lectin-type domain (CTLD). It shares 81% amino acid similarity with PmAV, an antiviral-like C-type Lectin from Penaeus monodom, and it is highly expressed in the hepatopancreas. Its expression is affected by infection with both WSSV and V. parahaemolyticus. Significantly, injection with rLvAV slowed WSSV replication, while injection with LvAV dsRNA initially led to enhanced virus propagation. Surprisingly, LvAV dsRNA subsequently led to a dramatic decrease in viral load in the later stages of infection, suggesting that LvAV may be subverted by WSSV to enhance viral replication or immune avoidance. Our results indicate that LvAV plays an important, but potentially complex role in the Pacific white shrimp's immune defense.

  19. Modellering och kundprocessanalys av kösystem på Vapiano Sturegatan

    OpenAIRE

    Ahlklo, Karin; Lind, Carin

    2016-01-01

    I denna rapport har kösystemet på Vapiano Sturegatan undersökts och analyserats. Restaurangen har problem med långa köer under lunchtid och syftet med denna rapport är att ge förslag på hur man skulle kunna minska dessa. De befintliga kösystemet ha modellerats med hjälp av markovsk köteori och approximerats till ett M/M/2-system samt ett M/M/8-system,varavM/M/2-systemet bedömdes vara mest tillförlitligt. Beräkningar av den förväntade tiden i systemet för olika fall ledde till slutsatsen att d...

  20. The Last Expedition of the Siberian A.V. Adrianov (Tuva, 1915–1916

    Directory of Open Access Journals (Sweden)

    Olga B. Belikova

    2014-12-01

    Full Text Available The article presents the results of the examination of archaeological activity of Siberian public figure and scientist A.V. Adrianov (1854–1920 in his last expedition. It took place in the upstream basin of the Yenisei River – in Tuva (Uryankhaysky Kray / Tannu Uryankhay in 1915–1916. The archaeologist could not summarize and publish the results of his successful field research – he died in 1920 due to the unjustified sentence of the Bolsheviks. The expedition prehistory, the content of the archaeological excavations and exploration, the history of the materials deposition to the storage, scientist's last years have been restored. The information, concerning 23 ancient Old Turkic manuscripts, examined by A.V. Adrianov has been identified and summarized. The data on new sources have been introduced into scientific use.