Choledocholitiasis. Endoskopisk behandling af 416 konsekutive patienter
DEFF Research Database (Denmark)
Pedersen, F M; Brandt, C J; Schaffalitzky de Muckadell, O B
1998-01-01
patients who underwent ERC for common bile duct stones between January 1990 and January 1995. The overall success rate of achieving a common bile duct free of stones was 89.0%, and in 94.7% of the patients endoscopic treatment was definitive. The overall complication rate was 9.6% and the 30-day mortality...
Laparoskopi af 100 konsekutive patienter med 128 ikkepalpable testes
DEFF Research Database (Denmark)
Cortes, D; Thorup, J M; Lenz, K
1996-01-01
. No intratubular germ cell neoplasia (carcinoma in situ) was proved. Germ cell hypoplasia or aplasia was demonstrated in 95% of cases with testicular parenchyma. We recommend laparoscopy as a safe procedure which leads to a diagnosis in patients with impalpable testes; the advent of laparoscopic procedure makes...... definitive treatment possible in about 50% of such cases....
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Default. 110.110 Section 110.110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Hearings § 110.110 Default. When a participant fails to act within a specified time, the presiding officer may consider him in default, issue an...
International Nuclear Information System (INIS)
Colin, Philippe; Jovenin, Nicolas; Delemer, Brigitte; Caron, Jean; Grulet, Herve; Hecart, Annie-Claude; Lukas, Celine; Bazin, Arnaud; Bernard, Mary-Helene; Scherpereel, Bernard; Peruzzi, Philippe; Nakib, Iab; Redon, Charles; Rousseaux, Pascal
2005-01-01
Purpose: To optimize and reduce the toxicity of pituitary adenoma irradiation by assessing the feasibility and effectiveness of fractionated stereotactic radiotherapy (FSR). Methods and Materials: Between 1990 and 1999, 110 consecutive patients, 47 with a functioning adenoma, were treated according to a strategy of either early surgery and FSR (n = 89) or FSR only (n = 21). Of the 110 patients, 75 had persistent macroscopic tumor and 47 persistent hormonal secretions; 15 were treated in the prophylactic setting. The linear accelerator-delivered dose was 50.4 Gy (5 x 1.8 Gy weekly), with a 2-mm safety margin. Results: After a minimal follow-up of 48 months, only 1 patient had developed progression. Of the 110 patients, 27 (36%) had a complete tumor response, 67 (89.3%) had an objective tumor response, 20 (42%) had a hormonal complete response, and 47 (100%) had a hormonal objective tumor response. The proportion of patients without a complete tumor response, objective tumor response, complete hormonal response, and objective hormonal response was 85.1%, 62%, 83%, and 59.3% at 4 years and 49.3%, 9%, 59.3%, and 10.6% at 8 years, respectively. The sole unfavorable predictive factor was preoperative SSE >20 mm for tumor response (p = 0.01) and growth hormone adenoma for the hormonal response (p <0.001). No late complications, except for pituitary deficiency, were reported, with a probability of requiring hormonal replacement of 28.5% and 35% at 4 and 8 years, respectively. Nonfunctioning status was the sole unfavorable factor (p = 0.0016). Conclusions: Surgery plus FSR is safe and effective. FSR focused to the target volume seems more suitable than standard radiotherapy, and standard fractionation reduces the risk of optic neuropathy sometimes observed after single-dose radiosurgery. Therefore, FSR allows us to consider combined transrhinoseptal surgery and early radiotherapy, with a curative goal without patient selection
International Nuclear Information System (INIS)
Krakow, D.
1983-01-01
The CT scans were done in 110 patients for examination of the liquor carrying cerebral brain compartments, especially the cisterns, after intrathecal application of the radiopaque medium metrizamide. The properties of the medium are explained in detail. (orig./MG) [de
International Nuclear Information System (INIS)
Morawek, W.
1991-07-01
In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de
49 CFR 110.110 - After-grant requirements.
2010-10-01
... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...
The PEP-3-KLH (CDX-110) vaccine in glioblastoma multiforme patients
Heimberger, Amy B.; Sampson, John H
2009-01-01
Conventional therapies for glioblastoma multiforme (GBM) fail to target tumor cells exclusively resulting in non-specific toxicity. Immune targeting of tumor-specific mutations may allow for more precise eradication of neoplastic cells. The epidermal growth factor receptor variant III (EGFRvIII) is a tumor-specific mutation that is widely expressed on GBM and other neoplasms and its expression enhances tumorigenicity. This in-frame deletion mutation splits a codon resulting in a novel glycine at the fusion junction producing a tumor-specific epitope target for cellular or humoral immunotherapy. We have previously shown that vaccination with a peptide that spans the EGFRvIII fusion junction (PEPvIII-KLH/CDX-110) is an efficacious immunotherapy in syngeneic murine models. In this review, we summarize our results in GBM patients targeting this mutation in multiple, multi-institutional Phase II immunotherapy trials. These trials demonstrated that a selected population of GBM patients who received the vaccines targeting EGFRvIII had an unexpectedly long survival time. Further therapeutic strategies and potential pitfalls using this approach are discussed. PMID:19591631
International Nuclear Information System (INIS)
Kusakabe, Kiyoko; Yokoyama, Kunihiko; Ito, Koichi
2012-01-01
This study was undertaken to measure the radiation exposure level of caregivers following outpatient NaI (I-131) 1,110 MBq therapy for remnant thyroid ablation after total thyroidectomy in patients with differentiated thyroid cancer, and to evaluate the influence of activities of daily living on radiation exposure level, with the goal of proposing an optimum method of I-131 therapy. The study included 37 patients with differentiated thyroid cancer, who had undergone total thyroidectomy and received outpatient based remnant thyroid ablation using NaI (I-131) 1,110 MBq, who were satisfying the following requirements: patients who have no evidence of distant metastases, whose living environments were appropriate for outpatient I-131 (1,110 MBq) therapy, and patients who gave written informed consent. The dose rate at a distance of 1 m from the body surface of the patient at the moment of release was measured using survey meters of the GM type or ionization chamber type. The dose level for the caregiver was measured with a personal dosimeter in all cases. The dose rate at a distance of 1 m from the patient's body surface 1 h after I-131 administration was in the range of 29-115 μSv/h (mean 63.8 μSv/h). The 7-day cumulative effective dose of caregivers was 0.11±0.08 mSv, on an average, in 34 dosimeters. In 31 of 34 dosimeters, cumulative effective dose of caregivers was below 0.2 mSv. Dose levels exceeding 0.2 mSv were recorded in 3 cases (0.21, 0.35 and 0.43 mSv in one case each). These results suggest that the exposure level of family members (caregiver and others) was minimal and is lower than the radiation levels affecting human environments. Outpatient-based remnant thyroid ablation with I-131 (1,110 MBq) performed after total thyroidectomy in patients with differentiated thyroid cancer is safe if applied in accordance with the appropriate supervision and guidance by experts with certain qualifications. (author)
Soto, M E; Espinola, N; Flores-Suarez, L F; Reyes, P A
2008-01-01
Takayasu Arteritis (TA) is a rare disease that mainly affects large elastic arteries. It is more frequently seen in Asia, the Mediterranean basin, South Africa and Latin America. We have characterized its clinical manifestations and identified the cardiovascular mortality predictors in a cohort of 110 Mexican Mestizo patients. Retrospective review of 110 charts of TA patients complying with the American College of Rheumatology (ACR) criteria, seen in a single hospital between 1976 and 2003. Demographic, clinical, and radiological characteristics were described. With the use of actuarial table analysis at 2, 5, and 10 years, and Kaplan Meier methods applying t function for probability, plus Cox regression analysis, the following factors were identified as mortality predictors: systemic arterial hypertension, coronary heart disease and aortic valve regurgitation. Informed consent and approval from the institutional Internal Review Board (IRB) were obtained. We observed a slowly progressive widespread obstructive arterial disease with cardiovascular (48%), neuro-ophthalmic (36%), and skin morbidity (13%). Systemic hypertension and heart disease were significant mortality predictors. Twenty-six percent of cases died due to myocardial infarction, chronic renal failure, stroke, or surgical complications. TA in Mexican Mestizos shows a clinical pattern similar to the one recognized in the Far East. Management strategies must be directed at reducing the identified mortality risk factors.
Sup(110)Sn/110In - a new generator system for positron emission tomography
International Nuclear Information System (INIS)
Lundqvist, H.; Einarsson, L.; Malmborg, P.; Scott-Robson, S.
1991-01-01
A generator system, 110 Sn/ 110 In, is suggested for use in the labelling of leukocytes with this short-lived (t 1/2 = 1.15 h) positron emitting (62%) isotope of indium. The half-life gives the labelled leukocytes time to be adequately distributed but is short enough to allow repeated studies within a few hours. The mother radionuclide 110 Sn (t 1/2 = 4.15 h) is produced by the reaction nat In(p, xn) 110 Sn which has a maximum cross-section of 110 mb at approx. 70 MeV and a practical yield of 400 MBq/μAh. (author)
7 CFR 917.110 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 917.110 Section 917.110 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Rules and Regulations General § 917.110 Communications. Unless otherwise prescribed in this...
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Pilots. 230.110 Section 230.110 Transportation... and Equalizing System § 230.110 Pilots. (a) General provisions. Pilots shall be securely attached... clearance. The minimum clearance of pilot above the rail shall be 3 inches and the maximum clearance shall...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk. 131.110 Section 131.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.110 Milk. (a...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Roads. 1710.110 Section 1710.110... (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.110 Roads. (a) Access to the subdivision. (1) Is access to the subdivision provided by public or private roads? What...
Bendriss, L; Khatouri, A
2012-08-01
The ischemic cerebrovascular accidents (I CVA) correspond to a pathology widely dominated by atherosclerosis and embolic cardiopathies. Our work aimed to determine the frequency of the cardiovascular diseases among the patients who were previously victims of an I CVA and the interest of the cardiovascular assessment in the etiologic inquest. We led a retrospective study in the cardiology service of the Avicenne military hospital of Marrakech about 110 cases of I CVA between January 2005 and August 2008. The electrocardiogram (ECG), Holter ECG, transthoracic echocardiography and Doppler echography of the cervical vessels were systematically made for all the patients. The transesophageal echocardiography was practice in a few patients. The average age of the patients was 60.8 years old (±12.14) with a male predominance (72%). Ninety-one percent of the patients presented at least one cardiovascular risk factor: hypertension (66.45%), diabetes (41.8%), smoking (35.45%). Cardiovascular antecedents were noted among 18.2% of the patients, the continuous atrial fibrillation comes first (9%). A carotid atheromatous excess was noted in 74 cases of which 24 with a significant plaque. The transesophageal echocardiography made to 13 patients showed a spontaneous echo contrast with a left atrial thrombus in four cases and a left atrial myxoma in one patient. Penetrating artery disease occupies 39%, large artery atherosclerosis 28% and cardiogenic stroke 18%. The cardiovascular assessment is indispensable, and the echocardiography is more interesting in presence of cardiopathy. Its therapeutic repercussion is modest. Copyright © 2012. Published by Elsevier SAS.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the Social Security Act must provide: (a) That the State agency will establish and maintain: (1) Methods and...
International Nuclear Information System (INIS)
Khan, P.; Ahmad, A.; Ahmad, B.; Khan, T.M.
2009-01-01
Cirrhosis liver is amongst the commonest clinical conditions in Pakistan. Besides other causes, it is mostly related to previous viral infection, in this part of the world. The main objective of this study was to find the frequency of HBsAg and anti HCV in cirrhotic patients of Swat district. This Prospective Study was conducted in the Medical unit of Saidu Teaching Hospital, Saidu Sharif from January 2006 to December 2006. One hundred and ten Cirrhotic Patients, 62 Male and 48 Female aged from 14 to 75 years were included in this study. Sera were tested by third generation Elisa method. Fifty-nine out of 110 (53.6%) patients were positive for anti HCV antibodies. Twenty-four (21.81%) Patients were positive for HBsAg. Eleven (10%) patients were positive for both HBsAg and anti HCV anti bodies. Sixteen (14.54%) were negative for both sero maker of hepatitis B and C. It is evident from this study that Hepatitis C, is a leading cause of cirrhosis in District Swat followed by HBV. Both the viruses account for at least three fourths of the total Cirrhotic. (Author)
32 CFR 865.110 - Decision process.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Decision process. 865.110 Section 865.110...-GENERAL PERSONNEL REVIEW BOARDS Air Force Discharge Review Board § 865.110 Decision process. (a) The DRB... decision making process. ...
5 CFR 950.110 - Prohibited discrimination.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Prohibited discrimination. 950.110 Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.110 Prohibited discrimination. Discrimination for...
42 CFR 494.110 - Condition: Quality assessment and performance improvement.
2010-10-01
... facility must maintain and demonstrate evidence of its quality improvement and performance improvement... RENAL DISEASE FACILITIES Patient Care § 494.110 Condition: Quality assessment and performance improvement. The dialysis facility must develop, implement, maintain, and evaluate an effective, data-driven...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv
46 CFR 403.110 - Accounting entities.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting entities. 403.110 Section 403.110 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.110 Accounting entities. Each Association shall be a separate accounting...
41 CFR 115-1.110 - Deviations.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...
1 CFR 500.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 500.110 Section 500.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.110 Self-evaluation... or organizations representing handicapped persons, to participate in the self-evaluation process by...
1 CFR 457.110 - Self-evaluation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 457.110 Section 457.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.110 Self-evaluation. (a... organizations representing handicapped persons, to participate in the self-evaluation process by submitting...
49 CFR 28.110 - Self-evaluation.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Self-evaluation. 28.110 Section 28.110 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.110 Self-evaluation...
7 CFR 922.110 - Container exemption.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Container exemption. 922.110 Section 922.110... COUNTIES IN WASHINGTON Container Exemption; Waivers of Inspection and Certification § 922.110 Container exemption. Whenever container limitations are effective pursuant to § 922.52, a handler may make test...
34 CFR 300.110 - Program options.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviation. 105-1.110 Section 105-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.110 Deviation. (a...
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Deviation. 101-1.110 Section 101-1.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.110 Deviation...
42 CFR 136.110 - Facilities construction.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Facilities construction. 136.110 Section 136.110..., DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH Grants for Development, Construction, and Operation of Facilities and Services § 136.110 Facilities construction. In addition to other requirements of this subpart...
11 CFR 110.17 - Price index increase.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Price index increase. 110.17 Section 110.17... PROHIBITIONS § 110.17 Price index increase. (a) Price index increases for party committee expenditure... 11 CFR 109.32 and 110.8 shall be increased by the percent difference between the price index, as...
34 CFR 1200.110 - Self-evaluation.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Self-evaluation. 1200.110 Section 1200.110 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL COUNCIL ON DISABILITY... COUNCIL ON DISABILITY § 1200.110 Self-evaluation. (a) The agency shall, by November 28, 1994, evaluate its...
49 CFR 807.110 - Self-evaluation.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Self-evaluation. 807.110 Section 807.110... TRANSPORTATION SAFETY BOARD § 807.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
22 CFR 530.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 530.110 Section 530.110 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.110 Self-evaluation. (a) The... representing handicapped persons, to participate in the self-evaluation process by submitting comments (both...
21 CFR 225.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...
9 CFR 3.110 - Veterinary care.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Veterinary care. 3.110 Section 3.110 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Mammals Animal Health and Husbandry Standards § 3.110 Veterinary care. (a) Newly acquired marine mammals...
7 CFR 4290.110 - Qualified management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Qualified management. 4290.110 Section 4290.110... Qualifications for the RBIC Program Organizing A Rbic § 4290.110 Qualified management. An Applicant must show, to the satisfaction of the Secretary, that its current or proposed management team is qualified and has...
22 CFR 711.110 - Self-evaluation.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 711.110 Section 711.110 Foreign... CORPORATION § 711.110 Self-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...
20 CFR 365.110 - Self-evaluation.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Self-evaluation. 365.110 Section 365.110... § 365.110 Self-evaluation. (a) The agency shall, by December 27, 1989, evaluate its current policies and... self-evaluation process by submitting comments (both oral and written). (c) The agency shall, until at...
19 CFR 201.110 - Self-evaluation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...
21 CFR 226.110 - Distribution records.
2010-04-01
...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR TYPE A MEDICATED ARTICLES Records and Reports § 226.110 Distribution records. Complete records shall be maintained for each shipment of Type A medicated article(s) in... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 226.110 Section 226.110 Food...
21 CFR 165.110 - Bottled water.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...
12 CFR 410.110 - Self-evaluation.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Self-evaluation. 410.110 Section 410.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.110 Self...
10 CFR 110.64 - Civil penalty.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Civil penalty. 110.64 Section 110.64 Energy NUCLEAR... Enforcement § 110.64 Civil penalty. (a) In response to a violation, the Commission may institute a proceeding to impose a civil penalty under section 234 of the Atomic Energy Act by issuing a notice to the...
49 CFR 174.110 - Car magazine.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Car magazine. 174.110 Section 174.110...) Materials § 174.110 Car magazine. When specially authorized by the carrier, Division 1.1 or 1.2 (explosive... packages of Class 1 (explosive) materials are placed in a “magazine” box made of sound lumber not less than...
14 CFR 1250.110 - Judicial review.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...
21 CFR 168.110 - Dextrose anhydrous.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...
Kim, Kyung-Ju; Lee, Tae Hun; Kim, Jung Ho; Cho, Nam-Yun; Kim, Woo Ho; Kang, Gyeong Hoon
2017-09-01
Deletion of the HSP110 T 17 mononucleotide repeat has recently been identified as a prognostic marker that is correlated with wild-type HSP110 (HSP110wt) expression in microsatellite instability-high (MSI-H) colorectal cancers. The aim of this study was to assess the correlation between deletion of the HSP110 T 17 repeat and expression of HSP110wt using DNA testing and immunohistochemistry and to determine the prognostic implications of HSP110 T 17 deletion in MSI-H advanced gastric cancers (GCs). The status of HSP110wt expression was evaluated by immunohistochemistry using an HSP110wt-specific antibody in 142 MSI-H advanced GCs. The size of the HSP110 T 17 repeat deletion was analyzed in 96 MSI-H advanced GCs; deletions were divided into small (0-2base pairs) and large deletions (3-5base pairs). Low and high expressions of HSP110wt were detected in 38 (26.8%) and 104 (73.2%) of the 142 cases, respectively. The HSP110 T 17 deletion was observed in 45 (46.9%) of the 96 MSI-H GC samples. Tumors with high expression of HSP110wt showed a tendency to have small or no deletion of HSP110 T 17 . In Kaplan-Meier survival analysis, tumors with a large HSP110 T 17 deletion were associated with favorable overall survival and disease-free survival compared with those with small/no deletion of HSP110 T 17 . However, HSP110 T 17 deletion size was not an independent prognostic factor in multivariate analysis. In summary, deletion of the HSP110 T 17 repeat was frequently observed in MSI-H GCs, and HSP110 T 17 deletion size was inversely correlated with HSP110wt expression status. Large HSP110 T 17 was not a prognostic indicator in MSI-H GCs. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
HUANG Yanwu
2014-06-01
Full Text Available ObjectiveTo investigate the epidemiological features and disease spectrum of inpatients with hepatitis C in recent years and to provide reference for the control of hepatitis C. MethodsA retrospective study of demography, epidemiology, and laboratory examination was performed in 110 hospitalized patients with hepatitis C. ResultsOf the 110 patients, 60 were male and 50 were female, with a male-to-female ratio of 1.2:1. The main transmission routes included blood product transfusion (33.6%, surgery (30.0%, intravenous drug use (14.5%, and sexual transmission (4.5%. The other 19 cases (17.4% were of unknown transmission route. The annual numbers of cases from 2008 to 2011 were 16, 18, 32, and 44, respectively. The genotype proportions in patients were as follows: 1b, 60.7% (17/28; 2a, 28.6% (8/28; 1b/2a mixed type, 7.1% (2/28; 3b, 3.6% (1/28. Of all patients, 13.6% (15/110 were found with acute hepatitis C, 67.3% (74/110 with chronic hepatitis C, 19.1% (21/110 with liver cirrhosis, and 109% (12/110 with decompensated cirrhosis. ConclusionThe incidence of HCV infection has been increasing year by year. The major HCV genotypes are 1b and 2a. Hepatitis C is apt to develop into liver cirrhosis. It is necessary to reinforce monitoring and to carry out specific epidemiological study among the target population.
Brown, Joshua B; Gestring, Mark L; Forsythe, Raquel M; Stassen, Nicole A; Billiar, Timothy R; Peitzman, Andrew B; Sperry, Jason L
2015-02-01
Undertriage is a concern in geriatric patients. The National Trauma Triage Protocol (NTTP) recognized that systolic blood pressure (SBP) less than 110 mm Hg may represent shock in those older than 65 years. The objective was to evaluate the impact of substituting an SBP of less than 110 mm Hg for the current SBP of less than 90 mm Hg criterion within the NTTP on triage performance and mortality. Subjects undergoing scene transport in the National Trauma Data Bank (2010-2012) were included. The outcome of trauma center need was defined as Injury Severity Score (ISS) greater than 15, intensive care unit admission, urgent operation, or emergency department death. Geriatric (age > 65 years) and adult (age, 16-65 years) cohorts were compared. Triage characteristics and area under the curve (AUC) were compared between SBP of less than 110 mm Hg and SBP of less than 90 mm Hg. Hierarchical logistic regression was used to determine whether geriatric patients newly triaged positive under this change (SBP, 90-109 mm Hg) have a risk of mortality similar to those triaged positive with SBP of less than 90 mm Hg. There were 1,555,944 subjects included. SBP of less than 110 mm Hg had higher sensitivity but lower specificity in geriatric (13% vs. 5%, 93% vs. 99%) and adult (23% vs. 10%, 90% vs. 98%) cohorts. AUC was higher for SBP of less than 110 mm Hg individually in both geriatric and adult (p AUC was similar for SBP of less than 110 mm Hg and SBP of less than 90 mm Hg in geriatric subjects but was higher for SBP of less than 90 mm Hg in adult subjects (p < 0.01). Substituting SBP of less than 110 mm Hg resulted in an undertriage reduction of 4.4% with overtriage increase of 4.3% in the geriatric cohort. Geriatric subjects with SBP of 90 mm Hg to 109 mm Hg had an odds of mortality similar to those of geriatric patients with SBP of less than 90 mm Hg (adjusted odds ratio, 1.03; 95% confidence interval, 0.88-1.20; p = 0.71). SBP of less than 110 mm Hg increases sensitivity. SBP of
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-06-17
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.
Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J. H.; Okkenhaug, Klaus; Vanhaesebroeck, Bart
2008-01-01
The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110α, p110β, and p110δ) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110α and p110δ to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110γ class IB PI3K lack SH2 domains and instead couple p110γ to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110β and cells derived from a p110β-deficient mouse line, that p110β is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110β and p110γ contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110β but not p110γ, p110β mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110γ in these cells reduced the contribution of p110β to GPCR signaling. Taken together, these data show that p110β and p110γ can couple redundantly to the same GPCR agonists. p110β, which shows a much broader tissue distribution than the leukocyte-restricted p110γ, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110γ expression is low or absent. PMID:18544649
48 CFR 249.110 - Settlement negotiation memorandum.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL
7 CFR 29.110 - Method of sampling.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Method of sampling. 29.110 Section 29.110 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Inspectors, Samplers, and Weighers § 29.110 Method of sampling. In sampling tobacco...
Angevin, Eric; Isambert, Nicolas; Trillet-Lenoir, Véronique; You, Benoit; Alexandre, Jérôme; Zalcman, Gérard; Vielh, Philippe; Farace, Françoise; Valleix, Fanny; Podoll, Thomas; Kuramochi, Yu; Miyashita, Itaru; Hosono, Osamu; Dang, Nam H; Ohnuma, Kei; Yamada, Taketo; Kaneko, Yutaro; Morimoto, Chikao
2017-04-25
YS110 is a humanised IgG1 monoclonal antibody with high affinity to the CD26 antigen. YS110 demonstrated preclinical anti-tumour effects without significant side effects. This FIH study was designed to determine the maximal tolerated dose (MTD) and recommended phase 2 dose (RP2D) to assess the tolerance, pharmacokinetics (PK) and pharmacodynamics profiles of YS110 and preliminary efficacy. YS110 were initially administered intravenously once every 2 weeks (Q2W) for three doses and then, based on PK data, once every week (Q1W) for five doses in patients with CD26-expressing solid tumours. Thirty-three patients (22 mesothelioma) received a median of 3 (range 1-30) YS110 infusions across six dose levels (0.1-6 mg kg -1 ). MTD was not reached and two dose-limiting toxicities (infusion hypersensitivity reactions) led to the institution of a systemic premedication. Low-grade asthenia (30.3%), hypersensitivity (27.3%), nausea (15.2%), flushing (15.2%), chills (12.1%) and pyrexia (12.1%) were reported as ADRs. Pharmacokinetic parameters (AUC and C max ) increased in proportion with the dose. sCD26/DPPIV assays indicated CD26 modulation. Prolonged stable diseases were observed in 13 out of 26 evaluable patients. YS110 is well tolerated up to 6 mg kg -1 Q1W, which has been defined as the RP2D, with encouraging prolonged disease stabilisations observed in a number of patients with advanced/refractory mesothelioma.
33 CFR 110.25 - Salem Sound, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Salem Sound, Mass. 110.25 Section 110.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.25 Salem Sound, Mass. (a) Beverly Harbor, north of Salem...
33 CFR 110.238 - Apra Harbor, Guam.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...
2010-07-01
... DISABILITIES Disability Ratings The Digestive System § 4.110 Ulcers. Experience has shown that the term “peptic ulcer” is not sufficiently specific for rating purposes. Manifest differences in ulcers of the stomach... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ulcers. 4.110 Section 4...
24 CFR 110.15 - Location of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Location of posters. 110.15 Section 110.15 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... HOUSING POSTER Requirements for Display of Posters § 110.15 Location of posters. All fair housing posters...
12 CFR 411.110 - Certification and disclosure.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...
7 CFR 3565.110 - Insolvency of lender.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Insolvency of lender. 3565.110 Section 3565.110... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Lender Requirements § 3565.110 Insolvency of lender. The... determination of insolvency by the lender. If the lender fails to transfer a loan when required, the guarantee...
46 CFR 7.110 - Mamala Bay, HI.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Mamala Bay, HI. 7.110 Section 7.110 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Hawaii § 7.110 Mamala Bay, HI. A line drawn from Barbers Point Light to Diamond Head Light. Pacific Coast ...
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Use of TIAs. 603.110 Section 603.110 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS General § 603.110 Use of TIAs. The ultimate goal for using a TIA is to broaden the technology base available to meet DOE mission...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.110 Section 28... Manufacturing Bonded Warehouse Losses § 28.110 Losses. Where there has been a loss of distilled spirits while in... of subpart O of this part, with respect to losses of spirits after withdrawal without payment of tax...
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1989-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low energy electron diffraction and low energy ion scattering. From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh/Ta(110) appears to grow in the Stranski-Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at 1.2 and 2. 5 eV binding energy during the initial phase of thin film growth (0 3.7 ML). Photoemission data for CO covered surfaces show that CO dissociates on the Rh/Ta(110) surface for Rh coverages less than 2.5 ML and also show that the Rh clusters develop at least one site capable of molecular CO adsorption above 0.3 ML Rh coverage. 38 refs., 5 figs
Characterization of Rh films on Ta(110)
International Nuclear Information System (INIS)
Jiang, L.Q.; Ruckman, M.W.; Strongin, M.
1990-01-01
The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low-energy electron diffraction (LEED) and low-energy ion scattering (LEIS). From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh appears to grow in the Stranski--Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at -1.5 and -2.5 eV binding energy during the initial phase of thin-film growth (0 3.7 ML). CO dissociates on the Rh/Ta(110) surface for Rh coverages<2.5 ML and the surface develops a site capable of molecular CO adsorption above 0.3-ML Rh coverage
27 CFR 21.110 - Gasoline, unleaded.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline, unleaded. 21.110....110 Gasoline, unleaded. Conforms to specifications as established by the American Society for Testing...-79. Any of the “seasonal and geographical” volatility classes for unleaded gasoline are considered...
44 CFR 16.110 - Self-evaluation.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Self-evaluation. 16.110... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.110 Self-evaluation. (a) The agency... handicaps or organizations representing individuals with handicaps, to participate in the self-evaluation...
p110α and p110β isoforms of PI3K signaling: are they two sides of the same coin?
Singh, Paramjeet; Dar, Mohd Saleem; Dar, Mohd Jamal
2016-09-01
Class-1 phosphatidylinositol-3-kinases (PI3Ks) are activated by a variety of extracellular stimuli and have been implicated in a wide range of cellular processes. p110α and p110β are the two most studied isoforms of the class-1A PI3K signaling pathway. Although these two isoforms are ubiquitously expressed and play multiple redundant roles, they also have distinct functions within the cell. More recently, p110α and p110β isoforms have been shown to translocate into the nucleus and play a role in DNA replication and repair, and in cell cycle progression. In the following Review article, we discuss the overlapping and unique roles of p110α and p110β isoforms with a particular focus on their structure, expression analysis, subcellular localization, and signaling contributions in various cell types and model organisms. © 2016 Federation of European Biochemical Societies.
25 CFR 720.110 - Self-evaluation.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Self-evaluation. 720.110 Section 720.110 Indians THE...-evaluation. (a) The agency shall, by August 24, 1987, evaluate its current policies and practices, and the... or organizations representing handicapped persons, to participate in the self-evaluation process by...
36 CFR 223.110 - Delegation to regional forester.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation to regional forester. 223.110 Section 223.110 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.110 Delegation to regional forester. The Chief, Forest Service, after approval of conditions of...
33 CFR 110.208 - Buffalo Harbor, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...
29 CFR 1650.110 - Implementation of salary offset.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Implementation of salary offset. 1650.110 Section 1650.110... Procedures for the Collection of Debts by Salary Offset § 1650.110 Implementation of salary offset. (a... proposed voluntary repayment agreement, deductions will begin in the next bi-weekly salary payment after a...
2010-04-01
... Frozen eggs. (a) Frozen eggs, frozen whole eggs, frozen mixed eggs is the food prepared by freezing... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen eggs. 160.110 Section 160.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
29 CFR 1978.110 - Judicial review.
2010-07-01
... Labor, shall not be subject to judicial review in any criminal or other civil proceedings (49 U.S.C... law judge, shall be transmitted by the Administrative Review Board, United States Department of Labor... 29 Labor 9 2010-07-01 2010-07-01 false Judicial review. 1978.110 Section 1978.110 Labor...
31 CFR 17.110 - Self-evaluation.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...
29 CFR 825.110 - Eligible employee.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...
Fermi surface and quantum well states of V(110) films on W(110)
International Nuclear Information System (INIS)
Krupin, Oleg; Rotenberg, Eli; Kevan, S D
2007-01-01
Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface
Fermi surface and quantum well states of V(110) films on W(110)
Energy Technology Data Exchange (ETDEWEB)
Krupin, Oleg [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Rotenberg, Eli [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Kevan, S D [Department of Physics, University of Oregon, Eugene, OR 97403 (United States)
2007-09-05
Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface.
Grasping the Existential Experience of Living with Systemic Lupus Erythematosus
DEFF Research Database (Denmark)
Larsen, Janni Lisander
Dette projekt havde til formål at undersøge eksistentielle vilkår hos kvinder med sygdommen, systemisk lupus erythematosus, herunder hvordan disse vilkår blev erfaret gennem et langvarigt sygdomsforløb. Data blev konstrueret gennem 3 konsekutive, personlige interview sessions på dag 0, efter 6 og...
International Nuclear Information System (INIS)
Cary, W.P.; Allen, J.C.; Callis, R.W.; Doane, J.L.; Harris, T.E.; Moetler, C.P.; Neren, A.; Prater, P.; Rensen, D.
1992-01-01
This paper reports on a new high power electron cyclotron heating (ECH) system which has been introduced on DIII-D. This system is designed to operate at 110 GHz with a total output power of 2 MW. The system consists of four Varian VGT-8011 gyrotrons (output power of 500 kW), and their associated support equipment. All components have been designed for up to a 10 second pulse duration. The 110 GHz system is intended to further progress in rf current drive experiments on DIII-D when used in conjunction with the existing 60 GHz ECH (1. 6 MW) , and the 30-60 MHz ICH (2MW) systems. H-mode physics, plasma stabilization experiments and transport studies are also to be conducted at 110 GHz
33 CFR 110.84b - Buffalo, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo, N.Y. 110.84b Section 110... REGULATIONS Special Anchorage Areas § 110.84b Buffalo, N.Y. The area within the Port of Buffalo known as Port of Buffalo Small Boat Harbor commencing at a point on shore at latitude 42°51′05″ N., longitude 78°51...
Energy Technology Data Exchange (ETDEWEB)
Methfessel, Torsten
2010-12-09
This thesis provides an introduction into the technique of spin-polarized scanning tunnelling microscopy and spectroscopy as an experimental method for the investigation of magnetic nanostructures. Experimental results for the spin polarized electronic structure depending on the crystal structure of ultrathin Co layers, and depending on the direction of the magnetization for ultrathin Fe layers are presented. High-resolution measurements show the position-dependent spin polarization on a single copper-phthalocyanine molecule deposited on a ferromagnetic surface. Co was deposited by molecular beam epitaxy on the (110) surface of the bodycentered cubic metals Cr and Fe. In contrast to previous reports in the literature only two layers of Co can be stabilized in the body-centered cubic (bcc) structure. The bcc-Co films on the Fe(110) surface show no signs of epitaxial distortions. Thicker layers reconstruct into a closed-packed structure (hcp / fcc). The bcc structure increases the spin-polarization of Co to P=62 % in comparison to hcp-Co (P=45 %). The temperature-dependent spin-reorientation of ultrathin Fe/Mo(110) films was investigated by spin-polarized spectroscopy. A reorientation of the magnetic easy axis from the [110] direction along the surface normal to the in-plane [001] axis is observed at T (13.2{+-}0.5) K. This process can be identified as a discontinuous reorientation transition, revealing two simultaneous minima of the free energy in a certain temperature range. The electronic structure of mono- and double-layer Fe/Mo(110) shows a variation with the reorientation of the magnetic easy axis and with the direction of the magnetization. The investigation of the spin-polarized charge transport through a copper-phthalocyanine molecule on the Fe/Mo(110) surface provides an essential contribution to the understanding of spin-transport at the interface between metal and organic molecule. Due to the interaction with the surface of the metal the HOMO-LUMO energy
DEFF Research Database (Denmark)
Nørgård-Sørensen, Jens
2008-01-01
Artiklens formål er påvise at samtidige og konsekutive grammatikaliseringer i et og samme sprog ikke er adskilte processer, men ofte vil være tæt forbundne. Denne teori illustreres med en "bølge" af grammatikaliseringer i russisk. Udgangspunktet er konjunktiven, der i oldrussisk var en perifrasti...
21 CFR 110.93 - Warehousing and distribution.
2010-04-01
...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING... microbial contamination as well as against deterioration of the food and the container. ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Warehousing and distribution. 110.93 Section 110...
The DOE/NASA SRG110 Program Overview
Shaltens, R. K.; Richardson, R. L.
2005-12-01
The Department of Energy is developing the Stirling Radioisotope Generator (SRG110) for NASAs Science Mission Directorate for potential surface and deep space missions. The SRG110 is one of two new radioisotope power systems (RPSs) currently being developed for NASA space missions, and is capable of operating in a range of planetary atmospheres and in deep space environments. It has a mass of approximately 27 kg and produces more than 125We(dc) at beginning of mission (BOM), with a design lifetime of fourteen years. Electrical power is produced by two (2) free-piston Stirlings convertor heated by two General Purpose Heat Source (GPHS) modules. The complete SRG110 system is approximately 38 cm x 36 cm and 76 cm long. The SRG110 generator is being designed in 3 stages: Engineering Model, Qualification Generator, and Flight Generator. Current plans call for the Engineering Model to be fabricated and tested by October 2006. Completion of testing of the Qualification Generator is scheduled for mid-2009. This development is being performed by Lockheed Martin, Valley Forge, PA and Infinia Corporation, Kennewick, WA under contract to the Department of Energy, Germantown, Md. Glenn Research Center, Cleveland, Ohio is providing independent testing and support for the technology transition for the SRG110 Program.
21 CFR 110.110 - Natural or unavoidable defects in food for human use that present no health hazard.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Natural or unavoidable defects in food for human... PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD Defect Action Levels § 110.110 Natural or... natural or unavoidable defects to the lowest level currently feasible. (d) The mixing of a food containing...
International Nuclear Information System (INIS)
Herreros Usher, Oscar; Maceiras de Jefimowicz, Elena; De la Vega Vedoya, Mario; Jorge Nassiff, Sonia
1980-01-01
Excitation functions and isomeric cross sections ratios have been measured for the 110 Cd (d,2n) and 111 Cd (d,3n) reactions in which the isomeric pair sup(110m)In/sup(110g)In is produced. Activation method was employed and the irradiations were performed at the synchrocyclotron of the Comision Nacional de Energia Atomica, Argentina, with an incident energy of 27.MeV. (author) [es
11 CFR 110.18 - Voting age population.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Voting age population. 110.18 Section 110.18 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CONTRIBUTION AND EXPENDITURE LIMITATIONS AND... population of the United States, of each State, and of each Congressional district. The term voting age...
CP110 exhibits novel regulatory activities during centriole assembly in Drosophila
Franz, Anna; Roque, Hélio; Saurya, Saroj; Dobbelaere, Jeroen
2013-01-01
CP110 is a conserved centriole protein implicated in the regulation of cell division, centriole duplication, and centriole length and in the suppression of ciliogenesis. Surprisingly, we report that mutant flies lacking CP110 (CP110Δ) were viable and fertile and had no obvious defects in cell division, centriole duplication, or cilia formation. We show that CP110 has at least three functions in flies. First, it subtly influences centriole length by counteracting the centriole-elongating activity of several centriole duplication proteins. Specifically, we report that centrioles are ∼10% longer than normal in CP110Δ mutants and ∼20% shorter when CP110 is overexpressed. Second, CP110 ensures that the centriolar microtubules do not extend beyond the distal end of the centriole, as some centriolar microtubules can be more than 50 times longer than the centriole in the absence of CP110. Finally, and unexpectedly, CP110 suppresses centriole overduplication induced by the overexpression of centriole duplication proteins. These studies identify novel and surprising functions for CP110 in vivo in flies. PMID:24297749
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
33 CFR 110.128b - Island of Hawaii, Hawaii.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Hawaii, Hawaii. 110.128b Section 110.128b Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128b Island of Hawaii, Hawaii. (a) Hilo Bay...
Directory of Open Access Journals (Sweden)
Gregory J Fox
Full Text Available Tuberculosis (TB is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results.To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam.Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451 under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860 and one with extra-pulmonary TB (rs10498244.SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection.
Fox, Gregory J; Sy, Dinh Ngoc; Nhung, Nguyen Viet; Yu, Bing; Ellis, Magda K; Van Hung, Nguyen; Cuong, Nguyen Kim; Thi Lien, Luu; Marks, Guy B; Saunders, Bernadette M; Britton, Warwick J
2014-01-01
Tuberculosis (TB) is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results. To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam. Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451) under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860) and one with extra-pulmonary TB (rs10498244). SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection.
Fox, Gregory J.; Sy, Dinh Ngoc; Nhung, Nguyen Viet; Yu, Bing; Ellis, Magda K.; Van Hung, Nguyen; Cuong, Nguyen Kim; Thi Lien, Luu; Marks, Guy B.; Saunders, Bernadette M.; Britton, Warwick J.
2014-01-01
Background Tuberculosis (TB) is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results. Methods To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam. Results Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451) under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860) and one with extra-pulmonary TB (rs10498244). Conclusion SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection. PMID:25006821
Molecular and clinical study of a cohort of 110 Algerian patients with autosomal recessive ataxia.
Hamza, Wahiba; Ali Pacha, Lamia; Hamadouche, Tarik; Muller, Jean; Drouot, Nathalie; Ferrat, Farida; Makri, Samira; Chaouch, Malika; Tazir, Meriem; Koenig, Michel; Benhassine, Traki
2015-06-12
Autosomal recessive cerebellar ataxias (ARCA) are a complex group of neurodegenerative disorders with great genetic and phenotypic heterogeneity, over 30 genes/loci have been associated with more than 20 different clinical forms of ARCA. Genetic heterogeneity combined with highly variable clinical expression of the cerebellar symptoms and overlapping features complicate furthermore the etiological diagnosis of ARCA. The determination of the most frequent mutations and corresponding ataxias, as well as particular features specific to a population, are mandatory to facilitate and speed up the diagnosis process, especially when an appropriate treatment is available. We explored 166 patients (115 families) refered to the neurology units of Algiers central hospitals (Algeria) with a cerebellar ataxia phenotype segregating as an autosomal recessive pattern of inheritance. Genomic DNA was extracted from peripheral blood samples and mutational screening was performed by PCR and direct sequencing or by targeted genomic capture and massive parallel sequencing of 57 genes associated with inherited cerebellar ataxia phenotypes. In this work we report the clinical and molecular results obtained on a large cohort of Algerian patients (110 patients/76 families) with genetically determined autosomal recessive ataxia, representing 9 different types of ARCA and 23 different mutations, including 6 novel ones. The five most common ARCA in this cohort were Friedreich ataxia, ataxia with isolated vitamin E deficiency, ataxia with oculomotor apraxia type 2, autosomal recessive spastic ataxia of Charlevoix-Saguenay and ataxia with oculomotor apraxia type 1. We report here a large cohort of patients with genetically determined autosomal recessive ataxia and the first study of the genetic context of ARCA in Algeria. This study showed that in Algerian patients, the two most common types of ataxia (Friedreich ataxia and ataxia with isolated vitamin E deficiency) coexist with forms that may be
33 CFR 110.128c - Island of Kauai, Hawaii.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Kauai, Hawaii. 110.128c Section 110.128c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128c Island of Kauai, Hawaii. (a) Nawiliwili Bay. The...
Translocation, accumulation and distribution of 110mAg in carp
International Nuclear Information System (INIS)
Li Chuanzhao; Zhao Wenhu; Xu Shiming
1995-01-01
The experimental carp were raised in the water with 110m Ag specific activity of 3.7 x 10 2 Bq/L, 3.7 x 10 3 Bq/L, 3.7 x 10 4 Bq/L respectively. The carp were sampled after raising 1,2,3,5,7,9,12,15,18,21 and 23 days, and separated into scale, bone, muscle, gill, alimentary canal, heart and heptapancreas for measuring the radioactivity. The results showed that 110m Ag was absorbed rapidly by carp via gill and alimentary canal from water, and distributed into all parts of the body, mainly in soft tissue with blood circulation. 110m Ag accumulation of the body increased with the 110m Ag specific activity in the water in the same raising time. The accumulation of 110m Ag in gill, alimentary canal, heart, muscle and bone appeared mono-peak curves with raising time. There was a linear relationship between the specific activity of 110m Ag in heptapancreas and the carp's raising time in 110m Ag water. The concentration abilities for 110m Ag in all organs were in the order of heptapancreas>gill>alimentary>canal>heart>muscle>bone
33 CFR 110.77 - Amistad Reservoir, Tex.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amistad Reservoir, Tex. 110.77... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.77 Amistad Reservoir, Tex. (a) Diablo East, Tex. That portion of the Amistad Reservoir enclosed by a line connecting the following points, excluding a 300-foot...
24 CFR 110.20 - Availability of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Availability of posters. 110.20... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.20 Availability of posters. All persons subject to this part may obtain fair housing posters from the Department's regional and area...
40 CFR 300.110 - National Response Team.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false National Response Team. 300.110... PLAN Responsibility and Organization for Response § 300.110 National Response Team. National planning... agencies named in § 300.175(b). Each agency shall designate a member to the team and sufficient alternates...
Energy transfer in porous anodic alumina/rhodamine 110 nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Elhouichet, H., E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Materiaux Mineraux et leurs Applications, Centre National de Recherches en Sciences des Materiaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Departement de Physique, Faculte des Sciences de Tunis, University of Tunis Elmanar 2092 Tunis (Tunisia); Harima, N.; Koyama, H. [Hyogo University of Teacher Education, Kato, Hyogo 673-1494 (Japan); Gaponenko, N.V. [Belarusian State University of Informatics and Radioelectronics, P. Browki St. 6, 220013 Minsk (Belarus)
2012-09-15
We have used porous anodic alumina (PAA) films as templates for embedding rhodamine 110 (Rh110) molecules and examined their photoluminescence (PL) properties in detail. The analysis of the polarization memory (PM) of PL strongly suggests that there is a significant energy transfer from PAA to Rh110 molecules. The effect of annealing the PAA layer on the PL properties of the nanocomposite has been studied. The results show that the energy transfer becomes more efficient in annealed PAA. - Highlights: Black-Right-Pointing-Pointer Porous anodic alumina-rhodamine 110 nanocomposites are elaborated. Black-Right-Pointing-Pointer Efficient energy transfer from the host to Rh110 molecules is evidenced from measurements of photoluminescence and degree of polarization memory spectra. Black-Right-Pointing-Pointer Thermal annealing of porous anodic alumina can improve the process of excitation transfer.
Targeting p110gamma in gastrointestinal cancers: attack on multiple fronts
Directory of Open Access Journals (Sweden)
Marco eFalasca
2014-10-01
Full Text Available Phosphoinositide 3-kinases (PI3Ks regulate several cellular functions that are critical for cancer progression and development, including cell survival, proliferation and migration. Three classes of PI3Ks exist with the class I PI3K encompassing four isoforms of the catalytic subunit known as p110α, p110β, p110γ and p110δ. Although for many years attention has been mainly focused on p110α recent evidence supports the conclusion that p110β, p110γ and p110δ can also have a role in cancer. Amongst these, accumulating evidence now supports the conclusion that p110γ is involved in several cellular processes associated with cancer development and progression and indeed this specific isoform has emerged as a novel important player in cancer progression. Studies from our laboratory have identified a specific overexpression of p110γ in human pancreatic ductal adenocarcinoma (PDAC and in hepatocellular carcinoma (HCC tissues compared to their normal counterparts. Our data have further established that selective inhibition of this PI3K isoform is able to block PDAC and HCC cell proliferation, strongly suggesting that pharmacological inhibition of this enzyme can directly affect these tumors growth. Furthermore increasing evidence suggests that p110γ plays also a key role in the interactions between cancer cells and tumor microenvironment and in particular in tumor-associated immune response. It has also been reported that p110γ can regulate invasion of myeloid cells into tumors and tumor angiogenesis. Finally p110γ has also been directly involved in regulation of cancer cell migration. Taken together these data indicate that p110γ plays multiple roles in regulation of several processes that are critical for tumor progression and metastasis. This review will discuss the role of p110γ in gastrointestinal tumor development and progression and how targeting this enzyme might represent a way to target very aggressive tumors such as pancreatic and
Cottom, James M; Baker, Joseph; Plemmons, Britton S
Chronic lateral ankle instability is a common condition treated by most foot and ankle surgeons. Once conservative treatment has failed, patients often undergo surgical reconstruction, either anatomic or nonanatomic. The present retrospective cohort study compared the clinical outcomes of 2 different arthroscopic Broström procedures. A total of 110 patients (83 females [75.5%] and 27 males [24.5%]) were treated with 1 of the 2 lateral ankle stabilization techniques from October 1, 2014 to December 31, 2015. Of the 110 patients, 75 were included in the arthroscopic lateral ankle stabilization group with an additional suture anchor used proximally and 35 were included in the arthroscopic lateral ankle stabilization group using the knotless design. The age of the cohort was 46.05 ± 17.89 (range 12 to 83) years. The body mass index was 30.03 ± 7.42 (range 18.3 to 52.5) kg/m 2 . Of the 110 patients, 25 (22.7%) had undergone concomitant procedures during lateral ankle stabilization. Overall, postoperative complications occurred in 14 patients (12.7%). No statistically significant differences were found between the 2 groups regarding the complication rates, use of concomitant procedures, and the presence of diabetes and workers compensation claims. No statistically significant differences were found in the mean age, body mass index, or gender distribution between the 2 groups. The preoperative American Orthopaedic Foot and Ankle Society (AOFAS) Ankle-Hindfoot scores were 50.85 ± 13.56 (range 18 to 76) and 51.26 ± 13.32 (range 18 to 69) in groups 1 and 2, respectively. The postoperative AOFAS Ankle-Hindfoot scores were 88.19 ± 10.72 (range 54 to 100) and 84 ± 15.41 (range 16 to 100) in groups 1 and 2, respectively. No statistically significant difference was found between these 2 groups. The preoperative visual analog scale score was 7.45 ± 1.39 (range 3 to 10) and 6.97 ± 1.25 (range 5 to 10), which had improved to 1.12 ± 1.38 (range 0 to 5) and
20 CFR 416.110 - Purpose of program.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Purpose of program. 416.110 Section 416.110... income program replaces the financial assistance programs for the aged, blind, and disabled in the 50... the program: (a) Objective tests. The law provides that payments are to be made to aged, blind, and...
Targeting GPR110 in HER2-Overexpressing Breast Cancers
2015-10-01
34assay"using"the"transwell" inserts"with" (A)"or"without" (B)"matrigel" for"SKBR3" cells "transfected"with"nonAtarge1ng"( NT1 )"orŗ"independent"GPR110"siRNAs...HER2 drug resistant cells and in tumorigenic population using a broad panel of cell line models. We have successfully generated inducible lentiviral...plasmids with GPR110 cDNA and cell lines that inducibly overexpress GPR110. Generation of cell lines with lentiviral plasmids containing GPR110
28 CFR 34.110 - Management of peer reviews.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Management of peer reviews. 34.110 Section 34.110 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES... the peer review process. ...
STS-110 Extravehicular Activity (EVA)
2002-01-01
STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.
Pharmacokinetics of Rhodamine 110 and Its Organ Distribution in Rats.
Jiang, Shiau-Han; Cheng, Yung-Yi; Huo, Teh-Ia; Tsai, Tung-Hu
2017-09-06
Rhodamine dyes have been banned as food additives due to their potential tumorigenicity. Rhodamine 110 is illegal as a food additive, although its pharmacokinetics have not been characterized, and no accurate bioanalytical methods are available to quantify rhodamine 110. The aim of this study was to develop and validate a fast, stable, and sensitive method to quantify rhodamine 110 using high-performance liquid chromatography coupled to tandem mass spectrometry (HPLC-MS/MS) to assess its pharmacokinetics and organ distribution in awake rats. Rhodamine 110 exhibited linear pharmacokinetics and slow elimination after oral administration. Furthermore, its oral bioavailability was approximately 34-35%. The distribution in the liver and kidney suggests that these organs are primarily responsible for rhodamine 110 metabolism and elimination. Our investigation describes the pharmacokinetics and a quantification method for rhodamine 110, improving our understanding of the food safety of rhodamine dyes.
24 CFR 110.25 - Description of posters.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Description of posters. 110.25... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.25 Description of posters. (a) The fair housing poster shall be 11 inches by 14 inches and shall bear the following legend: EC12OC91.008...
[Clinical Significance and Mechanism of PI3K p110β Overexpression in Non-small Cell Lung Cancer].
Xiong, Yan; Qu, Linlin; Li, Dong; Wang, Ying; Li, Ting
2017-12-20
Phosphatidylinositide 3-kinases (PI3K) pathway is one of the most important pathway in cells, which plays an important role in proliferation, growth, differentiation and mobility of cells. The aberrant activation of PI3K pathway was exsited in 50%-70% cases of non-small cell lung cancer (NSCLC). As the key point in PI3K pathway, expression of PI3K plays a critical role in activity of the pathway, which is closely related with the initiation and development of NSCLC, furthermore with the response of tumor to target treatment. Our study is to analyze the clinical significance and mechanism of PI3K p110β overexpression in NSCLC. Expression of p110β and other proteins in PI3K pathway were detected by immunohistochemistry in 170 cases of NSCLC. Correlation between expression of p110β and clinicopathological characteristics of patients as well as expression of other proteins in PI3K pathway was analyzed. In 170 NSCLC, overexpression of p110β was found in 41.8% of cases. Correlation between overexpression of p110β and Ki 67 index was significant (P=0.040). No significant difference of p110 expression were observed among different cohorts of gender, age, smoking status, classification, grade and stage (P>0.05). Correlation between expression of p110β and other proteins in PI3K pathway was various, positively correlated with PTEN loss (P0.05). Overexpression of p110β is frequently detected in NSCLC. It is closely related with PTEN loss NSCLC, which shows that it plays an important role in maintaining and developing of tumors driven by PTEN loss. It initiates the proliferation of tumor cells in NSCLC without phosphorylating Akt. PIK3CB mutation is not the major cause of overexpression of p110β. Dysregulation of receptor tyrosine kinases (RTKs) doesn't show potential of increasing p110β level in cancer tissue, furthermore the expression of p110β in tumors with EGFR mutation is lower than in tumors without EGFR mutation.
Chaudhari, Aditi; Krumlinde, Daniel; Lundqvist, Annika; Akyürek, Levent M; Bandaru, Sashidhar; Skålén, Kristina; Ståhlman, Marcus; Borén, Jan; Wettergren, Yvonne; Ejeskär, Katarina; Rotter Sopasakis, Victoria
2015-10-01
The phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) catalytic subunit p110α is the most frequently mutated kinase in human cancer, and the hot spot mutations E542K, E545K, and H1047R are the most common mutations in p110α. Very little is known about the metabolic consequences of the hot spot mutations of p110α in vivo. In this study, we used adenoviral gene transfer in mice to investigate the effects of the E545K and H1047R mutations on hepatic and whole-body glucose metabolism. We show that hepatic expression of these hot spot mutations results in rapid hepatic steatosis, paradoxically accompanied by increased glucose tolerance, and marked glycogen accumulation. In contrast, wild-type p110α expression does not lead to hepatic accumulation of lipids or glycogen despite similar degrees of upregulated glycolysis and expression of lipogenic genes. The reprogrammed metabolism of the E545K and H1047R p110α mutants was surprisingly not dependent on altered p110α lipid kinase activity. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
45 CFR 2523.110 - Can Federal agencies submit multiple applications?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Can Federal agencies submit multiple applications? 2523.110 Section 2523.110 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION... AMERICORPS PROGRAM ASSISTANCE § 2523.110 Can Federal agencies submit multiple applications? No. The...
33 CFR 118.110 - Daymarks and lateral lighting on bridges.
2010-07-01
... bridges. 118.110 Section 118.110 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.110 Daymarks and lateral lighting on bridges. (a... through bridges with U.S. aids to navigation system lateral marks and lights installed on the...
PROPER MOTIONS OF THE HH 110/270 SYSTEM
International Nuclear Information System (INIS)
Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.
2012-01-01
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
33 CFR 110.27 - Lynn Harbor in Broad Sound, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lynn Harbor in Broad Sound, Mass. 110.27 Section 110.27 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.27 Lynn Harbor in Broad Sound, Mass. North of...
33 CFR 110.179 - Skidaway River, Isle of Hope, Ga.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Skidaway River, Isle of Hope, Ga. 110.179 Section 110.179 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.179 Skidaway River, Isle of Hope, Ga. (a) The...
21 CFR 110.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 110.5 Section...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD General Provisions § 110.5 Current good manufacturing practice. (a) The criteria and...
40 CFR 211.110-2 - National security exemptions.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 211.110... ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-2 National security exemptions. (a) A new product which is produced to conform with specifications developed by national security agency...
23 CFR 630.110 - Modification of original agreement.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Modification of original agreement. 630.110 Section 630... OPERATIONS PRECONSTRUCTION PROCEDURES Project Authorization and Agreements § 630.110 Modification of original agreement. (a) When changes are needed to the original project agreement, a modification of agreement shall...
40 CFR 405.110 - Applicability; description of the condensed whey subcategory.
2010-07-01
... condensed whey subcategory. 405.110 Section 405.110 Protection of Environment ENVIRONMENTAL PROTECTION... Condensed Whey Subcategory § 405.110 Applicability; description of the condensed whey subcategory. The... whey and condensed acid whey. ...
12 CFR 516.110 - Who may submit a written comment?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who may submit a written comment? 516.110 Section 516.110 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPLICATION PROCESSING PROCEDURES Comment Procedures § 516.110 Who may submit a written comment? Any person may submit a...
33 CFR 110.70a - Northeast River, North East, Md.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast River, North East, Md. 110.70a Section 110.70a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.70a Northeast River, North East, Md. The water...
33 CFR 110.74c - Bahia de San Juan, PR.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bahia de San Juan, PR. 110.74c Section 110.74c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.74c Bahia de San Juan, PR. The waters of San Antonio...
BeppoSAX Observations of MKN 110
Nicastro, Fabrizio; Oliversen, Ronald J. (Technical Monitor)
2002-01-01
Mkn 110 is a bright, nearby Seyfert 1 galaxy, which underwent a long optical monitoring campaign, during the past 12 years. Optical observations show that Mkn 110 vary, both in flux and spectral shape. The intensity and width of its Broad Emission Lines (BELs) also vary, from typical Seyfert 1, to typical Narrow Line Seyfert 1 (NLSyl) values, so suggesting that this could be the first supermassive black holes where accretion state related transitions, as frequently observed in stellar-size black holes, have finally been observed. To verify these suggestions we asked to monitor Mkn 110 with BeppoSAX with three 50 ksec observations six months apart. The goal of the proposal was to observe spectral variations in X-ray, already suggested by previous, existing ROSAT (Roentgen Satellite) and ASCA (Advanced Satellite for Cosmology and Astrophysics) observations of the same source. The first of these three SAX (Satellite per Astronomia X) observations was taken on May 2000, and lacks the Low-Energy instrument (0.1-2 keV is the band in which NLSy1 and Sy1 X-ray spectra differ most).
PROPER MOTIONS OF THE HH 110/270 SYSTEM
Energy Technology Data Exchange (ETDEWEB)
Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)
2012-05-15
We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.
A study on behaviour of 110mAg in marine environment
International Nuclear Information System (INIS)
Xie Yunmian; Tang Wenqiao; Meng Jianyi
2000-01-01
The author describes a study on the behaviour of 110m Ag in marine environment. It includes the chemical species of 110m Ag in seawater, the absorption factor K d in/on sea sediment and biological concentration factor B f of marine biome for 110m Ag. The experiment and theoretical calculation indicate that 110 Ag exists as 110m AgCl 2 - : 110m Ag + ≅10 5 in seawater and AgCl precipitation is formed when [Ag + ][Cl - ]≥1.56 x 10 -10 . K d in/on sediment decreases with increasing of temperature and/or liquid/solid ratio. The effect of water nature on K d is very considerable. And the K d on sediment is in the order of 10 2 mL/g under the seawater atmosphere, which is two orders lower than under the freshwater atom sphere, 110m Ag is concentrated by marine biome strongly. B f is in the range of 10 2 -10 4 depending on different kind of marine biome
33 CFR 110.155 - Port of New York.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Port of New York. 110.155 Section... ANCHORAGE REGULATIONS Anchorage Grounds § 110.155 Port of New York. (a) Long Island Sound—(1) Anchorage No... northwest corner of the crib icebreaker north of the New York Central Railroad Company drawbridge across...
Transfer of radiosilver (Ag-110m) in the food chain
International Nuclear Information System (INIS)
Handl, J.
1993-01-01
Following the Chernobyl accident, Ag-110m (Half-life: 250 days) has been reported in some important components of the terrestrial environment such as pasture vegetation and pasture animals. A review of the available literature showed that the behaviour of silver in the terrestrial environment is relatively poorly understood. A research programme to study the behaviour of Ag-110m along the soil - vegetation - animal - man pathway was therefore initiated. In an in-vivo study in cooperation with the Institute of Animal Husbandry and Animal Behaviour, Mariensee with pigs the transfer of Ag-110m from feed to animal tissues was followed for 30 days using Ag-110m labelled meat as feed. The observation has not yet been finished. After the evaluation of all measurements, transfer factors animal tissue/feed as well as the biological half-life for Ag-110m in animal organs will be determined. (orig./BBR)
33 CFR 110.233 - Prince William Sound, Alaska.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Prince William Sound, Alaska. 110... ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.233 Prince William Sound, Alaska. (a) The anchorage grounds. In Prince William Sound, Alaska, beginning at a point at latitude 60°40′00″ N., longitude 146°40...
44 CFR 19.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.110 Remedial and... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 19.110 Section 19.110 Emergency Management and Assistance FEDERAL EMERGENCY...
41 CFR 101-25.110-3 - Tires accompanying new motor vehicles.
2010-07-01
... motor vehicles. 101-25.110-3 Section 101-25.110-3 Public Contracts and Property Management Federal...-GENERAL 25.1-General Policies § 101-25.110-3 Tires accompanying new motor vehicles. The tire identifications and recordkeeping regulations issued by the Department of Transportation require each motor...
International Nuclear Information System (INIS)
Kopecky, M.; Kub, J.; Maca, F.; Masek, J.; Pacherova, O.; Rushforth, A. W.; Gallagher, B. L.; Campion, R. P.; Novak, V.; Jungwirth, T.
2011-01-01
We report on high-resolution x-ray diffraction measurements of (Ga,Mn)As and (Ga,Mn)(As,P) epilayers. We observe a structural anisotropy in the form of stacking faults that are present in the (111) and (111) planes and absent in the (111) and (111) planes. They occupy 10 -2 %-10 -1 % of the ferromagnetic epilayer volume while no stacking faults are detected in the controlled, undoped GaAs epilayer. Full-potential density functional calculations provide additional evidence that the formation of the stacking faults is promoted by Mn attracted to these structural defects. The enhanced Mn density along the common [110] direction of the stacking fault planes produces a symmetry-breaking mechanism of a strength and sense that can account for the uniaxial [110]/[110] magnetocrystalline anisotropy of these ferromagnetic semiconductors.
33 CFR 110.156 - Randall Bay, Freeport, Long Island, N.Y.
2010-07-01
... Island, N.Y. 110.156 Section 110.156 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.156 Randall Bay, Freeport, Long Island, N.Y. (a) The anchorage grounds. Southward of a line 312 feet south of and parallel to the south side...
33 CFR 110.129a - Apra Harbor, Guam. (Datum: WGS 84)
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. (Datum: WGS 84) 110.129a Section 110.129a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.129a Apra Harbor, Guam. (Datum: WGS 84) (a...
High temperature behaviour of E110G and E110 fuel claddings in various mixtures of steam and air
International Nuclear Information System (INIS)
Perez-Feró, Erzsébet; Novotny, Tamás; Horváth, Márta; Kunstár, Mihály; Vér, Nóra; Hózer, Zoltán
2014-01-01
Experiments with sponge base E110G and the traditional E110 were carried out to compare the oxidation kinetics of these alloys in steam, in hydrogen rich steam, in steam-air and in air atmosphere and to study the effect of hydrogen- and nitrogen-containing environment on the oxidation. The effect of oxidizing atmosphere on the mechanical behaviour of the claddings was also investigated. The new and the traditional types of cladding rings were oxidised at high temperature (600°C – 1200°C). Oxidation of both alloys in steam-air mixture and in air atmosphere resulted in faster oxidation kinetics compared to steam. In many cases bumpy, porous oxide layer have been found. The presence of hydrogen in the steam atmosphere had no significant effect on the oxidation kinetics. Comparing the two alloys, more favourable behaviour of oxidised E110G was observed regarding the oxidation kinetics, breakaway oxidation and load bearing capability in all cases. (author)
Silencing p110β prevents rapid depletion of nuclear pAkt
International Nuclear Information System (INIS)
Ye, Zhi-wei; Ghalali, Aram; Högberg, Johan; Stenius, Ulla
2011-01-01
Highlights: ► p110β was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. ► p110β knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. ► Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110β subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110β in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110β knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110β is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110β knock out cells. We also found that p110β was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110β is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
Silencing p110{beta} prevents rapid depletion of nuclear pAkt
Energy Technology Data Exchange (ETDEWEB)
Ye, Zhi-wei; Ghalali, Aram; Hoegberg, Johan [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden); Stenius, Ulla, E-mail: ulla.stenius@ki.se [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden)
2011-12-02
Highlights: Black-Right-Pointing-Pointer p110{beta} was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. Black-Right-Pointing-Pointer p110{beta} knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. Black-Right-Pointing-Pointer Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110{beta} subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110{beta} in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110{beta} knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110{beta} is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110{beta} knock out cells. We also found that p110{beta} was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110{beta} is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.
41 CFR 102-117.110 - What is satisfactory service?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...
Characteristics of first loaded IG-110 graphite in HTTR core
International Nuclear Information System (INIS)
Sumita, Junya; Shibata, Taiju; Iyoku, Tatsuo; Sawa, Kazuhiro; Hanawa, Satoshi; Ishihara, Masahiro
2006-10-01
IG-110 graphite is a fine-grained isotropic and nuclear-grade graphite with excellent resistivity on both irradiation and corrosion and with high strength. The IG-110 graphite is used for the graphite components of High Temperature Engineering Test Reactor (HTTR) such as fuel and control rod guide blocks and support posts. In order to design and fabricate the graphite components in the HTTR, the Japan Atomic Energy Research Institute (the Japan Atomic Energy Agency at present) had established the graphite structural design code and design data on the basis of former research results. After the design code establishment, the IG-110 graphite components were fabricated and loaded in the HTTR core. This report summarized the characteristics of the first loaded IG-110 graphite as basic data for surveillance test, measuring material characteristics changed by neutron irradiation and oxidation. By comparing the design data, it was shown that the first loaded IG-110 graphite had excellent strength properties and enough safety margins to the stress limits in the design code. (author)
Sengupta, Isha; Das, Dipanwita; Singh, Shivaram Prasad; Chakravarty, Runu; Das, Chandrima
2017-12-15
Promyelocytic leukemia nuclear bodies (PML-NB) are sub-nuclear organelles that are the hub of numerous proteins. DNA/RNA viruses often hijack the cellular factors resident in PML-NBs to promote their proliferation in host cells. Hepatitis B virus (HBV), belonging to Hepadnaviridae family, remains undetected in early infection as it does not induce the innate immune response and is known to be the cause of several hepatic diseases leading to cirrhosis and hepatocellular carcinoma. The association of PML-NB proteins and HBV is being addressed in a number of recent studies. Here, we report that the PML-NB protein Speckled 110 kDa (Sp110) is SUMO1-modified and undergoes a deSUMOylation-driven release from the PML-NB in the presence of HBV. Intriguingly, Sp110 knockdown significantly reduced viral DNA load in the culture supernatant by activation of the type I interferon-response pathway. Furthermore, we found that Sp110 differentially regulates several direct target genes of hepatitis B virus protein X (HBx), a viral co-factor. Subsequently, we identified Sp110 as a novel interactor of HBx and found this association to be essential for the exit of Sp110 from the PML-NB during HBV infection and HBx recruitment on the promoter of these genes. HBx, in turn, modulates the recruitment of its associated transcription cofactors p300/HDAC1 to these co-regulated genes, thereby altering the host gene expression program in favor of viral persistence. Thus, we report a mechanism by which HBV can evade host immune response by hijacking the PML-NB protein Sp110, and therefore, we propose it to be a novel target for antiviral therapy. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
40 CFR 415.110 - Applicability; description of the potassium metal production subcategory.
2010-07-01
... potassium metal production subcategory. 415.110 Section 415.110 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Potassium Metal Production Subcategory § 415.110 Applicability; description of the potassium metal production subcategory. The provisions of this subpart are applicable to discharges...
Tank characterization report for single-shell tank 241-U-110
International Nuclear Information System (INIS)
Brown, T.M.; Jensen, L.
1993-09-01
Tank 241-U-110 (U-110) is a Hanford Site waste tank that was;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report
24 CFR 100.110 - Discriminatory practices in residential real estate-related transactions.
2010-04-01
... residential real estate-related transactions. 100.110 Section 100.110 Housing and Urban Development... Discrimination in Residential Real Estate-Related Transactions § 100.110 Discriminatory practices in residential real estate-related transactions. (a) This subpart provides the Department's interpretation of the...
Bismuth-induced restructuring of the GaSb(110) surface
DEFF Research Database (Denmark)
Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.
1998-01-01
The structure of the GaSb(110)(1 x 2)-Bi reconstruction has been solved using surface x-ray diffraction, scanning tunneling microscopy, and photoelectron spectroscopy. The ideal GaSb(110) surface is terminated with zigzag chains of anions and cations running in the [1 (1) over bar 0] direction...
24 CFR 266.110 - Reserve requirements.
2010-04-01
... HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Housing Finance Agency Requirements § 266.110 Reserve requirements. (a) HFAs with top-tier designation or overall...
12 CFR 560.110 - Most favored lender usury preemption.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Most favored lender usury preemption. 560.110... INVESTMENT Lending and Investment Provisions Applicable to all Savings Associations § 560.110 Most favored... permits its most favored lender to charge late fees, then a savings association located in that state may...
21 CFR 333.110 - First aid antibiotic active ingredients.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false First aid antibiotic active ingredients. 333.110... (CONTINUED) DRUGS FOR HUMAN USE TOPICAL ANTIMICROBIAL DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE First Aid Antibiotic Drug Products § 333.110 First aid antibiotic active ingredients. The product consists of any of...
High-temperature oxidation kinetics of sponge-based E110 cladding alloy
Yan, Yong; Garrison, Benton E.; Howell, Mike; Bell, Gary L.
2018-02-01
Two-sided oxidation experiments were recently conducted at 900°C-1200 °C in flowing steam with samples of sponge-based Zr-1Nb alloy E110. Although the old electrolytic E110 tubing exhibited a high degree of susceptibility to nodular corrosion and experienced breakaway oxidation rates in a relatively short time, the new sponge-based E110 demonstrated steam oxidation behavior comparable to Zircaloy-4. Sample weight gain and oxide layer thickness measurements were performed on oxidized E110 specimens and compared to oxygen pickup and oxide layer thickness calculations using the Cathcart-Pawel correlation. Our study shows that the sponge-based E110 follows the parabolic law at temperatures above 1015 °C. At or below 1015 °C, the oxidation rate was very low when compared to Zircaloy-4 and can be represented by a cubic expression. No breakaway oxidation was observed at 1000 °C for oxidation times up to 10,000 s. Arrhenius expressions are given to describe the parabolic rate constants at temperatures above 1015 °C and cubic rate constants are provided for temperatures below 1015 °C. The weight gains calculated by our equations are in excellent agreement with the measured sample weight gains at all test temperatures. In addition to the as-fabricated E110 cladding sample, prehydrided E110 cladding with hydrogen concentrations in the 100-150 wppm range was also investigated. The effect of hydrogen content on sponge-based E110 oxidation kinetics was minimal. No significant difference was found between as-fabricated and hydrided samples with regard to oxygen pickup and oxide layer thickness for hydrogen contents below 150 wppm.
48 CFR 1337.110-71 - Additional DOC clauses related to service contracting.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Additional DOC clauses related to service contracting. 1337.110-71 Section 1337.110-71 Federal Acquisition Regulations System....110-71 Additional DOC clauses related to service contracting. (a) Insert a clause substantially...
24 CFR 598.110 - Tests of pervasive poverty, unemployment and general distress.
2010-04-01
..., unemployment and general distress. 598.110 Section 598.110 Housing and Urban Development Regulations Relating... TWO AND THREE DESIGNATIONS Eligibility Requirements § 598.110 Tests of pervasive poverty, unemployment...) Unemployment. Unemployment is demonstrated by: (1) The most recent data available indicating that the annual...
Magnetic properties of deformed dipole bands in 110,112Te
International Nuclear Information System (INIS)
Evans, A O; Paul, E S; Boston, A J; Chantler, H J; Chiara, C J; Devlin, M; Fletcher, A M; Fossan, D B; LaFosse, D R; Lane, G J; Lee, I Y; Macchiavelli, A O; Nolan, P J; Sarantites, D G; Sears, J M; Semple, A T; Smith, J F; Starosta, K; Vaman, C; Ragnarsson, I; Afanasjev, A V
2006-01-01
A lifetime analysis using the Doppler-shift attenuation method has been performed on the Tellurium isotopes 110,112 Te. The experiment was performed using the Gammasphere array in conjunction with the MICROBALL charged-particle detector. Three strongly coupled bands were previously established in 110,112 Te which were observed up to unusually high spins. In the current experiment, it has been possible to extract lifetime measurements using a Doppler broadened lineshape analysis on one of the ΔI=1 band structures in 110 Te. In contrast to similar ΔI=1 structures in other nuclei in this mass region, the extracted B(M1) values did not rapidly decrease with increasing angular momentum. Instead, the strongly coupled band in 110 Te represents a deformed 1p-1h structure, rather than a weakly deformed structure showing the shears mechanism
Atomic structures of Cd Te and Cd Se (110) surfaces
International Nuclear Information System (INIS)
Watari, K.; Ferraz, A.C.
1996-01-01
Results are reported based on the self-consistent density-functional theory, within the local-density approximation using ab-initio pseudopotentials of clean Cd Te and Cd Se (110) surfaces. We analyzed the trends for the equilibrium atomic structures, and the variations of the bond angles at the II-VI (110). The calculations are sensitive to the ionicity of the materials and the results are in agreement with the arguments which predict that the relaxed zinc-blend (110) surfaces should depend on ionicity. (author). 17 refs., 1 figs., 3 tabs
LSMO-STO(110) multilayered structure grown by metalorganic aerosol deposition
International Nuclear Information System (INIS)
Sapoval, Oleg; Belenchuk, Alexander; Canter, Valeriu; Zasavitsky, Efim; Moshnyaga, Vasily
2013-01-01
La 0.67 Sr 0.33 MnO 3 -SrTiO 3 multilayered structure was grown on SrTiO 3 (110) substrates by metalorganic aerosol deposition technique. The crystal structure was examined by X-ray analysis including simulation of diffraction and reflection patterns. The magneto transport properties of superlattice are presented. The critical thickness of (110)-oriented LSMO layers is lower than 7 perovskite unite cells. The oxygen stoichiometry provided due to high gas pressure conditions is responsible for reducing of critical thickness of LSMO layers at LSMO-STO(110) interfaces. (authors)
21 CFR 135.110 - Ice cream and frozen custard.
2010-04-01
...) of this section, the name of the food is “frozen custard” or “french ice cream” or “french custard... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Ice cream and frozen custard. 135.110 Section 135.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...
33 CFR 110.120 - San Luis Obispo Bay, Calif.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Luis Obispo Bay, Calif. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.120 San Luis Obispo Bay, Calif. (a) Area A-1. Area A-1 is the water area bounded by the San Luis Obispo County wharf, the shoreline, a line drawn...
Uniform Si nano-dot fabrication using reconstructed structure of Si(110)
Yano, Masahiro; Uozumi, Yuki; Yasuda, Satoshi; Asaoka, Hidehito
2018-06-01
Si nano-dot (ND) formation on Si(110) is observed by means of a scanning tunneling microscope (STM). The initial Si-NDs are Si crystals that are continuous from the substrate and grow during the oxide layer desorption. The NDs fabricated on the flat surface of Si(110)-1 × 1 are surrounded by four types of facets with almost identical appearance probabilities. An increase in the size of the NDs increases the variety of its morphology. In contrast, most Si-NDs fabricated on straight-stepped surface of Si(110)-16 × 2 reconstructed structure are surrounded by only a single type of facet, namely the \\text{Si}(17,15,1)-2 × 1 plane. An appearance probability of the facet in which the base line is along the step of Si(110)-16 × 2 exceeds 75%. This finding provides a fabrication technique of uniformed structural Si-NDs by using the reconstructed structure of Si(110).
Diffusion of cesium and iodine in compressed IG-110 graphite compacts
International Nuclear Information System (INIS)
Carter, L.M.; Brockman, J.D.; Robertson, J.D.; Loyalka, S.K.
2016-01-01
Nuclear graphite grade IG-110 is currently used in the High Temperature Engineering Test Reactor (HTTR) in Japan for certain permanent and replaceable core components, and is a material of interest in general. Therefore, transport parameters for fission products in this material are needed. Measurement of diffusion through pressed compacts of IG-110 graphite is experimentally attractive because they are easy to prepare with homogeneous distributions of fission product surrogates. In this work, we measured diffusion coefficients for Cs and I in pressed compacts made from IG-110 powder in the 1079–1290 K temperature range, and compared them to those obtained in as-received IG-110. - Highlights: • A method for analysis of fission product diffusion in graphite by ICP-MS was applied to pressed IG-110 graphite compacts containing cesium and iodine. • Diffusion coefficients for cesium and iodine were obtained. • The measurement design simulates HTGR conditions of high temperature and flowing helium.
Energy Technology Data Exchange (ETDEWEB)
Larbi, Ahmed; Viala, Pierre; Baron, Marie Pierre; Taourel, Patrice; Cyteval, Catherine [Hopital Lapeyronie, Medical Imaging Department, Montpellier Cedex 5 (France); Molinari, Nicolas [Hopital Lapeyronie, Medical Data Processing Department, Montpellier Cedex 5 (France); Lukas, Cedric [Hopital Lapeyronie, Rheumatology Department, Montpellier Cedex 5 (France)
2014-03-15
To assess sacroiliac joint (SIJ) modifications on MRI and their ability to predict axial spondyloarthritis (SpA) with the purpose of identifying parameters for future prospective studies. Retrospective study was carried out of 110 consecutive patients referred for SIJ MRI with coronal, axial short TI inversion recovery (STIR), and axial T1 sequences over 6 months. Factors associated with SpA, including MRI SIJ modifications (fat deposition, structural abnormalities on T1-weighted images, and bone marrow edema [BME] on STIR sequences) and age were explored using multivariate logistic regression. The reference diagnosis was made 1-1.5 years later based on clinical, radiological, and biological findings, according to Assessment of SpondyloArthritis International Society (ASAS) criteria. Twenty-eight patients were diagnosed with SpA (female/male: 19/9, age 41 ± 13 years). Abnormal findings were found in up to 21 % of patients without SpA (including 11 % with BME), versus 64 % of SpA patients (50 % with BME). A threshold age of 42.6 years was found to discriminate SpA patients (ROC AUC: 0.71, 95 % CI: 0.59-0.81). BME location in the sacral (OR: 7.07 [1.05, 47.6], p = 0.044) and both sacral and iliac areas (OR: 36.0 [5.61, 231], p = 0.0002), as well as age (OR: 0.95 [0.92, 0.98], p = 0.0019) were found to be independent predictors of SpA. 83.6 % of patients were effectively diagnosed using BME location and patient age in a classification and regression tree (CART) algorithm (sensitivity: 61 %, specificity: 91 %, PPV: 71 %, NPV: 87 %). The BME location combined with the patient's age (threshold 42.6 years) could help predict SpA. Further studies are required before these features can be used by radiologists to boost their confidence in reporting SIJ MRI. (orig.)
International Nuclear Information System (INIS)
Larbi, Ahmed; Viala, Pierre; Baron, Marie Pierre; Taourel, Patrice; Cyteval, Catherine; Molinari, Nicolas; Lukas, Cedric
2014-01-01
To assess sacroiliac joint (SIJ) modifications on MRI and their ability to predict axial spondyloarthritis (SpA) with the purpose of identifying parameters for future prospective studies. Retrospective study was carried out of 110 consecutive patients referred for SIJ MRI with coronal, axial short TI inversion recovery (STIR), and axial T1 sequences over 6 months. Factors associated with SpA, including MRI SIJ modifications (fat deposition, structural abnormalities on T1-weighted images, and bone marrow edema [BME] on STIR sequences) and age were explored using multivariate logistic regression. The reference diagnosis was made 1-1.5 years later based on clinical, radiological, and biological findings, according to Assessment of SpondyloArthritis International Society (ASAS) criteria. Twenty-eight patients were diagnosed with SpA (female/male: 19/9, age 41 ± 13 years). Abnormal findings were found in up to 21 % of patients without SpA (including 11 % with BME), versus 64 % of SpA patients (50 % with BME). A threshold age of 42.6 years was found to discriminate SpA patients (ROC AUC: 0.71, 95 % CI: 0.59-0.81). BME location in the sacral (OR: 7.07 [1.05, 47.6], p = 0.044) and both sacral and iliac areas (OR: 36.0 [5.61, 231], p = 0.0002), as well as age (OR: 0.95 [0.92, 0.98], p = 0.0019) were found to be independent predictors of SpA. 83.6 % of patients were effectively diagnosed using BME location and patient age in a classification and regression tree (CART) algorithm (sensitivity: 61 %, specificity: 91 %, PPV: 71 %, NPV: 87 %). The BME location combined with the patient's age (threshold 42.6 years) could help predict SpA. Further studies are required before these features can be used by radiologists to boost their confidence in reporting SIJ MRI. (orig.)
33 CFR 110.87 - Henderson Harbor, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Henderson Harbor, N.Y. 110.87... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.87 Henderson Harbor, N.Y. (a) Area A. The area in the... latitude 43°51′08.8″ N, longitude 76°12′08.9″ W, thence to latitude 43°51′09.0″ N, longitude 76°12′19.0″ W...
Energy Technology Data Exchange (ETDEWEB)
Schober, E. [Abt. Roentgen fuer Konservative Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria); Schima, W. [Abt. Roentgen fuer Konservative Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria); Pokieser, P. [Abt. Roentgen fuer Chirurgische Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria)
1995-10-01
The symptom is associated with a multitude of pharyngoesophageal abnormalities. Our study compares the diagnostic yield of videofluoroscopy to that of static radiography in patients suffering from globus pharnygis. A total of 150 consecutive patients complaining of a lump in the throat, but without evidence of dysphagia, were studied in a standardized fashion with both methods. Videofluoroscopy combined with static radiography revealed morphological or functional abnormalities in 75% of our patients. The combination of the two methods yielded significantly more abnormalities in the pharynx and esophagus than videofluoroscopy or static radiography alone. Esophageal motor disorders, pharyngoesophageal sphincter dysfunction and pharyngeal residue of contrast material proved to be the most common abnormalities. In conclusion, videofluoroscopy combined with static radiography is mandatory in the radiological assessment of patients suffering from the globus sensation. (orig.) [Deutsch] Unsere Studie vergleicht die diagnostische Wertigkeit des konventionellen Roentgens mit jener der Videokineamtographie von Pharynx und Oesophagus bei der Abklaerung des Globusgefuehls. Wir haben 150 konsekutive Patienten mit Globusgefuehl, jedoch ohne Dysphagie mit beiden Methoden nach einem standardisierten Protokoll untersucht. Mittels der Kombination von konventionellem Roentgen mit der Videokinematographie fanden sich bei 75% der Patienten pathologische Veraenderungen. Durch die Kombination beider Methoden konnten signifikant mehr morphologische und funktionelle Stoerungen des Pharynx sowie Oesophagus aufgezeigt werden, als mit der alleinigen konventionellen Technik oder der alleinigen Videokinematographie. Die haeufigsten pathologischen Veraenderungen in unserem Kollektiv waren Oesophagusmotilitaetsstoerungen, eine Dyskinesie des pharyngooesophagealen Sphinkters sowie eine abnorme pharyngeale Kontrastmittelretention. Unsere Ergebnisse belegen eindeutig, dass die radiologische
2010-01-01
.... Dispute means a program or financial disagreement which the recipient organization requests be handled... recipient organization and SBA. Grants Management Specialist. An SBA employee designated by the AA/SBDCs who... Circular A-110 and Attachment E of OMB Circular A-102. Program manager. An SBA employee responsible for...
33 CFR 110.31 - Hull Bay and Allerton Harbor at Hull, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull Bay and Allerton Harbor at Hull, Mass. 110.31 Section 110.31 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.31 Hull Bay and Allerton Harbor at...
International Nuclear Information System (INIS)
Cabot, C.; Della Negra, S.; Deprun, C.; Gauvin, H.; Le Beyec, Y.
1978-01-01
By 63 Cu induced reactions on 110 Cd, 108 Cd, 106 Cd, 109 Ag, 107 Ag and 110 Pd targets, new isotopes were searched in the Ir, Os, Re region. Cross bombardments and excitation function measurements were used to identify new α emitting isotopes. The α-decay measurements are compared to the Qα values obtained from different mass predictions
Orphan receptor GPR110, an oncogene overexpressed in lung and prostate cancer
International Nuclear Information System (INIS)
Lum, Amy M; Wang, Bruce B; Beck-Engeser, Gabriele B; Li, Lauri; Channa, Namitha; Wabl, Matthias
2010-01-01
GPR110 is an orphan G protein-coupled receptor--a receptor without a known ligand, a known signaling pathway, or a known function. Despite the lack of information, one can assume that orphan receptors have important biological roles. In a retroviral insertion mutagenesis screen in the mouse, we identified GPR110 as an oncogene. This prompted us to study the potential isoforms that can be gleaned from known GPR110 transcripts, and the expression of these isoforms in normal and transformed human tissues. Various epitope-tagged isoforms of GPR110 were expressed in cell lines and assayed by western blotting to determine cleavage, surface localization, and secretion patterns. GPR110 transcript and protein levels were measured in lung and prostate cancer cell lines and clinical samples, respectively, by quantitative PCR and immunohistochemistry. We found four potential splice variants of GPR110. Of these variants, we confirmed three as being expressed as proteins on the cell surface. Isoform 1 is the canonical form, with a molecular mass of about 100 kD. Isoforms 2 and 3 are truncated products of isoform 1, and are 25 and 23 kD, respectively. These truncated isoforms lack the seven-span transmembrane domain characteristic of GPR proteins and thus are not likely to be membrane anchored; indeed, isoform 2 can be secreted. Compared with the median gene expression of ~200 selected genes, GPR110 expression was low in most tissues. However, it had higher than average gene expression in normal kidney tissue and in prostate tissues originating from older donors. Although identified as an oncogene in murine T lymphomas, GPR110 is greatly overexpressed in human lung and prostate cancers. As detected by immunohistochemistry, GPR110 was overexpressed in 20 of 27 (74%) lung adenocarcinoma tissue cores and in 17 of 29 (59%) prostate adenocarcinoma tissue cores. Additionally, staining with a GPR110 antibody enabled us to differentiate between benign prostate hyperplasia and potential
10 CFR Appendix M to Part 110 - Categorization of Nuclear Material d
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Categorization of Nuclear Material d M Appendix M to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. M Appendix M to Part 110—Categorization of Nuclear Material d [From IAEA INFCIRC/225...
19 CFR 200.735-110 - Indebtedness.
2010-04-01
... Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-110 Indebtedness..., reflect adversely on the Government as his employer. In the event of a dispute between an employee and an...
Class IA phosphatidylinositol 3-kinase p110α regulates phagosome maturation.
Directory of Open Access Journals (Sweden)
Emily P Thi
Full Text Available Of the various phosphatidylinositol 3- kinases (PI3Ks, only the class III enzyme Vps34 has been shown to regulate phagosome maturation. During studies of phagosome maturation in THP-1 cells deficient in class IA PI3K p110α, we discovered that this PI3K isoform is required for vacuole maturation to progress beyond acquisition of Rab7 leading to delivery of lysosomal markers. Bead phagosomes from THP-1 cells acquired p110α and contained PI3P and PI(3,4,5P3; however, p110α and PI(3,4,5P3 levels in phagosomes from p110α knockdown cells were decreased. Phagosomes from p110α knock down cells showed normal acquisition of both Rab5 and EEA-1, but were markedly deficient in the lysosomal markers LAMP-1 and LAMP-2, and the lysosomal hydrolase, β-galactosidase. Phagosomes from p110α deficient cells also displayed impaired fusion with Texas Red dextran-loaded lysosomes. Despite lacking lysosomal components, phagosomes from p110α deficient cells recruited normal levels of Rab7, Rab-interacting lysosomal protein (RILP and homotypic vacuole fusion and protein sorting (HOPs components Vps41 and Vps16. The latter observations demonstrated that phagosomal Rab7 was active and capable of recruiting effectors involved in membrane fusion. Nevertheless, active Rab7 was not sufficient to bring about the delivery of lysosomal proteins to the maturing vacuole, which is shown for the first time to be dependent on a class I PI3K.
Uptake and excretion of 110mAg by Mud carp Cirrhina molitorella
International Nuclear Information System (INIS)
Chen Shunhua; Zhong Chuangguang
2004-01-01
Accumulation, excretion and tissue distribution of 110m Ag from both labeled food and water pathways in juvenile mud carp Cirrhina molitorella were investigated. Results indicated that the excretion rate of 110m Ag uptaken from artificial food pathway was very fast. 24 hours after feeding, the radioactivity of the fish decreased rapidly to 2.62% of the initial one and maintained the similar level afterwards in the 7 days excretion experiment. On the 7th day of excretion, the fish were dissected to separate the organs and tissues. The distribution of 110m Ag in the fish was uneven. Radioactivity of 110m Ag in the organs and tissues was in the order as liver>intestine>gall bladder>eye>gill>remainder>muscle. The radioactivity in liver, intestine and gall bladder were 48.14%, 18/43% and 15.43% of the total radioactivity of the fish, respectively. The accumulation of waterborne 110m Ag by mud carp showed that 110m Ag was easy to be uptaken by the fish. the concentration factors at 8th hour and 13th day were 23.8 and 208.6 respectively. Excretion of 110m Ag uptaken from water pathway was slower than that from food pathway. The radioactivity decreased to 20.1% and 16.7% on 15th and 28th day, respectively. The excretion procedure was composed of fast excretion phase (0-2d) and slow excretion phase (2-28d). The half-life of 110m Ag in mud carp in the slow excretion phase was 22d during the slow excretion phase. The distribution of 110m Ag in organs and tissues was mainly in viscera, which accounted for about 80% of the total radioactivity of the fish
Real-time simulation of an F110/STOVL turbofan engine
Drummond, Colin K.; Ouzts, Peter J.
1989-01-01
A traditional F110-type turbofan engine model was extended to include a ventral nozzle and two thrust-augmenting ejectors for Short Take-Off Vertical Landing (STOVL) aircraft applications. Development of the real-time F110/STOVL simulation required special attention to the modeling approach to component performance maps, the low pressure turbine exit mixing region, and the tailpipe dynamic approximation. Simulation validation derives by comparing output from the ADSIM simulation with the output for a validated F110/STOVL General Electric Aircraft Engines FORTRAN deck. General Electric substantiated basic engine component characteristics through factory testing and full scale ejector data.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.110 Cacao nibs. (a... is “cacao nibs”, “cocoa nibs”, or “cracked cocoa”. (1) When the cacao nibs, or the cacao beans from...
10 CFR 110.30 - Members of the Nuclear Suppliers Group.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Members of the Nuclear Suppliers Group. 110.30 Section 110.30 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND... Italy Japan Latvia Luxembourg Netherlands New Zealand Norway Poland Portugal Republic of Korea Romania...
Efficient reduction of Cys110 thiyl radical by glutathione in human myoglobin
Nagao, Satoshi; Asami, Osamu; Yasui, Hiroyuki; Hirota, Shun
2011-01-01
Human myoglobin (hMb) possesses a cysteine (Cys) residue which is rare among mammalian Mbs. To investigate the effects of this unique Cys residue at the amino acid position 110 (Cys110) on hMb reactions, we studied the reactions of wild type (WT) methMb and its alanine mutant at Cys110 (C110A) with H2O2, particularly in the presence of reduced glutathione (GSH) which is well known as a reducing agent. The formation rates of the ferryloxo (Fe(IV) = O) species by H2O2 under air were about the s...
[Microcontroller temperature regulator MPT110 for drying-sterilizing cabinets].
Kostin, N N; Gavrishchuk, V I; Zelepukin, S A; Shkulepa, V M; Zharov, E N
2002-01-01
The paper describes a MPT-110 temperature microcontroller developed by the closed joint-stock company "OPLEKS" (Orel, Russia) and the results of comparative tests performed in the @IIICC-80 drying sterilizing cabinet. The use of the MPT-110 controller is shown to improve the quality of control and to shorten the times that is taken for the cabinet to reach the preset temperature point.
49 CFR 110.90 - Grant monitoring, reports, and records retention.
2010-10-01
... TRANSPORTATION HAZARDOUS MATERIALS PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.90 Grant monitoring, reports... originally planned. (4) Financial reporting, except as provided in § 110.70 and 49 CFR 18.41, shall be... accordance with 49 CFR 18.42, all financial and programmatic records, supporting documents, statistical...
33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Galveston Harbor, Bolivar Roads Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following...
30 CFR 260.110 - What bidding systems may MMS use?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...
33 CFR 110.150 - Block Island Sound, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Block Island Sound, N.Y. 110.150... ANCHORAGE REGULATIONS Anchorage Grounds § 110.150 Block Island Sound, N.Y. (a) The anchorage ground. A 3/4... following coordinates: latitude 41°06′12″ N., longitude 72°00′05″ W., latitude 41°07′40″ N., longitude 72°01...
Epitaxial graphene-encapsulated surface reconstruction of Ge(110)
Campbell, Gavin P.; Kiraly, Brian; Jacobberger, Robert M.; Mannix, Andrew J.; Arnold, Michael S.; Hersam, Mark C.; Guisinger, Nathan P.; Bedzyk, Michael J.
2018-04-01
Understanding and engineering the properties of crystalline surfaces has been critical in achieving functional electronics at the nanoscale. Employing scanning tunneling microscopy, surface x-ray diffraction, and high-resolution x-ray reflectivity experiments, we present a thorough study of epitaxial graphene (EG)/Ge(110) and report a Ge(110) "6 × 2" reconstruction stabilized by the presence of epitaxial graphene unseen in group-IV semiconductor surfaces. X-ray studies reveal that graphene resides atop the surface reconstruction with a 0.34 nm van der Waals (vdW) gap and provides protection from ambient degradation.
Facile Dehydrogenation of Ethane on the IrO2(110) Surface.
Bian, Yingxue; Kim, Minkyu; Li, Tao; Asthagiri, Aravind; Weaver, Jason F
2018-02-21
Realizing the efficient and selective conversion of ethane to ethylene is important for improving the utilization of hydrocarbon resources, yet remains a major challenge in catalysis. Herein, ethane dehydrogenation on the IrO 2 (110) surface is investigated using temperature-programmed reaction spectroscopy (TPRS) and density functional theory (DFT) calculations. The results show that ethane forms strongly bound σ-complexes on IrO 2 (110) and that a large fraction of the complexes undergo C-H bond cleavage during TPRS at temperatures below 200 K. Continued heating causes as much as 40% of the dissociated ethane to dehydrogenate and desorb as ethylene near 350 K, with the remainder oxidizing to CO x species. Both TPRS and DFT show that ethylene desorption is the rate-controlling step in the conversion of ethane to ethylene on IrO 2 (110) during TPRS. Partial hydrogenation of the IrO 2 (110) surface is found to enhance ethylene production from ethane while suppressing oxidation to CO x species. DFT predicts that hydrogenation of reactive oxygen atoms of the IrO 2 (110) surface effectively deactivates these sites as H atom acceptors, and causes ethylene desorption to become favored over further dehydrogenation and oxidation of ethane-derived species. The study reveals that IrO 2 (110) exhibits an exceptional ability to promote ethane dehydrogenation to ethylene near room temperature, and provides molecular-level insights for understanding how surface properties influence selectivity toward ethylene production.
A novel 1,10-seco withanolide from Physalis peruviana.
Fang, Sheng-Tao; Liu, Ji-Kai; Li, Bo
2010-07-01
A novel 1,10-seco withanolide, 1,10-seco withaperuvin C (1), together with four known withanolides, 4 beta-hydroxywithanolide E (2), visconolide (3), withanolide F (4), and withaphysanolide (5), was isolated from the aerial parts of Physalis peruviana. The structures of compounds 1-5 were determined on the basis of spectroscopic methods including extensive 1D and 2D NMR analysis. In addition, the possible biogenetic relationships among these five withanolides are discussed.
24 CFR 811.110 - Refunding of obligations issued to finance Section 8 projects.
2010-04-01
... finance Section 8 projects. 811.110 Section 811.110 Housing and Urban Development Regulations Relating to... RELATED AMENDMENTS § 811.110 Refunding of obligations issued to finance Section 8 projects. (a) This... refunding which generate the McKinney Act savings and, if necessary, HUD will finance in refunding bond debt...
33 CFR 110.8 - Lake Champlain, N.Y. and Vt.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Champlain, N.Y. and Vt. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.8 Lake Champlain, N.Y. and Vt. (a) Ticonderoga, N.Y. An area shoreward of a line bearing 312° from Ticonderoga Light to the southeast corner of the...
Directory of Open Access Journals (Sweden)
Rabea eMüller
2013-03-01
Full Text Available In cells cultured from neocortex of newborn rats, phosphoinositide-3-kinases of class I regulate the DNA synthesis in a subgroup of astroglial cells. We have studied the location of these cells as well as the kinase isoforms which facilitate the S phase entry. Using dominant negative isoforms as well as selective pharmacological inhibitors we quantified S phase entry by nuclear labeling with bromodeoxyuridine. Only in astroglial cells harvested from the marginal zone of the neocortex inhibition of phosphoinositide-3-kinases reduced the nuclear labeling with bromodeoxyuridine, indicating that neocortical astroglial cells differ in the regulation of proliferation. The two kinase isoforms p110 and p110were essential for S phase entry. p110 diminished the level of the p27Kip1 which inactivates the complex of cyclin E and CDK2 necessary for entry into the S phase. p110phosphorylated and inhibited glycogen synthase kinase-3which can prevent S-phase entry. Taken together, both isoforms mediated S phase in a subgroup of neocortical astroglial cells and acted via distinct pathways.
42 CFR 415.110 - Conditions for payment: Medically directed anesthesia services.
2010-10-01
... anesthesia services. 415.110 Section 415.110 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... directed anesthesia services. (a) General payment rule. Medicare pays for the physician's medical direction of anesthesia services for one service or two through four concurrent anesthesia services furnished...
45 CFR 2490.110 - Self-evaluation.
2010-10-01
... Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.110 Self-evaluation. (a) The agency shall, by November 28...
45 CFR 1706.110 - Self-evaluation.
2010-10-01
... Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the effects thereof...
40 CFR 5.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 5.110 Section 5.110 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...
13 CFR 113.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...
36 CFR 1211.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... action and self-evaluation. 1211.110 Section 1211.110 Parks, Forests, and Public Property NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...
7 CFR 1710.110 - Supplemental financing.
2010-01-01
... and Basic Policies § 1710.110 Supplemental financing. (a) Except in the case of financial hardship as determined by the Administrator, and following certain mergers, consolidations, and transfers of systems... merger, consolidation, or transfer of system substantially in its entirety, and the provisions of 7 CFR...
13 CFR 108.110 - Qualified management.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Qualified management. 108.110... management. An Applicant must show, to the satisfaction of SBA, that its current or proposed management team... or proposed management team has sufficient qualifications, SBA will consider information provided by...
12 CFR 1815.110 - Categorical exclusion.
2010-01-01
... permanent capital and/or liquidity of an applicant; (m) Actions where no use of Federal funds is involved in....110 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY... EIS or environmental assessment if the designated Fund official determines it meets the criteria...
31 CFR 28.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
..., 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall, within... self-evaluation. 28.110 Section 28.110 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL...
45 CFR 618.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 3 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 618.110 Section 618.110 Public Welfare Regulations Relating to Public Welfare (Continued...
45 CFR 2555.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 4 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 2555.110 Section 2555.110 Public Welfare Regulations Relating to Public Welfare (Continued...
24 CFR 3.110 - Remedial and affirmative action and self-evaluation.
2010-04-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... self-evaluation. 3.110 Section 3.110 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR...
18 CFR 1317.110 - Remedial and affirmative action and self-evaluation.
2010-04-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... affirmative action and self-evaluation. 1317.110 Section 1317.110 Conservation of Power and Water Resources TENNESSEE VALLEY AUTHORITY NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...
38 CFR 23.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... action and self-evaluation. 23.110 Section 23.110 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...
International Nuclear Information System (INIS)
Kingsley, D.P.E.; Kendall, B.E.; Fitz, C.R.; Hospital for Sick Children, London
1986-01-01
CT scans on 110 children with a diagnosis of tuberous sclerosis have been compared with the clinical features of the disease. Patients with definite radiological as well as definite or suggestive clinical features accounted for only 80% of cases. 16% had positive radiological and negative clinical features and 4% had positive clinical and negative radiological features. There is little relationship between the mental development and the incidence of periventricular tubers or cortical and parenchymal lesions. In 15 patients older than 7 years the diagnosis was only made at the time of CT. Cerebral atrophy was not a prominent feature. Giant cell astrocytomas were present in 14%, one third of whom presented for the first time. (orig.)
11 CFR 110.13 - Candidate debates.
2010-01-01
... debates include at least two candidates; and (2) The staging organization(s) does not structure the... PROHIBITIONS § 110.13 Candidate debates. (a) Staging organizations. (1) Nonprofit organizations described in 26..., subparts D and E. (b) Debate structure. The structure of debates staged in accordance with this section and...
33 CFR 110.232 - Southeast Alaska.
2010-07-01
... explosives anchorage. (5) A wooden vessel must: (i) Be fitted with a radar reflector screen of metal of sufficient size to permit target indication on the radar screen of commercial type radar; or (ii) Have steel... 110.232 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES...
45 CFR 1181.110 - Self-evaluation.
2010-10-01
... HUMANITIES INSTITUTE OF MUSEUM AND LIBRARY SERVICES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE INSTITUTE OF MUSEUM AND LIBRARY SERVICES § 1181.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the...
Tank characterization report for single-shell tank 241-U-110. Revision 1
Energy Technology Data Exchange (ETDEWEB)
Brown, T.M.; Jensen, L.
1993-09-01
Tank 241-U-110 (U-110) is a Hanford Site waste tank that was ;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report.
Spin transport anisotropy in (110)GaAs
Energy Technology Data Exchange (ETDEWEB)
Odilon, D.D.C. Jr.; Rudolph, Joerg; Hey, Rudolf; Santos, Paulo V. [Paul-Drude-Institut fuer Festkoerperelektronik, Berlin (Germany); Iikawa, Fernando [Universidade Estadual de Campinas, IFGW, Campinas SP (Brazil)
2007-07-01
Mobile piezoelectric potentials are used to coherently transport electron spins in GaAs(110) quantum wells (QW) over distances exceeding 60{mu}m. We demonstrate that the dynamics of mobile spins under external magnetic fields depends on the direction of motion in the QW plane. The weak piezoelectric fields impart a non-vanishing average velocity to the carriers, allowing for the direct observation of the carrier momentum dependence of the spin polarization dynamics. While transport along [001] direction presents high in-plane spin relaxation rates, transport along [ anti 110] shows a much weaker external field dependence due to the non-vanishing internal magnetic field. We show that the anisotropy is an intrinsic property of the underling GaAs matrix, associated with the bulk inversion asymmetry contribution to the LS-coupling.
10 CFR 5.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Remedial and affirmative action and self-evaluation. 5.110 Section 5.110 Energy NUCLEAR REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... action and self-evaluation. (a) Remedial action. If the designated agency official finds that a recipient...
38 CFR 51.110 - Resident assessment.
2010-07-01
...) PER DIEM FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.110 Resident assessment. The... physician orders for the resident's immediate care and a medical assessment, including a medical history and...) Review of assessments. The nursing facility management must examine each resident no less than once every...
29 CFR 36.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Remedial and affirmative action and self-evaluation. 36.110 Section 36.110 Labor Office of the Secretary of Labor NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...
27 CFR 24.110 - Organizational documents.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Organizational documents..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Application § 24.110 Organizational... under control number 1512-0058) [T.D. ATF-299, 55 FR 24989, June 19, 1990, as amended by T.D. ATF-409...
40 CFR 427.110 - Applicability; description of the wet dust collection subcategory.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the wet dust collection subcategory. 427.110 Section 427.110 Protection of Environment ENVIRONMENTAL PROTECTION... (particulates) from atmospheric emissions by means of wet scrubbers. ...
47 CFR 25.110 - Filing of applications, fees, and number of copies.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Filing of applications, fees, and number of copies. 25.110 Section 25.110 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing...
Energy Technology Data Exchange (ETDEWEB)
Mu, Rende, E-mail: dallasbiam@163.com [Beijing Institute of Aeronautical Materials, Aviation Key Laboratory of Science and Technology on Advanced Corrosion and Protection for Aviation Material, Department 5, P.O. Box 81-5, Beijing 100095 (China); Tan, Chengwen; Yu, Xiaodong [School of Material Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China)
2016-05-05
Tungsten single crystal and poly crystal were treated by electrolytic etching in a 3% by weight solution of NaOH in distilled water. The method for determining the proportion of {110} planes and characteristic morphology on the coating surface after electrolytic etching were investigated using EBSD and auto-focusing microscope. Then the optimization of process parameters for electrolytic etching is achieved. In order to compare the effect of process parameters, three process parameters were selected for the tungsten single crystal electrolytic etching. Through analyzing the change of {110} planes' proportion, we found that when the coatings are etched with 1.4 amp/cm{sup 2} and 3 min, {110} planes can be exposed in the greatest degree that can reach 61.4% on tubular surfaces. The proposed approach greatly improves the proportion of {110} planes relative to the original surface. - Highlights: • Tungsten single/poly crystals treated by electrolytic etching in solution of NaOH. • The {110} planes have the lower surface free energy than {112}. • Some {112} planes etched firstly, the {110} planes exposed at last during etching. • {110} planes exposed to the greatest extent with 1.4 amp/cm{sup 2} and 3 min.
Tank 241-BY-110 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
41 CFR 101-4.110 - Remedial and affirmative action and self-evaluation.
2010-07-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... action and self-evaluation. 101-4.110 Section 101-4.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 4-NONDISCRIMINATION...
48 CFR 49.110 - Settlement negotiation memorandum.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Settlement negotiation... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.110 Settlement negotiation memorandum. (a) The TCO shall, at the conclusion of negotiations, prepare a settlement negotiation memorandum...
40 CFR 417.110 - Applicability; description of the SO3 solvent and vacuum sulfonation subcategory.
2010-07-01
... solvent and vacuum sulfonation subcategory. 417.110 Section 417.110 Protection of Environment... POINT SOURCE CATEGORY SO3 Solvent and Vacuum Sulfonation Subcategory § 417.110 Applicability; description of the SO3 solvent and vacuum sulfonation subcategory. The provisions of this subpart are...
46 CFR 110.15-1 - Definitions.
2010-10-01
... vessel that normally navigates the waters of any ocean or the Gulf of Mexico 20 nautical miles or less... 110.10-1), section 4-8-3/11. Ocean vessel means a vessel that navigates the waters of any ocean or the... means a vessel that navigates exclusively on the Great Lakes and their connecting and tributary waters...
Cytomorphological Spectrum of Thyroiditis: A Review of 110 Cases
Nair, Rahul; Gambhir, Anushree; Kaur, Supreet; Pandey, Aditi; Shetty, Abhinav; Naragude, Piyusha
2018-01-01
Introduction Different types of thyroiditis may share some parallel clinical and biochemical features. Timely intervention can significantly reduce morbidity and mortality. Aim Aim of this study is to find the frequency of various thyroiditis, study the cytomorphological features and correlate with clinical findings including radiological findings, thyroid function test, and anti-thyroid peroxidase antibodies (Anti-TPO antibodies). Materials and Methods The study included consecutive 110 cases of thyroiditis. Detailed cytomorphological features were studied and correlated with ultrasonography findings, thyroid function test, anti-thyroid peroxidase antibodies (anti-TPO) and histopathological features where thyroidectomy specimens were received for histopathological examination. Results The majority were Hashimoto's thyroiditis (n = 100) and females (n = 103). Other forms of thyroiditis were Hashimoto's thyroiditis with colloid goiter (n = 5), De Quervain's thyroiditis (n = 3), and one case each of postpartum thyroiditis and Hashimoto's thyroiditis with associated malignancy. The majority of patients were in the age group of 21–40 (n = 70) and the majority (n = 73) had diffuse enlargement of thyroid. The majority of patients were hypothyroid (n = 52). The serum anti-TPO antibodies were elevated in 47 patients out of 71 patients. In the 48 patients who underwent ultrasonography, 38 were diagnosed as having thyroiditis. The most consistent cytomorphological features seen in fine-needle aspiration smears of Hashimoto's thyroiditis were increased background lymphocytes, lymphocytic infiltration of thyroid follicular cell clusters, and Hurthle cells. Conclusion The diagnostic cytological features in Hashimoto's thyroiditis are increased background lymphocytes, lymphocytic infiltration of thyroid follicular cell clusters, and Hurthle cells. FNAC remains the “Gold Standard” for diagnosing Hashimoto's thyroiditis. Clinical history, thyroid function, and biochemical
7 CFR 1221.110 - Powers and duties.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.110 Powers and duties. The Board shall have the following powers and duties: (a) To...
Mechanisms of self-diffusion on Pt(110)
DEFF Research Database (Denmark)
Lorensen, Henrik Qvist; Nørskov, Jens Kehlet; Jacobsen, Karsten Wedel
1999-01-01
The self-diffusion of Pt on the missing row reconstructed Pt(110) surface is discussed based on density functional calculations of activation energy barriers. Different competing diffusion mechanisms are considered and we show that several different diffusion paths along the reconstruction troughs...
The study of geometric structure of Na films on Cu(110)
International Nuclear Information System (INIS)
Zeybek, O.
2004-01-01
In order to understand the geometric structure of Na films on Cu( 110) substrate, a couple of surface science techniques have been applied in this study. The thickness of the Na films were calculated using X-ray Photoelectron Spectroscopy data and Mean Free Path. The coverages were compared with the work function changes in this study and other investigations. Sub-monolayer and up to 2 ML thickness of Na films on Cu(110) have been investigated using Low Energy Electron Diffraction (LEED) and Ultra Violet Inverse Photoelectron Spectroscopy. It is found that the (1 x 1) LEED pattern of Cu(110) changes to (1 x 2) with increasing Na coverage up to 1 ML. Af ter 1 ML Na films, LEED shows again (1 x 1) structure
41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?
2010-07-01
... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...
Atomic and molecular adsorption on Fe(110)
Xu, Lang; Kirvassilis, Demetrios; Bai, Yunhai; Mavrikakis, Manos
2018-01-01
Iron is the principal catalyst for the ammonia synthesis process and the Fischer-Tropsch process, as well as many other heterogeneously catalyzed reactions. It is thus of fundamental importance to understand the interactions between the iron surface and various reaction intermediates. Here, we present a systematic study of atomic and molecular adsorption behavior over Fe(110) using periodic, self-consistent density functional theory (DFT-GGA) calculations. The preferred binding sites, binding energies, and the corresponding surface deformation energies of five atomic species (H, C, N, O, and S), six molecular species (NH3, CH4, N2, CO, HCN, and NO), and eleven molecular fragments (CH, CH2, CH3, NH, NH2, OH, CN, COH, HCO, NOH, and HNO) were determined on the Fe(110) surface at a coverage of 0.25 monolayer. The binding strengths calculated using the PW91 functional decreased in the following order: C > CH >N > O > S > NH > COH > CN > CH2 > NOH > OH > HNO > HCO > NH2 > H > NO > HCN > CH3 > CO > N2 > NH3. No stable binding structures were observed for CH4. The estimated diffusion barriers and pathways, as well as the adsorbate-surface and intramolecular vibrational modes of all the adsorbates at their preferred binding sites, were identified. Using the calculated adsorption energetics, we constructed the potential energy surfaces for a few surface reactions including the decomposition of methane, ammonia, dinitrogen, carbon monoxide, and nitric oxide. These potential energy surfaces provide valuable insight into the ability of Fe(110) to catalyze common elementary steps.
Modified energetics and growth kinetics on H-terminated GaAs (110)
International Nuclear Information System (INIS)
Galiana, B.; Benedicto, M.; Díez-Merino, L.; Tejedor, P.; Lorbek, S.; Hlawacek, G.; Teichert, C.
2013-01-01
Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As 4 , has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å 2 measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As 4 molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed
Modified energetics and growth kinetics on H-terminated GaAs (110)
Energy Technology Data Exchange (ETDEWEB)
Galiana, B. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Departamento de Física, Universidad Carlos III de Madrid, Avenida de la Universidad 30, 28911 Madrid (Spain); Benedicto, M.; Díez-Merino, L.; Tejedor, P. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Lorbek, S.; Hlawacek, G.; Teichert, C. [Institut für Physik, Montanuniversität Leoben, Franz Josef St., 18A-8700 Leoben (Austria)
2013-10-28
Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As{sub 4}, has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å{sup 2} measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As{sub 4} molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed.
High-Statistics Study of the β+/EC-Decay of 110In
Diaz Varela, A.; Garrett, P. E.; Ball, G. C.; Banjay, J. C.; Cross, D. S.; Demand, G. A.; Finlay, P.; Garnsworthy, A. B.; Green, K. L.; Hackman, G.; Kulp, W. D.; Leach, K. G.; Orce, J. N.; Phillips, A. A.; Rand, E. T.; Svensson, C. E.; Sumithrarachchi, C.; Triambak, S.; Wong, J.; Wood, J. L.; Yates, S. W.
2014-03-01
A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC) facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ - γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ - γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ) reaction with monoenergetic neutrons for the calculation of B(E2) values and these results have lead to the proposal of a γ-soft rotor, or O(6) nucleus, rather than a vibrational, or U(5) pattern for the nature of the low-lying, low-spin levels in 110Cd.
High-Statistics Study of the β+/EC-Decay of 110In
Directory of Open Access Journals (Sweden)
Varela A. Diaz
2014-03-01
Full Text Available A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ − γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ − γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ reaction with monoenergetic neutrons for the calculation of B(E2 values and these results have lead to the proposal of a γ-soft rotor, or O(6 nucleus, rather than a vibrational, or U(5 pattern for the nature of the low-lying, low-spin levels in 110Cd.
15 CFR 8a.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
.... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 8a.110 Section 8a.110 Commerce and Foreign Trade Office of the Secretary of Commerce NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...
37 CFR 1.10 - Filing of correspondence by “Express Mail.”
2010-07-01
... Office to Addressee” service of the United States Postal Service (USPS) will be considered filed with the...Express Mail.â 1.10 Section 1.10 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions General...
Directory of Open Access Journals (Sweden)
Nicandro de Figueiredo Neto
1996-06-01
Full Text Available Apresentamos uma série consecutiva de 110 pacientes com hematoma subdural agudo traumático (HSDA admitidos no serviço de emergência do HBDF no período de 1°-janeiro a 1°-dezembro-1994. Todos os pacientes foram atendidos de acordo com o mesmo protocolo. Houve predominância do sexo masculino (79%, com idade variando entre 14 e 70 anos, sendo os atropelamentos (34% e os acidentes automobilísticos (20% as causas mais comuns. A maioria dos pacientes (85,7% foi admitida muito grave, com 8 pontos ou menos na Escala de Coma Glasgow (ECG, o que influenciou diretamente na mortalidade. A tomografia computadorizada de crânio foi o exame diagnóstico de escolha que mostrou serem as contusões e o inchaço cerebral ("swelling" as lesões intracranianas associadas mais freqüentes. A cirurgia foi realizada em 45,1% dos pacientes, e, em sua maioria, através de craniotomia fronto-têmporo-parietal ampla, com drenagem do hematoma, seguida de plástica da dura-mater. Em 54,9% as condições clínicas não permitiram a realização da cirurgia; neste grupo, cerca de 69,6% estavam em coma profundo à admissão, com 3 pontos na ECG. A letalidade cirúrgica foi de 61,2% e esteve diretamente relacionada à condição clínica inicial e à idade do paciente. A letalidade, incluindo todos os pacientes cirúrgicos e não cirúrgicos com HSDA, mesmo aqueles admitidos já com sinais de falência de tronco cerebral, foi de 79,5%. Além destes pacientes que faleceram, cerca de 7% evoluíram sem seqüelas ou com seqüelas mínimas; outros 11,4% com seqüelas de moderadas a paves e 2,1 % permaneceram em estado vegetativo persistente. Nossos dados estão de acordo com os da literatura no que se refere a elevada taxa de morbidade e mortalidade dos pacientes com HSDA.We report a series of 110 patients with acute traumatic subdural hematoma (ASDH admitted at HBDF emergency within 1994 (January Is1 to December PJ.All patients were treated according to the same protocol
Nuclear-physical properties of 105,106m,110mAg
International Nuclear Information System (INIS)
Popov, Yu. S.; Zakharova, L. V.; Sadulin, V. V.; Andreev, O. I.; Pakhomov, A. N.
2005-01-01
The nuclear-physical properties of the nuclides 105,106m,110m Ag, which are concomitant nuclides in reactor production of 103 Pd and 109 Cd used in metrology of ionizing radiations and in nuclear medicine, were studied. The following quantities were determined by semiconductor X-ray and γ-ray spectrometry: the parameter K α /K β of X-ray K radiation accompanying the decay of 110m Ag and the intensities of γ-ray quanta with the energies of 280 and 345 keV ( 105 Ag); 430, 451, and 512 keV ( 106m Ag); 658, 764, 885, 938, and 1384 keV ( 110m Ag). The half-lives determined using the above γ-ray lines are as follows: T 1/2 ( 105 Ag) = 41.2 ± 0.1 days; T 1/2 ( 106m Ag) = 8.30 ± 0.07 days. The errors are given for 95% confidence level [ru
First-principles studies on the adsorption of molecular oxygen on Ba(110) surface
International Nuclear Information System (INIS)
Li, S.F.; Xue Xinlian; Li Pinglin; Li Xinjian; Jia Yu
2006-01-01
The adsorption of O 2 on Ba(110) surface is studied with first-principles calculations based on density functional theory. Our calculations predict that O 2 may prefer to dissociative adsorption on Ba(110) surface without obvious barrier. Also our results do not support the model of charge transfer from the surface to the molecule as a bond breaking mechanism. Instead, the increasing hybridization between O 2 orbitals and the d states of Ba(110) surface may play an important role in the dissociation adsorption
12 CFR 1.110 - Taxing powers of a State or political subdivision.
2010-01-01
... impact of any possible limitations regarding the State's or political subdivision's taxing powers, as... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Taxing powers of a State or political subdivision. 1.110 Section 1.110 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY...
Management of Contracts for F110 Engine Procurements
National Research Council Canada - National Science Library
Granetto, Paul
2001-01-01
This audit was performed in response to an allegation to the Defense Hotline that the Wright-Patterson Air Force Base Procurement Contracting Office made poor procurement decisions on F110 aircraft engine contracts...
29 CFR 779.110 - Employees in retailing whose activities may bring them under the Act.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Employees in retailing whose activities may bring them under the Act. 779.110 Section 779.110 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR... Production of Goods for Commerce § 779.110 Employees in retailing whose activities may bring them under the...
Nitrogen adsorption on Fe(111), (100), and (110) surfaces
DEFF Research Database (Denmark)
Mortensen, Jens Jørgen; Ganduglia-Pirovano, Veronica; Hansen, Lars Bruno
1999-01-01
Adsorption energies and structures for N atoms on three low-index surfaces of Fe have been calculated using density functional theory (DFT) and the generalized gradient approximation (GGA). At low N coverage the adsorption energy on Fe(100) is found to be similar to 0.7 eV higher than on the (111......) and (110) surfaces - particularly the c(2 x 2)-N/Fe(100) structure with the N atoms in four-fold sites is very stable. We attribute the differences in adsorption energy to the lack of four-fold sites on the (111) and (110) surfaces, We suggest that at higher N coverages, islands with a structure similar...
Patient information and patient preparation in orthognathic surgery : A medical audit study
Rittersma, J.; Casparie, A.F.; Reerink, E.
1980-01-01
In 110 patients who had undergone various kinds of orthognathic surgery, patient satisfaction was measured by means of a written questionnaire. Ninety-four percent expressed satisfaction, both with regard to total preparation and the final outcome of the surgical procedure itself. Twenty to forty
El Hamdani, H.; El Amane, M.; Duhayon, C.
2018-03-01
Co-crystal of 1,10-phenanthrolin-1-ium-caffeine-hexafluorophosphate was synthesized, studied by FTIR, 1H, 13C NMR, DSC and X-ray structure and crystallized in the monoclinic space group C2/c. The unit cell parameters are a = 19.3761 (3), b = 17.9548 (3), c = 13.8074 (3) with β = 117.8132 (10). The final R value is 0.069 for 29,522 measured reflections. The co-crystal structure analysis indicate the 1,10-phenanthroline is protonated by one nitrogen atom and formed the 1,10-phenanthrolin-1-ium cation, which is stabilized by hydrogen bonds N+-H…Odbnd C interaction with carbonyl and imidazol ring in caffeine molecule. The intermolecular hydrogen bonds: Csbnd H...O, Csbnd H...N, Nsbnd H...O, Csbnd H...F and intramolecular hydrogen bond: C1sbnd H12...O14, together play a vital role in stabilizing the structure of co-crystal. The X-ray structural analysis confirm the assignments of the structure from infrared, 1H, 13C NMR, spectroscopic data DSC and molar conductivity analysis. The antimicrobial activity of the co-crystal was studied.
27 CFR 1.10 - Meaning of terms.
2010-04-01
..., NONINDUSTRIAL USE OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Definitions § 1.10... the Federal Alcohol Administration Act, Nonindustrial Use of Distilled Spirits and Wine, Bulk Sales... to engage in activities at a particular location. Brandy. Brandy or wine spirits for addition to...
40 CFR 180.110 - Maneb; tolerances for residues.
2010-07-01
... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.110... None Pepper 7 None Potato 0.1 None Pumpkin 7 None Squash, summer 4 None Squash, winter 4 None Tomato 4...
10 CFR 110.26 - General license for the export of nuclear reactor components.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false General license for the export of nuclear reactor components. 110.26 Section 110.26 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF... Denmark Finland France Germany Greece Indonesia Ireland Italy Japan Latvia Lithuania Luxembourg...
108mAg and 110mAg in crassostrea gigas
International Nuclear Information System (INIS)
Ishikawa, Y.; Sato, N.; Nakamura, E.; Sekine, T.; Yoshihara, K.
1992-01-01
Accumulation of radiosilver 108m Ag and 110m Ag in oysters (Crassostrea gigas) and their behavior in marine environments has been studied in the northeast Pacific coast in Japan. Enrichment of radiosilver in oysters depends on topographical conditions; significant bioaccumulation occurred in open bays, while it was hardly observed in bays with narrow shaped entrances. From these observations difference of the behavior of radiosilver between open and nearly closed bays is suggested. 110m Ag in oysters decayed with an effective half-life of about 150 days for both the Chinese nuclear weapon test and the Chernobyl accident. In contrast to radiosilver, the fission product nuclide 137 Cs was almost independent of topographical conditions, and its concentration was constant. 110m Ag bioaccumulation in oysters after the Chernobyl accident in 1986 was found in both open and nearly closed bays, the lattershowing much lower concentration of radiosilver than the former. Specific activity of 108m Ag in oysters was determined in bays open to the Pacific Oceans. (author) 13 refs.; 4 figs.; 3 tabs
Higuchi, Yoshinori; Nagano, Osamu; Sato, Yasunori; Yamamoto, Masaaki; Ono, Junichi; Saeki, Naokatsu; Miyakawa, Akifumi; Hirai, Tatsuo
2012-01-01
Objective The Japan Leksell Gamma Knife (JLGK) Society has conducted a prospective multi-institute study (JLGK0901, UNIN000001812) for selected patients in order to prove the effectiveness of stereotactic radiosurgery (SRS) alone using the gamma knife (GK) for 1-10 brain lesions. Herein, we verify the validity of 5 major patient selection criteria for the JLGK0901 trial. Materials and Methods Between 1998 and 2010, 2246 consecutive cases with 10352 brain metastases treated with GK were analyzed to determine the validity of the following 5 major JLGK0901 criteria; 1) 1-10 brain lesions, 2) less than 10 cm3 volume of the largest tumor, 3) no more than 15 cm3 total tumor volume, 4) no cerebrospinal fluid (CSF) dissemination, 5) Karnofsky performance status (KPS) score ≥70. Results For cases with >10 brain metastases, salvage treatments for new lesions were needed more frequently. The tumor control rate for lesions larger than 10 cm3 was significantly lower than that of tumors 15 cm3 total tumor volume or positive magnetic resonance imaging findings of CSF were significantly poorer. Outcomes in cases with KPS <70 were significantly poorer in terms of OS. Conclusion Our retrospective results of 2246 GK-treated cases verified the validity of the 5 major JLGK0901 criteria. The inclusion criteria for the JLGK0901 study are appearently good indications for SRS. PMID:29296339
33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.
2010-07-01
... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi Sound...
Simple countermeasures against the TM110-beam-blowup-mode in biperiodic structures
International Nuclear Information System (INIS)
Euteneuer, H.; Herminghaus, H.; Schoeler, H.
1984-01-01
The two fundamental methods of fighting beam blow-up in rf-accelerating-structures are staggered detuning and selective Q-spoiling of their higher order modes. Biperiodic structures offer a very simple way of applying the latter technique of the most dangerous TM 110 -like blowup mode at 1.7 times the accelerating frequency: letting this mode propagate but giving a large gap to the TM 110 -passband. This gap must be positive for electric coupling (f(phi=0) =1.7c. With asymmetric coupling elements between the cavities of a structure, one has a simple tool for staggered detuning: a change of the relative orientation of these elements spreads the resonance frequencies not only of the TM 110 -mode, but of at least all dipole modes. (orig.)
Hydrogen-promoted chlorination of RuO2(110)
Hofmann, J.P.; Zweidinger, S.; Knapp, M.; Seitsonen, A.P.; Schulte, K.; Andersen, J.N.; Lundgren, E.; Over, H.
2010-01-01
High-resolution core-level photoemission spectroscopy and temperature-programmed reaction experiments together with density functional theory calculations were used to elucidate on the atomic scale the chlorination mechanism of ruthenium dioxide RuO2(110) by hydrogen chloride exposure. The
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for laboratory operations associated with the production and process control system? 111.110 Section 111.110 Food... § 111.110 What quality control operations are required for laboratory operations associated with the...
33 CFR 110.168 - Hampton Roads, Virginia and adjacent waters (Datum: NAD 83).
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hampton Roads, Virginia and adjacent waters (Datum: NAD 83). 110.168 Section 110.168 Navigation and Navigable Waters COAST GUARD..., Virginia and adjacent waters (Datum: NAD 83). (a) Anchorage Grounds—(1) Anchorage A [Naval Anchorage]. The...
32 CFR 37.110 - What type of instruments are technology investment agreements (TIAs)?
2010-07-01
... investment agreements (TIAs)? 37.110 Section 37.110 National Defense Department of Defense OFFICE OF THE... What type of instruments are technology investment agreements (TIAs)? TIAs are assistance instruments used to stimulate or support research. As discussed in appendix B to this part, a TIA may be either a...
Graphene nanoribbons synthesized from molecular precursor polymerization on Au(110)
Energy Technology Data Exchange (ETDEWEB)
Massimi, Lorenzo; Ourdjini, Oualid; Della Pia, Ada; Mariani, Carlo; Betti, Maria Grazia [Dipartimento di Fisica, Università di Roma La Sapienza, Piazzale Aldo Moro 2, I - 00185 Roma (Italy); Cavaliere, Emanuele; Gavioli, Luca [i-LAMP & Dipartimento di Matematica e Fisica, Università Cattolica, 25121 Brescia (Italy)
2015-06-23
A spectroscopic study of 10,10-dibromo-9,9 bianthracene (DBBA) molecules deposited on the Au(110) surface is presented, by means of ultraviolet and X-ray photoemission, and X-ray absorption spectroscopy. Through a thermally activated procedure, these molecular precursors polymerize and eventually form graphene nanoribbons (GNRs) with atomically controlled shape and width, very important building blocks for several technological applications. The GNRs observed by scanning tunneling microscopy (STM) appear as short segments on top of the gold surface reconstruction, pointing out the delicate balance among surface diffusion and surface corrugation in their synthesis on the Au(110) surface.
48 CFR 570.110 - Cost or pricing data and information other than cost or pricing data.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Cost or pricing data and information other than cost or pricing data. 570.110 Section 570.110 Federal Acquisition Regulations System... PROPERTY General 570.110 Cost or pricing data and information other than cost or pricing data. (a) The...
Structure of the cobalt-filled missing-row reconstruction of Pt(110)
International Nuclear Information System (INIS)
Klein, C.; Koller, R.; Schmid, M.; Varga, P.; Lundgren, E.; Maca, F.; Redinger, J.
2004-01-01
The atomic structure of 0.5 monolayer (ML) Co deposited on Pt(110) was investigated by quantitative low-energy electron diffraction and ab initio density functional theory calculations, showing a pronounced inward relaxation and a filling of the missing-row sites of the Pt(110) substrate by Co atoms. Up to this Co coverage no significant intermixing of Pt atoms with Co atoms was observed by scanning tunneling microscopy, resulting in an alternating arrangement of pure Co and Pt rows
21 CFR 520.110 - Apramycin sulfate soluble powder.
2010-04-01
... apramycin for each 66 pounds of body weight. Water consumption should be monitored to determine that the... water consumption which varies depending on ambient temperature, humidity, and other factors. (3... 520.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...
43 CFR 46.110 - Incorporating consensus-based management.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Incorporating consensus-based management... § 46.110 Incorporating consensus-based management. (a) Consensus-based management incorporates direct... carry out those plans and activities. For the purposes of this Part, consensus-based management involves...
Tank characterization report for single-shell Tank 241-B-110
International Nuclear Information System (INIS)
Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.
1994-08-01
Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr
The Relaxation of Vicinal (001) with ZigZag [110] Steps
Hawkins, Micah; Hamouda, Ajmi Bh; González-Cabrera, Diego Luis; Einstein, Theodore L.
2012-02-01
This talk presents a kinetic Monte Carlo study of the relaxation dynamics of [110] steps on a vicinal (001) simple cubic surface. This system is interesting because [110] steps have different elementary excitation energetics and favor step diffusion more than close-packed [100] steps. In this talk we show how this leads to relaxation dynamics showing greater fluctuations on a shorter time scale for [110] steps as well as 2-bond breaking processes being rate determining in contrast to 3-bond breaking processes for [100] steps. The existence of a steady state is shown via the convergence of terrace width distributions at times much longer than the relaxation time. In this time regime excellent fits to the modified generalized Wigner distribution (as well as to the Berry-Robnik model when steps can overlap) were obtained. Also, step-position correlation function data show diffusion-limited increase for small distances along the step as well as greater average step displacement for zigzag steps compared to straight steps for somewhat longer distances along the step. Work supported by NSF-MRSEC Grant DMR 05-20471 as well as a DOE-CMCSN Grant.
47 CFR 68.110 - Compatibility of the public switched telephone network and terminal equipment.
2010-10-01
... changes in its communications facilities, equipment, operations or procedures, where such action is... in this part. If such changes can be reasonably expected to render any customer's terminal equipment... network and terminal equipment. 68.110 Section 68.110 Telecommunication FEDERAL COMMUNICATIONS COMMISSION...
Effect of different treatments on 110m Ag plant uptake in various soil types
International Nuclear Information System (INIS)
Szerbin, P.; Koblinger-Bokori, E.
1996-01-01
110m Ag contamination may occur as a result of atmospheric release either during normal operation of nuclear power plants or in accidental circumstances. The gamma peaks of 110m Ag and radiocaesium are very close, and not every laboratory could make distinction between them. Therefore very few references are available on 110m Ag environmental behaviour and plant uptake. In the present study plant uptake of 110m Ag from four different types of soil was investigated, and the results are presented in relation to major soil characteristics. In addition, effects of two different treatments (phosphate and organic matter fertilizations) are determined in each type of soil. Our study clearly demonstrates that a carefully selected post-accident treatment can significantly reduce the environmental consequences of radioactive releases. Methods to be developed on bases of such studies could be used for remedial actions of agricultural lands polluted with radioactive substances
International Nuclear Information System (INIS)
Park, Sung Jean; Seo, Min-Duk; Lee, Suk Kyeong; Lee, Bong Jin
2008-01-01
Gp110 of Epstein-Barr virus (EBV) mainly localizes on nuclear/ER membranes and plays a role in the assembly of EBV nucleocapsid. The C-terminal tail domain (gp110 CTD) is essential for the function of gp110 and the nuclear/ER membranes localization of gp110 is ruled by its C-terminal unique nuclear localization signal (NLS), consecutive four arginines. In the present study, the structural properties of gp110 CTD in membrane mimics were investigated using CD, size-exclusion chromatography, and NMR, to elucidate the effect of membrane environment on the structural transition and to compare the structural feature of the protein in the solution state with that of the membrane-bound form. CD and NMR analysis showed that gp110 CTD in a buffer solution appears to adopt a stable folding intermediate which lacks compactness, and a highly helical structure is formed only in membrane environments. The helical content of gp110 CTD was significantly affected by the negative charge as well as the size of membrane mimics. Based on the elution profiles of the size-exclusion chromatography, we found that gp110 CTD intrinsically forms a trimer, revealing that a trimerization region may exist in the C-terminal domain of gp110 like the ectodomain of gp110. The mutation of NLS (RRRR) to RTTR does not affect the overall structure of gp110 CTD in membrane mimics, while the helical propensity in a buffer solution was slightly different between the wild-type and the mutant proteins. This result suggests that not only the helicity induced in membrane environment but also the local structure around NLS may be related to trafficking to the nuclear membrane. More detailed structural difference between the wild-type and the mutant in membrane environment was examined using synthetic two peptides including the wild-type NLS and the mutant NLS
Adsorption of guaiacol on Fe (110) and Pd (111) from first principles
Hensley, Alyssa J. R.; Wang, Yong; McEwen, Jean-Sabin
2016-06-01
The catalytic properties of surfaces are highly dependent upon the effect said surfaces have on the geometric and electronic structure of adsorbed reactants, products, and intermediates. It is therefore crucial to have a surface-level understanding of the adsorption of the key species in a reaction in order to design active and selective catalysts. Here, we study the adsorption of guaiacol on Fe (110) and Pd (111) using dispersion-corrected density functional theory calculations as both of these metals are of interest as hydrodeoxygenation catalysts for the conversion of bio-oils to useable biofuels. Both vertical (via the oxygen functional groups) and horizontal (via the aromatic ring) adsorption configurations were examined and the resulting adsorption and molecular distortion energies showed that the vertical sites were only physisorbed while the horizontal sites were chemisorbed on both metal surfaces. A comparison of guaiacol's horizontal adsorption on Fe (110) and Pd (111) showed that guaiacol had a stronger adsorption on Pd (111) while the Fe (110) surface distorted the Csbnd O bonds to a greater degree. Electronic analyses on the horizontal systems showed that the greater adsorption strength for guaiacol on Pd (111) was likely due to the greater charge transfer between the aromatic ring and the surface Pd atoms. Additionally, the greater distortion of the Csbnd O bonds in adsorbed guaiacol on Fe (110) is likely due to the greater degree of interaction between the oxygen and surface Fe atoms. Overall, our results show that the Fe (110) surface has a greater degree of interaction with the functional groups and the Pd (111) surface has a greater degree of interaction with the aromatic ring.
High-temperature steam oxidation kinetics of the E110G cladding alloy
International Nuclear Information System (INIS)
Király, Márton; Kulacsy, Katalin; Hózer, Zoltán; Perez-Feró, Erzsébet; Novotny, Tamás
2016-01-01
In the course of recent years, several experiments were performed at MTA EK (Centre for Energy Research, Hungarian Academy of Sciences) on the isothermal high-temperature oxidation of the improved Russian cladding alloy E110G in steam/argon atmosphere. Using these data and designing additional supporting experiments, the oxidation kinetics of the E110G alloy was investigated in a wide temperature range, between 600 °C and 1200 °C. For short durations (below 500 s) or high temperatures (above 1065 °C) the oxidation kinetics was found to follow a square-root-of-time dependence, while for longer durations and in the intermediate temperature range (800–1000 °C) it was found to approach a cube-root-of-time dependence rather than a square-root one. Based on the results a new best-estimate and a conservative oxidation kinetics model were created. - Highlights: • Steam oxidation kinetics of E110G was studied at MTA EK based on old and new data. • New best-estimate and conservative steam oxidation kinetics were proposed for E110G. • The exponent of oxidation time changed depending on oxidation temperature. • A simple exponential curve was used instead of Arrhenius-type curve for the factor.
15 CFR 2011.110 - Suspension of certificate system.
2010-01-01
..., SYRUPS AND MOLASSES Certificate of Quota Eligibility § 2011.110 Suspension of certificate system. (a... of such suspension and the effective date thereof shall be published in the Federal Register. (b... such reinstatement and the effective date thereof shall be published in the Federal Register. (c...
A comparative DFT study on the dehydrogenation of methanol on Rh(100) and Rh(110)
Zhang, Minhua; Wu, Xingyu; Yu, Yingzhe
2018-04-01
Numerous density functional theory calculations have been performed to investigate the complete mechanisms of methanol dehydrogenation on Rh(100) and Rh(110) surfaces. The adsorption properties of relevant species were discussed in details. In addition, a comprehensive reaction network including four reaction pathways was built and analyzed. It is found that the initial Osbnd H bond scission of CH3OH seems to be more favorable than Csbnd H bond cleavage on both Rh(100) and Rh(110) surfaces from the perspective of activation barriers. It is also concluded that path1 (CH3OH → CH3O → CH2O → CHO → CO) is the predominant pathway on both Rh(100) and Rh (110) surfaces. On the whole, in most of the dehydrogenation reactions investigated, the energy barriers on Rh(100) are lower than those on Rh (110). Remarkable differences in the activity and predominant reaction pathway on Rh(100), Rh(110) and Rh(111) indicate that the dehydrogenation of methanol might be structure-sensitive.
Tank 241-BY-110 tank characterization plan. Revision 1
International Nuclear Information System (INIS)
Homi, C.S.
1995-01-01
This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110
Detailed spectroscopy of 110Cd: Evidence for weak mixing and the emergence of γ-soft behavior
Garrett, P. E.; Bangay, J.; Diaz Varela, A.; Ball, G. C.; Cross, D. S.; Demand, G. A.; Finlay, P.; Garnsworthy, A. B.; Green, K. L.; Hackman, G.; Hannant, C. D.; Jigmeddorj, B.; Jolie, J.; Kulp, W. D.; Leach, K. G.; Orce, J. N.; Phillips, A. A.; Radich, A. J.; Rand, E. T.; Schumaker, M. A.; Svensson, C. E.; Sumithrarachchi, C.; Triambak, S.; Warr, N.; Wong, J.; Wood, J. L.; Yates, S. W.
2012-10-01
A study of the β+-electron capture decay of 110In into levels of 110Cd is combined with a reanalysis of data from a previous study of 110Cd with the (n,n'γ) reaction with monoenergetic neutrons. The γγ coincidences from the 110In decay leads to many new assignments of γ rays observed in the (n,n'γ) reaction, permitting the observation of weak low-energy transitions, and setting stringent upper limits on unobserved decay branches. The uncertainties on many of the lifetimes from the (n,n'γ) reaction are significantly reduced, and limits are established for the lifetimes of levels too long for a direct measurement. The absence of enhanced transitions between the previously assigned phonon states and the deformed intruder states strongly suggests that mixing between the configurations is generally weak, refuting the strong-mixing scenario as an explanation of the decay pattern of the excited 0+ states in 110Cd. The decay pattern of the nonintruder states is suggestive of a γ-soft rotor, or O(6) nucleus, rather than a vibrational, or U(5), pattern. The existence of a four-particle-six-hole proton excitation in 110Cd is also suggested.
Magnetic properties of smooth terminating dipole bands in 110,112Te
International Nuclear Information System (INIS)
Evans, A.O.; Paul, E.S.; Boston, A.J.; Chantler, H.J.; Chiara, C.J.; Devlin, M.; Fletcher, A.M.; Fossan, D.B.; LaFosse, D.R.; Lane, G.J.; Lee, I.Y.; Macchiavelli, A.O.; Nolan, P.J.; Sarantites, D.G.; Sears, J.M.; Semple, A.T.; Smith, J.F.; Starosta, K.; Vaman, C.; Afanasjev, A.V.; Ragnarsson, I.
2006-01-01
Three strongly coupled sequences have been established in 110,112 Te up to high spins. They are interpreted in terms of deformed structures built on proton 1-particle-1-hole excitations that reach termination at I∼40-bar . This is the first observation of smooth terminating dipole structures in this mass region. Lifetime measurements have allowed the extraction of experimental B(M1;I->I-1) and B(E2;I->I-2) reduced transition rates for one of the dipole bands in 110 Te. The results support the deformed interpretation
A first principles study of adhesion and electronic structure at Fe (110)/graphite (0001) interface
Energy Technology Data Exchange (ETDEWEB)
Liu, Yangzhen; Xing, Jiandong; Li, Yefei, E-mail: yefeili@126.com; Sun, Liang; Wang, Yong
2017-05-31
Highlights: • The surface energy of graphite (0001) and Fe (110) has been calculated and the number of layers of graphite slab and Fe slab has been estimated. • The work of adhesion of Fe (110)/graphite (0001) interface with different interfacial separation d{sub 0} (1.7–3 Å) has been systematically discussed. • The total electron density and electron density difference of Fe (110)/graphite (0001) are used to study the bonding characteristics. • The Interfacial energy and fracture toughness of Fe (110)/graphite (0001) are estimated. - Abstract: Using first–principles calculations, we discuss the bulk properties of bcc Fe and graphite and that of the surface, the work of adhesion, and the electronic structure of Fe (110)/graphite (0001) interface. In this study, the experimental results of the bulk properties of bcc Fe and graphite reveal that our adopted parameters are reliable. Moreover, the results of surface energy demonstrate that nine atomic layers of graphite (0001) and five atomic layers of Fe (110) exhibit bulk–like interiors. The lattice mismatch of Fe (110)/graphite (0001) interface is about 6%. The results also exhibit that the Fe atom residing on top of the second layer of graphite slab (HCP structure) is the preferred stacking sequence. The work of adhesion (W{sub ad}) of the optimized Fe/graphite interface of HCP structure is 1.36 J/m{sup 2}. Electronic structures indicate that the bonding characteristics are a mixture of covalent and ionic bonds in the HCP interface. Moreover, the magnetic moment of atoms at the interface was studied using the spin polarized density of states.
The impact of renal artery stent revascularization on blood pressure: 1-year follow-up of 110 cases
International Nuclear Information System (INIS)
Wang Chao; Zou Yinghua; Yang Min; Wang Jian; Tong Xiaoqiang; Song Li
2007-01-01
Objective: To investigate the effect of renal artery revascularization through renal artery stenting(PTRAS)on blood pressure in patients with renal artery stenosis. Methods: During April 2000 through May 2005 110 cases of renal artery stenosis received PTRAS and followed up for at least 1 year with blood pressure measurements pre-and 1 year post-PTRAS. Results: The technical success rate was 100% for all 110 cases. The renal artery stenosis were decreased from 60%-100% before PTRAS to 0%-15% after the stent placement. There was significant difference between blood pressure pre-and 1 year post PTRAS. Systolic pressures decreased from(153 ± 32) mmHg to(131 ± 27) mmHg and diastolic pressures from(87 ± 19) mmHg to(75 ± 19) mmHg. The administration of antihypertensive diugs reduced from(2.6 ± 0.9 ) sorts to(1.9 ± 0.9) sorts. Conclusions: PTRAS revascularization is an effective procedure for blood pressure control in renal vascular hypertension during one year follow up. (authors)
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Under what conditions may non low-income Indian families participate in the program? 1000.110 Section 1000.110 Housing and Urban... ACTIVITIES Affordable Housing Activities § 1000.110 Under what conditions may non low-income Indian families...
Amirhoseiny, M.; Hassan, Z.; Ng, S. S.
2012-08-01
Photoelectrochemical etched Si layers were prepared on n-type (110) oriented silicon wafer. The photoluminescence (PL), Fourier transformed infrared (FTIR) absorption and Raman spectroscopies of etched Si (110) at two different current densities were studied. Both samples showed PL peak in the visible spectral range situated from 650 nm to 750 nm. The corresponding changes in Raman spectra at different current density are discussed. The blue shift in the PL and Raman peaks is consequent of the quantum confinement effect and defect states of surface Si nanocrystallites complexes and hydrogen atoms of the photoelectrochemical etched Si (110) samples. The attenuated total reflection (ATR) results show both hydrogen and oxygen related IR modes in the samples which can be used to explain the PL effect.
33 CFR 110.235 - Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83).
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). 110.235 Section 110.235 Navigation and Navigable Waters COAST... Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). (a) The anchorage grounds—(1...
40 CFR 98.110 - Definition of the source category.
2010-07-01
... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Ferroalloy Production § 98.110 Definition of the source category. The ferroalloy production source category consists of any facility that uses pyrometallurgical techniques to produce any of the following metals: ferrochromium, ferromanganese, ferromolybdenum...
International Nuclear Information System (INIS)
Campbell, C.T.
1984-01-01
The selective oxidation of ethylene to ethylene epoxide (C 2 H 4 +1/2O 2 →C 2 H 4 O) over Ag is the simplest example of kinetically controlled, selective heterogeneous catalysis. We have studied the steady-state kinetics and selectivity of this reaction for the first time on a clean, well-characterized Ag(110) surface by using a special apparatus which allows rapid (approx.20 s) transfer between a high-pressure catalytic microreactor and an ultrahigh vacuum surface analysis (AES, XPS, LEED, TDS) chamber. The effects of temperature and reactant pressures upon the rate and selectivity are virtually identical on Ag(110) and supported, high surface area Ag catalysts. The absolute specific rate (per Ag surface atom) is, however, some 100-fold higher for Ag(110) than for high surface area catalysts. This is related to the well-known structural sensitivity of this reaction. It is postulated that a small percentage of (110) planes (or [110]-like sites) are responsible for most of the catalytic activity of high surface area catalysts. The high activity of the (110) plane is attributed to its high sticking probability for dissociative oxygen adsorption, since the rate of ethylene epoxidation is shown in a related work [Ref. 1: C. T. Campbell and M. T. Paffett, Surf. Sci. (in press)] to be proportional to the coverage of atomically adsorbed oxygen at constant temperature and ethylene pressure
Directional uv photoemission from (100) and (110) molybdenum surfaces
DEFF Research Database (Denmark)
Cinti, R. C.; Khoury, E. Al; Chakraverty, B. K.
1976-01-01
A study of the (100) and (110) molybdenum surfaces by directional photoemission spectroscopy is presented. Energy distribution spectra formed by photoelectrons emitted normal to the surfaces have been measured for photon energies between 10.2 and 21.2 eV. The results are discussed in terms of cal......-transition and surface-emission processes. Two extra structures are interpreted in terms of surface states or resonances: on the (100) surface, 0.5 eV below EF; on the (110) surface, 4.5 eV below EF in the s-d hybridization gap....... of calculated band structure within the framework of the K∥-conservation assumption. A good agreement is found between the main features of the experimental spectra and the emission expected from the band structure along the corresponding symmetry line in the Brillouin zone, assuming essentially direct...
33 CFR 110.190 - Tortugas Harbor, in vicinity of Garden Key, Dry Tortugas, Fla.
2010-07-01
... Garden Key, Dry Tortugas, Fla. 110.190 Section 110.190 Navigation and Navigable Waters COAST GUARD..., in vicinity of Garden Key, Dry Tortugas, Fla. (a) The anchorage grounds. All of Bird Key Harbor, southwest of Garden Key, bounded by the surrounding reefs and shoals and, on the northeast, by a line...
DEFF Research Database (Denmark)
Salvatore, Princia; Nazmutdinov, Renat R.; Ulstrup, Jens
2015-01-01
Among the low-index single-crystal gold surfaces, the Au(110) surface is the most active toward molecular adsorption and the one with fewest electrochemical adsorption data reported. Cyclic voltammetry (CV), electrochemically controlled scanning tunneling microscopy (EC-STM), and density functional......, accompanied by a pair of strong voltammetry peaks in the double-layer region in acid solutions. Adsorption of the DNA bases gives featureless voltammograms with lower double-layer capacitance, suggesting that all the bases are chemisorbed on the Au(110) surface. Further investigation of the surface structures...... of the adlayers of the four DNA bases by EC-STM disclosed lifting of the Au(110) reconstruction, specific molecular packing in dense monolayers, and pH dependence of the A and G adsorption. DFT computations based on a cluster model for the Au(110) surface were performed to investigate the adsorption energy...
110 °C range athermalization of wavefront coding infrared imaging systems
Feng, Bin; Shi, Zelin; Chang, Zheng; Liu, Haizheng; Zhao, Yaohong
2017-09-01
110 °C range athermalization is significant but difficult for designing infrared imaging systems. Our wavefront coding athermalized infrared imaging system adopts an optical phase mask with less manufacturing errors and a decoding method based on shrinkage function. The qualitative experiments prove that our wavefront coding athermalized infrared imaging system has three prominent merits: (1) working well over a temperature range of 110 °C; (2) extending the focal depth up to 15.2 times; (3) achieving a decoded image being approximate to its corresponding in-focus infrared image, with a mean structural similarity index (MSSIM) value greater than 0.85.
29 CFR 4.110 - What contracts are covered.
2010-07-01
...'Hara Service Contract Act Covered Contracts Generally § 4.110 What contracts are covered. The Act... mean that the contract is not within the coverage of the Act. The amount of the contract is not determinative of the Act's coverage, although the requirements are different for contracts in excess of $2,500...
Energy Technology Data Exchange (ETDEWEB)
Hasselgren, L; Fahlander, C; Edvardson, L O; Thun, J E; Falk, F; Ghumman, B S
1975-04-01
The orientation precession technique, REPREC, for measurements of quadrupole moments is described. The application of REPREC to the measurement of the static electric quadrupole moments of the first excited 2/sup +/-states in /sup 108/ /sup 110/Pd is presented. The possibility to measure the matrix product P/sub 4/ = M/sub 02/M/sub 22/,M/sub 02/M/sub 22/ is also discussed. Such measurements are presented for /sup 108/ /sup 110/Pd. The results of these measurements are P/sub 4/O for both /sup 108/Pd and /sup 110/Pd. For /sup 108/Pd the quadrupole moment of the first excited 2/sup +/-state was found to be -.66 +- .18 eb and for /sup 110/Pd -.72 +- .14 eb. Intrinsic nuclear properties for /sup 106 -110/Pd are derived using the sum rules suggested by Kumar.
Growth morphology and structure of bismuth thin films on GaSb(110)
DEFF Research Database (Denmark)
Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.
1998-01-01
Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....
Directory of Open Access Journals (Sweden)
Wilhelm Rojewski
2015-06-01
Full Text Available The paper discusses the interoperability of the German compensated 110 kV grid and the Polish effectively earthed 110 kV grid. It is assumed that an area of one grid, separated from its power system, will be temporarily supplied from the other grid in its normal regime. Reference is made to the risks associated with phase-to-earth faults in grids so interconnected. Particular attention is paid to the working conditions of surge arresters and voltage transformers in the Polish 110 kV grid deprived of its neutral earthing when supplied from the German grid.
Magnetic anisotropy basis sets for epitaxial (110) and (111) REFe2 nanofilms
International Nuclear Information System (INIS)
Bowden, G J; Martin, K N; Fox, A; Rainford, B D; Groot, P A J de
2008-01-01
Magnetic anisotropy basis sets for the cubic Laves phase rare earth intermetallic REFe 2 compounds are discussed in some detail. Such compounds can be either free standing, or thin films grown in either (110) or (111) mode using molecular beam epitaxy. For the latter, it is useful to rotate to a new coordinate system where the z-axis coincides with the growth axes of the film. In this paper, three symmetry adapted basis sets are given, for multi-pole moments up to n = 12. These sets can be used for free-standing compounds and for (110) and (111) epitaxial films. In addition, the distortion of REFe 2 films, grown on sapphire substrates, is also considered. The distortions are different for the (110) and (111) films. Strain-induced harmonic sets are given for both specific and general distortions. Finally, some predictions are made concerning the preferred direction of easy magnetization in (111) molecular beam epitaxy grown REFe 2 films
Decarbonylation and hydrogenation reactions of allyl alcohol and acrolein on Pd(110)
Shekhar, Ratna; Barteau, Mark A.
1994-11-01
Allyl alcohol and acrolein reactions on the Pd(110) surface were investigated using temperature programmed desorption. For both unsaturated oxygenates, three coverage-dependent reaction pathways were observed. At low coverages, allyl alcohol decomposed completely to CO, hydrogen and carbonaceous species on the surface. For θ > 0.15 monolayer, ethylene (and small amounts of ethane) desorbed at ca. 295 K. Near saturation coverages, desorption of propanal was detected at ca. 235 K. The parent molecule, allyl alcohol, desorbed only after exposures sufficient to saturate these channels. Acrolein decomposition spectra were similar to those observed for allyl alcohol decomposition on the clean surface. Additional experiments with allyl alcohol on hydrogen- and deuterium-precoveredPd(110) surfaces demonstrated increased hydrogenation of the C 2-hydrocarbon products along with hydrogenation of allyl alcohol to 1-propanol. However, in contrast to previous results for allyl alcohol on the Pd(111) surface, there was no evidence for C-O scission reactions of any C 3 oxygenate on Pd(110).
Optical properties of new 5-(4-phenylethynyl)-substituted-1,10-phenanthroline derivatives
International Nuclear Information System (INIS)
Guerin, Juliette; Aronica, Christophe; Boeuf, Gaelle; Chauvin, Jerome; Moreau, Juliette; Lemercier, Gilles
2011-01-01
The synthesis and optical properties of a novel family of 5-substituted-1,10-phenanthroline derivatives are reported herein. One carbon-carbon triple-bond function was introduced using a Sonogashira cross-coupling reaction. The effects on optical properties, of the substitution with electro-withdrawing or -donating substituents in the 5th position of the 1,10-phenanthroline are investigated. Experimental chemical structure-polarisability relationship is analyzed according to the Lippert-Mataga correlation and compared to a theoretical study carried out with DFT calculations. These compounds are promising candidates for a fine-tuning of the internal charge-transfers but also as potential nonlinear chromophores and ligands within multifunctional coordination complexes. - Highlights: → Synthesis and optical properties of new 5-substituted-1,10-phenanthroline derivatives. → Sonogashira reaction was used for the substitution. → Structure-polarisability relationship analyzed according to Lippert-Mataga correlation. → Theoretical study was carried out with DFT calculations. → Fine-tuning of the internal charge-transfers within nonlinear compounds.
Incorporation of detailed eye model into polygon-mesh versions of ICRP-110 reference phantoms.
Nguyen, Thang Tat; Yeom, Yeon Soo; Kim, Han Sung; Wang, Zhao Jun; Han, Min Cheol; Kim, Chan Hyeong; Lee, Jai Ki; Zankl, Maria; Petoussi-Henss, Nina; Bolch, Wesley E; Lee, Choonsik; Chung, Beom Sun
2015-11-21
The dose coefficients for the eye lens reported in ICRP 2010 Publication 116 were calculated using both a stylized model and the ICRP-110 reference phantoms, according to the type of radiation, energy, and irradiation geometry. To maintain consistency of lens dose assessment, in the present study we incorporated the ICRP-116 detailed eye model into the converted polygon-mesh (PM) version of the ICRP-110 reference phantoms. After the incorporation, the dose coefficients for the eye lens were calculated and compared with those of the ICRP-116 data. The results showed generally a good agreement between the newly calculated lens dose coefficients and the values of ICRP 2010 Publication 116. Significant differences were found for some irradiation cases due mainly to the use of different types of phantoms. Considering that the PM version of the ICRP-110 reference phantoms preserve the original topology of the ICRP-110 reference phantoms, it is believed that the PM version phantoms, along with the detailed eye model, provide more reliable and consistent dose coefficients for the eye lens.
Tailored TiO2(110) surfaces and their reactivity
International Nuclear Information System (INIS)
Pang, C L; Bikondoa, O; Humphrey, D S; Papageorgiou, A C; Cabailh, G; Ithnin, R; Chen, Q; Muryn, C A; Onishi, H; Thornton, G
2006-01-01
Electron bombardment from a filament as well as voltage pulses from a scanning tunnelling microscope tip have been employed to modify the surface of TiO 2 (110). Individual H atoms are selectively desorbed with electrical pulses of +3 V from the scanning tunnelling microscope tip, whilst leaving the oxygen vacancies intact. This allows us to distinguish between oxygen vacancies and hydroxyl groups, which have a similar appearance in scanning tunnelling microscopy images. This then allows the oxygen vacancy-promoted dissociation of water and O 2 to be followed with the microscope. Electrical pulses between +5 and +10 V induce local TiO 2 (110)1 x 2 reconstructions centred around the pulse. As for electron bombardment of the surface, relatively low fluxes increase the density of oxygen vacancies whilst higher fluxes lead to the 1 x 2 and other 1 x n reconstructions
2010-10-01
... § 52.01-110 Water-level indicators, water columns, gauge-glass connections, gauge cocks, and pressure... 46 Shipping 2 2010-10-01 2010-10-01 false Water-level indicators, water columns, gauge-glass connections, gauge cocks, and pressure gauges (modifies PG-60). 52.01-110 Section 52.01-110 Shipping COAST...
Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries
International Nuclear Information System (INIS)
Geeting, J.G.H.; Reynolds, B.A.
1997-09-01
Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization
cis-Dichloridobis(1,10-phenanthrolinechromium(III chloride
Directory of Open Access Journals (Sweden)
Xiaoli Gao
2011-02-01
Full Text Available In the title complex, [CrCl2(C12H8N22]Cl, the CrIII ion is situated on a twofold rotation axis and displays a slightly distorted octahedral CrCl2N4 coordination geometry. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline and two chloride ligands. The chloride counter-anion exhibits half-occupation and is equally disordered over two positions.
Effective electron collection in highly (110)-oriented ZnO porous nanosheet framework photoanode
International Nuclear Information System (INIS)
Wang Xiangyan; Tian Zhipeng; Yu Tao; Tian Hanmin; Zhang Jiyuan; Yuan Shikui; Zhang Xiaobo; Li Zhaosheng; Zou Zhigang
2010-01-01
A highly (110)-oriented ZnO porous nanosheet framework is designed as the photoanode in photoelectrochemical systems, by virtue of its anisotropic electronic properties. It can be facilely prepared in large scale via a hydrothermal method. X-ray diffraction (XRD) analyses show that the orientation index of the (110) diffraction plane is 3.54, indicating the films possess (110) preferred orientation. Field-emission scanning electron microscope (FE-SEM) images exhibit that most of the nanosheets stand nearly perpendicularly on the substrate. The {002} lattice planes work just like conducting wires and induce the electrons to transport to the substrate. Chronoamperometry measurement demonstrates an effective electron collection. When the nanostructured photoanode is introduced to dye-sensitized solar cells, a conversion efficiency of 3.7% is obtained. The photoanode also has potential application in the other photoelectrochemical systems, such as photocatalytical splitting of water.
22 CFR 208.110 - What is the purpose of the nonprocurement debarment and suspension system?
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the purpose of the nonprocurement debarment and suspension system? 208.110 Section 208.110 Foreign Relations AGENCY FOR INTERNATIONAL... the nonprocurement debarment and suspension system? (a) To protect the public interest, the Federal...
2,2',-bipyridine and 1,10-phenanthroline complexes of lanthanide(III) trifluoroacetates
International Nuclear Information System (INIS)
Misra, S.N.; Singh, M.
1983-01-01
The syntheses and characterization of lanthanide(III) triflloroacetate complexes with 2,2'-bipyridine and 1,10-phenanthroline are reported. Lanthanide(III) trifluoroacetates yield compounds of the type Ln(CF 3 COO) 3 .bipy or phen with 2,2'-bipyridine and 1,10-phenanthroline. Their properties and structures have been studied using chemical analyses. electronic and infrared spectra. Thermal analysis of a few complexes have also been done. The infrared data show that the trifluoroacetate group acts as a bidentate ligand making the coordination number of lanthanide eight. (author)
International Nuclear Information System (INIS)
Won, Je Hwan; Lee, Jong Hyuk; Ko, Kyung Hee; Won, Jong Yoon; Park, Sung Il; Lee, Do Yun; Kang, Byung Chul
2000-01-01
To investigate the feasibility and complications of a percutaneously implantable port system for regional drug infusion. For intra-arterial drug infusion, a 5.8 or 5-F pediatric venous port system was implanted in 110 patients with hepatocellular carcinoma (n=79), liver metastasis (n=16), gallbladder cancer (n=4), stomach cancer (n=3), pancreatic cancer (n=3), Burger's diseases mellitus (n=2), or lymphoma (n=1). All intra-arterial port implantations were performed percutaneously in an angiographic ward through the common femoral artery (n=98), left subclavian artery (n=10), or left superficial femoral artery (n=2). Complications were evaluated during the follow-up period, which ranged from 21 to 530 (mean, 163) days. The technical success rate for percutaneous implantation of the system was 97.3% (107 of 110 patients). The tips of the port catheter were located in the common hepatic artery (n=34), proper hepatic artery (n=49), right hepatic artery quick resulthepatic artery (n=1), descending aorta at T9 level (n=10), left popliteal artery (n=2), right external iliac artery (n=1), left external iliac artery (n=1), or left deep femoral artery (n=1). Complications were encountered in 24 patients (22.4%), namely chamber site infection (n=7), catheter dislodgement (n=7), catheter occlusion (n=3), migration of coil (n=2), disconnection between chamber and catheter (n=1), kinking of catheter (n=1), arterial occlusion (n=1), necrosis of overlying skin (n=1), and leakage around port chamber (n=1). Outcomes of complications included removal of port systems or cessation of therapy in 12 cases (11.2%), correction of catheter location using a guide wire in five (4.7%), thrombolysis with urokinase in three (2.8%), and straightening using a snare in one (0.9%). In three patients, the port system was used without reintervention. Percutaneous implantation of an intra-arterial port system showed a high technical success rate and a low rate of serious complications. The method may be
Topical corticosteroid-induced rosacea-like dermatitis: A clinical study of 110 cases
Directory of Open Access Journals (Sweden)
Sanjay K Rathi
2011-01-01
Full Text Available Background: Prolonged and continuous use of topical steroids leads to rosacea-like dermatitis with variable clinical presentations. Aims: To study the various clinical presentations of patients with topical corticosteroid-induced rosacea-like dermatitis (TCIRD, who had a history of prolonged and repeated use of topical steroids for reasons other than the known disease entities. Methods: A total of 110 patients were enrolled for the study over a period of 2 years, excluding all those with the known disease entity in which topical steroids were commonly used. Detailed history which also included the source and the type of topical steroid use was taken along with clinical examination. Results: There were 12 males and 98 females with their age ranging from 18 to 54 years. The duration of topical steroid use ranged from 4 months to 20 years. The most common clinical presentation was diffuse erythema of the face. Most of the patients had rebound phenomenon on discontinuation of the steroid. The most common topical steroid used was Betamethasone valerate, which could be due to its easy availability and low cost. Conclusion: Varied clinical presentations are seen with prolonged and continuous use of topical steroids. The treatment of this dermatitis is difficult, requiring complete cessation of the offending steroid, usually done in a tapering fashion.
DEFF Research Database (Denmark)
Peter, Wf; Loos, M; de Vet, Hcw
2015-01-01
, and to preliminary assess its reliability and validity. We hypothesize that the AAQ correlates highly with performance-based tests, and moderately with self-reports. Methods Item selection was based on 1) the pilot AAQ; 2) pre-specified conditions; 3) the International Classification of Functioning core set for OA......Objective To develop an Animated Activity Questionnaire (AAQ), based on video animations, for assessing activity limitations in patients with hip/knee osteoarthritis (OA), which combines the advantages of self-reported questionnaires and performance-based tests, without many of their limitations......, 4) existing measurement instruments, and 5) focus groups of patients. Test-retest reliability was assessed in 30/110 patients. In 110 patients correlations were calculated between AAQ and self-reported Hip disability and Knee injury Osteoarthritis Outcome ADL subscale (H/KOOS). In 45/110 patients...
41 CFR 101-25.110 - Tire identification/registration program.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tire identification...-General Policies § 101-25.110 Tire identification/registration program. The regulations issued by the Department of Transportation in 49 CFR part 574, Tire Identification and Recordkeeping, require that tire...
International Nuclear Information System (INIS)
Kardinal, I.
1998-01-01
The complementary techniques of HR-XPS and HREELS have been applied to two distinct problems. The first studies adsorption and dissociation of C 2 N 2 on Ni (110) at room temperature (RT) and at 90 K and its co-adsorption with CO. At RT C 2 N 2 dissociates and forms a c(2x2)-CN structure. The resulting CN is found to be bound in the grooves of the (110) surface yielding the lowest C-N vibrational energy yet observed. C 2 N 2 was found to dissociate even at 90 K however the resulting CN overlayer after warming to RT showed remarkable differences to that of the RT adsorption. As well as the in-groove species a number of adsorption sites on the ridges with a bond order higher have been identified. Preadsorbed CO is completely driven of the Ni (110) surface by co-adsorption of CN at RT. HREELS indicates that first CO is desorbed from the on-top-sites and then from the bridge-sites of the (110)-ridges involving a considerable increase of the HREELS cross section for the CO on the bridge-sites. Also the signal intensity of the coadsorbed CN is suppressed by the CO present on the surface. The second study investigated the adsorption of bithiophene (BiT) on clean Ni (110) and the S-modified c(2x2)-S-Ni (110) and p(4x1)-S-Ni (110). The latter provided a strongly structured substrate which forced the assembly of the adsorbed BiT-molecules. The high degree of order of this adsorbate/substrate system was obvious in both the HR-XPS results and the BREELS results with strong azimuthal anisotropy. This system was used to asses the ability to use the HREELS impact selection rules to determine molecular orientation of a reasonably complex adsorbate overlayer. (author)
Surface Preparation of InAs (110 Using Atomic Hydrogen
Directory of Open Access Journals (Sweden)
T.D. Veal
2002-06-01
Full Text Available Atomic hydrogen cleaning has been used to produce structurally and electronically damage-free InAs(110 surfaces. X-ray photoelectron spectroscopy (XPS was used to obtain chemical composition and chemical state information about the surface, before and after the removal of the atmospheric contamination. Low energy electron diffraction (LEED and high-resolution electron-energy-loss spectroscopy (HREELS were also used, respectively, to determine the surface reconstruction and degree of surface ordering, and to probe the adsorbed contaminant vibrational modes and the collective excitations of the clean surface. Clean, ordered and stoichiometric InAs(110-(1×1 surfaces were obtained by exposure to thermally generated atomic hydrogen at a substrate temperature as low as 400ºC. Semi-classical dielectric theory analysis of HREEL spectra of the phonon and plasmon excitations of the clean surface indicate that no electronic damage or dopant passivation were induced by the surface preparation method.
Energy Technology Data Exchange (ETDEWEB)
Oertel, Stefan
2012-07-01
This thesis investigates the spin dynamics in both bulk GaAs and (llO)GaAs heterostructures using time- and polarization-resolved photoluminescence spectroscopy. In bulk GaAs the spin relaxation t ime is measured for the first time in the high temperature regime from 280 K to 400 K and is compared to numerical calculations. The numerical calculations are based on the spin relaxation theory of the Dyakonov-Perel mechanism effected by momentum scattering with polar optical phonons and electron-electron scattering and are in good agreement with the experimental results. Measurements of the dependence on the electron density serve to determine the energy dependent proportional factor between the electron density and the effective electron-electron scattering time. Also in bulk GaAs the interaction between the electron spin system and the nuclear spin system is investigated. The measured electron Lande g-factor under the influence of the nuclear magnetic field is used as an indicator to monitor the temporal evolution of the nuclear magnetic field under sustained dynamic nuclear polarization. Measurements with polarization modulated excitation enable the determination of the relevant time scale at which dynamic nuclear polarization takes place. Furthermore, the temporal evolution of the measured electron Lande g-factor shows the complex interplay of the dynamic nuclear polarization, the nuclear spin diffusion and the nuclear spin relaxation. In symmetric (110)-GaAs quantum wells the dependence of the inplane anisotropy of the electron Lande g-factor on the quantum well thickness is determined experimentally. The measurements are in very good agreement with calculations based upon k . p-theory and reveal a maximum of the anisotropy at maximum carrier localization in the quantum well. The origin of the anisotropy that is not present in symmetric (001) quantum wells is qualitatively described by means of a simplified model based on fourth-order perturbation theory. A
2010-01-01
... Equipment and Components Under NRC Export Licensing Authority H Appendix H to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. H Appendix H to Part 110—Illustrative List of Electromagnetic Enrichment Plant Equipment and Components Under...
2010-01-01
..., Plants and Equipment Under NRC's Export Licensing Authority N Appendix N to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. N Appendix N to Part 110—Illustrative List of Lithium Isotope Separation Facilities, Plants and Equipment...
MODELING SUPERSONIC-JET DEFLECTION IN THE HERBIG–HARO 110-270 SYSTEM WITH HIGH-POWER LASERS
International Nuclear Information System (INIS)
Yuan, Dawei; Li, Yutong; Lu, Xin; Yin, Chuanlei; Su, Luning; Liao, Guoqian; Zhang, Jie; Wu, Junfeng; Wang, Lifeng; He, Xiantu; Zhong, Jiayong; Wei, Huigang; Zhang, Kai; Han, Bo; Zhao, Gang; Jiang, Shaoen; Du, Kai; Ding, Yongkun; Zhu, Jianqiang
2015-01-01
Herbig–Haro (HH) objects associated with newly born stars are typically characterized by two high Mach number jets ejected in opposite directions. However, HH 110 appears to only have a single jet instead of two. Recently, Kajdi et al. measured the proper motions of knots in the whole system and noted that HH 110 is a continuation of the nearby HH 270. It has been proved that the HH 270 collides with the surrounding mediums and is deflected by 58°, reshaping itself as HH 110. Although the scales of the astrophysical objects are very different from the plasmas created in the laboratory, similarity criteria of physical processes allow us to simulate the jet deflection in the HH 110/270 system in the laboratory with high power lasers. A controllable and repeatable laboratory experiment could give us insight into the deflection behavior. Here we show a well downscaled experiment in which a laser-produced supersonic-jet is deflected by 55° when colliding with a nearby orthogonal side-flow. We also present a two-dimensional hydrodynamic simulation with the Euler program, LARED-S, to reproduce the deflection. Both are in good agreement. Our results show that the large deflection angle formed in the HH 110/270 system is probably due to the ram pressure from a flow–flow collision model
12 CFR 221.110 - Questions arising under this part.
2010-01-01
... technical circumstances under which a loan is made. Instead, the fundamental purpose of the loan is... solely toward purchases of stock for speculative or investment purposes. The Board answered that a margin... Section 221.110 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL...
25 CFR 900.110 - What does this subpart cover?
2010-04-01
... management, and the actual construction of the building or facility in accordance with the construction... construction management services as defined in § 900.113 may be included in a construction contract under this... Construction § 900.110 What does this subpart cover? (a) This subpart establishes requirements for issuing...
InGaAs/GaAs (110) quantum dot formation via step meandering
Energy Technology Data Exchange (ETDEWEB)
Diez-Merino, Laura; Tejedor, Paloma [Department of Nanostructures and Surfaces, Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Ines de la Cruz 3, 28049-Madrid (Spain)
2011-07-01
InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.
InGaAs/GaAs (110) quantum dot formation via step meandering
International Nuclear Information System (INIS)
Diez-Merino, Laura; Tejedor, Paloma
2011-01-01
InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.
33 CFR 110.84 - Black Rock Channel opposite foot of Porter Avenue, Buffalo, N.Y.
2010-07-01
... of Porter Avenue, Buffalo, N.Y. 110.84 Section 110.84 Navigation and Navigable Waters COAST GUARD... Channel opposite foot of Porter Avenue, Buffalo, N.Y. An area extending northwesterly between Black Rock... Triangulation Marker “N-5” on Bird Island Pier; thence southeasterly along the pier a distance of approximately...
21 CFR 212.110 - How must I maintain records of my production of PET drugs?
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false How must I maintain records of my production of PET drugs? 212.110 Section 212.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... those not stored at the inspected establishment, must be legible, stored to prevent deterioration or...
Quasiparticle interfacial level alignment of highly hybridized frontier levels: H2O on TiO2(110).
Migani, Annapaola; Mowbray, Duncan J; Zhao, Jin; Petek, Hrvoje
2015-01-13
Knowledge of the frontier levels' alignment prior to photoirradiation is necessary to achieve a complete quantitative description of H2O photocatalysis on TiO2(110). Although H2O on rutile TiO2(110) has been thoroughly studied both experimentally and theoretically, a quantitative value for the energy of the highest H2O occupied levels is still lacking. For experiment, this is due to the H2O levels being obscured by hybridization with TiO2(110) levels in the difference spectra obtained via ultraviolet photoemission spectroscopy (UPS). For theory, this is due to inherent difficulties in properly describing many-body effects at the H2O-TiO2(110) interface. Using the projected density of states (DOS) from state-of-the-art quasiparticle (QP) G0W0, we disentangle the adsorbate and surface contributions to the complex UPS spectra of H2O on TiO2(110). We perform this separation as a function of H2O coverage and dissociation on stoichiometric and reduced surfaces. Due to hybridization with the TiO2(110) surface, the H2O 3a1 and 1b1 levels are broadened into several peaks between 5 and 1 eV below the TiO2(110) valence band maximum (VBM). These peaks have both intermolecular and interfacial bonding and antibonding character. We find the highest occupied levels of H2O adsorbed intact and dissociated on stoichiometric TiO2(110) are 1.1 and 0.9 eV below the VBM. We also find a similar energy of 1.1 eV for the highest occupied levels of H2O when adsorbed dissociatively on a bridging O vacancy of the reduced surface. In both cases, these energies are significantly higher (by 0.6 to 2.6 eV) than those estimated from UPS difference spectra, which are inconclusive in this energy region. Finally, we apply self-consistent QPGW (scQPGW1) to obtain the ionization potential of the H2O-TiO2(110) interface.
Controlling Self-Assembly in Al(110) Homoepitaxy
Tiwary, Yogesh; Fichthorn, Kristen
2010-03-01
Homoepitaxial growth on Al(110) exhibits nanoscale self-assembly into huts with well-defined (100) and (111) facets [1]. Although some of the diffusion mechanisms underlying this kinetic self-assembly were identified and incorporated into a two-dimensional model [2], we used density-functional theory (DFT) to identify many other mechanisms that are needed to describe the three-dimensional assembly seen experimentally [3]. We developed a three-dimensional kinetic Monte Carlo (KMC) model of Al(110) homoepitaxy. The inputs to the model were obtained from DFT [3,4]. Our model is in agreement with experimentally observed trends for this system. We used KMC to predict self-assembly under various growth conditions. To achieve precise placement of Al nanohuts, we simulated thermal-field-directed assembly [5]. Our results indicate that this technique can be used to create uniform arrays of nanostructures. [1] F. Buatier de Mongeot, W. Zhu, A. Molle, R. Buzio, C. Boragno, U. Valbusa, E. Wang, and Z. Zhang, Phys. Rev. Lett. 91, 016102 (2003). [2] W. Zhu, F. Buatier de Mongeot, U. Valbusa, E. G. Wang, and Z. Y. Zhang, Phys. Rev. Lett. 92, 106102 (2004). [3] Y. Tiwary and K. A. Fichthorn, submitted to Phys. Rev. B. [4] Y. Tiwary and K. A. Fichthorn, Phys. Rev. B 78, 205418 (2008). [5] C. Zhang and R. Kalyanaraman, Appl. Phys. Lett. 83, 4827 (2003).
Micropore x-ray optics using anisotropic wet etching of (110) silicon wafers
International Nuclear Information System (INIS)
Ezoe, Yuichiro; Koshiishi, Masaki; Mita, Makoto; Mitsuda, Kazuhisa; Hoshino, Akio; Ishisaki, Yoshitaka; Yang Zhen; Takano, Takayuki; Maeda, Ryutaro
2006-01-01
To develop x-ray mirrors for micropore optics, smooth silicon (111)sidewalls obtained after anisotropic wet etching of a silicon (110) wafer were studied. A sample device with 19 μm wide (111) sidewalls was fabricated using a 220 μm thick silicon (110) wafer and potassium hydroxide solution. For what we believe to be the first time,x-ray reflection on the (111) sidewalls was detected in the angular response measurement. Compared to ray-tracing simulations, the surface roughness of the sidewalls was estimated to be 3-5 nm, which is consistent with the atomic force microscope and the surface profiler measurements
Micropore x-ray optics using anisotropic wet etching of (110) silicon wafers.
Ezoe, Yuichiro; Koshiishi, Masaki; Mita, Makoto; Mitsuda, Kazuhisa; Hoshino, Akio; Ishisaki, Yoshitaka; Yang, Zhen; Takano, Takayuki; Maeda, Ryutaro
2006-12-10
To develop x-ray mirrors for micropore optics, smooth silicon (111) sidewalls obtained after anisotropic wet etching of a silicon (110) wafer were studied. A sample device with 19 microm wide (111) sidewalls was fabricated using a 220 microm thick silicon (110) wafer and potassium hydroxide solution. For what we believe to be the first time, x-ray reflection on the (111) sidewalls was detected in the angular response measurement. Compared to ray-tracing simulations, the surface roughness of the sidewalls was estimated to be 3-5 nm, which is consistent with the atomic force microscope and the surface profiler measurements.
Studies of biological effects of fluoride stannous and UV short in Escherichia coli BH110
Energy Technology Data Exchange (ETDEWEB)
Ferreira da C, R., E-mail: rogercosta1@hotmail.com [Federal Institute of Education, Science and Technology of Goias, Campus Uruacu, Rua Formosa Qd 28 e 29, Loteamento Santana, 76400-000 Uruacu, Goias (Brazil)
2015-10-15
Full text: The amount of UV rays on the Earth's surface has increased due to depletion of the ozone layer, and this has worried society, since these radiation although not considered ionizing can cause damage to biological membrane and especially to DNA. The DNA has cell repair mechanisms that can work in lesions caused by electromagnetic radiation such as ultraviolet -short (UV C)and agents causing oxidative stress, such as tin salts. Among the repair mechanisms can highlight the adaptive repair, which consists of smaller doses to cells pre-exposure of an oxidizing agent, and when these cells are exposed to larger doses of the agent even if there is a reduction in mortality rate which leads to complete that repair mechanisms are activated in the pre-exposure reducing cell mortality. Several publications have shown the genotoxic effects of stannous salts such as stannous fluoride (SnF{sub 2}), which shows the importance of the study, since these salts are widely used in industry as components in toothpastes and mouthwashes. So we check whether pretreatment with UV C is able to induce adaptive response reducing the cytotoxic effects caused by exposure of the strains to SnF{sub 2}. We use a strain of Escherichia coli BH110 (BH110 E. coli) deficient in three genes (fpg, nfo and xth) involved in the excision repair bases. To verify the induction of adaptive response to strain BH110 was exposed to various doses of UV C and then treated with SnF{sub 2} a concentration of 110 u M. Our results showed that the LD10 of strain BH110 is 20 J/m{sup 2} and pre-treatment with UV C does not seem to induce adaptive repair in BH110 strains. (Author)
29 CFR 780.110 - Operations included in “cultivation and tillage of the soil.”
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Operations included in âcultivation and tillage of the soil.â 780.110 Section 780.110 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS EXEMPTIONS APPLICABLE TO AGRICULTURE, PROCESSIN...
Characteristic electron energy loss in lanthanum films adsorbed on tungsten (110) single crystal
International Nuclear Information System (INIS)
Gorodetskij, D.A.; Gorchinskij, A.D.; Kobylyanskij, A.V.
1988-01-01
The spectrum of electron energy loss (ELS) in a wide range of energy loss 0-150 eV has been studied for La films adsorbed on W(110) single crystal with the coverage Θ from submonolayer to a few monolayers. The concentration dependence of loss energy peaks amplitude of different nature has been studied for the adsorption of rare earth element on refractory substrate. It has been shown that the essential information for the interpretation of the energy loss nature may be obtained by the investigation of such dependences for La adsorption on W(110). It is found that the surface and bulk plasmons peaks appear in ELS of La-W(110) system before the completion of the physical monolayer. Thus, the collectivization of valence electrons in the rare earth element film at the transition metal surface ensues for the submonolayer coverage like in the case of collective processes in alkali and alkaline earth element films
The Peierls stress of the moving 1/2{110} screw dislocation in Ta
International Nuclear Information System (INIS)
Liu Ruiping; Wang Shaofeng; Wu Xiaozhi
2009-01-01
The Peierls stress of the moving 1/2 {110} screw dislocation with a planar and non-dissociated core structure in Ta has been calculated. The elastic strain energy which is associated with the discrete effect of the lattice and ignored in classical Peierls-Nabarro (P-N) theory has been taken into account in calculating the Peierls stress, and it can make the Peierls stress become smaller. The Peierls stress we obtain is very close to the experimental data. As shown in the numerical calculations and atomistic simulations, the core structure of the screw dislocation undergoes significant changes under the explicit stress before the screw dislocation moves. Moreover, the mechanism of the screw dislocation is revealed by our results and the experimental data that the screw dislocation retracts its extension in three {110} planes and transforms its dissociated core structure into a planar configuration. Therefore, the core structure of the moving 1/2 {110} screw dislocation in Ta is proposed to be planar.
Tank characterization report for single-shell tank 241-b-110
International Nuclear Information System (INIS)
Field, J.G.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-110. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05
22 CFR 146.110 - Remedial and affirmative action and self-evaluation.
2010-04-01
... THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 146.110 Remedial and affirmative action and self-evaluation. (a) Remedial action. If the...
Nikulin, S. A.; Rozhnov, A. B.; Belov, V. A.; Li, E. V.; Glazkina, V. S.
2011-11-01
Exploratory investigations of the influence of alloying and impurity content in the E110 alloy cladding tubes on the behavior under conditions of Loss of Coolant Accidents (LOCA) has been performed. Three alloys of E110 type have been tested: E110 alloy of nominal composition Zr-1%Nb (E110), E110 alloy of modified composition Zr-1%Nb-0.12%Fe-0.13%O (E110M), E110 alloy of nominal composition Zr-1%Nb with reduced impurity content (E110G). Alloys E110 and E110M were manufactured on the electrolytic basis and alloy E110G was manufactured on the basis of zirconium sponge. The high temperature oxidation tests in steam ( T = 1100 °C, 18% of equivalent cladding reacted (ECR)) have been conducted, kinetics of oxidation was investigated. Quantitative research of structure and fracture macrocharacteristics was performed by means of optical and electron microscopy. The results received were compared with the residual ductility of specimens. The results of the investigation showed the existence of "breakaway oxidation" kinetics and white spalling oxide in E110 and E110M alloys while the specimen oxidation kinetics in E110G alloy was characterized by a parabolic law and specimens had a dense black oxide. Oxygen and iron alloying in the E110 alloy positively changed the macrocharacteristics of structure and fracture. However, in general, it did not improve the resistance to embrittlement in LOCA conditions apparently because of a strong impurity influence caused by electrolytic process of zirconium production.
Novel and simple synthesis of brominated 1,10-phenanthrolines
Czech Academy of Sciences Publication Activity Database
Výprachtický, Drahomír; Kaňková, Dana; Pokorná, Veronika; Kmínek, Ivan; Dzhabarov, Vagif; Cimrová, Věra
2014-01-01
Roč. 67, č. 6 (2014), s. 915-921 ISSN 0004-9425 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : 1,10-phenanthroline * electrophilic aromatic substitution * bromination Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.558, year: 2014
Directory of Open Access Journals (Sweden)
Laura Aragoneses-Fenoll
2018-02-01
Full Text Available Class IA phosphatidylinositol 3-kinase (PI3K catalytic subunits p110α and p110δ are targets in cancer therapy expressed at high levels in T lymphocytes. The role of p110δ PI3K in normal or pathological immune responses is well established, yet the importance of p110α subunits in T cell-dependent immune responses is not clear. To address this problem, mice with p110α conditionally deleted in CD4+ and CD8+ T lymphocytes (p110α−/−ΔT were used. p110α−/−ΔT mice show normal development of T cell subsets, but slightly reduced numbers of CD4+ T cells in the spleen. “In vitro,” TCR/CD3 plus CD28 activation of naive CD4+ and CD8+ p110α−/−ΔT T cells showed enhanced effector function, particularly IFN-γ secretion, T-bet induction, and Akt, Erk, or P38 activation. Tfh derived from p110α−/−ΔT cells also have enhanced responses when compared to normal mice, and IL-2 expanded p110α−/−ΔT CD8+ T cells had enhanced levels of LAMP-1 and Granzyme B. By contrast, the expansion of p110α−/−ΔT iTreg cells was diminished. Also, p110α−/−ΔT mice had enhanced anti-keyhole limpet hemocyanin (KLH IFN-γ, or IL-4 responses and IgG1 and IgG2b anti-KLH antibodies, using CFA or Alum as adjuvant, respectively. When compared to WT mice, p110α−/−ΔT mice inoculated with B16.F10 melanoma showed delayed tumor progression. The percentage of CD8+ T lymphocytes was higher and the percentage of Treg cells lower in the spleen of tumor-bearing p110α−/−ΔT mice. Also, IFN-γ production in tumor antigen-activated spleen cells was enhanced. Thus, PI3K p110α plays a significant role in antigen activation and differentiation of CD4+ and CD8+ T lymphocytes modulating antitumor immunity.
49 CFR 25.110 - Remedial and affirmative action and self-evaluation.
2010-10-01
... ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 25.110 Remedial and affirmative action and self-evaluation. (a) Remedial action. If the...
110mAg root and foliar uptake in vegetables and its migration in soil
International Nuclear Information System (INIS)
Shang, Z.R.; Leung, J.K.C.
2003-01-01
110m Ag, as a radionuclide of corrosion products in water-cooled nuclear reactors, was detected in the liquid effluents of Guangdong Daya Bay Nuclear Power Station (GNPS) of Daya Bay under normal operation conditions. Experiments on a simulated terrestrial agricultural ecosystem were carried out using the pot experiment approach. The most common plants in Hong Kong and the South China vegetable gardens such as lettuce, Chinese spinach, kale, carrot, pepper, eggplant, bean, flowering cabbage, celery, European onion and cucumber were selected for 110m Ag root and foliar uptake tests. The results show that carrot, kale and flowering cabbage have the greatest values of soil to plant transfer factor among the vegetables, while 110m Ag can be transferred to Chinese spinach via foliar uptake. Flowering cabbage, the most popular leafy vegetable locally, could be used as a biomonitor for the radioisotope contamination in vegetables. Soil column and adsorption tests were also carried out to study the leaching ability and distributio coefficient (K d ) of 110m Ag in the soil. The results show that most of the radionuclide was adsorbed in the top 1 cm of soil regardless of the pH value. The K d was also determined
Gleńska-Olender, J; Durlik, K; Konieczna, I; Kowalska, P; Gawęda, J; Kaca, W
2017-11-01
Bacteria of the genus Proteus of the family Enterobacteriaceae are facultative human pathogens responsible mainly for urinary tract and wound infections, bacteremia and the development of rheumatoid arthritis (RA). We have analyzed and compared by ELISA the titer of antibodies in plasmas of healthy individuals and in sera of rheumatoid arthritis patients recognizing a potential host cross-reactive epitope (lysine-galacturonic acid epitopes) present in Proteus lipopolysaccharide (LPS). In our experiments LPSs isolated from two mutants of smooth Proteus mirabilis 1959 (O3), i.e. strains R110 and R45, were used. R110 (Ra type mutant) is lacking the O-specific polysaccharide, but possesses a complete core oligosaccharide, while R45 (Re type) has a reduced core oligosaccharide and contains two 3-deoxy-D-manno-oct-2-ulosonic acid residues and one of 4-amino-4-deoxy-L-arabinopyranose residues. Titer of P. mirabilis S1959 LPS-specific-antibodies increased with the age of blood donors. RA and blood donors' sera contained antibodies against S and Ra and Re type of P. mirabilis O3 LPSs. Antibodies recognizing lysine-galacturonic acid epitopes of O3 LPS were detected by ELISA in some plasmas of healthy individuals and sera of rheumatoid arthritis patients. RA patients antibodies reacting with P. mirabilis S1959 S and R LPSs may indicate a potential role of anti-LPS antibodies in molecular mimicry in RA diseases.
Development of axial asymmetry in the neutron-rich nucleus {sup 110}Mo
Energy Technology Data Exchange (ETDEWEB)
Watanabe, H., E-mail: hiroshi@ribf.riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yamaguchi, K.; Odahara, A. [Department of Physics, Osaka University, Machikaneyama-machi 1-1, Osaka 560-0043 Toyonaka (Japan); Sumikama, T. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Nishimura, S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yoshinaga, K. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Li, Z. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Miyashita, Y. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Sato, K. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Prochniak, L. [Institute of Physics, Maria Curie-Sklodowska University, pl. M. Curie-Sklodowskiej 1, 20-031 Lublin (Poland); Baba, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Berryman, J.S. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Blasi, N. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Bracco, A.; Camera, F. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Dipartimento di Fisica, Universita di Milano, via Celoria 16, I-20133 Milano (Italy); Chiba, J. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Doornenbal, P. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Go, S.; Hashimoto, T.; Hayakawa, S. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan)
2011-10-19
The neutron-rich nucleus {sup 110}Mo has been investigated by means of {gamma}-ray spectroscopy following the {beta}-decay of {sup 110}Nb, produced using in-flight fission of a {sup 238}U beam at 345 MeV/nucleon at the RIBF facility. In addition to the ground-band members reported previously, spectroscopic information on the low-lying levels of the quasi-{gamma} band built on the second 2{sup +} state at 494 keV has been obtained for the first time. The experimental finding of the second 2{sup +} state being lower than the yrast 4{sup +} level suggests that axially-asymmetric {gamma} softness is substantially enhanced in this nucleus. The experimental results are compared with model calculations based on the general Bohr Hamiltonian method. The systematics of the low-lying levels in even-even A{approx}110 nuclei is discussed in comparison with that in the neutron-rich A{approx}190 region, by introducing the quantity E{sub S}/E(2{sub 1}{sup +}), E{sub S}=E(2{sub 2}{sup +})-E(4{sub 1}{sup +}), as a global signature of the structural evolution involving axial asymmetry.
Isomerization of 2-phospha-4-silabicyclo[1.10]butane
Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.
2004-01-01
In analogy with the valence isomerism of the hydrocarbons bicyclobutane, 1,3-butadiene and cyclobutene, the rearrangements for 2-phospha-4-sila- bicyclo[1.1.0]butane were studied at the B3LYP/6-311+G** level of theory. The monocyclic 1,2-dihydro-1,2-phosphasilete is shown to be the thermodynamically
41 CFR 101-25.110-2 - Tires obtained through Federal Supply Schedules or regional term contracts.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tires obtained through Federal Supply Schedules or regional term contracts. 101-25.110-2 Section 101-25.110-2 Public Contracts... Federal Supply Schedules or regional term contracts. When tire manufacturers ship tires direct against...
Magnetoelastic coupling in TbFe2 (110) thin films
International Nuclear Information System (INIS)
Ciria, M.; Arnaudas, J.I.; Dufour, C.; Oderno, V.; Dumesnil, K.; del Moral, A.
1997-01-01
We have determined the rhombohedral magnetoelastic stress of a Laves phase TbFe 2 (110) single-crystal film, grown by molecular-beam epitaxy. The film thickness was 1300 Angstrom. The magnetoelastic stress was directly measured by using a low-temperature cantilever capacitive method, between 300 and 10 K. The isotherms clearly display the coercive field but, unlike bulk alloy behavior, do not saturate even at the maximum field of 12 T. The determined rhombohedral magnetoelastic parameter of the film is B ε,2 =-0.43 GPa, at 0 K and 12 T, which is 0.67 times the value for bulk TbFe 2 . B ε,2 follows a power m 3 of the reduced magnetization m, indicating a single-ion volume origin for the rhombohedral magnetoelastic stress of this film. Measurements performed in a 300 Angstrom TbFe 2 (110) film deposited onto a YFe 2 buffer show that the coercive field is drastically lowered and that the magnetoelastic distortion is negligible. copyright 1997 American Institute of Physics
Systemic Assessment of Patients Undergoing Dental Implant ...
African Journals Online (AJOL)
Background: Procedure‑related and patient‑related factors influence the prognosis of dental implants to a major extent. Hence, we aimed to evaluate and analyze various systemic factors in patients receiving dental implants. Materials and Methods: Fifty‑one patients were included in the study, in which a total of 110 dental ...
Energy Technology Data Exchange (ETDEWEB)
Hasselgren, L; Fahlander, C; Falk, F; Edvardson, L O; Thun, J E; Ghuman, B S [Uppsala Univ. (Sweden). Fysiska Institutionen; Skaali, B [Oslo Univ. (Norway). Fysisk Institutt
1976-06-28
The reorientation precession technique, REPREC, for measurements of quadrupole moments is described. The application of REPREC to the measurement of the static electric quadrupole moments of the first excited 2/sup +/ states in /sup 108/ /sup 110/Pd is presented. The possibility to measure the sign of the matrix product P/sub 4/ = M/sub 02/Msub(22')Msub(02')M/sub 22/ is also discussed. Such measurements are presented for /sup 108/ /sup 110/Pd. The results of these measurements are P/sub 4/ < 0 for both /sup 108/Pd and /sup 110/Pd. For /sup 108/Pd the quadrupole moment of the first excited 2/sup +/ state was found to be -0.66+-0.18e.b and for /sup 110/Pd, -0.72+-0.14e.b. Intrinsic nuclear properties for /sup 106 -110/Pd are derived using the sum rules suggested by Kumar.
Geometric structures of thin film: Pt on Pd(110) and NiO on Ni(100)
Energy Technology Data Exchange (ETDEWEB)
Warren, Oden L. [Iowa State Univ., Ames, IA (United States)
1993-07-01
This thesis is divided into 3 papers: dynamical low-energy electron- diffraction investigation of lateral displacements in topmost layer of Pd(110); determination of (1x1) and (1x2) structures of Pt thin films on Pd(110) by dynamical low-energy electron-diffraction analysis; and structural determination of a NiO(111) film on Ni(100) by dynamical low-energy electron-diffraction analysis.
Organic adsorbates on metal surfaces. PTCDA and NTCDA on AG(110)
Energy Technology Data Exchange (ETDEWEB)
Abbasi, Afshin
2010-02-22
Polyaromatic molecules functionalized with carboxylic groups have served as model systems for the growth of organic semiconducting films on a large variety of substrates. Most non-reactive substrates allow for a growth mode compatible with the bulk phase of the molecular crystal with two molecules in the unit cell, but some more reactive substrates including Ag(111) and Ag(110) can induce substantial changes in the first monolayer (ML). In the specific case of Ag(110), the adsorbate unit cell of both NTCDA and PTCDA resembles a brickwall structure, with a single molecule in the unit cell. From this finding, it can be concluded that the adsorbate-substrate interaction is stronger than typical inter-molecular binding energies in the respective bulk phases. In the present work, the interactions between small Ag(110) clusters and a single NTCDA or PTCDA molecule are investigated with different ab initio techniques. Four major ingredients contribute to the binding between adsorbate and substrate: Directional bonds between Ag atoms in the topmost layer and the oxygen atoms of the molecule, Pauli repulsion between filled orbitals of molecule and substrate, an attractive van-der-Waals interaction, and a negative net charge on the molecule inducing positive image charges in the substrate, resulting therefore in an attractive Coulomb interaction between these opposite charges. As both Hartree-Fock theory and density functional theory with typical gradient-corrected density functional do not contain any long range correlation energy required for dispersion interactions, we compare these approaches with the fastest numerical technique where the leading term of the van-der-Waals interaction is included, i.e. second order Moeller-Plesset theory (MP2). Both Hartree-Fock and density functional theory result in bended optimized geometries where the adsorbate is interacting mainly via the oxygen atoms, with the core of the molecule repelled from the substrate. Only at the MP2 level
Tailoring Graphene Morphology and Orientation on Cu(100), Cu(110), and Cu(111)
Jacobberger, Robert; Arnold, Michael
2013-03-01
Graphene CVD on Cu is phenomenologically complex, yielding diverse crystal morphologies, such as lobes, dendrites, stars, and hexagons, of various orientations. We present a comprehensive study of the evolution of these morphologies as a function of Cu surface orientation, pressure, H2:CH4, and nucleation density. Growth was studied on ultra-smooth, epitaxial Cu films inside Cu enclosures to minimize factors that normally complicate growth. With low H2:CH4, Mullins-Sekerka instabilities propagate to form dendrites, indicating transport limited growth. In LPCVD, the dendrites extend hundreds of microns in the 100, 111, and 110 directions on Cu(100), (110), and (111) and are perturbed by twin boundaries. In APCVD, multiple preferred dendrite orientations exist. With increasing H2:CH4, the dendritic nature of growth is suppressed. In LPCVD, square, rectangle, and hexagon crystals form on Cu(100), (110) and (111), reflecting the Cu crystallography. In APCVD, the morphology becomes hexagonal on each surface. If given ample time, every growth regime yields high-quality monolayers with D:G Raman ratio rationally tailor the graphene crystal morphology and orientation.
Structural, electronic and adsorption properties of Rh(111)/Mo(110) bimetallic catalyst: A DFT study
Energy Technology Data Exchange (ETDEWEB)
Palotás, K., E-mail: palotas@phy.bme.hu [Budapest University of Technology and Economics, Department of Theoretical Physics, H-1111 Budapest (Hungary); Slovak Academy of Sciences, Institute of Physics, Department of Complex Physical Systems, Center for Computational Materials Science, SK-84511 Bratislava (Slovakia); Bakó, I. [Hungarian Academy of Sciences, Research Center for Natural Sciences, Institute of Organic Chemistry, H-1117 Budapest (Hungary); Bugyi, L. [MTA-SZTE, Reaction Kinetics and Surface Chemistry Research Group, Rerrich B. Sqr. 1, H-6720 Szeged (Hungary)
2016-12-15
Highlights: • 1 ML of Rh on Mo(110) forms a wavy structure propagating along the [001] direction. • Strain & ligand effects in the Rh film cause a downward shift of the d-band center. • CO adsorption energies are decreased by about 35% compared to pure Rh(111). • Depending on adsorption site, 0.28–0.46 e is transferred to adsorbed CO from Rh film. • CO adsorption generates 0.15–0.22 e transfer from Rh film to Mo in the unit cell. - Abstract: Geometric and electronic characterizations of one monolayer rhodium with Nishiyama-Wassermann (NW) structure on Mo(110) substrate have been performed by density functional theory (DFT) calculations. In the NW structure the Rh atoms form a wavy structure propagating along the [001] direction, characterized by an amplitude of 0.26 Å in the [110] direction and by 0.10 Å in the [110] direction of the Mo(110) substrate. Strain and ligand effects operating in the rhodium film are distinguished and found to be manifested in the downward shift of the d-band center of the electron density of states (DOS) by 0.11 eV and 0.18 eV, respectively. The shift in the d-band center of Rh DOS predicts a decrease in the surface reactivity toward CO adsorption, which has been verified by detailed calculations of bond energies of CO located at on-top, bridge and hollow adsorption sites. The CO adsorption energies are decreased by about 35% compared to those reported for pure Rh(111), offering novel catalytic pathways for the molecule. An in-depth analysis of the charge transfer and the partial DOS characters upon CO adsorption on the NW-structured Rh(111)/Mo(110) bimetallic catalyst and on the pure Rh(111) surface sheds light on the bonding mechanism of CO and on the governing factors determining its lowered bond energy on the bimetallic surface.
Practice of Totally Tubeless Nephrolitotomy among Patients with Renal Calculus
Directory of Open Access Journals (Sweden)
Musa Ekici
2013-08-01
Full Text Available Purpose: We aimed to present the data on totally tubeless nephrolitotomy (PNL outcomes undergone in our clinic. Materials and Methods: We retrospectively analyzed 140 patients undergone totally tubeless PNL in our clinic between January 2010 and December 2012. Results: Mean patient age was 47,84 (5-73. Mean operative time was 88,8 (45-110 minutes where mean stone area was 375,3 (110-175 mm2 . 92,8% was our stone free rate. Remaining 10 patients had undergone ureterorenoscopy for ureteral stones. Two patients having non-opaque stones had residual kidney stones and treated by SWL. 8 patients (%5,7 needed blood transfusion, 2 patients needed perirenal hematoma and treated conservatively. No patients needed additional treatment or encountered vascular complications. One patient encountered serozal colon injury and treated conservatively. Conclusion: With regard to patient comfort, shorter hospital stay, low analgesic requirement, totally tubeless PNL gained popularity. We believe totally tubeless PNL may be used in suitable cases. Key Words: Kidney Stone, Totally Tubeless, Nephrolithotomy [Cukurova Med J 2013; 38(4.000: 636-641
31 CFR 103.110 - Voluntary information sharing among financial institutions.
2010-07-01
... Information Sharing Procedures To Deter Money Laundering and Terrorist Activity § 103.110 Voluntary.... 5312(a)(2) that is required under this part to establish and maintain an anti-money laundering program... suspects may involve possible terrorist activity or money laundering. (2) Notice requirement. A financial...
46 CFR 133.110 - Survival craft muster and embarkation arrangements.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft muster and embarkation arrangements. 133... VESSELS LIFESAVING SYSTEMS Requirements for All OSVs § 133.110 Survival craft muster and embarkation... lighting supplied from the emergency source of electrical power. (e) Each davit-launched survival craft...
International Nuclear Information System (INIS)
Markelov, V.A.; Novikov, V.V.; Kon'kov, V.F.; Tselishchev, A.V.; Dologov, A.B.; Zmitko, M.; Maserik, V.; Kocik, J.
2008-01-01
As structural materials for VVER 1000 fuel rod claddings and FA components use is made of zirconium alloys E110 (Zr 1Nb) and E635 (Zr 1.2Sn 1Nb 0.35Fe) that meet the design parameters of operation. Nonetheless, the work is in progress to perfect those alloys to reach higher corrosion and shape change resistance. At VNIINM updated E110M and E635M alloys have been developed on E110 and E635 bases. To assess the corrosion behaviour of the updated alloys in comparison to the base alloys their cladding samples were tested in RVS 3 loop of LWR 15 reactor (NRI, Rez) in PWR water chemistry with coolant surface and volume boiling. The data are presented on the influence effected by in pile irradiation for up to 324 days on oxide coat thickness and microstructure of fuel claddings produced from the four tested alloys. It has been revealed that E110 alloy its updated version E110M and E635M alloy compared to E635 have higher corrosion resistances. The paper discusses th+e results on the in pile corrosion of cladding samples from the alloys under study in comparison to the results acquired for similar samples tested in LWR 15 inactive channel and under autoclave conditions. Using methods of TEM, EDX analyses of extraction replicas dislocation structure and phase composition changes were studied in samples of all four alloy claddings LWR 15 reactor irradiated to the material damage dose of 1.5 dpa. The interrelation is discussed between irradiation effected strengthening and corrosion of fuel claddings made of E110 and E635 type zirconium alloys and the evolution of their structure and phase states
Cizmecioglu, Onur; Ni, Jing; Xie, Shaozhen; Zhao, Jean J; Roberts, Thomas M
2016-01-01
We aimed to understand how spatial compartmentalization in the plasma membrane might contribute to the functions of the ubiquitous class IA phosphoinositide 3-kinase (PI3K) isoforms, p110α and p110β. We found that p110β localizes to membrane rafts in a Rac1-dependent manner. This localization potentiates Akt activation by G-protein-coupled receptors (GPCRs). Thus genetic targeting of a Rac1 binding-deficient allele of p110β to rafts alleviated the requirement for p110β-Rac1 association for GPCR signaling, cell growth and migration. In contrast, p110α, which does not play a physiological role in GPCR signaling, is found to reside in nonraft regions of the plasma membrane. Raft targeting of p110α allowed its EGFR-mediated activation by GPCRs. Notably, p110β dependent, PTEN null tumor cells critically rely upon raft-associated PI3K activity. Collectively, our findings provide a mechanistic account of how membrane raft localization regulates differential activation of distinct PI3K isoforms and offer insight into why PTEN-deficient cancers depend on p110β. DOI: http://dx.doi.org/10.7554/eLife.17635.001 PMID:27700986
Preparation technology of 103Pd-110Agm composite alloy membranes
International Nuclear Information System (INIS)
Liu Zhuo; Chen Daming; Jin Xiaohai; Li Zhongyong; Guo Feihu; Qin Hongbin
2012-01-01
The preparation of 103 Pd- 110 Ag m alloy membranes was the basis for the production of 103 Pd- 125 I composite sources. Taking 103 Pd and 110 Ag m as trace elements, the method of non-electrolytical plating was chosen to prepare the alloy membrane. A γ-detector and electron microscope (SEM) were used for quantitative and qualitative analysis, respectively. The pre-treatment of the support before the preparation of Palladium-silver composite membranes was discussed in detail. It was found that when the concentration of PdCl 2 was between 0.5 and 2.0 mmol/L the result was good. The effects of various factors were investigated, including the proportion of Pd and Ag, the concentrations of the total metal, ammonium hydroxide hydrazine and ethylenediaminetetraacetic acid, temperature, the time, and the rotation speed. By improving the reaction conditions the alloy membrane with metallic luster was obtained. Besides, the presence of Pd and Ag was observed in the alloy membranes by qualitative analysis. (authors)
Hjörvarsson, B; Olafsson, S; Karlsson, E B; Birch, J; Sundgren, J E
1997-01-01
We have investigated the hydrogen distribution within multilayered Mo/V (110) and (001) artificial superlattices. The hydrogen concentration, determined by the sup 1 H( sup 1 sup 5 N, alpha gamma) sup 1 sup 2 C nuclear resonance reaction, is found to decrease with decreasing layer thickness. The decrease is attributed to an interface region with reduced hydrogen content. The extension of this interface region is found to be two monolayers in Mo/V (110), compared to the previously reported three monolayers in Mo/V (001) superlattices. In the (110) oriented samples the relative amount of H in the interface region decreases with increasing average H content (H/V (atomicratio) approx. 0.3-0.5). This effect is shown to be related to the orientation of the hydrogen planes with respect to the boundaries implied by the Mo/V interfaces. The hydrogen induced volume change, obtained by conventional theta-2 theta x-ray diffraction (XRD) and reciprocal space mapping, is found to be smaller for the (110) samples than for t...
Structural and magnetic anisotropy in the epitaxial FeV2O4 (110) spinel thin films
Shi, Xiaolan; Wang, Yuhang; Zhao, Kehan; Liu, Na; Sun, Gaofeng; Zhang, Liuwan
2015-11-01
The epitaxial 200-nm-thick FeV2O4(110) films on (110)-oriented SrTiO3, LaAlO3 and MgAl2O4 substrates were fabricated for the first time by pulsed laser deposition, and the structural, magnetic, and magnetoresistance anisotropy were investigated systematically. All the films are monoclinic, whereas its bulk is cubic. Compared to FeV2O4 single crystals, films on SrTiO3 and MgAl2O4 are strongly compressively strained in [001] direction, while slightly tensily strained along normal [110] and in-plane [ 1 1 ¯ 0 ] directions. In contrast, films on LaAlO3 are only slightly distorted from cubic. The magnetic hard axis is in direction, while the easier axis is along normal [110] direction for films on SrTiO3 and MgAl2O4, and in-plane [ 1 1 ¯ 0 ] direction for films on LaAlO3. Magnetoresistance anisotropy follows the magnetization. The magnetic anisotropy is dominated by the magnetocrystalline energy, and tuned by the magneto-elastic coupling.
GREEN CHEMISTRY APPLICATION FOR THE SYNTHESIS OF (1-N-4’-METHOXYBENZYL-1,10-PHENANTHROLINIUM BROMIDE
Directory of Open Access Journals (Sweden)
Maulidan Firdaus
2010-06-01
Full Text Available A simple, energy-efficient, and relatively quick synthetic procedure for the synthesis of (1-N-4'-methoxybenzyl-1,10-phenanthrolinium bromide, based on green chemistry principles has been carried out. The synthesis was started by solvent-free reduction of p-anisaldehyde with NaBH4 to give 4-methoxybenzyl alcohol in 98% yield to be followed by solvent-free treatment of the resulted alcohol with PBr3 to yield 4-methoxybenzyl bromide (86%. Furthermore, the obtained bromide was reacted with 1,10-phenanthroline in acetone at reflux for 12 h to give the phenanthrolinium salt target in 68% yield. Keywords: green chemistry, p-anisaldehyde, (1-N-4'-methoxybenzyl-1,10-phenanthrolinium bromide
International Nuclear Information System (INIS)
Pryadkin, S.L.; Tsoj, V.S.
1988-01-01
The electrically polished (100) and (110) surfaces of tungsten are studied with the aid of a scanning tunnel microscope at atmospheric pressure. The (110) surface consists of a large number of atomically plane terraces whereas the (100) surface is faceted. The scanning tunnel microscope data can explain such results of experiments on transverse electron focussing as the strong dependence of the probability for specular reflection of conduction electrons scattered by the (100) surface on the electron de Broglie wavelength and the absence of a dependence of the probability for specular reflection on the wavelength for the (110) surface
cis-Difluoridobis(1,10-phenanthroline)chromium(III) perchlorate monohydrate
DEFF Research Database (Denmark)
Birk, Torben; Bendix, Jesper; Weihe, Högni
2008-01-01
The title complex, [CrF(2)(C(12)H(8)N(2))(2)]ClO(4)·H(2)O, displays a slightly distorted octa-hedral coordination geometry around the central chromium(III) ion. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline [average Cr(III)-N = 2.0726 (10) Å] and two fluoride [ave...
33 CFR 110.85 - Niagara River, Youngstown, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River, Youngstown, N.Y... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.85 Niagara River, Youngstown, N.Y. (a) Area 1... of the Niagara River at latitude 43°14′33″ N, longitude 79°03′7.5″ W; thence westerly to a point at...
42 CFR 421.110 - Requirements for approval of an agreement.
2010-10-01
... SERVICES (CONTINUED) MEDICARE PROGRAM MEDICARE CONTRACTING Intermediaries § 421.110 Requirements for... regulatory authorities of the State or States in which it, or any subcontractor performing some or all of its... only providers located in a single State; (5) Has acted in good faith to achieve effective cooperation...
46 CFR 199.110 - Survival craft muster and embarkation arrangements.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft muster and embarkation arrangements. 199... § 199.110 Survival craft muster and embarkation arrangements. (a) Each muster station must have... emergency source of electrical power. (e) Each davit-launched and free-fall survival craft muster station...
Directory of Open Access Journals (Sweden)
H A Badehian
2015-07-01
Full Text Available In recent work the structural, electronic and optical properties of BSb compound in bulk and surface (110 states have been studied. Calculations have been performed using Full-Potential Augmented Plane Wave (FP-LAPW method by WIEN2k code in Density Functional Theory (DFT framework. The structural properties of the bulk such as lattice constant, bulk module and elastic constants have been investigated using four different approximations. The band gap energy of the bulk and the (110 surface of BSb were obtained about 1.082 and 0.38 eV respectively. Moreover the surface energy, the work function, the surface relaxation, surface state and the band structure of BSb (110 were investigated using symmetric and stoichiometric 15 layers slabs with the vacuum of 20 Bohr. In addition, the real and imaginary parts of the dielectric function of the bulk and the BSb (110 slab were calculated and compared to each other. Our obtained results have a good agreement with the available results.
Atomic and electronic structure of V-Rh(110) near-surface alloy
Czech Academy of Sciences Publication Activity Database
Píš, I.; Stetsovych, V.; Mysliveček, J.; Kettner, M.; Vondráček, Martin; Dvořák, F.; Mazur, D.; Matolín, V.; Nehasil, V.
2013-01-01
Roč. 117, č. 24 (2013), s. 12679-12688 ISSN 1932-7447 Institutional support: RVO:68378271 Keywords : V−Rh(110) near-surface alloy * STM * XPS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.835, year: 2013
{sup 110m}Ag root and foliar uptake in vegetables and its migration in soil
Energy Technology Data Exchange (ETDEWEB)
Shang, Z.R.; Leung, J.K.C. E-mail: jkcleung@hku.hk
2003-07-01
{sup 110m}Ag, as a radionuclide of corrosion products in water-cooled nuclear reactors, was detected in the liquid effluents of Guangdong Daya Bay Nuclear Power Station (GNPS) of Daya Bay under normal operation conditions. Experiments on a simulated terrestrial agricultural ecosystem were carried out using the pot experiment approach. The most common plants in Hong Kong and the South China vegetable gardens such as lettuce, Chinese spinach, kale, carrot, pepper, eggplant, bean, flowering cabbage, celery, European onion and cucumber were selected for {sup 110m}Ag root and foliar uptake tests. The results show that carrot, kale and flowering cabbage have the greatest values of soil to plant transfer factor among the vegetables, while{sup 110m}Ag can be transferred to Chinese spinach via foliar uptake. Flowering cabbage, the most popular leafy vegetable locally, could be used as a biomonitor for the radioisotope contamination in vegetables. Soil column and adsorption tests were also carried out to study the leaching ability and distributio coefficient (K{sub d}) of {sup 110m}Ag in the soil. The results show that most of the radionuclide was adsorbed in the top 1 cm of soil regardless of the pH value. The K{sub d} was also determined.
Contemporary management of spinal AVFs and AVMs: lessons learned from 110 cases.
Rangel-Castilla, Leonardo; Russin, Jonathan J; Zaidi, Hasan A; Martinez-Del-Campo, Eduardo; Park, Min S; Albuquerque, Felipe C; McDougall, Cameron G; Nakaji, Peter; Spetzler, Robert F
2014-09-01
Spinal arteriovenous fistulas (AVFs) and arteriovenous malformations (AVMs) are rare, complex spinal vascular lesions that are challenging to manage. Recently, understanding of these lesions has increased thanks to neuroimaging technology. Published reports of surgical results and clinical outcome are limited to small series. The authors present a large contemporary series of patients with spinal AVFs and AVMs who were treated at Barrow Neurological Institute in Phoenix, Arizona. Retrospective detailed review of a prospective vascular database was performed for all patients with spinal AVFs and AVMs treated between 2000 and 2013. Patient demographic data, AVF and AVM characteristics, surgical results, clinical outcomes, complications, and long-term follow-up were reviewed. Between 2000 and 2013, 110 patients (57 male and 53 female) underwent obliteration of spinal AVFs and AVMs. The mean age at presentation was 42.3 years (range 18 months-81 years). There were 44 patients with AVFs and 66 with AVMs. The AVM group included 27 intramedullary, 21 conus medullaris, 12 metameric, and 6 extradural. The most common location was thoracic spine (61%), followed by cervical (22.7%), lumbar (14.5%), and sacral (1.8%). The most common presenting signs and symptoms included paresis/paralysis (75.5%), paresthesias (60%), pain (51.8%), bowel/bladder dysfunction (41.8%), and myelopathy (36.4%). Evidence of rupture was seen in 26.4% of patients. Perioperative embolization was performed in 42% of patients. Resection was performed in 95 patients (86.4%). Embolization alone was the only treatment in 14 patients (12.7%). One patient was treated with radiosurgery alone. Angiographically verified AVF and AVM obliteration was achieved in 92 patients (83.6%). At a mean follow-up duration of 30.5 months (range 1-205 months), 43 patients (97.7%) with AVFs and 57 (86.4%) with AVMs remained functionally independent (McCormick Scale scores ≤ 2). Perioperative complications were seen in 8
Putative bronchopulmonary flagellated protozoa in immunosuppressed patients.
Kilimcioglu, Ali Ahmet; Havlucu, Yavuz; Girginkardesler, Nogay; Celik, Pınar; Yereli, Kor; Özbilgin, Ahmet
2014-01-01
Flagellated protozoa that cause bronchopulmonary symptoms in humans are commonly neglected. These protozoal forms which were presumed to be "flagellated protozoa" have been previously identified in immunosuppressed patients in a number of studies, but have not been certainly classified so far. Since no human cases of bronchopulmonary flagellated protozoa were reported from Turkey, we aimed to investigate these putative protozoa in immunosuppressed patients who are particularly at risk of infectious diseases. Bronchoalveolar lavage fluid samples of 110 immunosuppressed adult patients who were admitted to the Department of Chest Diseases, Hafsa Sultan Hospital of Celal Bayar University, Manisa, Turkey, were examined in terms of parasites by light microscopy. Flagellated protozoal forms were detected in nine (8.2%) of 110 cases. Metronidazole (500 mg b.i.d. for 30 days) was given to all positive cases and a second bronchoscopy was performed at the end of the treatment, which revealed no parasites. In conclusion, immunosuppressed patients with bronchopulmonary symptoms should attentively be examined with regard to flagellated protozoa which can easily be misidentified as epithelial cells.
Directory of Open Access Journals (Sweden)
Oscar Q Pich
Full Text Available BACKGROUND: The terminal organelle is a complex structure involved in many aspects of the biology of mycoplasmas such as cell adherence, motility or cell division. Mycoplasma genitalium cells display a single terminal organelle and duplicate this structure prior to cytokinesis in a coordinated manner with the cell division process. Despite the significance of the terminal organelle in mycoplasma virulence, little is known about the mechanisms governing its duplication. METHODOLOGY/PRINCIPAL FINDINGS: In this study we describe the isolation of a mutant, named T192, with a transposon insertion close to the 3' end of the mg192 gene encoding for P110 adhesin. This mutant shows a truncated P110, low levels of P140 and P110 adhesins, a large number of non-motile cells and a high frequency of new terminal organelle formation. Further analyses revealed that the high rates of new terminal organelle formation in T192 cells are a direct consequence of the reduced levels of P110 and P140 rather than to the expression of a truncated P110. Consistently, the phenotype of the T192 mutant was successfully complemented by the reintroduction of the mg192 WT allele which restored the levels of P110 and P140 to those of the WT strain. Quantification of DAPI-stained DNA also showed that the increase in the number of terminal organelles in T192 cells is not accompanied by a higher DNA content, indicating that terminal organelle duplication does not trigger DNA replication in mycoplasmas. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate the existence of a mechanism regulating terminal organelle duplication in M. genitalium and strongly suggest the implication of P110 and P140 adhesins in this mechanism.
Mixed-ligand copper(II) complexes of dipicolylamine and 1,10 ...
Indian Academy of Sciences (India)
Unknown
DNA repair mechanism.13,14 Copper(II) complexes containing heterocyclic bases have received consid- erable current interest in nucleic acid chemistry due to their diverse applications following the discovery of the “chemical nuclease” activity of the [Cu. (phen)2]+ (phen = 1,10-phenanthroline) complex in the presence of ...
Large-angle positronium emission for Al(110)
International Nuclear Information System (INIS)
Schultz, P.J.; Lynn, K.G.; Frieze, W.E.
1984-10-01
Mono-energetic positrons have been used to study the time-of-flight distribution of ortho-positronium (o-Ps) formed just outside the surface of an Al(110) single crystal. The data are interpreted in terms of two predominant angular distributions for the directly formed o-Ps: one that is peaked towards the surface normal and another that is directed towards large angles. These processes are shown to be very sensitive to both oxygen exposure and Ar + ion sputtering. Ps emitted at large-angles may be evidence of formation with electrons propagating in a two-dimensional surface state
DEFF Research Database (Denmark)
Garcia-Mota, Monica; Vojvodic, Aleksandra; Metiu, Horia
2011-01-01
The oxygen evolution reaction (OER) on the rutile M-TiO2(110) (M = V, Nb, Ta, Cr, Mo, W, Mn, Fe, Ru, Ir, Ni) surfaces was investigated by using density functional theory calculations. The stability of different doped TiO2 systems was analyzed. The scaling relationship between the binding energies...... of OER intermediates (HOO* versus HO*) is found to follow essentially the same trend as for undoped oxides. Our theoretical analysis shows a lower overpotential associated with OER on the doped M-TiO2(110) than on the undoped TiO2(110). The theoretical activity of Cr-, Mo-, Mn-, and Ir-doped TiO2...
ICP-MS measurement of silver diffusion coefficient in graphite IG-110 between 1048K and 1284K
Carter, L. M.; Seelig, J. D.; Brockman, J. D.; Robertson, J. D.; Loyalka, S. K.
2018-01-01
Silver-110m has been shown to permeate intact silicon carbide and pyrolytic carbon coating layers of the TRISO fuel particles during normal High Temperature Gas-Cooled Reactor (HTGR) operational conditions. The diffusion coefficients for silver in graphite IG-110 measured using a release method designed to simulate HTGR conditions of high temperature and flowing helium in the temperature range 1048-1253 K are reported. The measurements were made using spheres milled from IG-110 graphite that were infused with silver using a pressure vessel technique. The Ag diffusion was measured using a time release technique with an ICP-MS instrument for detection. The results of this work are:
Metal-ion complexes of functionalised 1,10-Phenanthrolines as hydrolytic synzymes
Weijnen, J.G.J.
1993-01-01
In this thesis metal-ion complexes of functionalised 1,10-phenanthroline derivatives have been studied as model systems for hydrolytic metallo-enzymes. Amphiphilic metallo- complexes incorporated into micelles or vesicles and water-soluble complexes in pure aqueous buffer solutions, have
Research on Line Patrol Strategy of 110kV Transmission Line after Lightning Strike
Directory of Open Access Journals (Sweden)
Li Mingjun
2016-01-01
Full Text Available Lightning faults occupy in the majority of instantaneous fault and reclosing can usually be successful, so power supply can be restored without immediate patrol in many cases. Firstly, this paper introduces the lightning fault positioning and identifying method. Then test electrical performance of insulators after lightning strike from 110kV lines. Data shows that lightning strike has little effect on the electric performance of insulator. Finally, illustrating disposal process of the 110 kV transmission line after lightning fault, certifying that the power supply reliability be ensured without line patrol.
Fissionlike phenomena for systems with mass A=110
International Nuclear Information System (INIS)
Heusch, B.
1984-01-01
We present a part of the considerable amount of data we obtained these last years in the study of composite systems of mass around 110. From the rotating liquid drop models, theses systems are known as nearly the most stable nuclei, i.e. angular momenta as large as 90 h can be fully absorbed. Only bombarding energies less than 8MeV/nucleon will be considered here avoiding therefore that imcomplete fusion, projectile fragmentation of other such mechanisms play a measurable role
On the interplay between Si(110) epilayer atomic roughness and subsequent 3C-SiC growth direction
Khazaka, Rami; Michaud, Jean-François; Vennéguès, Philippe; Nguyen, Luan; Alquier, Daniel; Portail, Marc
2016-11-01
In this contribution, we performed the growth of a 3C-SiC/Si/3C-SiC layer stack on a Si(001) substrate by means of chemical vapor deposition. We show that, by tuning the growth conditions, the 3C-SiC epilayer can be grown along either the [111] direction or the [110] direction. The key parameter for the growth of the desired 3C-SiC orientation on the Si(110)/3C-SiC(001)/Si(001) heterostructure is highlighted and is linked to the Si epilayer surface morphology. The epitaxial relation between the layers has been identified using X-ray diffraction and transmission electron microscopy (TEM). We showed that, regardless of the top 3C-SiC epilayer orientation, domains rotated by 90° around the growth direction are present in the epilayer. Furthermore, the difference between the two 3C-SiC orientations was investigated by means of high magnification TEM. The results indicate that the faceted Si(110) epilayer surface morphology results in a (110)-oriented 3C-SiC epilayer, whereas a flat hetero-interface has been observed between 3C-SiC(111) and Si(110). The control of the top 3C-SiC growth direction can be advantageous for the development of new micro-electro-mechanical systems.
33 CFR 110.60 - Captain of the Port, New York.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Captain of the Port, New York... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.60 Captain of the Port, New York. (a) Western... point of origin. (d) New York Harbor. (1) Newark Bay, Southeast. All waters bound by the following...
Structural and spectroscopic studies of 2,9-dimethyl-1,10 ...
African Journals Online (AJOL)
The crystal structures of the pronated ligand, 2,9-dimethyl-1,10-phenanthrolinium (DPH) cation with selected counter anions (chloride (1), triflate (2), and gold dicyanide (3)) are reported. The role of a hydrogen bond interaction in influencing the solid state p-p stacking found in all three compounds has been investigated.
21 CFR 510.110 - Antibiotics used in food-producing animals.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Antibiotics used in food-producing animals. 510... Rulings and Decisions § 510.110 Antibiotics used in food-producing animals. (a) The Food and Drug... has requested an evaluation of the public health aspects of the use of antibiotics in veterinary...
Poly[μ4-glutarato-di-μ3-glutarato-bis(1,10-phenanthrolinediyttrium(III
Directory of Open Access Journals (Sweden)
Ling Jin
2011-08-01
Full Text Available In the title complex, [Y2(C5H6O43(C12H8N22]n, three glutarate groups and two 1,10-phenanthroline molecules surround the two YIII ions. Both YIII ions are coordinated by two N atoms from the 1,10-phenanthroline, seven O atoms from five glutarate groups in a distorted tricapped trigonal–prismatic geometry. The YIII ions are bridged by glutarate ligands in three modes, forming a layered, polymeric structure. The resulting layers are assembled by π–π stacking interactions [centroid–centroid distances = 3.740 (3 and 3.571 (3 Å] into a three-dimensional supramolecular architecture.
International Nuclear Information System (INIS)
Tse, Y Y; Chakalov, R I; Joshi, M M; Jones, I P; Muirhead, C M; Palai, R
2006-01-01
Cross-sectional TEM and microanalysis were carried out to understand at a microscopic level the effects of microstructure and chemistry on the physical properties of manganites and manganite/cuprate films. TEM observations on pure LCMO grown on a (110) STO substrate were carried out first to determine the defect structure and detect any formation of second phase precipitates, as well as microstructural changes not detectable by X-ray reflections. La 0.7 Ca 0.3 MnO 3 (LCMO) grows epitaxially on a (110) SrTiO 3 (STO) substrate. HRTEM reveals a nearly defect-free interface between LCMO and STO with a few irregularly arranged misfit dislocations. The microstructure obtained from laser ablated nanometre scaled La 0.7 Ca 0.3 MnO 3 (LCMO)/YBa 2 Cu 3 O 7 -δ (YBCO)/PrBa 2 Cu 3 O 7 (PBCO) multilayers on (110) STO was also studied. Diffraction patterns show that all films grow epitaxially on top of the (110) STO substrate, with the c-axis of YBCO in plane. There is a roughness of about 10nm between PBCO and YBCO and the roughness is increased at the YBCO - LCMO interface
STS-110 Crew Interview: Jerry Ross
2002-01-01
STS-110 Mission Specialist Jerry Ross is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Ross outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Ross discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
STS-110 Crew Interview: Stephen Frick
2002-01-01
STS-110 Pilot Stephen Frick is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Frick outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Frick discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.
Cheng, Yongfeng; Han, Xuesong; Ouyang, Huangche; Rao, Yu
2012-03-18
An efficient method towards synthesis of 1,10-phenanthrolines is described. Through Lewis acid-catalyzed annulation reaction between 3-ethoxycyclobutanones and 8-aminoquinolines, a variety of unsymmetric and symmetric 1,10-phenanthroline derivatives were readily prepared with high regioselectivity at room temperature.
5 CFR 3101.110 - Additional rules for United States Customs Service employees.
2010-01-01
... SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE DEPARTMENT OF THE TREASURY § 3101.110 Additional... shall be disqualified from participation in any matter involving the relative or the relative's employer...
Role of wave functions in electromagnetism : RAS from GaAs (110)
Wijers, C.M.J.; de Boeij, P.L.
2001-01-01
We have calculated the reflectance anisotropy for the GaAs (110) surface using the discrete cellular method. This method extends the range of application of standard discrete dipole calculations by incorporating nonlocal polarizabilitites. The method adds a second quantum mechanical channel of
Acoustically induced spin transport in (110)GaAs quantum wells
Energy Technology Data Exchange (ETDEWEB)
Couto, Odilon D.D. Jr.
2008-09-29
In this work, we employ surface acoustic waves (SAWs) to transport and manipulate optically generated spin ensembles in (110) GaAs quantum wells (QWs). The strong carrier confinement into the SAW piezoelectric potential allows for the transport of spin-polarized carrier packets along well-defined channels with the propagation velocity of the acoustic wave. In this way, spin transport over distances exceeding 60 m is achieved, corresponding to spin lifetimes longer than 20 ns. The demonstration of such extremely long spin lifetimes is enabled by three main factors: (i) Suppression of the D'yakonov-Perel' spin relaxation mechanism for z-oriented spins in (110) IIIV QWs; (ii) Suppression of the Bir-Aronov-Pikus spin relaxation mechanism caused by the type-II SAW piezoelectric potential; (iii) Suppression of spin relaxation induced by the mesoscopic carrier confinement into narrow stripes along the SAW wave front direction. A spin transport anisotropy under external magnetic fields (B{sub ext}) is demonstrated for the first time. Employing the well-defined average carrier momentum impinged by the SAW, we analyze the spin dephasing dynamics during transport along the [001] and [1 anti 10] in-plane directions. For transport along [001], fluctuations of the internal magnetic field (B{sub int}), which arises from the spin-orbit interaction associated with the bulk inversion asymmetry of the crystal, lead to decoherence within 2 ns as the spins precess around B{sub ext}. In contrast, for transport along the [1 anti 10] direction, the z-component of the spin polarization is maintained for times one order of magnitude longer due to the non-zero average value of B{sub int}. The dephasing anisotropy between the two directions is fully understood in terms of the dependence of the spin-orbit coupling on carrier momentum direction, as predicted by the D'yakonov-Perel' mechanism for the (110) system. (orig.)
24 CFR 110.30 - Effect of failure to display poster.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effect of failure to display poster... FAIR HOUSING FAIR HOUSING POSTER Enforcement § 110.30 Effect of failure to display poster. Any person... Secretary pursuant to part 105 of this chapter. A failure to display the fair housing poster as required by...
20 CFR 703.110 - Other forms of endorsements and policies.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Other forms of endorsements and policies. 703... Insurance Carriers § 703.110 Other forms of endorsements and policies. Where the form of endorsement prescribed by § 703.109 is not appropriate when used in conjunction with a form of policy approved for use by...
Energy Technology Data Exchange (ETDEWEB)
Gao, Jinling, E-mail: Jinling_Gao@yeah.net; Yao, Wenjuan, E-mail: wj_yao@yeah.net; Ma, Yudong
2016-08-15
Graphical abstract: An analytical model and a numerical procedure are developed to study the mechanical response of IG-110 graphite bricks in HTGR subjected to high temperature and irradiation. The calculation results show great accordance with each other. Rational suggestions on the calculation and design of the IG-110 graphite structure are proposed based on the sensitivity analyses including temperature, irradiation dimensional change, creep and Poisson’s ratio. - Highlights: • Analytical solution of stress and displacement of IG-110 graphite components in HTGR. • Finite element procedure developed for stress analysis of HTGR graphite component. • Parameters analysis of mechanical response of graphite components during the whole life of the reflector. - Abstract: Structural design of nuclear power plant project is an important sub-discipline of civil engineering. Especially after appearance of the fourth generation advanced high temperature gas cooled reactor, structural mechanics in reactor technology becomes a popular subject in structural engineering. As basic ingredients of reflector in reactor, graphite bricks are subjected to high temperature and irradiation and the stress field of graphite structures determines integrity of reflector and makes a great difference to safety of whole structure. In this paper, based on assumptions of elasticity, side reflector is regarded approximately as a straight cylinder structure and primary creep strain is ignored. An analytical study on stress of IG110 graphite parts is present. Meanwhile, a finite element procedure for calculating stresses in the IG110 graphite structure exposed in the high temperature and irradiation is developed. Subsequently, numerical solution of stress in IG110 graphite structure is obtained. Analytical solution agrees well with numerical solution, which indicates that analytical derivation is accurate. Finally, influence of temperature, irradiation dimensional change, creep and Poisson
First excited states in doubly-odd 110Sb: Smooth band termination in the A ∼ 110 region
International Nuclear Information System (INIS)
Lane, G.J.; Fossan, D.B.; Thorslund, I.
1996-01-01
Excited states have been identified for the first time in 110 Sb in a comprehensive series of γ-spectroscopy experiments, including recoil-mass and neutron-field measurements. Three high-spin decoupled bands with configurations based on 2p-2h excitations across the Z = 50 shell gap, are observed to show the features of smooth band termination, the first such observation in an odd-odd nucleus. The yrast intruder band has been connected to the low spin levels and is tentatively identified up to its predicred termination at I π = (45 + ). Detailed configuration assignments are made through comparison with configuration-dependent cranked Nilsson-Strutinsky calculations; excellent agreement with experiment is obtained. The systematic occurrence of smoothly terminating bands in the neighboring isotopes is discussed
THE HEAT TREATMENT ANALYSIS OF E110 CASE HARDENING STEEL
Directory of Open Access Journals (Sweden)
MAJID TOLOUEI-RAD
2016-03-01
Full Text Available This paper investigates mechanical and microstructural behaviour of E110 case hardening steel when subjected to different heat treatment processes including quenching, normalizing and tempering. After heat treatment samples were subjected to mechanical and metallographic analysis and the properties obtained from applying different processes were analysed. The heat treatment process had certain effects on the resultant properties and microstructures obtained for E110 steel which are described in details. Quenching produced a martensitic microstructure characterized by significant increase in material’s hardness and a significant decreased in its impact energy. Annealed specimens produced a coarse pearlitic microstructure with minimal variation in hardness and impact energy. For normalized samples, fine pearlitic microstructure was identified with a moderate increase in hardness and significant reduction in impact energy. Tempering had a significant effect on quenched specimens, with a substantial rise in material ductility and reduction of hardness with increasing tempering temperature. Furthermore, Results provide additional substantiation of temper embrittlement theory for low-carbon alloys, and indicate potential occurrence of temper embrittlement for fine pearlitic microstructures.
Negative ion formation in the scattering of state-selected NO+ on GaAs(110)
International Nuclear Information System (INIS)
Martin, J.S.; Greeley, J.N.; Morris, J.R.; Ferenchok, B.T.; Jacobs, D.C.
1993-01-01
A hyperthermal beam of state-selected NO + X 1 Σ + (v,j) impinges on a clean, well characterized GaAs(110) surface. The resulting two-electron transfer products NO-and O- are independently interrogated with a novel ion imaging technique as a function of NO + translational and vibrational energies. The products are shown to have different appearance thresholds, product translational energy distributions, and NO + vibrational energy dependencies. Most notably, vibrational energy is an order of magnitude more effective that translational energy in activating O- formation at a collision energy of 45 eV. The O- angular distribution exhibits a correlation with translational energy which is asymmetric about the surface normal. These results suggest that the probability of O- formation is dependent on the molecules point of impact with the GaAs (110) surface. The dynamical features of the NO + /GaAs(110) reaction will be discussed in terms of the three independent coordinates addressed in this experiment: the diatom internuclear separation, the molecule-surface distance, and the surface impact parameter
Bis(1,10-phenanthroline-κ2N,N′(sulfato-κOcopper(II ethanol monosolvate
Directory of Open Access Journals (Sweden)
Natthaya Meundaeng
2013-10-01
Full Text Available The crystal structure of the title compound, [Cu(SO4(C12H8N22]·C2H5OH, arises from the assembly of the neutral complex [Cu(SO4(C12H8N22] and an ethanol solvent molecule. The CuII ion is five-coordinate, surrounded by two pairs of N atoms from two independent N,N′-chelating 1,10-phenanthroline ligands, and one O atom of monodentate sulfate ligand, in a distorted trigonal-bipyramidal fashion. Spatial orientation of the ligands and the assembly in the solid state are stabilized by the C—H...O hydrogen-bonding interactions, established between the O atoms (from the sulfate ligand and the ethanol molecule and the neighbouring 1,10-phenanthroline molecules. There is also an offset face-to-face π–π stacking between the 1,10-phenanthroline ligands. The ethanol solvent molecule is disordered over two orientations in the ratio 0.663 (10:0.337 (10. The crystal examined was subject to racemic twinning and the refined twin fraction was 0.346 (19.
A theoretical study of hydrogen atoms adsorption and diffusion on PuO_2 (110) surface
International Nuclear Information System (INIS)
Yu, H.L.; Tang, T.; Zheng, S.T.; Shi, Y.; Qiu, R.Z.; Luo, W.H.; Meng, D.Q.
2016-01-01
The mechanisms of adsorption and diffusion of hydrogen atoms on the PuO_2 (110) surface are investigated by density functional theory corrected for onsite Coulombic interactions (GGA + U). In order to find out the energetically more favorable adsorption site and optimum diffusion path, adsorption energy of atomic H on various sites and the diffusion energy barrier are derived and compared. Our results show that both chemisorption and physisorption exist for H atoms adsorption configurations on PuO_2 (110) surface. Two processes for H diffusion are investigated using the climbing nudged-elastic-band (cNEB) approach. We have identified two diffusion mechanisms, leading to migration of atomic H on the surface and diffusion from surface to subsurface. The energy barriers indicate that it is energetically more favorable for H atom to be on the surface. Hydrogen permeation through purity PuO_2 surface is mainly inhibited from hydrogen atom diffusion from surface to subsurface. - Highlights: • H atoms adsorption on PuO_2 (110) surface are investigated by GGA + U. • Both chemisorption and physisorption exist for H atoms adsorption configurations. • H atoms migration into PuO_2 (100) surface are inhibited with the barrier of 2.15 eV. • H atoms diffusion on PuO_2 (110) surface are difficult at room temperature.
Magnetocrystalline anisotropy in a (110) (Tb0.27Dy0.73)Fe2 thin-film
International Nuclear Information System (INIS)
Fuente, C de la; Arnaudas, J I; Benito, L; Ciria, M; Moral, A del; Dufour, C; Dumesnil, K
2004-01-01
Magnetic anisotropy measurements performed in a (110) (Tb 0.27 Dy 0.73 )Fe 2 (Terfenol-D) film epitaxially grown on a sapphire substrate are presented. The magnetic torque curves have been determined by using a vectorial vibrating sample magnetometer, which allows us to measure the angular dependence of magnetization components parallel, M parallel , and perpendicular, M perp , to the applied field up to 2 T. The fourfold symmetry associated with the cubic structure within the (110) plane is clearly observed. The analysis of the experimental torque has been carried out considering magnetocrystalline anisotropy up to sixth order and magnetoelastic energy up to second order; so, the magnetocrystalline anisotropy constants in the (110) plane of the film, K 1 and K 2 , have been obtained. This allows us to determine the direction of the magnetization easy axis for (110) Terfenol-D thin-film: it is [1bar12] at RT, passes through [3bar34] at 140 K and then changes to [1bar20] at 40 K. It was completely impossible to explain the angular dependence of the experimental magnetic torque without including shear and tetragonal magnetoelastic stress parameters, b 2 and b 1 , respectively. This confirms the paramount role of the strain in the determination of the magnetic properties in this kind of Terfenol-D thin film
Tank characterization report for single-shell tank 241-C-110. Revision 1
International Nuclear Information System (INIS)
Benar, C.J.
1997-01-01
One of the major functions of the Tank Waste Remediation System (IWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-C-110. The objectives of this report are to use characterization data in response to technical issues associated with 241-C-110 waste and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. While only the results from recent sample events will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-C-110 are provided included surveillance information, records pertaining to waste transfers and tank operations, and 1124 expected tank contents derived from a process knowledge model. The sampling events are listed, as well as sample data obtained before 1989. The results of the 1992 sampling events are also reported in the data package. The statistical analysis and numerical manipulation of data used in issue resolution are reported in Appendix C. Appendix D contains the evaluation to establish the best basis for the inventory estimate and the statistical analysis performed for this evaluation. A bibliography that resulted from an in-depth literature search of all known information sources applicable to tank 241-C-110 and its respective waste types is contained in Appendix E
Structural changes during oxidation of Au(110)
International Nuclear Information System (INIS)
Hale, P.; Thurgate, S.; Wilkie, P.; Parker, A.J.
2000-01-01
Full text: We have constructed an Ultra High vacuum (UHV) system interfaced to an electro-chemical cell. The UHV system is equipped with Low Energy Electron Diffraction (LEED) and X-ray Photoelectron Spectroscopy (XPS). We have used these techniques to examine the oxidation of the Au(110) surface. The gold (110) single crystal exhibits a (2x1) surface structure when clean, but when immersed in 0.01 M HCIO 4 under potential control, the structure has been found to change. Throughout the double layer region the structure remains as (2x1) but when the potential is increased above 0.9-1.0V vs Ag/AgCI, (the pre-oxidation region) the surface structure changes to a centred rectangular structure found to represent a c(2x2) over-layer. This structure is fairly stable and reproducible. After the initial oxidation the structure prevails until 1.2-1.3V whereupon oxidation occurs on a larger scale and the surface structure becomes (1x1). These structures return to (2x1) after the reduction of the oxide, proving that the structural changes are reversible. XPS of these regions has shown a difference in the chemical state of the oxygen. Adsorbed perchlorate ion is initially the only oxygen component but as the potential increases the peak shifts into the hydroxide region and finally it splits into a hydroxide peak and a metal oxide peak. This study indicates a new way of looking at the structure and composition of the gold surface and provides insight into the nature of the interaction between the surface and the solution
A new NH 3 orbital of the NH 3/Ni(110) surface observed by metastable quenching spectroscopy
Lee, Lihwa; Arias, Jose; Hanrahan, Ciaran; Martin, Richard M.; Metiu, Horia
1986-01-01
By using metastable quenching spectroscopy we have found a new NH 3 filled orbital (in the language of one electron theory) for NH 3/Ni(110), located at the Fermi level of the surface. The orbital is not observed when NH 3 is adsorbed on Ni(110), but it is detected for NH 3 adsorbed on polycrystalline Al.
Comparison of NBG-18, NBG-17, IG-110 and IG-11 oxidation kinetics in air
Lee, Jo Jo; Ghosh, Tushar K.; Loyalka, Sudarshan K.
2018-03-01
The oxidation rates of several nuclear-grade graphites, NBG-18, NBG-17, IG-110 and IG-11, were measured in air using thermogravimetry. Kinetic parameters and oxidation behavior for each grade were compared by coke type, filler grain size and microstructure. The thickness of the oxidized layer for each grade was determined by layer peeling and direct density measurements. The results for NBG-17 and IG-11 were compared with those available in the literature and our recently reported results for NBG-18 and IG-110 oxidation in air. The finer-grained graphites IG-110 and IG-11 were more oxidized than medium-grained NBG-18 and NBG-17 because of deeper oxidant penetration, higher porosity and higher probability of available active sites. Variation in experimental conditions also had a marked effect on the reported kinetic parameters by several studies. Kinetic parameters such as activation energy and transition temperature were sensitive to air flow rates as well as sample size and geometry.
Diagnosis of Acute Groin Injuries: A Prospective Study of 110 Athletes
Serner, Andreas; Tol, Johannes L.; Jomaah, Nabil; Weir, Adam; Whiteley, Rodney; Thorborg, Kristian; Robinson, Matthew; Hölmich, Per
2015-01-01
Acute groin injuries are common in high-intensity sports, but there are insufficient data on injury characteristics such as injury mechanisms and clinical and radiological findings. To describe these characteristics in a cohort of athletes. Cross-sectional study; Level of evidence, 3. A total of 110
29 CFR 1952.110 - Description of the plan as initially approved.
2010-07-01
... the covered occupational safety and health issues as defined by the Secretary of Labor in 29 CFR 1902... Section 1952.110 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH... requirements of part 1902. Under this legislation all occupational safety and health standards and amendments...
26 CFR 509.110 - Patent and copyright royalties and film rentals.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Patent and copyright royalties and film rentals... (CONTINUED) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.110 Patent and copyright... copyrights, artistic and scientific works, patents, designs, plans, secret processes and formulae, trademarks...
Webmedia sai 110 miljonit krooni Aafrika ja Aasia vallutamiseks / Ilmar Kahro
Kahro, Ilmar
2010-01-01
Poolast pärit Kesk- ja Ida-Euroopa riskikapitalifond Enterprise Investors saab Eesti suurimas tarkvaraettevõttes Webmedia Group 36-protsendise osaluse ja investeerib selleks 110 mln. kooni. Webmedia üks eesmärke on laieneda Pärsia lahe riikidesse, firma on välja arendanud Katari riigiportaali
Role of step stiffness and kinks in the relaxation of vicinal (001) with zigzag [110] steps
Mahjoub, B.; Hamouda, Ajmi BH.; Einstein, TL.
2017-08-01
We present a kinetic Monte Carlo study of the relaxation dynamics and steady state configurations of 〈110〉 steps on a vicinal (001) simple cubic surface. This system is interesting because 〈110〉 (fully kinked) steps have different elementary excitation energetics and favor step diffusion more than 〈100〉 (nominally straight) steps. In this study we show how this leads to different relaxation dynamics as well as to different steady state configurations, including that 2-bond breaking processes are rate determining for 〈110〉 steps in contrast to 3-bond breaking processes for 〈100〉-steps found in previous work [Surface Sci. 602, 3569 (2008)]. The analysis of the terrace-width distribution (TWD) shows a significant role of kink-generation-annihilation processes during the relaxation of steps: the kinetic of relaxation, toward the steady state, is much faster in the case of 〈110〉-zigzag steps, with a higher standard deviation of the TWD, in agreement with a decrease of step stiffness due to orientation. We conclude that smaller step stiffness leads inexorably to faster step dynamics towards the steady state. The step-edge anisotropy slows the relaxation of steps and increases the strength of step-step effective interactions.
Influence of pre-hydriding on embrittlement of E110 alloy under LOCA conditions
International Nuclear Information System (INIS)
VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Fedotov, P.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Kuznetsov, V.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Nechaeva, O.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Novikov, V.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Salatov, A.; Ignatiev, D.; Mokrushin, A.; Soldatkin, D.; Urusov, A.
2015-01-01
The researches presented in this paper were carried out in the framework of TVS-K project developed by JSC “TVEL”. The data on the corrosion and residual ductility of unirradiated and pre-hydrided E110 alloy under LACA conditions at temperature range from 1100 to 1200°C are presented. The hydrogen concentration was varied from 30 (as-received) to 600 wppm. The initial concentration of hydrogen has no effect on the oxidation kinetics, while the oxidation kinetics are parabolic and the breakaway oxidation is not observed. Oxide films on surfaces of claddings are black and shining. There are no cracks, visual spots and peelings. The residual ductility of oxidised samples decrease with hydrogen concentration rise. The residual ductility of claddings oxidized at 1100 °C, generally higher than the same of the claddings oxidized at 1200 °C. E110 alloy has a good residual ductility in comparison to Zry-4, ZIRLO, M5. Joint analysis of the test results allowed us to formulate embrittlement criteria of the E110 alloy under LOCA conditions. This embrittlement criterion is preliminary, because the experimental data base must to be enlarged by results of tests with claddings of another geometry and quench experiments. (author)
Perioperative glycemic control in diabetic patients undergoing coronary artery bypass graft surgery
Directory of Open Access Journals (Sweden)
Ehab A. Wahby
2016-08-01
Conclusion: Tight glycemic control improved perioperative outcome in diabetic CABG patients. Maintaining perioperative blood glucose level between 110 and 149 mg/dl is safe and should be recommended as a routine practice in diabetic patients undergoing CABG surgery.
40 CFR 81.110 - Camden-Sumter Intrastate Air Quality Control Region.
2010-07-01
... Quality Control Regions § 81.110 Camden-Sumter Intrastate Air Quality Control Region. The Camden-Sumter Intrastate Air Quality Control Region (South Carolina) consists of the territorial area encompassed by the... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Camden-Sumter Intrastate Air Quality...
Enhanced Bonding of Silver Nanoparticles on Oxidized TiO2(110)
DEFF Research Database (Denmark)
Hansen, Jonas Ørbæk; Salazar, Estephania Lira; Galliker, Patrick
2010-01-01
The nucleation and growth of silver nanoclusters on TiO2(110) surfaces with on-top O adatoms (oxidized TiO2), surface O vacancies and H adatoms (reduced TiO2) have been studied. From the interplay of scanning tunneling microscopy/photoelectron spectroscopy experiments and density functional theor...
33 CFR 110.250 - St. Thomas Harbor, Charlotte Amalie, V.I.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false St. Thomas Harbor, Charlotte... SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.250 St. Thomas Harbor, Charlotte Amalie.... Thomas, V.I. of the United States and approaches thereto, including all waters under its jurisdiction, as...
The effects of antimony doping on the surface structure of rutile TiO2(110)
International Nuclear Information System (INIS)
Bechstein, Ralf; Schuette, Jens; Kuehnle, Angelika; Kitta, Mitsunori; Onishi, Hiroshi
2009-01-01
Titanium dioxide represents a very important wide bandgap photocatalyst that is known to be sensitized to visible light by transition metal doping. Antimony doping has been demonstrated to provide photocatalytic activity when codoped with chromium at an optimum dopant ratio [Sb]/[Cr] of about 1.5. Here, the role of antimony doping on the surface structure of rutile TiO 2 (110) is studied using non-contact atomic force microscopy (NC-AFM) under ultra-high vacuum conditions. At first glance, the surface structure of antimony-doped TiO 2 (110) resembles the structure of pristine TiO 2 (110). However, in contrast to what is found in pristine TiO 2 (110), a dense layer of protruding features is observed upon antimony doping, which is tentatively ascribed to antimony-rich clusters. Moreover, homogeneously distributed holes are found on the surface, which differ in depth and shape depending on the preparation conditions. Holes with depths ranging from a few up to more than a hundred monatomic steps are observed. These holes are explained by surface segregation of antimony during annealing, as the ionic radius of Sb 3+ is considerably larger than the ionic radius of Ti 4+ . Our finding provides an indication of why an antimony concentration larger than the optimum ratio results in decreased photocatalytic activity. Moreover, controlling annealing temperature seems to constitute a promising strategy for creating nanosized holes on TiO 2 surfaces.
International Nuclear Information System (INIS)
Exner, Kai S.; Anton, Josef; Jacob, Timo; Over, Herbert
2014-01-01
Graphical abstract: - Highlights: • Using the method Pourbaix diagram we identified the oxygen covered RuO 2 (110) surface as the catalytically active phase under chlorine evolution reaction (CER) conditions. This active phase is compared with the active phase in the Deacon process, the heterogeneous gas phase counterpart of the CER. - Abstract: Constrained ab initio thermodynamics in the form of a Pourbaix diagram can greatly assist kinetic modeling of a particular electrochemical reaction such as the chlorine evolution reaction (CER) over RuO 2 (110). Pourbaix diagrams reveal stable surface structures, as a function of pH and the potential. The present DFT study indicates that the Pourbaix diagram in the CER potential region above 1.36 V and pH values around zero is dominated by a stable surface structure in which all coordinatively undercoordinated Ru sites (Ru cus ) are capped by on-top oxygen (O ot ). This oxygen saturated RuO 2 (110) surface is considered to serve as the catalytically active phase in the CER, quite in contrast to the heterogeneously catalyzed HCl oxidation (Deacon process), for which the active RuO 2 (110) surface is mainly covered by on-top chlorine. The active sites in the CER are suggested to be Ru cus O ot surface complexes, while in the Deacon process both undercoordinated surface Ru and oxygen sites must be available for the activation of HCl molecules
Silver-mediated oxidative C-H difluoromethylation of phenanthridines and 1,10-phenanthrolines.
Zhu, Sheng-Qing; Xu, Xiu-Hua; Qing, Feng-Ling
2017-10-17
A silver-mediated oxidative difluoromethylation of phenanthridines and 1,10-phenanthrolines with TMSCF 2 H is disclosed. This C-H difluoromethylation of N-containing polycyclic aromatics constitutes an efficient method for the regioselective synthesis of difluoromethylated N-heterocycles.
Synthesis of Responses to Vatican Statement from 110 U.S. Catholic Colleges.
Gallin, Sr. Alice
1986-01-01
The situation of U.S. Catholic colleges and universities is outlined, and the responses of 110 American Catholic college and university presidents to the Vatican's statement concerning the role and relationships of Catholic universities worldwide are synthesized. (MSE)
Surface Chirality of Gly-Pro Dipeptide Adsorbed on a Cu(110) Surface.
Cruguel, Hervé; Méthivier, Christophe; Pradier, Claire-Marie; Humblot, Vincent
2015-07-01
The adsorption of chiral Gly-Pro dipeptide on Cu(110) has been characterized by combining in situ polarization modulation infrared reflection absorption spectroscopy (PM-RAIRS) and X-ray photoelectron spectroscopy (XPS). The chemical state of the dipeptide, and its anchoring points and adsorption geometry, were determined at various coverage values. Gly-Pro molecules are present on Cu(110) in their anionic form (NH2 /COO(-)) and adsorb under a 3-point binding via both oxygen atoms of the carboxylate group and via the nitrogen atom of the amine group. Low-energy electron diffraction (LEED) and scanning tunneling microscopy (STM) have shown the presence of an extended 2D chiral array, sustained via intermolecular H-bonds interactions. Furthermore, due to the particular shape of the molecule, only one homochiral domain is formed, creating thus a truly chiral surface. © 2015 Wiley Periodicals, Inc.
Epitaxial growth of fcc-CoxNi100-x thin films on MgO(110) single-crystal substrates
International Nuclear Information System (INIS)
Ohtake, Mitsuru; Nukaga, Yuri; Sato, Yoichi; Futamoto, Masaaki; Kirino, Fumiyoshi
2009-01-01
Co x Ni 100-x (x=100, 80, 20, 0 at. %) epitaxial thin films were prepared on MgO(110) single-crystal substrates heated at 300 deg. C by ultrahigh vacuum molecular beam epitaxy. The growth mechanism is discussed based on lattice strain and crystallographic defects. CoNi(110) single-crystal films with a fcc structure are obtained for all compositions. Co x Ni 100-x film growth follows the Volmer-Weber mode. X-ray diffraction analysis indicates that the out-of-plane and the in-plane lattice spacings of the Co x Ni 100-x films are in agreement within ±0.5% with the values of the respective bulk Co x Ni 100-x crystals, suggesting that the strain in the film is very small. High-resolution cross-sectional transmission microscopy shows that an atomically sharp boundary is formed between a Co(110) fcc film and a MgO(110) substrate, where periodical misfit dislocations are preferentially introduced in the film at the Co/MgO interface. The presence of such periodical misfit dislocations relieves the strain caused by the lattice mismatch between the film and the substrate.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Expedited review procedures for certain kinds of research involving no more than minimal risk, and for minor changes in approved research. 56.110 Section 56.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL...
WR 110: A SINGLE WOLF-RAYET STAR WITH COROTATING INTERACTION REGIONS IN ITS WIND?
International Nuclear Information System (INIS)
Chene, A.-N.; Moffat, A. F. J.; Fahed, R.; St-louis, N.; Muntean, V.; Chevrotiere, A. De La; Cameron, C.; Matthews, J. M.; Gamen, R. C.; Lefevre, L.; Rowe, J. F.; Guenther, D. B.; Kuschnig, R.; Weiss, W. W.; Rucinski, S. M.; Sasselov, D.
2011-01-01
A 30 day contiguous photometric run with the Microvariability and Oscillations of STars (MOST) satellite on the WN5-6b star WR 110 (HD 165688) reveals a fundamental periodicity of P = 4.08 ± 0.55 days along with a number of harmonics at periods P/n, with n ∼ 2, 3, 4, 5, and 6, and a few other possible stray periodicities and/or stochastic variability on timescales longer than about a day. Spectroscopic radial velocity studies fail to reveal any plausible companion with a period in this range. Therefore, we conjecture that the observed light-curve cusps of amplitude ∼0.01 mag that recur at a 4.08 day timescale may arise in the inner parts, or at the base, of a corotating interaction region (CIR) seen in emission as it rotates around with the star at constant angular velocity. The hard X-ray component seen in WR 110 could then be a result of a high velocity component of the CIR shock interacting with the ambient wind at several stellar radii. Given that most hot, luminous stars showing CIRs have two CIR arms, it is possible that either the fundamental period is 8.2 days or, more likely in the case of WR 110, there is indeed a second weaker CIR arm for P = 4.08 days, that occurs ∼two-thirds of a rotation period after the main CIR. If this interpretation is correct, WR 110 therefore joins the ranks with three other single WR stars, all WN, with confirmed CIR rotation periods (WR 1, WR 6, and WR 134), albeit with WR 110 having by far the lowest amplitude photometric modulation. This illustrates the power of being able to secure intense, continuous high-precision photometry from space-based platforms such as MOST. It also opens the door to revealing low-amplitude photometric variations in other WN stars, where previous attempts have failed. If all WN stars have CIRs at some level, this could be important for revealing sources of magnetism or pulsation in addition to rotation periods.
Waste compatibility safety issues and final results for tank 241-T-110 push mode samples
International Nuclear Information System (INIS)
Nuzum, J.L.
1997-01-01
This document is the final laboratory report for Tank 241-T-110. Push mode core segments were removed from risers 2 and 6 between January 29, 1997, and February 7, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-110 Push Mode Core Sampling and analysis Plan (TSAP) and Safety Screening Data Quality Objective (DQO). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO
7 CFR 110.5 - Availability of records to facilitate medical treatment.
2010-01-01
... pesticide required to be maintained under § 110.3 is necessary to provide medical treatment or first aid to... care professional, to be a medical emergency, the record information of the restricted use pesticide, relating to the medical emergency, shall be provided immediately. (b)(1) The attending licensed health care...
40 CFR 266.110 - Waiver of DRE trial burn for boilers.
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waiver of DRE trial burn for boilers... HAZARDOUS WASTE MANAGEMENT FACILITIES Hazardous Waste Burned in Boilers and Industrial Furnaces § 266.110 Waiver of DRE trial burn for boilers. Boilers that operate under the special requirements of this section...
THE EFFICACY OF THE CABLES OF 6–110 KW WITH XLPE INSULATION. Part 2
Directory of Open Access Journals (Sweden)
M. A. Korotkevich
2017-01-01
Full Text Available The assessment of the suitability of cables of 6–110 kW with XLPE insulation in comparison with cables of the same voltage but possessing paper-oil insulation has been fulfilled on the basis of the method of multi-objective optimization that makes it possible to account not only the quantitative characteristics (of reduced costs, but also qualitative ones. As an indicator of the reliability of the cable line the maximum mean time to failure (the value inversely proportional to the parameter of succession of failures, which is an order more for cable lines with XLPE insulation than for cable lines with paper insulation, is adopted. A comprehensive assessment of the convenience of installation of cable lines revealed that the installation of cable with XLPE insulation features a 1.2–1.6 times easier installation as compared to three-wire (voltage 10 kW and 1.4 times easier installation as compared to single-core oil-filled cables (voltage of 110 kW. The efficacy of the cables 6–110 kW with XLPE insulation is proved on the basis on the method of multi-objective optimization, that took into account as the costs for the construction and operation of cable lines and the reliability of its operation, ease of its installation and other quality indicators. If the goals taken into account are considered as equally important, the polyethylene-insulated cables for a voltage of 10–110 kW is more efficient as compared to three-wire (voltage 10 kW and solid (110 kW cables with paper insulation. Herewith, the cost of the cable with XLPE insulation may exceed the cost of cable with paper insulation up to two times. If the most important aim is to provide the minimum reduced costs for the construction and operation of the cable line, the use of cables with XLPE insulation for voltage of 10 kW is most advisable in individual cases.
International Nuclear Information System (INIS)
Anghel, L.V.; Balasoiu, M.; Lazar, D.M.; Ishchenko, L.A.
2011-01-01
The composition of composites has a huge impact on the stability of tris-1,10-phenanthroline iron (II) complex during the determination of total iron content. The subject of this work is the determination of the stability of tris-1,10-phenanthroline iron (II) complex in samples of biominerals produced by bacteria Klebsiella oxytoca. The stability of this complex was monitored in the time period of 0-60 min. The aim of this work is to determine the concentration of the biogenic ferrihydrite in the samples and the time interval in which the absorbance of the complex is highest. The UV-Vis spectrophotometric method was used for the determination. Obtained results indicate that for more exact estimations of the concentration of biogenic ferrihydrite, absorbance of tris-1,10-phenanthroline iron (II) complex should be measured within 25 min from the moment ortho-phenanthroline was added
International Nuclear Information System (INIS)
Chernov, Sergii
2016-01-01
Recent experiments discovered a new class of materials called topological insulators and started an extensive investigation in order to find more materials of such type and to understand and explore the opening perspectives in fundamental science and application. These materials exhibit a Dirac-type (massless) electronic state, bridging the fundamental band gap. Surprisingly, a strongly spin-polarized surface state with linear dispersion resembling that of Dirac type was found on the already well-investigated W(110) surface. This rose the question of the existence of the same non-trivial electron state on other metal surfaces. The present work describes the investigation of surface electronic states on the Mo(110) surface, their dispersion and transformation upon surface oxidation. This system is isoelectronic to the case of W(110) but due to the lower atomic number the spin-orbit interaction responsible for local band gap formation is substantially decreased by a factor of 5. The Mo(110) surface was shown to exhibit a linearly dispersing state quite similar to the one on W(110), but within a smaller energy range of 120 meV, with the Dirac point lying in the center of a local band gap in k-space. The experimental investigations were performed with the help of momentum microscopy, using a Ti:sapphire laser in the lab and synchrotron radiation at BESSY II, Berlin. The results show good agreement with theoretical calculations of the band structure and photoemission patterns for clean Mo(110). The fully parallel 3D acquisition scheme allowed to visualize the full surface Brillouin zone of the sample up to few eV binding energy within a single exposure of typically less than 30 min. This opens the door to future time-resolved experiments with maximum detection efficiency.
Energy Technology Data Exchange (ETDEWEB)
Chernov, Sergii
2016-04-20
Recent experiments discovered a new class of materials called topological insulators and started an extensive investigation in order to find more materials of such type and to understand and explore the opening perspectives in fundamental science and application. These materials exhibit a Dirac-type (massless) electronic state, bridging the fundamental band gap. Surprisingly, a strongly spin-polarized surface state with linear dispersion resembling that of Dirac type was found on the already well-investigated W(110) surface. This rose the question of the existence of the same non-trivial electron state on other metal surfaces. The present work describes the investigation of surface electronic states on the Mo(110) surface, their dispersion and transformation upon surface oxidation. This system is isoelectronic to the case of W(110) but due to the lower atomic number the spin-orbit interaction responsible for local band gap formation is substantially decreased by a factor of 5. The Mo(110) surface was shown to exhibit a linearly dispersing state quite similar to the one on W(110), but within a smaller energy range of 120 meV, with the Dirac point lying in the center of a local band gap in k-space. The experimental investigations were performed with the help of momentum microscopy, using a Ti:sapphire laser in the lab and synchrotron radiation at BESSY II, Berlin. The results show good agreement with theoretical calculations of the band structure and photoemission patterns for clean Mo(110). The fully parallel 3D acquisition scheme allowed to visualize the full surface Brillouin zone of the sample up to few eV binding energy within a single exposure of typically less than 30 min. This opens the door to future time-resolved experiments with maximum detection efficiency.
(110) oriented GaAs/Al0.3Ga0.7As quantum wells for optimized T-shaped quantum wires
DEFF Research Database (Denmark)
Gislason, Hannes; Sørensen, Claus Birger; Hvam, Jørn Märcher
1996-01-01
High control of (110) oriented GaAs/Al0.3Ga0.7As quantum wells is very important for the growth of optimized T-shaped GaAs/AlGaAs quantum wires, We investigate theoretically and experimentally 20-200 Angstrom wide (110) oriented GaAs quantum wells grown on (110) oriented substrates and cleaved...... edges. Photoluminescence transition energies are found to be in good agreement with theory for all well widths. The mean well width is controllable to 1 monolayer accuracy and an effective well width fluctuation of 3.7 Angstrom is derived from the photoluminescence linewidths. The growth rate...
Perspective: A controversial benchmark system for water-oxide interfaces: H2O/TiO2(110)
Diebold, Ulrike
2017-07-01
The interaction of water with the single-crystalline rutile TiO2(110) surface has been the object of intense investigations with both experimental and computational methods. Not only is TiO2(110) widely considered the prototypical oxide surface, its interaction with water is also important in many applications where this material is used. At first, experimental measurements were hampered by the fact that preparation recipes for well-controlled surfaces had yet to be developed, but clear experimental evidence that water dissociation at defects including oxygen vacancies and steps emerged. For a perfect TiO2(110) surface, however, an intense debate has evolved whether or not water adsorbs as an intact molecule or if it dissociates by donating a proton to a so-called bridge-bonded surface oxygen atom. Computational studies agree that the energy difference between these two states is very small and thus depends sensitively on the computational setup and on the approximations used in density functional theory (DFT). While a recent molecular beam/STM experiment [Z.-T. Wang et al., Proc. Natl. Acad. Sci. U. S. A. 114(8), 1801-1805 (2017)] gives conclusive evidence for a slight preference (0.035 eV) for molecular water and a small activation energy of (0.36 eV) for dissociation, understanding the interface between liquid water and TiO2(110) arises as the next controversial frontier.
Reactions of OH Radicals with Tris (1,10-Phenanthroline) Iron (II) Studied by Pulse Radiolysis
DEFF Research Database (Denmark)
Siekierska Floryan, E.; Pagsberg, Palle Bjørn
1976-01-01
The reaction of OH radicals with aqueous tris(1,10-phenanthroline)iron(II) leads to the formation of an adduct, which exhibits a broad absorption band at rmpH = 6, λmax = 460 nm, and epsilon (Porson)460 = 6700 (molar, decadic, 1 mol−1 cm−1). The rate of formation of the adduct is first order...... in complex concentration with a bimolecular rate constant Image independent of pH in the range pH 3–11. The adduct decays by mixed-order kinetics, but at 310 nm a second-order formation of a decay product can be directly observed. The reaction of OH radicals with aqueous 1,10-phenanthroline leads also...... to the formation of an adduct which absorbs in the whole visible region with a maximum at 425 nm and ε425 = 2612 (molar, decadic, 1 mol−1 cm−1) in neutral solution. The adduct exhibits a red shift in acidic and alkaline media. The formation is first order in 1,10-phenanthroline with a bimolecular rate constant...
High incidence of thyroid cancer among patients with acromegaly.
Kaldrymidis, Dimitrios; Papadakis, Georgios; Tsakonas, Georgios; Kaldrymidis, Philippos; Flaskas, Theofanis; Seretis, Andreas; Pantazi, Eleni; Kostoglou-Athanassiou, Ifigenia; Peppa, Melpomeni; Roussou, Paraskevi; Diamanti-Kandarakis, Evanthia
2016-01-01
Several studies have suggested that patients with acromegaly have an increased risk of thyroid, colorectal, breast and prostate cancers. In this study we determined the prevalence of malignant neoplasms in patients with acromegaly. Cancer risk was evaluated in a cohort of 110 patients (M/F 48/62, age 58.63±13.8 years, range 30-86) with acromegaly. Mean age at diagnosis of acromegaly was 46.37±13.11 years. Mean period of time since diagnosis of acromegaly was 12.26+9.6 years. From 110 patients, cancer was diagnosed in 26 (23.6%) patients. Thyroid cancer was the most common cancer and was diagnosed in 13 patients (11.8%); other cancers encountered were gastric cancer (N=2), endometrial cancer (N-2), and breast cancer, colon cancer, prostate cancer (N-2), myelodysplastic syndrome, renal cell carcinoma, lung cancer and pancreatic carcinoma, one case each. Age, gender, age at the time of diagnosis of acromegaly, tumor size of pituitary adenoma and duration of disease were not associated with cancer development. This study suggests that patients with acromegaly have an increased risk of thyroid cancer and therefore they should undergo regular screening with hormonal and ultrasound evaluation of the thyroid and FNAB when required.
Eddy-resolving 1/10° model of the World Ocean
Ibrayev, R. A.; Khabeev, R. N.; Ushakov, K. V.
2012-02-01
The first results on simulating the intra-annual variability of the World Ocean circulation by use of the eddy-resolving model are considered. For this purpose, a model of the World Ocean with a 1/10° horizontal resolution and 49 vertical levels was developed (a 1/10 × 1/10 × 49 model of the World Ocean). This model is based on the traditional system of three-dimensional equations of the large-scale dynamics of the ocean and boundary conditions with an explicit allowance for water fluxes on the free surface of the ocean. The equations are written in the tripolar coordinate system. The numerical method is based on the separation of the barotropic and baroclinic components of the solution. Discretization in time is implemented using explicit schemes allowing effective parallelization for a large number of processors. The model uses the sub-models of the boundary layer of the atmosphere and the submodel of sea-ice thermodynamics. The model of the World Ocean was developed at the Institute of Numerical Mathematics of the Russian Academy of Sciences (INM RAS) and the P.P. Shirshov Institute of Oceanogy (IO RAS). The formulation of the problem of simulating the intra-annual variability of thermohydrodynamic processes of the World Ocean and the parameterizations that were used are considered. In the numerical experiment, the temporal evolution of the atmospheric effect is determined by the normal annual cycle according to the conditions of the international Coordinated Ocean-Ice Reference Experiment (CORE-I). The calculation was carried out on a multiprocessor computer with distributed memory; 1601 computational cores were used. The presented analysis demonstrates that the obtained results are quite satisfactory when compared to the results that were obtained by other eddy-resolving models of the global ocean. The analysis of the model solution is, to a larger extent, of a descriptive character. A detailed analysis of the results is to be presented in following works
Double life of centrioles: CP110 in the spotlight.
Bettencourt-Dias, Mónica; Carvalho-Santos, Zita
2008-01-01
Centrioles lead an important double life: they can give rise to the centrosome or convert to basal bodies and template cilia. Little is known about the control of centriole fate. Spektor and colleagues have now identified a centriolar complex, composed of CP110 and CEP97, which inhibits centriole to basal body conversion, preventing cilia formation. This work paves the way to understanding centriole and cilia biogenesis, which are two processes misregulated in human diseases, such as cancer and polycystic kidney disease.
Structural and electronic properties of Pt induced nanowires on Ge(110)
Energy Technology Data Exchange (ETDEWEB)
Zhang, L.; Bampoulis, P.; Safaei, A.; Zandvliet, H.J.W.; Houselt, A. van, E-mail: A.vanHouselt@utwente.nl
2016-11-30
Highlights: • Deposition of Pt induces regularly spaced (1.13 nm, 1.97 nm and 3.38 nm) nanowires on Ge(110). • In the troughs between the wires spaced 6× the Ge lattice consant pentagons are observed. • Spatially resolved STS reveals a filled electronic state at −0.35 eV. • This state has its highest intensity above the pentagons. • For 2 ML Pt, nanowires coexist with PtGe clusters, which become liquid like above 1040 K. - Abstract: The structural and electronic properties of Pt induced nanowires on Ge(110) surfaces have been studied by scanning tunneling microscopy and low energy electron microscopy. The deposition of a sub-monolayer amount of Pt and subsequent annealing at 1100 (±30) K results into nanowires which are aligned along the densely packed [1–10] direction of the Ge(110) surface. With increasing Pt coverage the nanowires form densely packed arrays with separations of 1.1 ± 0.1 nm, 2.0 ± 0.1 nm and 3.4 ± 0.1 nm. Ge pentagons reside in the troughs for nanowire separations of 3.4 nm, however for smaller nanowire separations no pentagons are found. Spatially resolved scanning tunneling spectroscopy measurements reveal a filled electronic state at −0.35 eV. This electronic state is present in the troughs as well as on the nanowires. The −0.35 eV state has the strongest intensity on the pentagons. For Pt depositions exceeding two monolayers, pentagon free nanowire patches are found, that coexist with Pt/Ge clusters. Upon annealing at 1040 K these Pt/Ge clusters become liquid-like, indicating that we are dealing with eutectic Pt{sub 0.22}Ge{sub 0.78} clusters. Low energy electron microscopy videos reveal the formation and spinodal decomposition of these eutectic Pt/Ge clusters.
Mechanism of oxidation of L-methionine by iron(III)-1,10 ...
Indian Academy of Sciences (India)
Unknown
Abstract. Kinetics and mechanism of oxidation of L-methionine by iron(III)–1,10- phenanthroline complex have been studied in perchloric acid medium. The reaction is first order each in iron(III) and methionine. Increase in [phenanthroline] increases the rate while increase in [HClO4] decreases it. While the reactive species ...
30 CFR 291.110 - Who may MMS require to produce information?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may MMS require to produce information? 291... § 291.110 Who may MMS require to produce information? (a) MMS may require any lessee, operator of a lease or unit, shipper, grantee, or transporter to provide information that MMS believes is necessary to...
Zhao, Pei; Wang, Ying; Huang, Zhi liang; Mao, Yangwu; Xu, Yuan Lai
2015-04-01
a-axis-, c-axis-, (103)/(110)- and (113)-oriented YBa2Cu3O7-δ (YBCO) films were pareared by spray atomizing and coprecipitating laser chemical vapor deposition. The surface of the a-axis-oriented YBCO film consisted of rectangular needle-like grains whose in-plane epitaxial growth relationship was YBCO [100] // STO [001] (YBCO [001] // STO [100]), and that of the c-axis-oriented YBCO film consisted of dense flat surface with epitaxial growth relationship of YBCO [001] // STO [001] (YBCO [100] //STO [100]). For the (103)/(110)-oriented and (113)-oriented YBCO film, they showed wedge-shaped and triangle-shaped grains, with corresponding in-plane epitaxial growth relationship of YBCO [110] // STO [110] (YBCO [010] // STO [010]) and YBCO [100] // STO [100] (YBCO [113] // STO [111], respectively.
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
International Nuclear Information System (INIS)
Komine, Kuniaki; Konno, Mutsuo
1999-01-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
Directory of Open Access Journals (Sweden)
Hedayat A
1998-07-01
Full Text Available Primary Hyperparathyroidism is a fairly common disease that is much more predominant in females. Treatment is surgery and includes removing the parathyroid adenoma or the hyperplastic parathyroid glands. Considering the difficulty of this operation procedure, localization test are utilized including ultrasound, MRI, CT scan, Thallium-Technesium subtraction scan, MIBI scan and a series of other tests. According to the studies regarding these tests, MIBI scan is superior to all the others. In this survery we have studied 110 primary hyperparathyroidism patients that were operated on in Dr.Shariati Hospital between 1356 and 1376. In order to localize the adenoma ultrasound was used in ten patients, thallium-technesium subtraction scan in 38 patients. MIBI scan in 30 patients and CT scan in 3 patients. The sensitivity of MIBI scan was 86% and its specificity was 100%. In comparison, the sensitivity of thallium-technesium scan was found to be about 65%. Our results show that MIBI scan has had a high degree of sensitivity and specificity in our patients and has shown to be the best localization test. Therefore we suggest this test for the localization of all parathyroid adenomas.
Directory of Open Access Journals (Sweden)
T. Malivanova
2015-11-01
Conclusions: This study found out the opposite effect of polymorphisms at −238 and −308 positions in TNF promoter on the outcome of BC patients. Carriers of low expressed allele −238(A have poor outcome because of low response to standard hormone therapy which presumably connected with the activation of Her2 pathway. The obtained results allow supposing that a special approach to the treatment of this group of BC patients should be used.
Otorhinolaryngological patient injuries in Finland.
Lehtivuori, Tuuli; Palonen, Reima; Mussalo-Rauhamaa, Helena; Holi, Tarja; Henriksson, Markus; Aaltonen, Leena-Maija
2013-10-01
Otorhinolaryngology (ORL) is considered a specialty associated with few serious patient injuries. Research data that support this belief are, however, scarce. We analyzed claims associated with ORL to determine the number of Finnish cases and the possible common denominators. Register study of ORL cases in the Patient Insurance Centre (PIC), the Regional State Administrative Agencies (RSAA), and the National Supervisory Authority for Welfare and Care (Valvira) during the years 2004 to 2008. These three agencies are the main actors in the field of patient injury in Finland. We analyzed compensated ORL patient injury cases from the PIC and cases associated with the ORL specialty for Valvira and RSAA from 2004 to 2008 and surveyed patient treatment files, statements from specialists, and compensation decisions. Injuries were usually associated with operations; three patients who experienced injuries during these procedures died. Common ORL operations such as tonsillectomy, septoplasty, and paranasal sinus surgery were most often associated with compensated injuries. Serious injuries were few, with a total of 110 out of 422 (26.1%) claims compensated by the PIC. Of the 110 compensated cases, 30 (27.3%) were related to tumor surgery. The most usual compensated case had iatrogenic nerve injury affecting the facial or trigeminal nerves. Of the compensated cases, 79 (71.8%) were treated by specialists, 15 (13.6%) by residents, and the rest by other medical professionals. Patient injuries in ORL are seldom severe and are strongly associated with surgery. A typical compensated injury was one that occurred in a central hospital during working hours. N/A. Copyright © 2013 The American Laryngological, Rhinological, and Otological Society, Inc.
2 MW 110 GHz ECH heating system for DIII-D
International Nuclear Information System (INIS)
Moeller, C.; Prater, R.; Callis, R.; Remsen, D.; Doane, J.; Cary, W.; Phelps, R.; Tupper, M.
1990-09-01
A 2 MW 110 GHz ECH system using Varian 0.5 MW gyrotrons is under construction for use on the DIII-D tokamak by late 1991. Most of the components are being design and fabricated at General Atomics, including the gyrotron tanks, superconducting magnets, and transmission line. These components are intended for operation with 10 second pulses and, in the future, with 1 MW gyrotrons. 6 refs., 5 figs
Tank characterization report for single-shell tank 241-U-110
International Nuclear Information System (INIS)
Brown, T.M.; Jensen, L.
1993-04-01
This report investigates the nature of the waste in tank U-110 using historical and current information. When characterizing tank waste, several important properties are considered. First, the physical characteristics of the waste are presented, including waste appearance, density, and size of waste particles. The existence of any exotherms in the tank that may present a safety concern is investigated. Finally, the radiological and chemical composition of the tank are presented
12 CFR 563b.110 - Who must review my business plan?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who must review my business plan? 563b.110... business plan? (a) Your chief executive officer and members of the board of directors must review, and at least two-thirds of your board of directors must approve, the business plan. (b) Your chief executive...
Patient education has a positive effect in patients with a stoma
DEFF Research Database (Denmark)
Danielsen, Anne Kjaergaard; Burcharth, Jakob; Rosenberg, Jacob
2013-01-01
group (7396,90 USD) as well as higher effectiveness scores in the intervention (166,89) compared with the control group (110.98). a significant rise in stoma-related knowledge (p=0.0000), and an increase in psychosocial adjustment (p= 0.000). CONCLUSION: Structured patient education aimed at patients......AIM: A systematic review was performed to assess whether education of patients having stoma formation improves quality of life and whether it is cost effective. METHOD: A literature search was performed to identify studies on the structured education of ostomates and outcome using the following...... databases: MEDLINE, Cinahl, Embase, Cochrane and PsycInfo. Inclusion criteria were: clinical studies reporting effects of educational interventions in relation to patients with a stoma. Commentaries or studies not testing an intervention were excluded. RESULTS: Seven articles met the inclusion criteria...
DEFF Research Database (Denmark)
Stilling, Nicolaj; Jung, Helene; Nørby, Bettina
2009-01-01
follow-up 110 weeks). Success criteria were defined as symptom relief and improved or preserved renal function. Results. Twenty-nine patients (66%) experienced complete symptom resolution and 10 patients (23%) had significant symptom improvement (i.e. no need for pain-killing medication). Five patients...
Substrate strain induced interaction of adatoms on W (110)
Kappus, W.
1980-09-01
The interaction of adatoms due to elastic strains created in an elastically isotropic substrate is investigated. For cases where the adatoms occupy sites with low symmetry, an angular dependent interaction results which falls off as s-3 at large distances. An exact expression is given for the long range interaction in terms of an anisotropy parameter of the force dipole tensor. The short range interaction is calculated by introducing a smooth cutoff. Interactions of adatoms on near neighbour sites on W (110) are given.
The effects of antimony doping on the surface structure of rutile TiO{sub 2}(110)
Energy Technology Data Exchange (ETDEWEB)
Bechstein, Ralf; Schuette, Jens; Kuehnle, Angelika [Fachbereich Physik, Universitaet Osnabrueck, Barbarastrasse 7, D-49076 Osnabrueck (Germany); Kitta, Mitsunori; Onishi, Hiroshi [Department of Chemistry, Kobe University, Rokko-dai, Nada-ku, Kobe 657-8501 (Japan)], E-mail: kuehnle@uos.de
2009-07-01
Titanium dioxide represents a very important wide bandgap photocatalyst that is known to be sensitized to visible light by transition metal doping. Antimony doping has been demonstrated to provide photocatalytic activity when codoped with chromium at an optimum dopant ratio [Sb]/[Cr] of about 1.5. Here, the role of antimony doping on the surface structure of rutile TiO{sub 2}(110) is studied using non-contact atomic force microscopy (NC-AFM) under ultra-high vacuum conditions. At first glance, the surface structure of antimony-doped TiO{sub 2}(110) resembles the structure of pristine TiO{sub 2}(110). However, in contrast to what is found in pristine TiO{sub 2}(110), a dense layer of protruding features is observed upon antimony doping, which is tentatively ascribed to antimony-rich clusters. Moreover, homogeneously distributed holes are found on the surface, which differ in depth and shape depending on the preparation conditions. Holes with depths ranging from a few up to more than a hundred monatomic steps are observed. These holes are explained by surface segregation of antimony during annealing, as the ionic radius of Sb{sup 3+} is considerably larger than the ionic radius of Ti{sup 4+}. Our finding provides an indication of why an antimony concentration larger than the optimum ratio results in decreased photocatalytic activity. Moreover, controlling annealing temperature seems to constitute a promising strategy for creating nanosized holes on TiO{sub 2} surfaces.
Energy Technology Data Exchange (ETDEWEB)
Seenivasan, H.; Tiwari, Ashwani K., E-mail: ashwani@iiserkol.ac.in [Indian Institute of Science Education and Research Kolkata, Mohanpur 741252 (India)
2014-05-07
Water adsorption and dissociation on Ni(110) surface is studied in detail and compared with its close packed counterparts using density functional theory calculations. Water adsorption occurs on the top site as found on Ni(100) and Ni(111) but the adsorption is stronger on Ni(110). H and OH preferably adsorb on the short bridge sites (brgshort) opposed to hollow sites on (100) and (111) surfaces. Energy barriers for water molecule dissociation on Ni(110) as obtained from the transition state (TS) calculations were low compared to other Ni low indexed surfaces. TS geometries at different positions of the lattice coordinate, Q, were obtained to study the effect of surface temperature on dissociation of H{sub 2}O molecules. These calculations revealed that second layer atoms were also involved in the TS. Dissociation probabilities are obtained using a semi-classical approximation by sampling Q for a Boltzmann distribution at different temperatures. Results showed that the increasing surface temperature significantly increases the dissociation probabilities at lower energies and saturates near the barrier for dissociation. Although the contribution from both top and second layers is similar at low surface temperatures, motion of top layer atoms contribute more towards dissociation probability at higher surface temperatures. Dissociation probabilities obtained are more than one order of magnitude higher than that on Ni(100) and Ni(111) surfaces suggesting Ni(110) to be more reactive among the low indexed Ni surfaces.
Time-of-flight electron energy loss spectroscopy using TM110 deflection cavities
Directory of Open Access Journals (Sweden)
W. Verhoeven
2016-09-01
Full Text Available We demonstrate the use of two TM110 resonant cavities to generate ultrashort electron pulses and subsequently measure electron energy losses in a time-of-flight type of setup. The method utilizes two synchronized microwave cavities separated by a drift space of 1.45 m. The setup has an energy resolution of 12 ± 2 eV FWHM at 30 keV, with an upper limit for the temporal resolution of 2.7 ± 0.4 ps. Both the time and energy resolution are currently limited by the brightness of the tungsten filament electron gun used. Through simulations, it is shown that an energy resolution of 0.95 eV and a temporal resolution of 110 fs can be achieved using an electron gun with a higher brightness. With this, a new method is provided for time-resolved electron spectroscopy without the need for elaborate laser setups or expensive magnetic spectrometers.
International Nuclear Information System (INIS)
Shapter, J.G.; Rogers, B.L.; Ford, M.J.
2003-01-01
Full text: Since its development in 1982, the Scanning Tunneling Microscope (STM) has developed into a powerful tool for the study of surfaces and adsorbates. However, the utility of the technique can be further enhanced through the development of techniques for generating theoretical STM images. This is particularly true when studying molecules adsorbed on a substrate, as the results are often interpreted superficially due to an inadequate understanding of the orbital overlap probed in the experiment. A method of preparing theoretical scanning tunneling microscope (STM) images using comparatively inexpensive desktop computers and the commercially available CRYSTAL98 package is presented through a study of benzene adsorbed on the Cu(110) surface. Density Functional Theory (DFT) and Hartree-Fock (HF) methods are used to model clean Cu(110) slabs of various thicknesses and to simulate the adsorption of benzene onto these slabs. Eight possible orientations of benzene on the Cu(110) surface are proposed, and the optimum orientation according to the calculations is presented. Theoretical STM images of the Cu(110) surface and benzene adsorbed on the Cu(110) surface are compared with experimental STM images of the system from a published study. Significant differences are observed and are examined in detail
Vapor and gas sampling of single-shell tank 241-BX-110 using the in situ vapor sampling system
International Nuclear Information System (INIS)
Lockrem, L.L.
1997-01-01
The Vapor Issue Resolution Program tasked the Vapor Team (the team) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-BX-110. This document presents sampling data resulting from the April 30, 1996 sampling of SST 241-BX-110. Analytical results will be presented in a separate report issued by Pacific Northwest National Laboratory (PNNL), which supplied and analyzed the sampling media
Self-assembled formation and transformation of In/CdZnTe(110) nano-rings into camel-humps
International Nuclear Information System (INIS)
Cohen-Taguri, G.; Ruzin, A.; Goldfarb, I.
2012-01-01
We used in situ scanning tunneling microscopy to monitor in real time the formation of nano-rings at the molecular beam epitaxially grown In/CdZnTe(110) surface, and Auger electron spectroscopy to explore the corresponding compositional changes. In-diffusion of In and segregation of Cd to the surface in course of annealing lead to a formation of elliptically distorted nano-rings, elongated along the fast [110] diffusion direction. Exacerbated diffusion anisotropy in the liquid state, at temperatures above the melting point of In, further distorts the nano-rings into a camel-hump shape.
International Nuclear Information System (INIS)
Schultz, P.J.; Lynn, K.G.; Frieze, W.E.; Vehanen, A.
1983-01-01
Positron emission from a W(110) single crystal has been studied as a function of copper coverage utilizing a variable-energy positron beam in conjunction with low-energy electron diffraction and Auger-electron spectroscopy. Evidence is presented that indicates that sig- p nificant positron localization occurs at defects associated with the Cu/W(110) interface, which can be removed by high-temperature annealing. Our data also reveal new information about the islanding of copper on tungsten, providing a reliable means of identifying and quantifying the relative two-dimensional coverage of the surface by these islands
The effect of feeding Bt MON810 maize to pigs for 110 days on intestinal microbiota.
Directory of Open Access Journals (Sweden)
Stefan G Buzoianu
Full Text Available OBJECTIVE: To assess the effects of feeding Bt MON810 maize to pigs for 110 days on the intestinal microbiota. METHODOLOGY/PRINCIPAL FINDINGS: Forty male pigs (∼40 days old were blocked by weight and litter ancestry and assigned to one of four treatments; 1 Isogenic maize-based diet for 110 days (Isogenic; 2 Bt maize-based diet (MON810 for 110 days (Bt; 3 Isogenic maize-based diet for 30 days followed by a Bt maize-based diet for 80 days (Isogenic/Bt; 4 Bt maize-based diet for 30 days followed by an isogenic maize-based diet for 80 days (Bt/Isogenic. Enterobacteriaceae, Lactobacillus and total anaerobes were enumerated in the feces using culture-based methods on days 0, 30, 60 and 100 of the study and in ileal and cecal digesta on day 110. No differences were found between treatments for any of these counts at any time point. The relative abundance of cecal bacteria was also determined using high-throughput 16 S rRNA gene sequencing. No differences were observed in any bacterial taxa between treatments, with the exception of the genus Holdemania which was more abundant in the cecum of pigs fed the isogenic/Bt treatment compared to pigs fed the Bt treatment (0.012 vs 0.003%; P≤0.05. CONCLUSIONS/SIGNIFICANCE: Feeding pigs a Bt maize-based diet for 110 days did not affect counts of any of the culturable bacteria enumerated in the feces, ileum or cecum. Neither did it influence the composition of the cecal microbiota, with the exception of a minor increase in the genus Holdemania. As the role of Holdemania in the intestine is still under investigation and no health abnormalities were observed, this change is not likely to be of clinical significance. These results indicate that feeding Bt maize to pigs in the context of its influence on the porcine intestinal microbiota is safe.
49 CFR 41.110 - New DOT owned buildings and additions to buildings.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false New DOT owned buildings and additions to buildings....110 New DOT owned buildings and additions to buildings. (a) DOT Operating Administrations responsible for the design and construction of new DOT Federally owned buildings will ensure that each building is...
21 CFR 2.110 - Definition of ammonia under Federal Caustic Poison Act.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Definition of ammonia under Federal Caustic Poison... SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS Caustic Poisons § 2.110 Definition of ammonia under Federal Caustic Poison Act. For the purpose of determining whether an article containing ammonia...
An x-ray standing wave study of silver nano-wires on Cu(110)
International Nuclear Information System (INIS)
Stampfl, A.P.J.; Nyberg, G.
1998-01-01
Full text: The growth of Ag on Cu(110) is a well characterised adsorption system. At low coverages (under 1 ML), several reconstructions have been reported. Silver is believed to occupy the troughs of the Cu(110) surface, forming one-dimensional linear chains. We have carried out X-ray standing wave measurements especially in the low coverage limit (< 0.5 ML) using the [200], [220] and [111] Bragg reflection planes of copper and several core and auger lines. The usual dipole approximation analysis scheme was replaced by a more accurate description of the standing wave process which allowed use of the intense high energy core levels. We show that Ag does indeed sit along the troughs of the copper surface: the coherent fraction of the silver increased with decreasing coverage, its position being nearly the same as the bulk lattice at low coverages
Conductive atomic force microscopy study of InAs growth kinetics on vicinal GaAs (110)
International Nuclear Information System (INIS)
Tejedor, Paloma; Diez-Merino, Laura; Beinik, Igor; Teichert, Christian
2009-01-01
Conductive atomic force microscopy has been used to investigate the effect of atomic hydrogen and step orientation on the growth behavior of InAs on GaAs (110) misoriented substrates. Samples grown by conventional molecular beam epitaxy exhibit higher conductivity on [110]-multiatomic step edges, where preferential nucleation of InAs nanowires takes place by step decoration. On H-terminated substrates with triangular terraces bounded by [115]-type steps, three-dimensional InAs clusters grow selectively at the terrace apices as a result of a kinetically driven enhancement in upward mass transport via AsH x intermediate species and a reduction in the surface free energy.
Patient satisfaction after total knee arthroplasty: an Asian perspective.
Thambiah, Matthew Dhanaraj; Nathan, Sahaya; Seow, Branden Z X; Liang, Shen; Lingaraj, Krishna
2015-05-01
Total knee arthroplasty (TKA) is an effective method for alleviating pain and restoring knee function in patients with severe osteoarthritis. However, despite the improvements in surgical technique and postoperative care, it has been reported that up to 19% of patients are dissatisfied after their operations. The aim of this study was to evaluate patient satisfaction levels after TKA in an Asian cohort, as well as assess the correlation between patient satisfaction levels and the results of traditional physician-based scoring systems. The medical data of 103 Asian patients who underwent 110 TKAs between December 2008 and June 2009 were obtained from our hospital's Joint Replacement Registry. The minimum follow-up period was one year and patient expectations were assessed before TKA. Patient satisfaction was assessed postoperatively using a 5-point Likert scale. Reasons for patient dissatisfaction were recorded. Standardised instruments (e.g. the Knee Society Score, the Western Ontario and McMaster Universities Osteoarthritis Index [WOMAC] and the generic Short Form-36 health survey) were used to assess the patient's functional status and the severity of symptoms pre- and postoperatively. Among the 110 TKAs performed, 92.8% resulted in patient satisfaction. Patient satisfaction correlated with postoperative WOMAC function scores (p = 0.028), postoperative WOMAC final scores (p = 0.040) and expectations being met (p = 0.033). Although there was a high level of patient satisfaction following TKA in our cohort of Asian patients, a significant minority was dissatisfied. Patient satisfaction is an important outcome measure and should be assessed in addition to traditional outcome scores.
Tyrosine 110 in the measles virus phosphoprotein is required to block STAT1 phosphorylation
International Nuclear Information System (INIS)
Devaux, Patricia; Messling, Veronika von; Songsungthong, Warangkhana; Springfeld, Christoph; Cattaneo, Roberto
2007-01-01
The measles virus (MV) P gene encodes three proteins: P, an essential polymerase cofactor, and C and V, which have multiple functions including immune evasion. We show here that the MV P protein also contributes to immune evasion, and that tyrosine 110 is required to block nuclear translocation of the signal transducer and activator of transcription factors (STAT) after interferon type I treatment. In particular, MV P inhibits STAT1 phosphorylation. This is shown not only by transient expression but also by reverse genetic analyses based on a new functional infectious cDNA derived from a MV vaccine vial (Moraten strain). Our study also identifies a conserved sequence around P protein tyrosine 110 as a candidate interaction site with a cellular protein
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
Energy Technology Data Exchange (ETDEWEB)
Komine, Kuniaki [Nuclear Power Engineering Corp., Tokyo (Japan); Konno, Mutsuo
1999-07-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
Gomes, Janaina F; Busson, Bertrand; Tadjeddine, Abderrahmane
2006-03-23
Ethanol in an acidic solution-Pt(110) interface was studied by SFG spectroscopy (between 1820 and 2325 cm(-1)) to explore primarily the effects of the alcohol concentration. Stretching bands of H-Pt (ca. 1970 or 2050 cm(-1)) and CO (ca. 1980 and 2040 cm(-1)) species, produced by the ethanol oxidation, were detected during the adsorption and oxidation of 0-1 mol L(-1) ethanol in a 0.1 mol L(-1) HClO(4) solution on the electrode surface. Hydrogen and CO coadsorb stably on Pt(110) between 0.05 and 0.15 V in ethanol-containing solutions. In this potential range, the blue shift of the hydrogen resonance (ca. 80 cm(-1)) reveals a weakening of the hydrogen bonding between adsorbed hydrogen and water molecules in the double layer. After the hydrogen desorption (0.15 V), the formation of compact CO islands, depending on the ethanol concentration, lifts the Pt(110) surface reconstruction. In ethanol-free solution, the surface remains reconstructed. The lower-frequency CO band is assigned to the CO species adsorbed on (1 x 2) reconstructed Pt(110) domains, having smaller local coverages, while the higher-frequency CO band is attributed to the close-packed CO species adsorbed on (1 x 1) patches. The reaction pathway forming CO(2) is less favored with increasing ethanol concentration.
Seeking asymmetric rotors in mass region A∼100-110
International Nuclear Information System (INIS)
Varshney, Mani; Gupta, D K; Singh, M; Singh, Yuvraj; Bihari, Chhail; Varshney, A K; Gupta, K K
2011-01-01
The staggering indices S(I, I-1, I-2) versus spin (I) graphs have been plotted using known experimental data along with empirical calculations of Varshney et al (2007 Phys. Scr. 75 451) in some nuclei of mass region A∼100-110. Most of the transional nuclei of Mo, Ru and Pd isotopes have been found to be triaxial. The known B(E2) values of these nuclei are also close to the triaxial rotor model predictions (Davydov A S and Filippov G F 1958 Nucl. Phys. 8 237).
Kalinovskaya, I. V.; Zadorozhnaya, A. N.
2018-04-01
Influence of cinnamic acid on the luminescent properties of the europium(III) nitrate with 1,10-phenantroline in a polymer materials was studied. It was shown that combined use of these rare earth complexes leads to intense luminescence in the 400-700 nm region. Samples containing polymer europium nitrate with 1,10-phenantroline and cinnamic acid at a molar ratio of 1:2,0 had the maximum luminescence intensity and photostability.
Photochemistry of 1,1,1-Trifluoroacetone on Rutile TiO2(110)
International Nuclear Information System (INIS)
Zehr, Robert T.; Deskins, N. Aaron; Henderson, Michael A.
2010-01-01
The ultraviolet (UV) photon-induced photodecomposition of 1,1,1-trifluoroacetone (TFA) adsorbed on the rutile TiO2(110) surface has been investigated with photon stimulated desorption (PSD), temperature programmed desorption (TPD) and density functional theory (DFT). TFA adsorbed molecularly on the reduced surface (8% oxygen vacancies) in states desorbing below 300 K with trace thermal decomposition observed in TPD. Adsorption of TFA on a preoxidized TiO2(110) surface (accomplished by pre-exposure with 20 L O2) led to formation of a new TFA desorption state at 350 K, assigned to decomposition of a TFA-diolate species ((CF3)(CH3)COO). No TFA photochemistry was detected on the reduced surface. UV irradiation of TFA on the oxidized surface depleted TFA in the 350 K state, with TFA molecules in other TPD states unaffected. PSD measurements reveal that both carbonyl substituents (CH3 and CF3), as well as CO, were liberated during UV exposure at 95 K. Post-irradiation TPD showed evidence for both acetate (evolving as ketene at 650 K) and trifluoroacetate (evolving as CO2 at 600 K) as surface-bound photodecomposition products. The CO PSD product was not due to adsorbed CO, to mass spectrometer cracking of a CO-containing PSD product, or from background effects, but originated from complete fragmentation of an unidentified adsorbed TFA species. Thermodynamic analysis using DFT indicated that the photodecomposition of the TFA-diolate was likely not driven by thermodynamics alone as both pathways (CH3+trifluoroacetate and CF3+acetate) were detected when thermodynamics shows a clear preference for only one (CF3+acetate). These observations are in contrast to the photochemical behavior of acetone, butanone and acetaldehyde on TiO2(110), where only one of the two carbonyl substituent groups was observed, with a stoichiometric amount of carboxylate containing the other substituent left on the surface. We conclude that fluorination significantly alters the electronic structure of
Huang, P; He, J; Zhang, Y M
2017-05-30
Objective: To apply themobile application of patient management in education and follow-up for patients following total knee arthroplasty, and evaluate the clinical outcomes. Methods: A total of 150 patients following total knee arthroplasty were chosen from May to October 2016 in orthopaedics department of our hospital, and they were randomly divided into two groups. On the basis of the traditional education, the observation group combined with the APP education, guidance of functional exercise and follow-up. While traditional face-to-face and telephone education were combined to control group. The activity, compliance and satisfaction score of the two groups were observed. Results: Finally, 132 patients were included in the study. The postoperative range of motion of the two groups in February were respectively (110.83±6.83)°and (105.45±7.53)°, the difference was statistically significant ( P <0.05); the range of motion in March were respectively (110±6.33)°and (103.26±7.57)°, the difference was statistically significant too ( P <0.05); Patients's compliance and satisfaction score in observation group were significantly better than control group( P <0.05). Conclusion: Combination of traditional face-to-face education with mobile application will improve effects of functional training, compliance, and hospital-discharge satisfaction, it will also both shorten the education time and increase the education efficiency. To sum up, it's worth being widely applied clinically.
Polonium: 110th anniversary of its discovery
International Nuclear Information System (INIS)
Mould, R. F.
2008-01-01
It is appropriate that the 110 Th anniversary of the discovery of polonium by Marie and Pierre Curie is commemorated in a Polish journal since this element was named for Poland and was also the element discovered by the Curies before they discovered radium. Polonium's discovery and characteristics are described. Polonium has never been used in medicine, and was largely forgotten apart from a few minor industrial uses, and as a trigger for a nuclear weapon, until the murder in November 2006 in London using 210 Polonium, of the ex-KGB officer Alexander Litvinenko. Polonium had previously been linked, without any definite proof, with the deaths of a few scientists who had worked with the element, including Irene and Frederick Joliet-Curie. This review ends with possible evidence for such links. (authors)
Hoffrichter, André; Barrios, Hans; Massmann, Janek; Venkataramanachar, Bhavasagar; Schnettler, Armin
2018-02-01
The structural changes in the European energy system lead to an increase of renewable energy sources that are primarily connected to the distribution grid. Hence the stationary analysis of the transmission grid and the regionalization of generation capacities are strongly influenced by subordinate grid structures. To quantify the impact on the congestion management in the German transmission grid, a 110 kV grid model is derived using publicly available data delivered by Open Street Map and integrated into an existing model of the European transmission grid. Power flow and redispatch simulations are performed for three different regionalization methods and grid configurations. The results show a significant impact of the 110 kV system and prove an overestimation of power flows in the transmission grid when neglecting subordinate grids. Thus, the redispatch volume in Germany to dissolve bottlenecks in case of N-1 contingencies decreases by 38 % when considering the 110 kV grid.
Optical properties of silicene, Si/Ag(111), and Si/Ag(110)
Hogan, C.; Pulci, O.; Gori, P.; Bechstedt, F.; Martin, D. S.; Barritt, E. E.; Curcella, A.; Prevot, G.; Borensztein, Y.
2018-05-01
We present a state-of-the-art study of the optical properties of free-standing silicene and of single-layer Si one- and two-dimensional (1D and 2D) nanostructures supported on Ag(110) and Ag(111) substrates. Ab initio simulations of reflectance anisotropy spectroscopy (RAS) and surface differential reflectivity spectroscopy (SDRS) applied to the clean Ag surface and Si/Ag interfaces are compared with new measurements. For Si/Ag(110), we confirm a pentagonal nanoribbon geometry, strongly bonded to the substrate, and rule out competing zigzag chain and silicenelike models. For Si/Ag(111), we reproduce the main experimental features and isolate the optical signal of the epitaxial silicene overlayer. The absorption spectrum of a silicene sheet computed including excitonic and local field effects is found to be quite similar to that calculated within an independent particle approximation and shows strong modifications when adsorbed on a Ag substrate. Important details of the computational approach are examined and the origins of the RAS and SDRS signals are explained in terms of the interface and substrate response functions. Our study does not find any evidence for Si adlayers that retain the properties of freestanding silicene.
Assessment of R18, COG1410, and APP96-110 in excitotoxicity and traumatic brain injury
Directory of Open Access Journals (Sweden)
Chiu Li Shan
2017-11-01
Full Text Available Cationic arginine-rich and poly-arginine peptides (referred to as CARPs have potent neuroprotective properties in in vitro excitotoxicity and in vivo models of stroke. Traumatic brain injury (TBI shares many pathophysiological processes as stroke, including excitotoxicity. Therefore, we evaluated our lead peptide, poly-arginine R18, with the COG1410 and APP96-110 peptides, which have neuroprotective actions following TBI. In an in vitro cortical neuronal glutamic acid excitotoxicity injury model, R18 was highly neuroprotective and reduced neuronal calcium influx, while COG1410 and APP96-110 displayed modest neuroprotection and were less effective at reducing calcium influx. In an impact-acceleration closed-head injury model (Marmarou model, R18, COG1410, and APP96-110 were administered intravenously (300 nmol/kg at 30 minutes after injury in male Sprague-Dawley rats. When compared to vehicle, no peptide significantly improved functional outcomes, however the R18 and COG1410 treatment groups displayed positive trends in the adhesive tape test and rotarod assessments. Similarly, no peptide had a significant effect on hippocampal neuronal loss, however a significant reduction in axonal injury was observed for R18 and COG1410. In conclusion, this study has demonstrated that R18 is significantly more effective than COG1410 and APP96-110 at reducing neuronal injury and calcium influx following excitotoxicity, and that both R18 and COG1410 reduce axonal injury following TBI. Additional dose response and treatment time course studies are required to further assess the efficacy of R18 in TBI.
International Nuclear Information System (INIS)
Lin, Naiming; Guo, Junwen; Xie, Faqin; Zou, Jiaojuan; Tian, Wei; Yao, Xiaofei; Zhang, Hongyan; Tang, Bin
2014-01-01
Highlights: • Continuous chromizing coating was synthesized on P110 steel by pack cementation. • The chromizing coating showed better corrosion resistance. • Comparison of surface fractal dimensions can estimate corrosion resistance. - Abstract: In the field of corrosion research, mass gain/loss, electrochemical tests and comparing the surface elemental distributions, phase constitutions as well as surface morphologies before and after corrosion are extensively applied to investigate the corrosion behavior or estimate the corrosion resistance of materials that operated in various environments. Most of the above methods are problem oriented, complex and longer-period time-consuming. However from an object oriented point of view, the corroded surfaces of materials often have self-similar characterization: fractal property which can be employed to efficiently achieve damaged surface analysis. The present work describes a strategy of comparison of the surface fractal dimensions for corrosion resistance estimation: chromizing coating was synthesized on P110 steel surface to improve its performance via pack cementation. Scanning electron microscope (SEM) was used to investigate the surface morphologies of the original and corroded samples. Surface fractal dimensions of the detected samples were calculated by binary images related to SEM images of surface morphologies with box counting algorithm method. The results showed that both surface morphologies and surface fractal dimensions of P110 steel varied greatly before and after corrosion test, but the chromizing coating changed slightly. The chromizing coating indicated better corrosion resistance than P110 steel. Comparison of surface fractal dimensions of original and corroded samples can rapidly and exactly realize the estimation of corrosion resistance
Energy Technology Data Exchange (ETDEWEB)
Lin, Naiming, E-mail: lnmlz33@163.com [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Guo, Junwen [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Xie, Faqin [School of Aeronautics, Northwestern Polytechnical University, Xi’an 710072 (China); Zou, Jiaojuan; Tian, Wei [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Yao, Xiaofei [School of Materials and Chemical Engineering, Xi’an Technological University, Xi’an 710032 (China); Zhang, Hongyan; Tang, Bin [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China)
2014-08-30
Highlights: • Continuous chromizing coating was synthesized on P110 steel by pack cementation. • The chromizing coating showed better corrosion resistance. • Comparison of surface fractal dimensions can estimate corrosion resistance. - Abstract: In the field of corrosion research, mass gain/loss, electrochemical tests and comparing the surface elemental distributions, phase constitutions as well as surface morphologies before and after corrosion are extensively applied to investigate the corrosion behavior or estimate the corrosion resistance of materials that operated in various environments. Most of the above methods are problem oriented, complex and longer-period time-consuming. However from an object oriented point of view, the corroded surfaces of materials often have self-similar characterization: fractal property which can be employed to efficiently achieve damaged surface analysis. The present work describes a strategy of comparison of the surface fractal dimensions for corrosion resistance estimation: chromizing coating was synthesized on P110 steel surface to improve its performance via pack cementation. Scanning electron microscope (SEM) was used to investigate the surface morphologies of the original and corroded samples. Surface fractal dimensions of the detected samples were calculated by binary images related to SEM images of surface morphologies with box counting algorithm method. The results showed that both surface morphologies and surface fractal dimensions of P110 steel varied greatly before and after corrosion test, but the chromizing coating changed slightly. The chromizing coating indicated better corrosion resistance than P110 steel. Comparison of surface fractal dimensions of original and corroded samples can rapidly and exactly realize the estimation of corrosion resistance.
Global Burden of Hypertension and Systolic Blood Pressure of at Least 110 to 115 mm Hg, 1990-2015
DEFF Research Database (Denmark)
Forouzanfar, Mohammad H; Liu, Patrick; Roth, Gregory A
2017-01-01
Importance: Elevated systolic blood (SBP) pressure is a leading global health risk. Quantifying the levels of SBP is important to guide prevention policies and interventions. Objective: To estimate the association between SBP of at least 110 to 115 mm Hg and SBP of 140 mm Hg or higher and the bur......Importance: Elevated systolic blood (SBP) pressure is a leading global health risk. Quantifying the levels of SBP is important to guide prevention policies and interventions. Objective: To estimate the association between SBP of at least 110 to 115 mm Hg and SBP of 140 mm Hg or higher...... and the burden of different causes of death and disability by age and sex for 195 countries and territories, 1990-2015. Design: A comparative risk assessment of health loss related to SBP. Estimated distribution of SBP was based on 844 studies from 154 countries (published 1980-2015) of 8.69 million participants...... in the primary analysis. Main Outcomes and Measures: Mean SBP level, cause-specific deaths, and health burden related to SBP (≥110-115 mm Hg and also ≥140 mm Hg) by age, sex, country, and year. Results: Between 1990-2015, the rate of SBP of at least 110 to 115 mm Hg increased from 73 119 (95% uncertainty...
Rao, A. V. Narasimha; Swarnalatha, V.; Pal, P.
2017-12-01
Anisotropic wet etching is a most widely employed for the fabrication of MEMS/NEMS structures using silicon bulk micromachining. The use of Si{110} in MEMS is inevitable when a microstructure with vertical sidewall is to be fabricated using wet anisotropic etching. In most commonly employed etchants (i.e. TMAH and KOH), potassium hydroxide (KOH) exhibits higher etch rate and provides improved anisotropy between Si{111} and Si{110} planes. In the manufacturing company, high etch rate is demanded to increase the productivity that eventually reduces the cost of end product. In order to modify the etching characteristics of KOH for the micromachining of Si{110}, we have investigated the effect of hydroxylamine (NH2OH) in 20 wt% KOH solution. The concentration of NH2OH is varied from 0 to 20% and the etching is carried out at 75 °C. The etching characteristics which are studied in this work includes the etch rates of Si{110} and silicon dioxide, etched surface morphology, and undercutting at convex corners. The etch rate of Si{110} in 20 wt% KOH + 15% NH2OH solution is measured to be four times more than that of pure 20 wt% KOH. Moreover, the addition of NH2OH increases the undercutting at convex corners and enhances the etch selectivity between Si and SiO2.
2 CFR 182.110 - What do subparts A through F of this part do?
2010-01-01
... FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.110 What do subparts A through F of this part do? Subparts A through F...
22 CFR 96.110 - Dissemination and reporting of information about temporarily accredited agencies.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Dissemination and reporting of information... ACT OF 2000 (IAA) Procedures and Standards Relating to Temporary Accreditation § 96.110 Dissemination and reporting of information about temporarily accredited agencies. The accrediting entity must...
Alpha thalassemia among sickle cell anaemia patients in Kampala, Uganda.
Lubega, Irene; Ndugwa, Christopher M; Mworozi, Edison A; Tumwine, James K
2015-06-01
Sickle cell anaemia is prevalent in sub Saharan Africa. While α+-thalassaemia is known to modulate sickle cell anaemia, its magnitude and significance in Uganda have hitherto not been described. To determine the prevalence of α+thalassaemia among sickle cell anaemia patients in Mulago Hospital and to describe the clinical and laboratory findings in these patients. A cross sectional study was carried out on patients with sickle cell anaemia in Kampala. Dried blood spots were used to analyze for the deletional α+ thalassaemia using multiplex polymerase chain reaction. Of the 142 patients with sickle cell anaemia, 110 (77.5%) had the αα+thalassaemia deletion. The gene frequency of (-α) was 0.425. Ninety one percent (100/110) of those with α+thalassaemia were heterozygous (αα/α-). Amongst the patients older than 60 months, 15 (83.3%) of those without αα+thalassaemia had significant hepatomegaly of greater than 4 cm compared to 36 (45.6%) of those with α+thalassaemia (p=0.003). The gene frequency of (-α) of 0.425 noted in this study is higher than that reported from many places in Africa. Concurrent alpha thalassemia might be a protective trait against significant hepatomegaly in sickle cell anaemia patients more than 60 months of age at Mulago hospital.
Directory of Open Access Journals (Sweden)
Yali eWang
2015-06-01
Full Text Available Actinoplanes sp. SE50/110 produces the -glucosidase inhibitor acarbose, which is used to treat type 2 diabetes mellitus. To obtain a comprehensive understanding of its cellular metabolism, a genome-scale metabolic model of strain SE50/110, iYLW1028, was reconstructed on the bases of the genome annotation, biochemical databases, and extensive literature mining. Model iYLW1028 comprises 1028 genes, 1128 metabolites and 1219 reactions. 122 and 81 genes were essential for cell growth on acarbose synthesis and sucrose media, respectively, and the acarbose biosynthetic pathway in SE50/110 was expounded completely. Based on model predictions, the addition of arginine and histidine to the media increased acarbose production by 78% and 59%, respectively. Additionally, dissolved oxygen has a great effect on acarbose production based on model predictions. Furthermore, genes to be overexpressed for the overproduction of acarbose were identified, and the deletion of treY eliminated the formation of by-product component C. Model iYLW1028 is a useful platform for optimizing and systems metabolic engineering for acarbose production in Actinoplanes sp. SE50/110.
International Nuclear Information System (INIS)
Tse, Y Y; Jones, I P; Chakalov, R I; Muirhead, C M; Palai, R; Huhtinen, H
2008-01-01
La 0.7 Ca 0.3 MnO 3 (LCMO) films grown on (110) surfaces of various (pseudo-) cubic substrates, SrTiO 3 (STO), LaAlO 3 (LAO) and La 0.3 Sr 0.7 Al 0.5 Ta 0.35 O 3 (LSAT), were studied by means of transmission electron microscopy (TEM). (110) LSAT substrate and LCMO film have the smallest lattice mismatch. (110) LAO substrate induces compressive strain while (110) STO induces tensile strain in the LCMO film. In all cases, the (010) 0 plane (long axis) of LCMO is parallel to the substrate surface. In the case of LSAT, the [001] 0 is parallel to [011] LSAT while the films on the other 2 substrates have [100] 0 // to the [011] substrates. Films grown on STO and LAO show an easy magnetisation when the applied magnetic field is in plane along the long-axis of the LCMO. In the case of LSAT, there is no in-plane anisotropy. The films on STO and LAO have twins as the dominant defects. The film on LSAT has less twining. High resolution TEM shows that LCMO on (110) LSAT (the least lattice mismatch) possesses a perfect interface with no misfit dislocations in the area of examination. The LCMO films on (110) LAO and (110) STO have nearly perfect interfaces with atomic sharpness but with misfit dislocations. The different in-plane crystal directions and strain distributions in the films may account for the different magnetisation behaviours of the LCMO films on the different (011) substrates.
Directory of Open Access Journals (Sweden)
Jianbo Sun
2016-03-01
Full Text Available The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels.
Sun, Jianbo; Sun, Chong; Lin, Xueqiang; Cheng, Xiangkun; Liu, Huifeng
2016-01-01
The novel Cr-containing low alloy steels have exhibited good corrosion resistance in CO2 environment, mainly owing to the formation of Cr-enriched corrosion film. In order to evaluate whether it is applicable to the CO2 and H2S coexistence conditions, the corrosion behavior of low-chromium steels in CO2-H2S environment with high pressure and high temperature was investigated using weight loss measurement and surface characterization. The results showed that P110 steel suffered localized corrosion and both 3Cr-P110 and 5Cr-P110 steels exhibited general corrosion. However, the corrosion rate of 5Cr-P110 was the highest among them. The corrosion process of the steels was simultaneously governed by CO2 and H2S. The outer scales on the three steels mainly consisted of FeS1−x crystals, whereas the inner scales on Cr-containing steels comprised of amorphous FeS1−x, Cr(OH)3 and FeCO3, in contrast with the amorphous FeS1−x and FeCO3 mixture film of P110 steel. The more chromium the steel contains, the more chromium compounds the corrosion products contain. The addition of chromium in steels increases the uniformity of the Cr-enriched corrosion scales, eliminates the localized corrosion, but cannot decrease the general corrosion rates. The formation of FeS1−x may interfere with Cr-enriched corrosion scales and lowering the corrosion performance of 3Cr-P110 and 5Cr-P110 steels. PMID:28773328
Self-organized patterns along sidewalls of iron silicide nanowires on Si(110) and their origin
Energy Technology Data Exchange (ETDEWEB)
Das, Debolina; Mahato, J. C.; Bisi, Bhaskar; Dev, B. N., E-mail: msbnd@iacs.res.in [Department of Materials Science, Indian Association for the Cultivation of Science, Kolkata 700032 (India); Satpati, B. [Surface Physics and Material Science Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700064 (India)
2014-11-10
Iron silicide (cubic FeSi{sub 2}) nanowires have been grown on Si(110) by reactive deposition epitaxy and investigated by scanning tunneling microscopy and scanning/transmission electron microscopy. On an otherwise uniform nanowire, a semi-periodic pattern along the edges of FeSi{sub 2} nanowires has been discovered. The origin of such growth patterns has been traced to initial growth of silicide nanodots with a pyramidal Si base at the chevron-like atomic arrangement of a clean reconstructed Si(110) surface. The pyramidal base evolves into a comb-like structure along the edges of the nanowires. This causes the semi-periodic structure of the iron silicide nanowires along their edges.
Quantitative XRD analysis of {110} twin density in biotic aragonites.
Suzuki, Michio; Kim, Hyejin; Mukai, Hiroki; Nagasawa, Hiromichi; Kogure, Toshihiro
2012-12-01
{110} Twin densities in biotic aragonite have been estimated quantitatively from the peak widths of specific reflections in powder X-ray diffraction (XRD) patterns, as well as direct confirmation of the twins using transmission electron microscopy (TEM). Influence of the twin density on the peak widths in the XRD pattern was simulated using DIFFaX program, regarding (110) twin as interstratification of two types of aragonite unit layers with mirrored relationship. The simulation suggested that the twin density can be estimated from the difference of the peak widths between 111 and 021, or between 221 and 211 reflections. Biotic aragonite in the crossed-lamellar microstructure (three species) and nacreous microstructure (four species) of molluscan shells, fish otoliths (two species), and a coral were investigated. The XRD analyses indicated that aragonite crystals in the crossed-lamellar microstructure of the three species contain high density of the twins, which is consistent with the TEM examination. On the other hand, aragonite in the nacre of the four species showed almost no difference of the peak widths between the paired reflections, indicating low twin densities. The results for the fish otoliths were varied between the species. Such variation of the twin density in biotic aragonites may reflect different schemes of crystal growth in biomineralization. Copyright © 2012 Elsevier Inc. All rights reserved.
Energies controlling nucleation and growth processes: The case of Ag/W(110)
DEFF Research Database (Denmark)
Jones, G. W.; Marcano, J. M.; Nørskov, Jens Kehlet
1990-01-01
The nucleation density Nx(T) of Ag islands on the 2-monolayer-thick silver intermediate layer on W(110) is measured by UHV scanning electron microscopy and compared with kinetic nucleation equations. This yields a well-determined value of Ed+2Eb=0.65±0.03 eV, with pair-binding energy Eb=0...
Dunbar, W E; Schilt, A A
1972-09-01
Seven new hydroxy-substituted 1,10-phenanthroline derivatives have been evaluated as chromogenic reagents for the determination of copper in strongly alkaline solution. The most sensitive of these, 2,9-dimethyl-4,7-dihydroxy-1,10-phenanthroline, has proven to be highly effective in a simple, rapid procedure for determining trace amounts of copper in sodium hydroxide, potassium carbonate, sodium phosphate or ammonium hydroxide.
Directory of Open Access Journals (Sweden)
Narayana Goruntla
2018-01-01
Full Text Available Introduction: Medication nonadherence in elderly patients could result in a waste of medical expenses in a long-time span as well as deterioration of the patient's medical condition. Aim: The aim of this study is to evaluate the impact of one-dose package dispensing with patient counseling on medication adherence among elderly patients suffering from chronic disorders. Settings and Design: This is prospective, open-labeled, randomized trial carried out at dispensing pharmacy of the secondary care referral hospital, located in resource-limited settings of Anantapur District, Andhra Pradesh, India. Subjects and Methods: A total of 330 (aged ≥60 years patients were randomly assigned to one of three study groups: Group A (n = 110, no change in dosing and packing; Group B (n = 110, one-dose package dispensing; Group C (n = 110, One-dose package dispensing with patient counseling. Medication adherence levels were measured using a pill count and visual analog scale (VAS method at baseline and follow-up (after 1 month. Statistical Analysis: Descriptive statistics were used to represent the sociodemographic, clinical, and medication adherence profile of study participants. One-way ANOVA test is used to assess significant differences between three groups with a P 60 years who are on multiple medications can benefit from one-dose package dispensing and appropriate counseling. This will improve medication adherence hence better outcomes.
Promotion effect of monovalent metals (K and Cs) on the GaAs (110) surface oxidation
International Nuclear Information System (INIS)
Valeri, S.; Sberveglieri, P.; Angeli, E.
1987-01-01
The effect of thin (∼ 1 monolayer) overlayers of low electronegativity metals (Cs and K) on the RT oxidation behaviour of GaAs(110) cleavage surface is studied. This study was with Auger and Photoemission spectroscopies. Attention has been focused on the core-valence-valence and Auger lineshapes on the Ga and As 3d peaks. Presence of the alkali metal enhances the GaAs (110) oxidation rate several orders of magnitude above the clean surface value has been found. The range 0-100 Langmuir is investigated in detail. The oxidation process of the GaAs(110) surface in the presence of both K and Cs overlayer follows a multi-step kinetic and reaches a saturation at exposure lower than 100 Langmuir. Both Ga and As atoms are involved in the oxygen bonding. The metal enhanced semiconductor oxidation is generally reported to be a process involving predominantly the semiconductor surface atoms. However in the Cs - and K - GaAs case, an involvement of the alkali metal atoms too, reflected in the shape modification of their Auger line has been found. The promotion effect of K and Cs is discussed in terms of their low electronegativity and in comparison with the results recently reported in the literature for the other low electronegativity metals
Valence band variation in Si (110) nanowire induced by a covered insulator
International Nuclear Information System (INIS)
Hong-Hua, Xu; Xiao-Yan, Liu; Yu-Hui, He; Gang, Du; Ru-Qi, Han; Jin-Feng, Kang; Chun, Fan; Ai-Dong, Sun
2010-01-01
In this work, we investigate strain effects induced by the deposition of gate dielectrics on the valence band structures in Si (110) nanowire via the simulation of strain distribution and the calculation of a generalized 6×6k·p strained valence band. The nanowire is surrounded by the gate dielectric. Our simulation indicates that the strain of the amorphous SiO 2 insulator is negligible without considering temperature factors. On the other hand, the thermal residual strain in a nanowire with amorphous SiO 2 insulator which has negligible lattice misfit strain pushes the valence subbands upwards by chemical vapour deposition and downwards by thermal oxidation treatment. In contrast with the strain of the amorphous SiO 2 insulator, the strain of the HfO 2 gate insulator in Si (110) nanowire pushes the valence subbands upwards remarkably. The thermal residual strain by HfO 2 insulator contributes to the up-shifting tendency. Our simulation results for valence band shifting and warping in Si nanowires can provide useful guidance for further nanowire device design. (classical areas of phenomenology)
International Nuclear Information System (INIS)
Zhang, Yong-Chao; Pan, Lun; Lu, Jinhui; Song, Jiajia; Li, Zheng; Zhang, Xiangwen; Wang, Li; Zou, Ji-Jun
2017-01-01
Highlights: • The mechanism of ethylene hydrogenation on perfect and oxygen defective Co_3O_4(110) is investigated by using DFT + U. • Oxygen vacancy promotes ethylene hydrogenation thermodynamically and kinetically. • The Co3O4 (110) facet is more active than the (111) one for ethylene hydrogenation. - Abstract: Crystal facet engineering and defect engineering are both critical strategies to improve the catalytic hydrogenation performance of catalyst. Herein, ethylene hydrogenation on the perfect and oxygen defective Co_3O_4(110) surfaces has been studied by using periodic density functional theory calculations. The results are compared with that on Co_3O_4(111) surface to clarify the problem of which facet for Co_3O_4 is more reactive, and to illuminate the role of oxygen vacancy. The low oxygen vacancy formation energy suggests that Co_3O_4(110) surface with defective site is easily formed. The whole mechanism of H_2 dissociation and stepwise hydrogenation of ethylene to ethane is examined, and the most favorable pathway is heterolytic dissociation of H_2 follows two stepwise hydrogenation of ethylene process. The results show that ethyl hydrogenation to ethane on perfect Co_3O_4(110) surface is the rate limiting step with an activation energy of 1.19 eV, and the presence of oxygen vacancy strongly reduces the activation energies of main elementary steps, and the activation energy of rate limiting step is only 0.47 eV. Compared with that on Co_3O_4(111), ethylene hydrogenation is preferred on Co_3O_4(110) surface. Therefore, Co_3O_4 with exposed (110) facet is predicted as an excellent catalyst for ethylene hydrogenation.
Directory of Open Access Journals (Sweden)
Wen-ping LV
2013-01-01
Full Text Available Objective To investigate the clinical predictors and prognosis of the patients with advanced stage small hepatocellular carcinoma (SHCC after hepatectomy. Methods A total of 110 patients with SHCC admitted to the General Hospital of PLA and undergone hepatectomy from Jan. 1995 to Dec. 2009 were included in present retrospective study. Survival analysis was performed by Log-rank test and Kaplan-Meier. The association of SHCC and nine routine clinical parameters was analyzed by the univariate and multivariate logistic regression analysis. Results Of the 110 patients with SHCC, 31 (28.2% were SHCC in advanced stage, and the 1, 3, 5 year survival rates were 78.6%, 61.6% and 38.5%, respectively, with a median survival time of 48.8 months (95% CI 29.2-68.4 months. Seventy-nine of the 110 patients (71.8% were suffering form early stage SHCC, and the 1, 3, 5 year survival rates were 98.7%, 83.8% and 74.8%, respectively, with a median survival time of 98.0 months (95%CI 73.8-122.2 months. The survival rate was obviously higher in the patients with early stage SHCC than in those with advanced stage SHCC (χ2=13.29, P=0.0003. Multivariate analysis showed that positive AFP was a potential significant predictor of SHCC in advanced stage (RR=14.45; 95%CI 4.05-51.64, P<0.001. Conclusion The SHCC in advanced stage signifies an ominous prognosis. Positive AFP is a potential significant predictor for advanced stage SHCC.
Catalytic hydrolysis of COS over CeO_2 (110) surface: A density functional theory study
International Nuclear Information System (INIS)
Song, Xin; Ning, Ping; Wang, Chi; Li, Kai; Tang, Lihong; Sun, Xin
2017-01-01
Graphical abstract: CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. H_2O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H_2O is easier adsorbed on the CeO_2 (110) surface than COS. • When COS and H_2O jointly adsorb on the CeO_2 (110) surface, the H_2O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO_2 (110) surface using Dmol"3 model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO_2 and H_2S was evaluated. The absolute values of adsorption energy of H_2O-CeO_2 are higher than that of COS-CeO_2. Meanwhile, the adsorption energy and geometries show that H_2O is easier adsorbed on the surface of CeO_2 (110) than COS. H_2O plays a role as a bridge in the process of joint adsorption. H_2O forms more Ce−O−H groups on the CeO_2 (110) surface. CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H_2O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO_2 can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe_2O_3 and CeO_2 for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H_2O to S in COS over CeO_2 decreases the energy barriers of hydrolysis reaction, and enhances the reaction activity of COS hydrolysis.
36 CFR 1212.110 - Are any of my Federal assistance awards exempt from this part?
2010-07-01
... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 1212.110 Are any of my Federal assistance awards...
International Nuclear Information System (INIS)
Song Fei; Mao Hongying; Guan Dandan; Dou Weidong; Zhang Hanjie; Li Haiyang; He Pimo; Bao Shining; Hofmann, Philip
2009-01-01
The interface electronic properties of fluorene-1-carboxylic acid (FC-1) adsorbed on Cu(110) have been studied by ultraviolet photoemission spectroscopy (UPS) and first-principles calculations. Both the molecular orbitals and the Cu valence band are significantly modified upon adsorption. FC-1 is chemically bonded to Cu(110) through charge donation and back donation involving the lowest unoccupied molecular orbital (LUMO) and the highest occupied molecular orbital (HOMO) of the molecule. An observed reduction of the work function can be attributed to the adsorption induced charge redistribution, and the positive interface dipole.
International Nuclear Information System (INIS)
Smirnov, A.; Markov, D.; Smirnov, V.; Polenok, V.; Ivashchenko, A.; Strozhuk, A.
2006-01-01
The paper presents the main examination results on the condition of fuel rods claddings, guide tubes and spacer grids of the WWER FA made of E110 and E635 alloys operated under standard operating conditions. The paper is based on the data obtained during the examination of 28 WWER-1000 FA and 12 WWER-400 FA. E110 alloy is shown to be suitable material for the WWER fuel rod claddings under the normal operating conditions. E635 alloy is attractive to manufacturing of the skeleton components. The currently used combination (E110 as a material of fuel rods claddings and E635 - as a material of the skeleton components) is the optimal solution for the WWER fuel assembly because the advantages of the both alloys are used. (authors)
Credendino, Raffaele
2012-11-01
In this work, we present a systematic DFT analysis of the effect of surface coverage on the coordination properties of alkoxysilanes to the (104) and (110) surfaces of MgCl 2. Furthermore, we investigated several possible migration pathways for alkoxysilane migration on the same surfaces. Our study clearly shows that complete coverage of the Mg vacancies on the surface by coordinating alkoxysilanes is hampered by steric repulsion between vicinally coordinated donor molecules. Our study clearly indicates that alkoxysilane migration between different MgCl 2 monolayers on the (104) and (110) surfaces requires donor dissociation. The same holds for alkoxysilane migration on a single (110) MgCl 2 monolayer. However, in the case of the (104) surface we found a very low energy pathway for alkoxysilane migration along the same monolayer. © 2012 American Chemical Society.
Credendino, Raffaele; Pater, Jochem T M; Liguori, Dario; Morini, Giampiero; Cavallo, Luigi
2012-01-01
In this work, we present a systematic DFT analysis of the effect of surface coverage on the coordination properties of alkoxysilanes to the (104) and (110) surfaces of MgCl 2. Furthermore, we investigated several possible migration pathways for alkoxysilane migration on the same surfaces. Our study clearly shows that complete coverage of the Mg vacancies on the surface by coordinating alkoxysilanes is hampered by steric repulsion between vicinally coordinated donor molecules. Our study clearly indicates that alkoxysilane migration between different MgCl 2 monolayers on the (104) and (110) surfaces requires donor dissociation. The same holds for alkoxysilane migration on a single (110) MgCl 2 monolayer. However, in the case of the (104) surface we found a very low energy pathway for alkoxysilane migration along the same monolayer. © 2012 American Chemical Society.
Triaqua(1,10-phenanthroline-2,9-dicarboxylatocobalt(II dihydrate
Directory of Open Access Journals (Sweden)
Zi-Fa Shi
2010-04-01
Full Text Available The title compound, [Co(C14H6N2O4(H2O3]·2H2O, has twofold crystallographic symmetry. The CoII atom is in a distorted pentagonal-bipyramidal coordination environment with two N atoms and two O atoms from a tetradentate 1,10-phenanthroline-2,9-dicarboxylate ligand and one O atom from a water molecule forming the pentagonal plane, and two O atoms from two water molecules occupying axial positions. In the crystal, adjacent molecules are linked by O—H...O hydrogen bonds, forming a three-dimensional network.
Transport characteristics of a silicene nanoribbon on Ag(110
Directory of Open Access Journals (Sweden)
Ryoichi Hiraoka
2017-08-01
Full Text Available We present the transport characteristics of individual silicene nanoribbons (SiNRs grown on Ag(110. By lifting up a single SiNR with a low-temperature scanning tunneling microscope tip, a nanojunction consisting of tip, SiNR and Ag is fabricated. In the differential conductance spectra of the nanojunctions fabricated by this methodology, a peak appears at the Fermi level which is not observed in the spectra measured either for the SiNRs before being lifted up or the clean Ag substrate. We discuss the origin of the peak as it relates to the SiNR.
Energy Technology Data Exchange (ETDEWEB)
Sturdza, Alina; Kirisits, Christian; Poetter, Richard [Medical University of Vienna, Department of Radiation Oncology, Comprehensive Cancer CenterVienna, Vienna (Austria); Hofmann, Sandra; Kranawetter, Marlene; Grimm, Christoph; Schwameis, Richard [Medical University Vienna, Department of general Gynecology and Gynecologic Oncology, Comprehensive Cancer Center Vienna, Vienna (Austria); Polterauer, Stephan; Reinthaller, Alexander [Medical University Vienna, Department of general Gynecology and Gynecologic Oncology, Comprehensive Cancer Center Vienna, Vienna (Austria); Karl Landsteiner Institute for General Gynecology and Experimental Gynecologic Oncology, Vienna (Austria); Krainer, Michael [Medical University Vienna, Clinical Division of Oncology, Department of Medicine 1, Comprehensive Cancer Center, Vienna (Austria)
2017-12-15
Patients with recurrent cervical cancer (RecCC) who received definitive radiochemotherapy including image-guided adaptive brachytherapy (IGABT) as primary treatment are currently treated in our institution with palliative intent by chemotherapy (CHT) combined with bevacizumab (BEV). We aim to evaluate the risk of gastrointestinal (GI)/genitourinary (GU) fistula formation in these patients. Data of 35 consecutive patients with RecCC treated initially with radiochemotherapy and IGABT were collected. Known and presumed risk factors associated with fistula formation were evaluated. Fistula rate was compared between patients receiving CHT or CHT+BEV. Of the 35 patients, 25 received CHT and 10 patients received CHT+BEV. Clinical characteristics were comparable. Fistulae were reported in 6 patients: two fistulae (8%) in the CHT group, four (40%) in the CHT+BEV group. GU fistula occurred in the CHT+BEV group only (3/4). Of these 6 patients with fistulae, 5 (83%) had undergone previous invasive procedures after the diagnosis of RecCC and 1 patient had undergone pelvic re-irradiation; 3/6 patients had developed a local recurrence. No other risk factors for fistula formation were identified. In patients with RecCC after definitive radiochemotherapy including IGABT, the addition of BEV to CHT may increase the risk for GU fistula formation, particularly after invasive pelvic procedures. Future clinical studies are required to identify predictors for fistula formation to subsequently improve patient selection for the addition of BEV in the RecCC setting. (orig.) [German] Patientinnen mit Rezidiv eines Zervixkarzinoms (RecCC), die primaer eine bildgesteuerte adaptive Brachytherapie (IGABT) und kombinierte Radiochemotherapie (RCHT) erhalten hatten, werden derzeit in unserem Institut mit einer Kombination aus Chemotherapie (CHT) und Bevacizumab (BEV) behandelt. Ziel dieser Studie war es, das Risiko fuer das Auftreten gastrointestinaler (GI) sowie urogenitaler (GU) Fisteln unter CHT
30 CFR 250.110 - What must I include in my welding plan?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What must I include in my welding plan? 250.110... must I include in my welding plan? You must include all of the following in the Welding Plan that you... qualified personnel weld; (c) Practices and procedures for safe welding that address: (1) Welding in...
Oxygen adsorption on Pt(110)-(1x2): new high-coverage structures
DEFF Research Database (Denmark)
Helveg, Stig; Lorensen, Henrik Qvist; Horch, Sebastian
1999-01-01
From an interplay between scanning tunneling microscopy (STM) experiments and density functional theory (DFT) calculations, a comprehensive picture is obtained for oxygen adsorption on the Pt(110)-(1 x 2) surface, from single isolated oxygen atoms chemisorbed in FCC sites along the platinum ridges...... adsorption and platinum lattice distortions. (C) 1999 Elsevier Science B.V. All rights reserved....
A brief review of intruder rotational bands and magnetic rotation in the A = 110 mass region
Banerjee, P.
2018-05-01
Nuclei in the A ∼ 110 mass region exhibit interesting structural features. One of these relates to the process by which specific configurations, built on the excitation of one or more protons across the Z = 50 shell-gap, manifest as collective rotational bands at intermediate spins and gradually lose their collectivity with increase in spin and terminate in a non-collective state at the maximum spin which the configuration can support. These bands are called terminating bands that co-exist with spherical states. Some of these bands are said to terminate smoothly underlining the continuous character of the process by which the band evolves from significant collectivity at low spin to a pure particle-hole non-collective state at the highest spin. The neutron-deficient A ∼ 110 mass region provides the best examples of smoothly terminating bands. The present experimental and theoretical status of such bands in several nuclei with 48 ≤ Z ≤ 52 spanning the 106 ≤ A ≤ 119 mass region have been reviewed in this article. The other noteworthy feature of nuclei in the A ∼ 110 mass region is the observation of regular rotation-like sequences of strongly enhanced magnetic dipole transitions in near-spherical nuclei. These bands, unlike the well-studied rotational sequences in deformed nuclei, arise from a spontaneous symmetry breaking by the anisotropic currents of a few high-j excited particles and holes. This mode of excitation is called magnetic rotation and was first reported in the Pb region. Evidence in favor of the existence of such structures, also called shears bands, are reported in the literature for a large number of Cd, In, Sn and Sb isotope with A ∼ 110. The present article provides a general overview of these reported structures across this mass region. The review also discusses antimagnetic rotation bands and a few cases of octupole correlations in the A = 110 mass region.
PS1-10bzj: A FAST, HYDROGEN-POOR SUPERLUMINOUS SUPERNOVA IN A METAL-POOR HOST GALAXY
Energy Technology Data Exchange (ETDEWEB)
Lunnan, R.; Chornock, R.; Berger, E.; Milisavljevic, D.; Drout, M.; Sanders, N. E.; Challis, P. M.; Czekala, I.; Foley, R. J.; Fong, W.; Kirshner, R. P.; Leibler, C.; Marion, G. H.; Narayan, G. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Huber, M. E. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); McCrum, M.; Smartt, S. J. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Rest, A. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Roth, K. C. [Gemini Observatory, 670 N. Aohoku Place, Hilo, HI 96720 (United States); Scolnic, D., E-mail: rlunnan@cfa.harvard.edu [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); and others
2013-07-10
We present observations and analysis of PS1-10bzj, a superluminous supernova (SLSN) discovered in the Pan-STARRS Medium Deep Survey at a redshift z = 0.650. Spectroscopically, PS1-10bzj is similar to the hydrogen-poor SLSNe 2005ap and SCP 06F6, though with a steeper rise and lower peak luminosity (M{sub bol} {approx_equal} -21.4 mag) than previous events. We construct a bolometric light curve, and show that while PS1-10bzj's energetics were less extreme than previous events, its luminosity still cannot be explained by radioactive nickel decay alone. We explore both a magnetar spin-down and circumstellar interaction scenario and find that either can fit the data. PS1-10bzj is located in the Extended Chandra Deep Field South and the host galaxy is imaged in a number of surveys, including with the Hubble Space Telescope. The host is a compact dwarf galaxy (M{sub B} Almost-Equal-To -18 mag, diameter {approx}< 800 pc), with a low stellar mass (M{sub *} Almost-Equal-To 2.4 Multiplication-Sign 10{sup 7} M{sub Sun }), young stellar population ({tau}{sub *} Almost-Equal-To 5 Myr), and a star formation rate of {approx}2-3 M{sub Sun} yr{sup -1}. The specific star formation rate is the highest seen in an SLSN host so far ({approx}100 Gyr{sup -1}). We detect the [O III] {lambda}4363 line, and find a low metallicity: 12 + (O/H) = 7.8 {+-} 0.2 ({approx_equal} 0.1 Z{sub Sun }). Together, this indicates that at least some of the progenitors of SLSNe come from young, low-metallicity populations.
40 CFR 1065.110 - Work inputs and outputs, accessory work, and operator demand.
2010-07-01
... engine to operate a fuel system, and as another example you may supply compressor work to the engine to... AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Equipment Specifications § 1065.110... resistor load bank to simulate electrical loads. (3) Pump, compressor, and turbine work. Use pumps...
Bonding of gold nanoclusters to oxygen vacancies on rutile TiO2(110)
DEFF Research Database (Denmark)
Lopez, Nuria; schaub, R.; Thostrup, P.
2003-01-01
Through an interplay between scanning tunneling microscopy (STM) and density functional theory (DFT) calculations, we show that bridging oxygen vacancies are the active nucleation sites for Au clusters on the rutile TiO2(110) surface. We find that a direct correlation exists between a decrease in...
11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...
Semiconductor-based, large-area, flexible, electronic devices on {110} oriented substrates
Goyal, Amit
2014-08-05
Novel articles and methods to fabricate the same resulting in flexible, oriented, semiconductor-based, electronic devices on {110} textured substrates are disclosed. Potential applications of resulting articles are in areas of photovoltaic devices, flat-panel displays, thermophotovoltaic devices, ferroelectric devices, light emitting diode devices, computer hard disc drive devices, magnetoresistance based devices, photoluminescence based devices, non-volatile memory devices, dielectric devices, thermoelectric devices and quantum dot laser devices.
[100] or [110] aligned, semiconductor-based, large-area, flexible, electronic devices
Goyal, Amit
2015-03-24
Novel articles and methods to fabricate the same resulting in flexible, large-area, [100] or [110] textured, semiconductor-based, electronic devices are disclosed. Potential applications of resulting articles are in areas of photovoltaic devices, flat-panel displays, thermophotovoltaic devices, ferroelectric devices, light emitting diode devices, computer hard disc drive devices, magnetoresistance based devices, photoluminescence based devices, non-volatile memory devices, dielectric devices, thermoelectric devices and quantum dot laser devices.
Study on the GaAs(110) surface using emitted atom spectrometry
International Nuclear Information System (INIS)
Gayone, J.E.; Sanchez, E.A.; Grizzi, O.; Universidad Nacional de Cuyo, Mendoza
1998-01-01
The facilities implemented at Bariloche for the ion scattering spectrometry is described, and recent examples of the technique application to determine the atomic structure and the composition of metallic and semiconductor surfaces, pure and with different adsorbates. The surface analysis technique using emitted atom spectrometry is discussed. The sensitivity to the GaAs(110) surface atomic relaxation is presented, and the kinetic of hydrogen adsorption by the mentioned surface is studied