WorldWideScience

Sample records for demensudredning 110 konsekutive patienter

  1. Choledocholitiasis. Endoskopisk behandling af 416 konsekutive patienter

    DEFF Research Database (Denmark)

    Pedersen, F M; Brandt, C J; Schaffalitzky de Muckadell, O B

    1998-01-01

    patients who underwent ERC for common bile duct stones between January 1990 and January 1995. The overall success rate of achieving a common bile duct free of stones was 89.0%, and in 94.7% of the patients endoscopic treatment was definitive. The overall complication rate was 9.6% and the 30-day mortality...

  2. Laparoskopi af 100 konsekutive patienter med 128 ikkepalpable testes

    DEFF Research Database (Denmark)

    Cortes, D; Thorup, J M; Lenz, K

    1996-01-01

    . No intratubular germ cell neoplasia (carcinoma in situ) was proved. Germ cell hypoplasia or aplasia was demonstrated in 95% of cases with testicular parenchyma. We recommend laparoscopy as a safe procedure which leads to a diagnosis in patients with impalpable testes; the advent of laparoscopic procedure makes...... definitive treatment possible in about 50% of such cases....

  3. CT examination after intrathecal or intraventricular application of metrizamide in 110 patients for neurosurgery

    International Nuclear Information System (INIS)

    Krakow, D.

    1983-01-01

    The CT scans were done in 110 patients for examination of the liquor carrying cerebral brain compartments, especially the cisterns, after intrathecal application of the radiopaque medium metrizamide. The properties of the medium are explained in detail. (orig./MG) [de

  4. Treatment of pituitary adenomas by fractionated stereotactic radiotherapy: A prospective study of 110 patients

    International Nuclear Information System (INIS)

    Colin, Philippe; Jovenin, Nicolas; Delemer, Brigitte; Caron, Jean; Grulet, Herve; Hecart, Annie-Claude; Lukas, Celine; Bazin, Arnaud; Bernard, Mary-Helene; Scherpereel, Bernard; Peruzzi, Philippe; Nakib, Iab; Redon, Charles; Rousseaux, Pascal

    2005-01-01

    Purpose: To optimize and reduce the toxicity of pituitary adenoma irradiation by assessing the feasibility and effectiveness of fractionated stereotactic radiotherapy (FSR). Methods and Materials: Between 1990 and 1999, 110 consecutive patients, 47 with a functioning adenoma, were treated according to a strategy of either early surgery and FSR (n = 89) or FSR only (n = 21). Of the 110 patients, 75 had persistent macroscopic tumor and 47 persistent hormonal secretions; 15 were treated in the prophylactic setting. The linear accelerator-delivered dose was 50.4 Gy (5 x 1.8 Gy weekly), with a 2-mm safety margin. Results: After a minimal follow-up of 48 months, only 1 patient had developed progression. Of the 110 patients, 27 (36%) had a complete tumor response, 67 (89.3%) had an objective tumor response, 20 (42%) had a hormonal complete response, and 47 (100%) had a hormonal objective tumor response. The proportion of patients without a complete tumor response, objective tumor response, complete hormonal response, and objective hormonal response was 85.1%, 62%, 83%, and 59.3% at 4 years and 49.3%, 9%, 59.3%, and 10.6% at 8 years, respectively. The sole unfavorable predictive factor was preoperative SSE >20 mm for tumor response (p = 0.01) and growth hormone adenoma for the hormonal response (p <0.001). No late complications, except for pituitary deficiency, were reported, with a probability of requiring hormonal replacement of 28.5% and 35% at 4 and 8 years, respectively. Nonfunctioning status was the sole unfavorable factor (p = 0.0016). Conclusions: Surgery plus FSR is safe and effective. FSR focused to the target volume seems more suitable than standard radiotherapy, and standard fractionation reduces the risk of optic neuropathy sometimes observed after single-dose radiosurgery. Therefore, FSR allows us to consider combined transrhinoseptal surgery and early radiotherapy, with a curative goal without patient selection

  5. Takayasu arteritis: clinical features in 110 Mexican Mestizo patients and cardiovascular impact on survival and prognosis.

    Science.gov (United States)

    Soto, M E; Espinola, N; Flores-Suarez, L F; Reyes, P A

    2008-01-01

    Takayasu Arteritis (TA) is a rare disease that mainly affects large elastic arteries. It is more frequently seen in Asia, the Mediterranean basin, South Africa and Latin America. We have characterized its clinical manifestations and identified the cardiovascular mortality predictors in a cohort of 110 Mexican Mestizo patients. Retrospective review of 110 charts of TA patients complying with the American College of Rheumatology (ACR) criteria, seen in a single hospital between 1976 and 2003. Demographic, clinical, and radiological characteristics were described. With the use of actuarial table analysis at 2, 5, and 10 years, and Kaplan Meier methods applying t function for probability, plus Cox regression analysis, the following factors were identified as mortality predictors: systemic arterial hypertension, coronary heart disease and aortic valve regurgitation. Informed consent and approval from the institutional Internal Review Board (IRB) were obtained. We observed a slowly progressive widespread obstructive arterial disease with cardiovascular (48%), neuro-ophthalmic (36%), and skin morbidity (13%). Systemic hypertension and heart disease were significant mortality predictors. Twenty-six percent of cases died due to myocardial infarction, chronic renal failure, stroke, or surgical complications. TA in Mexican Mestizos shows a clinical pattern similar to the one recognized in the Far East. Management strategies must be directed at reducing the identified mortality risk factors.

  6. [Ischemic stroke. Prevalence of cardiovascular causes documented by an extensive cardiovascular workup in 110 patients].

    Science.gov (United States)

    Bendriss, L; Khatouri, A

    2012-08-01

    The ischemic cerebrovascular accidents (I CVA) correspond to a pathology widely dominated by atherosclerosis and embolic cardiopathies. Our work aimed to determine the frequency of the cardiovascular diseases among the patients who were previously victims of an I CVA and the interest of the cardiovascular assessment in the etiologic inquest. We led a retrospective study in the cardiology service of the Avicenne military hospital of Marrakech about 110 cases of I CVA between January 2005 and August 2008. The electrocardiogram (ECG), Holter ECG, transthoracic echocardiography and Doppler echography of the cervical vessels were systematically made for all the patients. The transesophageal echocardiography was practice in a few patients. The average age of the patients was 60.8 years old (±12.14) with a male predominance (72%). Ninety-one percent of the patients presented at least one cardiovascular risk factor: hypertension (66.45%), diabetes (41.8%), smoking (35.45%). Cardiovascular antecedents were noted among 18.2% of the patients, the continuous atrial fibrillation comes first (9%). A carotid atheromatous excess was noted in 74 cases of which 24 with a significant plaque. The transesophageal echocardiography made to 13 patients showed a spontaneous echo contrast with a left atrial thrombus in four cases and a left atrial myxoma in one patient. Penetrating artery disease occupies 39%, large artery atherosclerosis 28% and cardiogenic stroke 18%. The cardiovascular assessment is indispensable, and the echocardiography is more interesting in presence of cardiopathy. Its therapeutic repercussion is modest. Copyright © 2012. Published by Elsevier SAS.

  7. The PEP-3-KLH (CDX-110) vaccine in glioblastoma multiforme patients

    Science.gov (United States)

    Heimberger, Amy B.; Sampson, John H

    2009-01-01

    Conventional therapies for glioblastoma multiforme (GBM) fail to target tumor cells exclusively resulting in non-specific toxicity. Immune targeting of tumor-specific mutations may allow for more precise eradication of neoplastic cells. The epidermal growth factor receptor variant III (EGFRvIII) is a tumor-specific mutation that is widely expressed on GBM and other neoplasms and its expression enhances tumorigenicity. This in-frame deletion mutation splits a codon resulting in a novel glycine at the fusion junction producing a tumor-specific epitope target for cellular or humoral immunotherapy. We have previously shown that vaccination with a peptide that spans the EGFRvIII fusion junction (PEPvIII-KLH/CDX-110) is an efficacious immunotherapy in syngeneic murine models. In this review, we summarize our results in GBM patients targeting this mutation in multiple, multi-institutional Phase II immunotherapy trials. These trials demonstrated that a selected population of GBM patients who received the vaccines targeting EGFRvIII had an unexpectedly long survival time. Further therapeutic strategies and potential pitfalls using this approach are discussed. PMID:19591631

  8. Molecular and clinical study of a cohort of 110 Algerian patients with autosomal recessive ataxia.

    Science.gov (United States)

    Hamza, Wahiba; Ali Pacha, Lamia; Hamadouche, Tarik; Muller, Jean; Drouot, Nathalie; Ferrat, Farida; Makri, Samira; Chaouch, Malika; Tazir, Meriem; Koenig, Michel; Benhassine, Traki

    2015-06-12

    Autosomal recessive cerebellar ataxias (ARCA) are a complex group of neurodegenerative disorders with great genetic and phenotypic heterogeneity, over 30 genes/loci have been associated with more than 20 different clinical forms of ARCA. Genetic heterogeneity combined with highly variable clinical expression of the cerebellar symptoms and overlapping features complicate furthermore the etiological diagnosis of ARCA. The determination of the most frequent mutations and corresponding ataxias, as well as particular features specific to a population, are mandatory to facilitate and speed up the diagnosis process, especially when an appropriate treatment is available. We explored 166 patients (115 families) refered to the neurology units of Algiers central hospitals (Algeria) with a cerebellar ataxia phenotype segregating as an autosomal recessive pattern of inheritance. Genomic DNA was extracted from peripheral blood samples and mutational screening was performed by PCR and direct sequencing or by targeted genomic capture and massive parallel sequencing of 57 genes associated with inherited cerebellar ataxia phenotypes. In this work we report the clinical and molecular results obtained on a large cohort of Algerian patients (110 patients/76 families) with genetically determined autosomal recessive ataxia, representing 9 different types of ARCA and 23 different mutations, including 6 novel ones. The five most common ARCA in this cohort were Friedreich ataxia, ataxia with isolated vitamin E deficiency, ataxia with oculomotor apraxia type 2, autosomal recessive spastic ataxia of Charlevoix-Saguenay and ataxia with oculomotor apraxia type 1. We report here a large cohort of patients with genetically determined autosomal recessive ataxia and the first study of the genetic context of ARCA in Algeria. This study showed that in Algerian patients, the two most common types of ataxia (Friedreich ataxia and ataxia with isolated vitamin E deficiency) coexist with forms that may be

  9. 10 CFR 110.110 - Default.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Default. 110.110 Section 110.110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Hearings § 110.110 Default. When a participant fails to act within a specified time, the presiding officer may consider him in default, issue an...

  10. Screening of 110 cirrhotic patients for hepatitis B and C at Saidu Teaching Hospital, Saidu Sharif, Swat

    International Nuclear Information System (INIS)

    Khan, P.; Ahmad, A.; Ahmad, B.; Khan, T.M.

    2009-01-01

    Cirrhosis liver is amongst the commonest clinical conditions in Pakistan. Besides other causes, it is mostly related to previous viral infection, in this part of the world. The main objective of this study was to find the frequency of HBsAg and anti HCV in cirrhotic patients of Swat district. This Prospective Study was conducted in the Medical unit of Saidu Teaching Hospital, Saidu Sharif from January 2006 to December 2006. One hundred and ten Cirrhotic Patients, 62 Male and 48 Female aged from 14 to 75 years were included in this study. Sera were tested by third generation Elisa method. Fifty-nine out of 110 (53.6%) patients were positive for anti HCV antibodies. Twenty-four (21.81%) Patients were positive for HBsAg. Eleven (10%) patients were positive for both HBsAg and anti HCV anti bodies. Sixteen (14.54%) were negative for both sero maker of hepatitis B and C. It is evident from this study that Hepatitis C, is a leading cause of cirrhosis in District Swat followed by HBV. Both the viruses account for at least three fourths of the total Cirrhotic. (Author)

  11. Percutaneous Treatment of Common Bile Duct Stones: Results and Complications in 110 Consecutive Patients

    NARCIS (Netherlands)

    Kint, Johan F.; van den Bergh, Janneke E.; van Gelder, Rogier E.; Rauws, Erik A.; Gouma, Dirk J.; van Delden, Otto M.; Laméris, Johan S.

    2015-01-01

    Background/Aims: Choledocholithiasis is a common complication of cholecystolithiasis, occurring in 15-20% of patients who have gallbladder stones. Endoscopic retrograde cholangio-pancreatography is the standard treatment. When this is not possible or not feasible, percutaneous transhepatic stone

  12. Fusion of 110Pd with 110Pd

    International Nuclear Information System (INIS)

    Morawek, W.

    1991-07-01

    In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de

  13. A110

    Directory of Open Access Journals (Sweden)

    T. Malivanova

    2015-11-01

    Conclusions: This study found out the opposite effect of polymorphisms at −238 and −308 positions in TNF promoter on the outcome of BC patients. Carriers of low expressed allele −238(A have poor outcome because of low response to standard hormone therapy which presumably connected with the activation of Her2 pathway. The obtained results allow supposing that a special approach to the treatment of this group of BC patients should be used.

  14. Thyroid remnant ablation using 1,110 MBq of I-131 after total thyroidectomy. Regulatory considerations on release of patients after unsealed radioiodine therapy

    International Nuclear Information System (INIS)

    Kusakabe, Kiyoko; Yokoyama, Kunihiko; Ito, Koichi

    2012-01-01

    This study was undertaken to measure the radiation exposure level of caregivers following outpatient NaI (I-131) 1,110 MBq therapy for remnant thyroid ablation after total thyroidectomy in patients with differentiated thyroid cancer, and to evaluate the influence of activities of daily living on radiation exposure level, with the goal of proposing an optimum method of I-131 therapy. The study included 37 patients with differentiated thyroid cancer, who had undergone total thyroidectomy and received outpatient based remnant thyroid ablation using NaI (I-131) 1,110 MBq, who were satisfying the following requirements: patients who have no evidence of distant metastases, whose living environments were appropriate for outpatient I-131 (1,110 MBq) therapy, and patients who gave written informed consent. The dose rate at a distance of 1 m from the body surface of the patient at the moment of release was measured using survey meters of the GM type or ionization chamber type. The dose level for the caregiver was measured with a personal dosimeter in all cases. The dose rate at a distance of 1 m from the patient's body surface 1 h after I-131 administration was in the range of 29-115 μSv/h (mean 63.8 μSv/h). The 7-day cumulative effective dose of caregivers was 0.11±0.08 mSv, on an average, in 34 dosimeters. In 31 of 34 dosimeters, cumulative effective dose of caregivers was below 0.2 mSv. Dose levels exceeding 0.2 mSv were recorded in 3 cases (0.21, 0.35 and 0.43 mSv in one case each). These results suggest that the exposure level of family members (caregiver and others) was minimal and is lower than the radiation levels affecting human environments. Outpatient-based remnant thyroid ablation with I-131 (1,110 MBq) performed after total thyroidectomy in patients with differentiated thyroid cancer is safe if applied in accordance with the appropriate supervision and guidance by experts with certain qualifications. (author)

  15. Assessment of MRI abnormalities of the sacroiliac joints and their ability to predict axial spondyloarthritis: a retrospective pilot study on 110 patients

    International Nuclear Information System (INIS)

    Larbi, Ahmed; Viala, Pierre; Baron, Marie Pierre; Taourel, Patrice; Cyteval, Catherine; Molinari, Nicolas; Lukas, Cedric

    2014-01-01

    To assess sacroiliac joint (SIJ) modifications on MRI and their ability to predict axial spondyloarthritis (SpA) with the purpose of identifying parameters for future prospective studies. Retrospective study was carried out of 110 consecutive patients referred for SIJ MRI with coronal, axial short TI inversion recovery (STIR), and axial T1 sequences over 6 months. Factors associated with SpA, including MRI SIJ modifications (fat deposition, structural abnormalities on T1-weighted images, and bone marrow edema [BME] on STIR sequences) and age were explored using multivariate logistic regression. The reference diagnosis was made 1-1.5 years later based on clinical, radiological, and biological findings, according to Assessment of SpondyloArthritis International Society (ASAS) criteria. Twenty-eight patients were diagnosed with SpA (female/male: 19/9, age 41 ± 13 years). Abnormal findings were found in up to 21 % of patients without SpA (including 11 % with BME), versus 64 % of SpA patients (50 % with BME). A threshold age of 42.6 years was found to discriminate SpA patients (ROC AUC: 0.71, 95 % CI: 0.59-0.81). BME location in the sacral (OR: 7.07 [1.05, 47.6], p = 0.044) and both sacral and iliac areas (OR: 36.0 [5.61, 231], p = 0.0002), as well as age (OR: 0.95 [0.92, 0.98], p = 0.0019) were found to be independent predictors of SpA. 83.6 % of patients were effectively diagnosed using BME location and patient age in a classification and regression tree (CART) algorithm (sensitivity: 61 %, specificity: 91 %, PPV: 71 %, NPV: 87 %). The BME location combined with the patient's age (threshold 42.6 years) could help predict SpA. Further studies are required before these features can be used by radiologists to boost their confidence in reporting SIJ MRI. (orig.)

  16. Analysis of Two Different Arthroscopic Broström Repair Constructs for Treatment of Chronic Lateral Ankle Instability in 110 Patients: A Retrospective Cohort Study.

    Science.gov (United States)

    Cottom, James M; Baker, Joseph; Plemmons, Britton S

    Chronic lateral ankle instability is a common condition treated by most foot and ankle surgeons. Once conservative treatment has failed, patients often undergo surgical reconstruction, either anatomic or nonanatomic. The present retrospective cohort study compared the clinical outcomes of 2 different arthroscopic Broström procedures. A total of 110 patients (83 females [75.5%] and 27 males [24.5%]) were treated with 1 of the 2 lateral ankle stabilization techniques from October 1, 2014 to December 31, 2015. Of the 110 patients, 75 were included in the arthroscopic lateral ankle stabilization group with an additional suture anchor used proximally and 35 were included in the arthroscopic lateral ankle stabilization group using the knotless design. The age of the cohort was 46.05 ± 17.89 (range 12 to 83) years. The body mass index was 30.03 ± 7.42 (range 18.3 to 52.5) kg/m 2 . Of the 110 patients, 25 (22.7%) had undergone concomitant procedures during lateral ankle stabilization. Overall, postoperative complications occurred in 14 patients (12.7%). No statistically significant differences were found between the 2 groups regarding the complication rates, use of concomitant procedures, and the presence of diabetes and workers compensation claims. No statistically significant differences were found in the mean age, body mass index, or gender distribution between the 2 groups. The preoperative American Orthopaedic Foot and Ankle Society (AOFAS) Ankle-Hindfoot scores were 50.85 ± 13.56 (range 18 to 76) and 51.26 ± 13.32 (range 18 to 69) in groups 1 and 2, respectively. The postoperative AOFAS Ankle-Hindfoot scores were 88.19 ± 10.72 (range 54 to 100) and 84 ± 15.41 (range 16 to 100) in groups 1 and 2, respectively. No statistically significant difference was found between these 2 groups. The preoperative visual analog scale score was 7.45 ± 1.39 (range 3 to 10) and 6.97 ± 1.25 (range 5 to 10), which had improved to 1.12 ± 1.38 (range 0 to 5) and

  17. Assessment of MRI abnormalities of the sacroiliac joints and their ability to predict axial spondyloarthritis: a retrospective pilot study on 110 patients

    Energy Technology Data Exchange (ETDEWEB)

    Larbi, Ahmed; Viala, Pierre; Baron, Marie Pierre; Taourel, Patrice; Cyteval, Catherine [Hopital Lapeyronie, Medical Imaging Department, Montpellier Cedex 5 (France); Molinari, Nicolas [Hopital Lapeyronie, Medical Data Processing Department, Montpellier Cedex 5 (France); Lukas, Cedric [Hopital Lapeyronie, Rheumatology Department, Montpellier Cedex 5 (France)

    2014-03-15

    To assess sacroiliac joint (SIJ) modifications on MRI and their ability to predict axial spondyloarthritis (SpA) with the purpose of identifying parameters for future prospective studies. Retrospective study was carried out of 110 consecutive patients referred for SIJ MRI with coronal, axial short TI inversion recovery (STIR), and axial T1 sequences over 6 months. Factors associated with SpA, including MRI SIJ modifications (fat deposition, structural abnormalities on T1-weighted images, and bone marrow edema [BME] on STIR sequences) and age were explored using multivariate logistic regression. The reference diagnosis was made 1-1.5 years later based on clinical, radiological, and biological findings, according to Assessment of SpondyloArthritis International Society (ASAS) criteria. Twenty-eight patients were diagnosed with SpA (female/male: 19/9, age 41 ± 13 years). Abnormal findings were found in up to 21 % of patients without SpA (including 11 % with BME), versus 64 % of SpA patients (50 % with BME). A threshold age of 42.6 years was found to discriminate SpA patients (ROC AUC: 0.71, 95 % CI: 0.59-0.81). BME location in the sacral (OR: 7.07 [1.05, 47.6], p = 0.044) and both sacral and iliac areas (OR: 36.0 [5.61, 231], p = 0.0002), as well as age (OR: 0.95 [0.92, 0.98], p = 0.0019) were found to be independent predictors of SpA. 83.6 % of patients were effectively diagnosed using BME location and patient age in a classification and regression tree (CART) algorithm (sensitivity: 61 %, specificity: 91 %, PPV: 71 %, NPV: 87 %). The BME location combined with the patient's age (threshold 42.6 years) could help predict SpA. Further studies are required before these features can be used by radiologists to boost their confidence in reporting SIJ MRI. (orig.)

  18. 49 CFR 110.110 - After-grant requirements.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...

  19. Analysis of 2000 cases treated with gamma knife surgery: validating eligibility criteria for a prospective multi-institutional study of stereotactic radiosurgery alone for treatment of patients with 1-10 brain metastases (JLGK0901) in Japan

    Science.gov (United States)

    Higuchi, Yoshinori; Nagano, Osamu; Sato, Yasunori; Yamamoto, Masaaki; Ono, Junichi; Saeki, Naokatsu; Miyakawa, Akifumi; Hirai, Tatsuo

    2012-01-01

    Objective The Japan Leksell Gamma Knife (JLGK) Society has conducted a prospective multi-institute study (JLGK0901, UNIN000001812) for selected patients in order to prove the effectiveness of stereotactic radiosurgery (SRS) alone using the gamma knife (GK) for 1-10 brain lesions. Herein, we verify the validity of 5 major patient selection criteria for the JLGK0901 trial. Materials and Methods Between 1998 and 2010, 2246 consecutive cases with 10352 brain metastases treated with GK were analyzed to determine the validity of the following 5 major JLGK0901 criteria; 1) 1-10 brain lesions, 2) less than 10 cm3 volume of the largest tumor, 3) no more than 15 cm3 total tumor volume, 4) no cerebrospinal fluid (CSF) dissemination, 5) Karnofsky performance status (KPS) score ≥70. Results For cases with >10 brain metastases, salvage treatments for new lesions were needed more frequently. The tumor control rate for lesions larger than 10 cm3 was significantly lower than that of tumors 15 cm3 total tumor volume or positive magnetic resonance imaging findings of CSF were significantly poorer. Outcomes in cases with KPS <70 were significantly poorer in terms of OS. Conclusion Our retrospective results of 2246 GK-treated cases verified the validity of the 5 major JLGK0901 criteria. The inclusion criteria for the JLGK0901 study are appearently good indications for SRS. PMID:29296339

  20. Complicated diverticular disease of the colon, do we need to change the classical approach, a retrospective study of 110 patients in southeast England

    Directory of Open Access Journals (Sweden)

    Subhas Gokulakkrishna

    2008-01-01

    Full Text Available Abstract Background Complicated diverticular disease of the colon imposes a serious risk to patient's life, challenge to surgeons and has cost implications for health authority. The aim of this study is to evaluate the management outcome of complicated colonic diverticular disease in a district hospital and to explore the current strategies of treatment. Methods This is a retrospective study of all patients who were admitted to the surgical ward between May 2002 and November 2006 with a diagnosis of complicated diverticular disease. A proforma of patients' details, admission date, ITU admission, management outcomes and the follow up were recorded from the patients case notes and analyzed. The mean follow-up was 34 months (range 6–60 months Results The mean age of patients was 72.7 years (range 39–87 years. Thirty-one men (28.18 % and Seventy-nine women (71.81% were included in this study. Male: female ratio was 1:2.5. Sixty-eight percent of patients had one or more co-morbidities. Forty-one patients (37.27% had two or more episodes of diverticulitis while 41.8% of them had no history of diverticular disease. Eighty-six percent of patients presented with acute abdominal pain while bleeding per rectum was the main presentation in 14%. Constipation and erratic bowel habit were the commonest chronic symptoms in patients with history of diverticular disease. Generalized tenderness was reported in 64.28% while 35.71% have left iliac fossa tenderness. Leukocytosis was reported in 58 patients (52.72%. The mean time from the admission until the start of operative intervention was 20.57 hours (range 4–96 hours. Perforation was confirmed in 59.52%. Mortality was 10.90%. Another 4 (3.63% died during follow up for other reasons. Conclusion Complicated diverticular disease carries significant morbidity and mortality. These influenced by patient-related factors. Because of high mortality and morbidities, we suggest the need to target a specific group of

  1. STS-110 Extravehicular Activity (EVA)

    Science.gov (United States)

    2002-01-01

    STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.

  2. 46 CFR 403.110 - Accounting entities.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting entities. 403.110 Section 403.110 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.110 Accounting entities. Each Association shall be a separate accounting...

  3. 34 CFR 300.110 - Program options.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...

  4. 14 CFR 1250.110 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...

  5. 21 CFR 131.110 - Milk.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk. 131.110 Section 131.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.110 Milk. (a...

  6. 32 CFR 865.110 - Decision process.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Decision process. 865.110 Section 865.110...-GENERAL PERSONNEL REVIEW BOARDS Air Force Discharge Review Board § 865.110 Decision process. (a) The DRB... decision making process. ...

  7. 34 CFR 110.32 - Mediation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...

  8. 7 CFR 917.110 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 917.110 Section 917.110 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Rules and Regulations General § 917.110 Communications. Unless otherwise prescribed in this...

  9. 49 CFR 174.110 - Car magazine.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Car magazine. 174.110 Section 174.110...) Materials § 174.110 Car magazine. When specially authorized by the carrier, Division 1.1 or 1.2 (explosive... packages of Class 1 (explosive) materials are placed in a “magazine” box made of sound lumber not less than...

  10. 49 CFR 230.110 - Pilots.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Pilots. 230.110 Section 230.110 Transportation... and Equalizing System § 230.110 Pilots. (a) General provisions. Pilots shall be securely attached... clearance. The minimum clearance of pilot above the rail shall be 3 inches and the maximum clearance shall...

  11. 41 CFR 115-1.110 - Deviations.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...

  12. 41 CFR 105-1.110 - Deviation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviation. 105-1.110 Section 105-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.110 Deviation. (a...

  13. 41 CFR 101-1.110 - Deviation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Deviation. 101-1.110 Section 101-1.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.110 Deviation...

  14. 10 CFR 110.64 - Civil penalty.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Civil penalty. 110.64 Section 110.64 Energy NUCLEAR... Enforcement § 110.64 Civil penalty. (a) In response to a violation, the Commission may institute a proceeding to impose a civil penalty under section 234 of the Atomic Energy Act by issuing a notice to the...

  15. 11 CFR 6.110 - Evaluation.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...

  16. 5 CFR 950.110 - Prohibited discrimination.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Prohibited discrimination. 950.110 Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.110 Prohibited discrimination. Discrimination for...

  17. 45 CFR 235.110 - Fraud.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the Social Security Act must provide: (a) That the State agency will establish and maintain: (1) Methods and...

  18. 21 CFR 225.110 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...

  19. 21 CFR 226.110 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR TYPE A MEDICATED ARTICLES Records and Reports § 226.110 Distribution records. Complete records shall be maintained for each shipment of Type A medicated article(s) in... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 226.110 Section 226.110 Food...

  20. 9 CFR 3.110 - Veterinary care.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Veterinary care. 3.110 Section 3.110 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Mammals Animal Health and Husbandry Standards § 3.110 Veterinary care. (a) Newly acquired marine mammals...

  1. 42 CFR 136.110 - Facilities construction.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Facilities construction. 136.110 Section 136.110..., DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH Grants for Development, Construction, and Operation of Facilities and Services § 136.110 Facilities construction. In addition to other requirements of this subpart...

  2. 7 CFR 922.110 - Container exemption.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Container exemption. 922.110 Section 922.110... COUNTIES IN WASHINGTON Container Exemption; Waivers of Inspection and Certification § 922.110 Container exemption. Whenever container limitations are effective pursuant to § 922.52, a handler may make test...

  3. 21 CFR 165.110 - Bottled water.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...

  4. 24 CFR 1710.110 - Roads.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Roads. 1710.110 Section 1710.110... (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.110 Roads. (a) Access to the subdivision. (1) Is access to the subdivision provided by public or private roads? What...

  5. 7 CFR 4290.110 - Qualified management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Qualified management. 4290.110 Section 4290.110... Qualifications for the RBIC Program Organizing A Rbic § 4290.110 Qualified management. An Applicant must show, to the satisfaction of the Secretary, that its current or proposed management team is qualified and has...

  6. Is extra-glandular organ damage in primary Sjögren's syndrome related to the presence of systemic auto-antibodies and/or hypergammaglobulinemia? A long-term cohort study with 110 patients from the Netherlands.

    Science.gov (United States)

    Ter Borg, Evert-Jan; Kelder, Johannes Cornelis

    2017-07-01

    To test the hypothesis that systemic auto-antibodies or hypergammaglobulinemia are related to the prevalence of extra-glandular tissue organ damage (EGOD) in primary Sjögren's syndrome (SS). A real practice-based investigation of a relatively large (n = 110) Dutch cohort of primary SS patients systematically followed up in a large non-academic hospital. After a follow up of mean 8.2 years a significant correlation was found between disease duration and the prevalence of EGOD. We did not observe a relationship between the total number or type of systemic auto-antibodies or hypergammaglobulinemia and the total number of EGOD. However, there was a correlation between the prevalence of polyneuropathy (PNP) and antinuclear antibodies (ANA) as well as anti-Ro/SS-A positivity and there was an inverse relationship between the presence of anti-Ro/SS-A antibodies and primary biliary cirrhosis (PBC). All PBC cases were anti-Ro/SS-A and anti-La/SS-B negative but ANA positive. There was a trend for a higher occurrence of pleuro-pulmonary disease in the ANA negative cases. Although we did not find a relationship between the total number or type of systemic auto-antibodies and the total number of EGOD, there were correlations between specific systemic auto-antibodies and specific types of EGOD. The presence of ANA and anti-Ro/SS-A was associated with the occurrence of PNP, as well as was the absence of anti-Ro/SS-A with PBC. © 2017 Asia Pacific League of Associations for Rheumatology and John Wiley & Sons Australia, Ltd.

  7. 21 CFR 168.110 - Dextrose anhydrous.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...

  8. 27 CFR 21.110 - Gasoline, unleaded.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline, unleaded. 21.110....110 Gasoline, unleaded. Conforms to specifications as established by the American Society for Testing...-79. Any of the “seasonal and geographical” volatility classes for unleaded gasoline are considered...

  9. 21 CFR 160.110 - Frozen eggs.

    Science.gov (United States)

    2010-04-01

    ... Frozen eggs. (a) Frozen eggs, frozen whole eggs, frozen mixed eggs is the food prepared by freezing... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen eggs. 160.110 Section 160.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  10. 29 CFR 825.110 - Eligible employee.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...

  11. 29 CFR 1978.110 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... Labor, shall not be subject to judicial review in any criminal or other civil proceedings (49 U.S.C... law judge, shall be transmitted by the Administrative Review Board, United States Department of Labor... 29 Labor 9 2010-07-01 2010-07-01 false Judicial review. 1978.110 Section 1978.110 Labor...

  12. 27 CFR 28.110 - Losses.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.110 Section 28... Manufacturing Bonded Warehouse Losses § 28.110 Losses. Where there has been a loss of distilled spirits while in... of subpart O of this part, with respect to losses of spirits after withdrawal without payment of tax...

  13. 38 CFR 4.110 - Ulcers.

    Science.gov (United States)

    2010-07-01

    ... DISABILITIES Disability Ratings The Digestive System § 4.110 Ulcers. Experience has shown that the term “peptic ulcer” is not sufficiently specific for rating purposes. Manifest differences in ulcers of the stomach... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ulcers. 4.110 Section 4...

  14. Sup(110)Sn/110In - a new generator system for positron emission tomography

    International Nuclear Information System (INIS)

    Lundqvist, H.; Einarsson, L.; Malmborg, P.; Scott-Robson, S.

    1991-01-01

    A generator system, 110 Sn/ 110 In, is suggested for use in the labelling of leukocytes with this short-lived (t 1/2 = 1.15 h) positron emitting (62%) isotope of indium. The half-life gives the labelled leukocytes time to be adequately distributed but is short enough to allow repeated studies within a few hours. The mother radionuclide 110 Sn (t 1/2 = 4.15 h) is produced by the reaction nat In(p, xn) 110 Sn which has a maximum cross-section of 110 mb at approx. 70 MeV and a practical yield of 400 MBq/μAh. (author)

  15. 24 CFR 266.110 - Reserve requirements.

    Science.gov (United States)

    2010-04-01

    ... HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Housing Finance Agency Requirements § 266.110 Reserve requirements. (a) HFAs with top-tier designation or overall...

  16. 21 CFR 163.110 - Cacao nibs.

    Science.gov (United States)

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.110 Cacao nibs. (a... is “cacao nibs”, “cocoa nibs”, or “cracked cocoa”. (1) When the cacao nibs, or the cacao beans from...

  17. 19 CFR 200.735-110 - Indebtedness.

    Science.gov (United States)

    2010-04-01

    ... Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-110 Indebtedness..., reflect adversely on the Government as his employer. In the event of a dispute between an employee and an...

  18. Characterization of Rh films on Ta(110)

    International Nuclear Information System (INIS)

    Jiang, L.Q.; Ruckman, M.W.; Strongin, M.

    1989-01-01

    The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low energy electron diffraction and low energy ion scattering. From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh/Ta(110) appears to grow in the Stranski-Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at 1.2 and 2. 5 eV binding energy during the initial phase of thin film growth (0 3.7 ML). Photoemission data for CO covered surfaces show that CO dissociates on the Rh/Ta(110) surface for Rh coverages less than 2.5 ML and also show that the Rh clusters develop at least one site capable of molecular CO adsorption above 0.3 ML Rh coverage. 38 refs., 5 figs

  19. Characterization of Rh films on Ta(110)

    International Nuclear Information System (INIS)

    Jiang, L.Q.; Ruckman, M.W.; Strongin, M.

    1990-01-01

    The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low-energy electron diffraction (LEED) and low-energy ion scattering (LEIS). From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh appears to grow in the Stranski--Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at -1.5 and -2.5 eV binding energy during the initial phase of thin-film growth (0 3.7 ML). CO dissociates on the Rh/Ta(110) surface for Rh coverages<2.5 ML and the surface develops a site capable of molecular CO adsorption above 0.3-ML Rh coverage

  20. 110GHz ECH on DIII-D

    International Nuclear Information System (INIS)

    Cary, W.P.; Allen, J.C.; Callis, R.W.; Doane, J.L.; Harris, T.E.; Moetler, C.P.; Neren, A.; Prater, P.; Rensen, D.

    1992-01-01

    This paper reports on a new high power electron cyclotron heating (ECH) system which has been introduced on DIII-D. This system is designed to operate at 110 GHz with a total output power of 2 MW. The system consists of four Varian VGT-8011 gyrotrons (output power of 500 kW), and their associated support equipment. All components have been designed for up to a 10 second pulse duration. The 110 GHz system is intended to further progress in rf current drive experiments on DIII-D when used in conjunction with the existing 60 GHz ECH (1. 6 MW) , and the 30-60 MHz ICH (2MW) systems. H-mode physics, plasma stabilization experiments and transport studies are also to be conducted at 110 GHz

  1. 11 CFR 110.17 - Price index increase.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Price index increase. 110.17 Section 110.17... PROHIBITIONS § 110.17 Price index increase. (a) Price index increases for party committee expenditure... 11 CFR 109.32 and 110.8 shall be increased by the percent difference between the price index, as...

  2. Dicty_cDB: VFF110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

  3. 11 CFR 110.13 - Candidate debates.

    Science.gov (United States)

    2010-01-01

    ... debates include at least two candidates; and (2) The staging organization(s) does not structure the... PROHIBITIONS § 110.13 Candidate debates. (a) Staging organizations. (1) Nonprofit organizations described in 26..., subparts D and E. (b) Debate structure. The structure of debates staged in accordance with this section and...

  4. 13 CFR 130.110 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Dispute means a program or financial disagreement which the recipient organization requests be handled... recipient organization and SBA. Grants Management Specialist. An SBA employee designated by the AA/SBDCs who... Circular A-110 and Attachment E of OMB Circular A-102. Program manager. An SBA employee responsible for...

  5. 27 CFR 24.110 - Organizational documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Organizational documents..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Application § 24.110 Organizational... under control number 1512-0058) [T.D. ATF-299, 55 FR 24989, June 19, 1990, as amended by T.D. ATF-409...

  6. 46 CFR 110.15-1 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... vessel that normally navigates the waters of any ocean or the Gulf of Mexico 20 nautical miles or less... 110.10-1), section 4-8-3/11. Ocean vessel means a vessel that navigates the waters of any ocean or the... means a vessel that navigates exclusively on the Great Lakes and their connecting and tributary waters...

  7. 13 CFR 108.110 - Qualified management.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Qualified management. 108.110... management. An Applicant must show, to the satisfaction of SBA, that its current or proposed management team... or proposed management team has sufficient qualifications, SBA will consider information provided by...

  8. 7 CFR 1710.110 - Supplemental financing.

    Science.gov (United States)

    2010-01-01

    ... and Basic Policies § 1710.110 Supplemental financing. (a) Except in the case of financial hardship as determined by the Administrator, and following certain mergers, consolidations, and transfers of systems... merger, consolidation, or transfer of system substantially in its entirety, and the provisions of 7 CFR...

  9. 12 CFR 1815.110 - Categorical exclusion.

    Science.gov (United States)

    2010-01-01

    ... permanent capital and/or liquidity of an applicant; (m) Actions where no use of Federal funds is involved in....110 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY... EIS or environmental assessment if the designated Fund official determines it meets the criteria...

  10. 38 CFR 51.110 - Resident assessment.

    Science.gov (United States)

    2010-07-01

    ...) PER DIEM FOR NURSING HOME CARE OF VETERANS IN STATE HOMES Standards § 51.110 Resident assessment. The... physician orders for the resident's immediate care and a medical assessment, including a medical history and...) Review of assessments. The nursing facility management must examine each resident no less than once every...

  11. 33 CFR 110.232 - Southeast Alaska.

    Science.gov (United States)

    2010-07-01

    ... explosives anchorage. (5) A wooden vessel must: (i) Be fitted with a radar reflector screen of metal of sufficient size to permit target indication on the radar screen of commercial type radar; or (ii) Have steel... 110.232 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES...

  12. BeppoSAX Observations of MKN 110

    Science.gov (United States)

    Nicastro, Fabrizio; Oliversen, Ronald J. (Technical Monitor)

    2002-01-01

    Mkn 110 is a bright, nearby Seyfert 1 galaxy, which underwent a long optical monitoring campaign, during the past 12 years. Optical observations show that Mkn 110 vary, both in flux and spectral shape. The intensity and width of its Broad Emission Lines (BELs) also vary, from typical Seyfert 1, to typical Narrow Line Seyfert 1 (NLSyl) values, so suggesting that this could be the first supermassive black holes where accretion state related transitions, as frequently observed in stellar-size black holes, have finally been observed. To verify these suggestions we asked to monitor Mkn 110 with BeppoSAX with three 50 ksec observations six months apart. The goal of the proposal was to observe spectral variations in X-ray, already suggested by previous, existing ROSAT (Roentgen Satellite) and ASCA (Advanced Satellite for Cosmology and Astrophysics) observations of the same source. The first of these three SAX (Satellite per Astronomia X) observations was taken on May 2000, and lacks the Low-Energy instrument (0.1-2 keV is the band in which NLSy1 and Sy1 X-ray spectra differ most).

  13. 28 CFR 34.110 - Management of peer reviews.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Management of peer reviews. 34.110 Section 34.110 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES... the peer review process. ...

  14. Atomic and molecular adsorption on Fe(110)

    Science.gov (United States)

    Xu, Lang; Kirvassilis, Demetrios; Bai, Yunhai; Mavrikakis, Manos

    2018-01-01

    Iron is the principal catalyst for the ammonia synthesis process and the Fischer-Tropsch process, as well as many other heterogeneously catalyzed reactions. It is thus of fundamental importance to understand the interactions between the iron surface and various reaction intermediates. Here, we present a systematic study of atomic and molecular adsorption behavior over Fe(110) using periodic, self-consistent density functional theory (DFT-GGA) calculations. The preferred binding sites, binding energies, and the corresponding surface deformation energies of five atomic species (H, C, N, O, and S), six molecular species (NH3, CH4, N2, CO, HCN, and NO), and eleven molecular fragments (CH, CH2, CH3, NH, NH2, OH, CN, COH, HCO, NOH, and HNO) were determined on the Fe(110) surface at a coverage of 0.25 monolayer. The binding strengths calculated using the PW91 functional decreased in the following order: C > CH >N > O > S > NH > COH > CN > CH2 > NOH > OH > HNO > HCO > NH2 > H > NO > HCN > CH3 > CO > N2 > NH3. No stable binding structures were observed for CH4. The estimated diffusion barriers and pathways, as well as the adsorbate-surface and intramolecular vibrational modes of all the adsorbates at their preferred binding sites, were identified. Using the calculated adsorption energetics, we constructed the potential energy surfaces for a few surface reactions including the decomposition of methane, ammonia, dinitrogen, carbon monoxide, and nitric oxide. These potential energy surfaces provide valuable insight into the ability of Fe(110) to catalyze common elementary steps.

  15. 46 CFR 7.110 - Mamala Bay, HI.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Mamala Bay, HI. 7.110 Section 7.110 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Hawaii § 7.110 Mamala Bay, HI. A line drawn from Barbers Point Light to Diamond Head Light. Pacific Coast ...

  16. 33 CFR 110.238 - Apra Harbor, Guam.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...

  17. 10 CFR 603.110 - Use of TIAs.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Use of TIAs. 603.110 Section 603.110 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS General § 603.110 Use of TIAs. The ultimate goal for using a TIA is to broaden the technology base available to meet DOE mission...

  18. 48 CFR 249.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...

  19. 33 CFR 110.128c - Island of Kauai, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Kauai, Hawaii. 110.128c Section 110.128c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128c Island of Kauai, Hawaii. (a) Nawiliwili Bay. The...

  20. 33 CFR 110.128b - Island of Hawaii, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Island of Hawaii, Hawaii. 110.128b Section 110.128b Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.128b Island of Hawaii, Hawaii. (a) Hilo Bay...

  1. 29 CFR 1650.110 - Implementation of salary offset.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Implementation of salary offset. 1650.110 Section 1650.110... Procedures for the Collection of Debts by Salary Offset § 1650.110 Implementation of salary offset. (a... proposed voluntary repayment agreement, deductions will begin in the next bi-weekly salary payment after a...

  2. 36 CFR 223.110 - Delegation to regional forester.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation to regional forester. 223.110 Section 223.110 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.110 Delegation to regional forester. The Chief, Forest Service, after approval of conditions of...

  3. 33 CFR 110.25 - Salem Sound, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Salem Sound, Mass. 110.25 Section 110.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.25 Salem Sound, Mass. (a) Beverly Harbor, north of Salem...

  4. 24 CFR 110.15 - Location of posters.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Location of posters. 110.15 Section 110.15 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... HOUSING POSTER Requirements for Display of Posters § 110.15 Location of posters. All fair housing posters...

  5. 1 CFR 500.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 500.110 Section 500.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.110 Self-evaluation... or organizations representing handicapped persons, to participate in the self-evaluation process by...

  6. 22 CFR 711.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 711.110 Section 711.110 Foreign... CORPORATION § 711.110 Self-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...

  7. 49 CFR 807.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Self-evaluation. 807.110 Section 807.110... TRANSPORTATION SAFETY BOARD § 807.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...

  8. 20 CFR 365.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Self-evaluation. 365.110 Section 365.110... § 365.110 Self-evaluation. (a) The agency shall, by December 27, 1989, evaluate its current policies and... self-evaluation process by submitting comments (both oral and written). (c) The agency shall, until at...

  9. 22 CFR 530.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 530.110 Section 530.110 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.110 Self-evaluation. (a) The... representing handicapped persons, to participate in the self-evaluation process by submitting comments (both...

  10. 1 CFR 457.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 457.110 Section 457.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.110 Self-evaluation. (a... organizations representing handicapped persons, to participate in the self-evaluation process by submitting...

  11. 19 CFR 201.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...

  12. 33 CFR 110.208 - Buffalo Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...

  13. 34 CFR 1200.110 - Self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Self-evaluation. 1200.110 Section 1200.110 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL COUNCIL ON DISABILITY... COUNCIL ON DISABILITY § 1200.110 Self-evaluation. (a) The agency shall, by November 28, 1994, evaluate its...

  14. 12 CFR 411.110 - Certification and disclosure.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...

  15. 12 CFR 410.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Self-evaluation. 410.110 Section 410.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.110 Self...

  16. 7 CFR 29.110 - Method of sampling.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Method of sampling. 29.110 Section 29.110 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Inspectors, Samplers, and Weighers § 29.110 Method of sampling. In sampling tobacco...

  17. 7 CFR 3565.110 - Insolvency of lender.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Insolvency of lender. 3565.110 Section 3565.110... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Lender Requirements § 3565.110 Insolvency of lender. The... determination of insolvency by the lender. If the lender fails to transfer a loan when required, the guarantee...

  18. 49 CFR 28.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Self-evaluation. 28.110 Section 28.110 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.110 Self-evaluation...

  19. Fermi surface and quantum well states of V(110) films on W(110)

    Energy Technology Data Exchange (ETDEWEB)

    Krupin, Oleg [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Rotenberg, Eli [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Kevan, S D [Department of Physics, University of Oregon, Eugene, OR 97403 (United States)

    2007-09-05

    Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface.

  20. Fermi surface and quantum well states of V(110) films on W(110)

    International Nuclear Information System (INIS)

    Krupin, Oleg; Rotenberg, Eli; Kevan, S D

    2007-01-01

    Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface

  1. Dicty_cDB: SLE110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

  2. 42 CFR 494.110 - Condition: Quality assessment and performance improvement.

    Science.gov (United States)

    2010-10-01

    ... facility must maintain and demonstrate evidence of its quality improvement and performance improvement... RENAL DISEASE FACILITIES Patient Care § 494.110 Condition: Quality assessment and performance improvement. The dialysis facility must develop, implement, maintain, and evaluate an effective, data-driven...

  3. STS-110 Crew Interview: Stephen Frick

    Science.gov (United States)

    2002-01-01

    STS-110 Pilot Stephen Frick is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Frick outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Frick discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.

  4. STS-110 Crew Interview: Jerry Ross

    Science.gov (United States)

    2002-01-01

    STS-110 Mission Specialist Jerry Ross is seen during this preflight interview, where he gives a quick overview of the mission before answering questions about his inspiration to become an astronaut and his career path. Ross outlines his role in the mission in general, and specifically during the docking and extravehicular activities (EVAs). He describes the payload (S0 Truss and Mobile Transporter) and the dry run installation of the S0 truss that will take place the day before the EVA for the actual installation. Ross discusses the planned EVAs in detail and outlines what supplies will be left for the resident crew of the International Space Station (ISS). He ends with his thoughts on the most valuable aspect of the ISS.

  5. Polonium: 110th anniversary of its discovery

    International Nuclear Information System (INIS)

    Mould, R. F.

    2008-01-01

    It is appropriate that the 110 Th anniversary of the discovery of polonium by Marie and Pierre Curie is commemorated in a Polish journal since this element was named for Poland and was also the element discovered by the Curies before they discovered radium. Polonium's discovery and characteristics are described. Polonium has never been used in medicine, and was largely forgotten apart from a few minor industrial uses, and as a trigger for a nuclear weapon, until the murder in November 2006 in London using 210 Polonium, of the ex-KGB officer Alexander Litvinenko. Polonium had previously been linked, without any definite proof, with the deaths of a few scientists who had worked with the element, including Irene and Frederick Joliet-Curie. This review ends with possible evidence for such links. (authors)

  6. Structural changes during oxidation of Au(110)

    International Nuclear Information System (INIS)

    Hale, P.; Thurgate, S.; Wilkie, P.; Parker, A.J.

    2000-01-01

    Full text: We have constructed an Ultra High vacuum (UHV) system interfaced to an electro-chemical cell. The UHV system is equipped with Low Energy Electron Diffraction (LEED) and X-ray Photoelectron Spectroscopy (XPS). We have used these techniques to examine the oxidation of the Au(110) surface. The gold (110) single crystal exhibits a (2x1) surface structure when clean, but when immersed in 0.01 M HCIO 4 under potential control, the structure has been found to change. Throughout the double layer region the structure remains as (2x1) but when the potential is increased above 0.9-1.0V vs Ag/AgCI, (the pre-oxidation region) the surface structure changes to a centred rectangular structure found to represent a c(2x2) over-layer. This structure is fairly stable and reproducible. After the initial oxidation the structure prevails until 1.2-1.3V whereupon oxidation occurs on a larger scale and the surface structure becomes (1x1). These structures return to (2x1) after the reduction of the oxide, proving that the structural changes are reversible. XPS of these regions has shown a difference in the chemical state of the oxygen. Adsorbed perchlorate ion is initially the only oxygen component but as the potential increases the peak shifts into the hydroxide region and finally it splits into a hydroxide peak and a metal oxide peak. This study indicates a new way of looking at the structure and composition of the gold surface and provides insight into the nature of the interaction between the surface and the solution

  7. Pharmacokinetics of Rhodamine 110 and Its Organ Distribution in Rats.

    Science.gov (United States)

    Jiang, Shiau-Han; Cheng, Yung-Yi; Huo, Teh-Ia; Tsai, Tung-Hu

    2017-09-06

    Rhodamine dyes have been banned as food additives due to their potential tumorigenicity. Rhodamine 110 is illegal as a food additive, although its pharmacokinetics have not been characterized, and no accurate bioanalytical methods are available to quantify rhodamine 110. The aim of this study was to develop and validate a fast, stable, and sensitive method to quantify rhodamine 110 using high-performance liquid chromatography coupled to tandem mass spectrometry (HPLC-MS/MS) to assess its pharmacokinetics and organ distribution in awake rats. Rhodamine 110 exhibited linear pharmacokinetics and slow elimination after oral administration. Furthermore, its oral bioavailability was approximately 34-35%. The distribution in the liver and kidney suggests that these organs are primarily responsible for rhodamine 110 metabolism and elimination. Our investigation describes the pharmacokinetics and a quantification method for rhodamine 110, improving our understanding of the food safety of rhodamine dyes.

  8. 33 CFR 110.84b - Buffalo, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo, N.Y. 110.84b Section 110... REGULATIONS Special Anchorage Areas § 110.84b Buffalo, N.Y. The area within the Port of Buffalo known as Port of Buffalo Small Boat Harbor commencing at a point on shore at latitude 42°51′05″ N., longitude 78°51...

  9. Targeting GPR110 in HER2-Overexpressing Breast Cancers

    Science.gov (United States)

    2015-10-01

    34assay"using"the"transwell" inserts"with" (A)"or"without" (B)"matrigel" for"SKBR3" cells "transfected"with"nonAtarge1ng"( NT1 )"orŗ"independent"GPR110"siRNAs...HER2 drug resistant cells and in tumorigenic population using a broad panel of cell line models. We have successfully generated inducible lentiviral...plasmids with GPR110 cDNA and cell lines that inducibly overexpress GPR110. Generation of cell lines with lentiviral plasmids containing GPR110

  10. Polymorphisms of SP110 are associated with both pulmonary and extra-pulmonary tuberculosis among the Vietnamese.

    Science.gov (United States)

    Fox, Gregory J; Sy, Dinh Ngoc; Nhung, Nguyen Viet; Yu, Bing; Ellis, Magda K; Van Hung, Nguyen; Cuong, Nguyen Kim; Thi Lien, Luu; Marks, Guy B; Saunders, Bernadette M; Britton, Warwick J

    2014-01-01

    Tuberculosis (TB) is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results. To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam. Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451) under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860) and one with extra-pulmonary TB (rs10498244). SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection.

  11. Cytomorphological Spectrum of Thyroiditis: A Review of 110 Cases

    Science.gov (United States)

    Nair, Rahul; Gambhir, Anushree; Kaur, Supreet; Pandey, Aditi; Shetty, Abhinav; Naragude, Piyusha

    2018-01-01

    Introduction Different types of thyroiditis may share some parallel clinical and biochemical features. Timely intervention can significantly reduce morbidity and mortality. Aim Aim of this study is to find the frequency of various thyroiditis, study the cytomorphological features and correlate with clinical findings including radiological findings, thyroid function test, and anti-thyroid peroxidase antibodies (Anti-TPO antibodies). Materials and Methods The study included consecutive 110 cases of thyroiditis. Detailed cytomorphological features were studied and correlated with ultrasonography findings, thyroid function test, anti-thyroid peroxidase antibodies (anti-TPO) and histopathological features where thyroidectomy specimens were received for histopathological examination. Results The majority were Hashimoto's thyroiditis (n = 100) and females (n = 103). Other forms of thyroiditis were Hashimoto's thyroiditis with colloid goiter (n = 5), De Quervain's thyroiditis (n = 3), and one case each of postpartum thyroiditis and Hashimoto's thyroiditis with associated malignancy. The majority of patients were in the age group of 21–40 (n = 70) and the majority (n = 73) had diffuse enlargement of thyroid. The majority of patients were hypothyroid (n = 52). The serum anti-TPO antibodies were elevated in 47 patients out of 71 patients. In the 48 patients who underwent ultrasonography, 38 were diagnosed as having thyroiditis. The most consistent cytomorphological features seen in fine-needle aspiration smears of Hashimoto's thyroiditis were increased background lymphocytes, lymphocytic infiltration of thyroid follicular cell clusters, and Hurthle cells. Conclusion The diagnostic cytological features in Hashimoto's thyroiditis are increased background lymphocytes, lymphocytic infiltration of thyroid follicular cell clusters, and Hurthle cells. FNAC remains the “Gold Standard” for diagnosing Hashimoto's thyroiditis. Clinical history, thyroid function, and biochemical

  12. 21 CFR 333.110 - First aid antibiotic active ingredients.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 5 2010-04-01 2010-04-01 false First aid antibiotic active ingredients. 333.110... (CONTINUED) DRUGS FOR HUMAN USE TOPICAL ANTIMICROBIAL DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE First Aid Antibiotic Drug Products § 333.110 First aid antibiotic active ingredients. The product consists of any of...

  13. 33 CFR 110.155 - Port of New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Port of New York. 110.155 Section... ANCHORAGE REGULATIONS Anchorage Grounds § 110.155 Port of New York. (a) Long Island Sound—(1) Anchorage No... northwest corner of the crib icebreaker north of the New York Central Railroad Company drawbridge across...

  14. 12 CFR 560.110 - Most favored lender usury preemption.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Most favored lender usury preemption. 560.110... INVESTMENT Lending and Investment Provisions Applicable to all Savings Associations § 560.110 Most favored... permits its most favored lender to charge late fees, then a savings association located in that state may...

  15. 41 CFR 102-117.110 - What is satisfactory service?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...

  16. 21 CFR 110.93 - Warehousing and distribution.

    Science.gov (United States)

    2010-04-01

    ...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING... microbial contamination as well as against deterioration of the food and the container. ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Warehousing and distribution. 110.93 Section 110...

  17. 21 CFR 110.5 - Current good manufacturing practice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 110.5 Section...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD General Provisions § 110.5 Current good manufacturing practice. (a) The criteria and...

  18. 24 CFR 110.20 - Availability of posters.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Availability of posters. 110.20... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.20 Availability of posters. All persons subject to this part may obtain fair housing posters from the Department's regional and area...

  19. 24 CFR 110.25 - Description of posters.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Description of posters. 110.25... HOUSING FAIR HOUSING POSTER Requirements for Display of Posters § 110.25 Description of posters. (a) The fair housing poster shall be 11 inches by 14 inches and shall bear the following legend: EC12OC91.008...

  20. 21 CFR 135.110 - Ice cream and frozen custard.

    Science.gov (United States)

    2010-04-01

    ...) of this section, the name of the food is “frozen custard” or “french ice cream” or “french custard... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Ice cream and frozen custard. 135.110 Section 135.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...

  1. 33 CFR 110.233 - Prince William Sound, Alaska.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Prince William Sound, Alaska. 110... ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.233 Prince William Sound, Alaska. (a) The anchorage grounds. In Prince William Sound, Alaska, beginning at a point at latitude 60°40′00″ N., longitude 146°40...

  2. 33 CFR 110.77 - Amistad Reservoir, Tex.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amistad Reservoir, Tex. 110.77... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.77 Amistad Reservoir, Tex. (a) Diablo East, Tex. That portion of the Amistad Reservoir enclosed by a line connecting the following points, excluding a 300-foot...

  3. 31 CFR 17.110 - Self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...

  4. 25 CFR 720.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Self-evaluation. 720.110 Section 720.110 Indians THE...-evaluation. (a) The agency shall, by August 24, 1987, evaluate its current policies and practices, and the... or organizations representing handicapped persons, to participate in the self-evaluation process by...

  5. 44 CFR 16.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Self-evaluation. 16.110... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.110 Self-evaluation. (a) The agency... handicaps or organizations representing individuals with handicaps, to participate in the self-evaluation...

  6. 40 CFR 211.110-2 - National security exemptions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 211.110... ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-2 National security exemptions. (a) A new product which is produced to conform with specifications developed by national security agency...

  7. 33 CFR 110.120 - San Luis Obispo Bay, Calif.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false San Luis Obispo Bay, Calif. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.120 San Luis Obispo Bay, Calif. (a) Area A-1. Area A-1 is the water area bounded by the San Luis Obispo County wharf, the shoreline, a line drawn...

  8. 40 CFR 300.110 - National Response Team.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 27 2010-07-01 2010-07-01 false National Response Team. 300.110... PLAN Responsibility and Organization for Response § 300.110 National Response Team. National planning... agencies named in § 300.175(b). Each agency shall designate a member to the team and sufficient alternates...

  9. 11 CFR 110.18 - Voting age population.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Voting age population. 110.18 Section 110.18 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CONTRIBUTION AND EXPENDITURE LIMITATIONS AND... population of the United States, of each State, and of each Congressional district. The term voting age...

  10. 20 CFR 416.110 - Purpose of program.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Purpose of program. 416.110 Section 416.110... income program replaces the financial assistance programs for the aged, blind, and disabled in the 50... the program: (a) Objective tests. The law provides that payments are to be made to aged, blind, and...

  11. 23 CFR 630.110 - Modification of original agreement.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Modification of original agreement. 630.110 Section 630... OPERATIONS PRECONSTRUCTION PROCEDURES Project Authorization and Agreements § 630.110 Modification of original agreement. (a) When changes are needed to the original project agreement, a modification of agreement shall...

  12. Energy transfer in porous anodic alumina/rhodamine 110 nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Elhouichet, H., E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Materiaux Mineraux et leurs Applications, Centre National de Recherches en Sciences des Materiaux, B.P. 95, Hammam-Lif 2050 (Tunisia); Departement de Physique, Faculte des Sciences de Tunis, University of Tunis Elmanar 2092 Tunis (Tunisia); Harima, N.; Koyama, H. [Hyogo University of Teacher Education, Kato, Hyogo 673-1494 (Japan); Gaponenko, N.V. [Belarusian State University of Informatics and Radioelectronics, P. Browki St. 6, 220013 Minsk (Belarus)

    2012-09-15

    We have used porous anodic alumina (PAA) films as templates for embedding rhodamine 110 (Rh110) molecules and examined their photoluminescence (PL) properties in detail. The analysis of the polarization memory (PM) of PL strongly suggests that there is a significant energy transfer from PAA to Rh110 molecules. The effect of annealing the PAA layer on the PL properties of the nanocomposite has been studied. The results show that the energy transfer becomes more efficient in annealed PAA. - Highlights: Black-Right-Pointing-Pointer Porous anodic alumina-rhodamine 110 nanocomposites are elaborated. Black-Right-Pointing-Pointer Efficient energy transfer from the host to Rh110 molecules is evidenced from measurements of photoluminescence and degree of polarization memory spectra. Black-Right-Pointing-Pointer Thermal annealing of porous anodic alumina can improve the process of excitation transfer.

  13. Transfer of radiosilver (Ag-110m) in the food chain

    International Nuclear Information System (INIS)

    Handl, J.

    1993-01-01

    Following the Chernobyl accident, Ag-110m (Half-life: 250 days) has been reported in some important components of the terrestrial environment such as pasture vegetation and pasture animals. A review of the available literature showed that the behaviour of silver in the terrestrial environment is relatively poorly understood. A research programme to study the behaviour of Ag-110m along the soil - vegetation - animal - man pathway was therefore initiated. In an in-vivo study in cooperation with the Institute of Animal Husbandry and Animal Behaviour, Mariensee with pigs the transfer of Ag-110m from feed to animal tissues was followed for 30 days using Ag-110m labelled meat as feed. The observation has not yet been finished. After the evaluation of all measurements, transfer factors animal tissue/feed as well as the biological half-life for Ag-110m in animal organs will be determined. (orig./BBR)

  14. 21 CFR 110.110 - Natural or unavoidable defects in food for human use that present no health hazard.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Natural or unavoidable defects in food for human... PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD Defect Action Levels § 110.110 Natural or... natural or unavoidable defects to the lowest level currently feasible. (d) The mixing of a food containing...

  15. The p110beta isoform of phosphoinositide 3-kinase signals downstream of G protein-coupled receptors and is functionally redundant with p110gamma.

    Science.gov (United States)

    Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart

    2008-06-17

    The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.

  16. The p110β isoform of phosphoinositide 3-kinase signals downstream of G protein-coupled receptors and is functionally redundant with p110γ

    Science.gov (United States)

    Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J. H.; Okkenhaug, Klaus; Vanhaesebroeck, Bart

    2008-01-01

    The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110α, p110β, and p110δ) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110α and p110δ to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110γ class IB PI3K lack SH2 domains and instead couple p110γ to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110β and cells derived from a p110β-deficient mouse line, that p110β is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110β and p110γ contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110β but not p110γ, p110β mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110γ in these cells reduced the contribution of p110β to GPCR signaling. Taken together, these data show that p110β and p110γ can couple redundantly to the same GPCR agonists. p110β, which shows a much broader tissue distribution than the leukocyte-restricted p110γ, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110γ expression is low or absent. PMID:18544649

  17. Pulmonary complications in 110 consecutive renal transplant ...

    African Journals Online (AJOL)

    pulmonary embolism in 5, and lung abscess in 1. Sixty- nine patients ... The incidence of pulmonary complications after renal ... the factors that influence the development of these .... mobilisation have reduced the risk of pulmonary embolism.

  18. Atomic structures of Cd Te and Cd Se (110) surfaces

    International Nuclear Information System (INIS)

    Watari, K.; Ferraz, A.C.

    1996-01-01

    Results are reported based on the self-consistent density-functional theory, within the local-density approximation using ab-initio pseudopotentials of clean Cd Te and Cd Se (110) surfaces. We analyzed the trends for the equilibrium atomic structures, and the variations of the bond angles at the II-VI (110). The calculations are sensitive to the ionicity of the materials and the results are in agreement with the arguments which predict that the relaxed zinc-blend (110) surfaces should depend on ionicity. (author). 17 refs., 1 figs., 3 tabs

  19. Tank 241-BY-110 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110

  20. Management of Contracts for F110 Engine Procurements

    National Research Council Canada - National Science Library

    Granetto, Paul

    2001-01-01

    This audit was performed in response to an allegation to the Defense Hotline that the Wright-Patterson Air Force Base Procurement Contracting Office made poor procurement decisions on F110 aircraft engine contracts...

  1. 40 CFR 180.110 - Maneb; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.110... None Pepper 7 None Potato 0.1 None Pumpkin 7 None Squash, summer 4 None Squash, winter 4 None Tomato 4...

  2. 40 CFR 98.110 - Definition of the source category.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Ferroalloy Production § 98.110 Definition of the source category. The ferroalloy production source category consists of any facility that uses pyrometallurgical techniques to produce any of the following metals: ferrochromium, ferromanganese, ferromolybdenum...

  3. [Clinical Significance and Mechanism of PI3K p110β Overexpression
 in Non-small Cell Lung Cancer].

    Science.gov (United States)

    Xiong, Yan; Qu, Linlin; Li, Dong; Wang, Ying; Li, Ting

    2017-12-20

    Phosphatidylinositide 3-kinases (PI3K) pathway is one of the most important pathway in cells, which plays an important role in proliferation, growth, differentiation and mobility of cells. The aberrant activation of PI3K pathway was exsited in 50%-70% cases of non-small cell lung cancer (NSCLC). As the key point in PI3K pathway, expression of PI3K plays a critical role in activity of the pathway, which is closely related with the initiation and development of NSCLC, furthermore with the response of tumor to target treatment. Our study is to analyze the clinical significance and mechanism of PI3K p110β overexpression in NSCLC. Expression of p110β and other proteins in PI3K pathway were detected by immunohistochemistry in 170 cases of NSCLC. Correlation between expression of p110β and clinicopathological characteristics of patients as well as expression of other proteins in PI3K pathway was analyzed. In 170 NSCLC, overexpression of p110β was found in 41.8% of cases. Correlation between overexpression of p110β and Ki 67 index was significant (P=0.040). No significant difference of p110 expression were observed among different cohorts of gender, age, smoking status, classification, grade and stage (P>0.05). Correlation between expression of p110β and other proteins in PI3K pathway was various, positively correlated with PTEN loss (P0.05). Overexpression of p110β is frequently detected in NSCLC. It is closely related with PTEN loss NSCLC, which shows that it plays an important role in maintaining and developing of tumors driven by PTEN loss. It initiates the proliferation of tumor cells in NSCLC without phosphorylating Akt. PIK3CB mutation is not the major cause of overexpression of p110β. Dysregulation of receptor tyrosine kinases (RTKs) doesn't show potential of increasing p110β level in cancer tissue, furthermore the expression of p110β in tumors with EGFR mutation is lower than in tumors without EGFR mutation.

  4. [Microcontroller temperature regulator MPT110 for drying-sterilizing cabinets].

    Science.gov (United States)

    Kostin, N N; Gavrishchuk, V I; Zelepukin, S A; Shkulepa, V M; Zharov, E N

    2002-01-01

    The paper describes a MPT-110 temperature microcontroller developed by the closed joint-stock company "OPLEKS" (Orel, Russia) and the results of comparative tests performed in the @IIICC-80 drying sterilizing cabinet. The use of the MPT-110 controller is shown to improve the quality of control and to shorten the times that is taken for the cabinet to reach the preset temperature point.

  5. A novel 1,10-seco withanolide from Physalis peruviana.

    Science.gov (United States)

    Fang, Sheng-Tao; Liu, Ji-Kai; Li, Bo

    2010-07-01

    A novel 1,10-seco withanolide, 1,10-seco withaperuvin C (1), together with four known withanolides, 4 beta-hydroxywithanolide E (2), visconolide (3), withanolide F (4), and withaphysanolide (5), was isolated from the aerial parts of Physalis peruviana. The structures of compounds 1-5 were determined on the basis of spectroscopic methods including extensive 1D and 2D NMR analysis. In addition, the possible biogenetic relationships among these five withanolides are discussed.

  6. Deletion in HSP110 T17: correlation with wild-type HSP110 expression and prognostic significance in microsatellite-unstable advanced gastric cancers.

    Science.gov (United States)

    Kim, Kyung-Ju; Lee, Tae Hun; Kim, Jung Ho; Cho, Nam-Yun; Kim, Woo Ho; Kang, Gyeong Hoon

    2017-09-01

    Deletion of the HSP110 T 17 mononucleotide repeat has recently been identified as a prognostic marker that is correlated with wild-type HSP110 (HSP110wt) expression in microsatellite instability-high (MSI-H) colorectal cancers. The aim of this study was to assess the correlation between deletion of the HSP110 T 17 repeat and expression of HSP110wt using DNA testing and immunohistochemistry and to determine the prognostic implications of HSP110 T 17 deletion in MSI-H advanced gastric cancers (GCs). The status of HSP110wt expression was evaluated by immunohistochemistry using an HSP110wt-specific antibody in 142 MSI-H advanced GCs. The size of the HSP110 T 17 repeat deletion was analyzed in 96 MSI-H advanced GCs; deletions were divided into small (0-2base pairs) and large deletions (3-5base pairs). Low and high expressions of HSP110wt were detected in 38 (26.8%) and 104 (73.2%) of the 142 cases, respectively. The HSP110 T 17 deletion was observed in 45 (46.9%) of the 96 MSI-H GC samples. Tumors with high expression of HSP110wt showed a tendency to have small or no deletion of HSP110 T 17 . In Kaplan-Meier survival analysis, tumors with a large HSP110 T 17 deletion were associated with favorable overall survival and disease-free survival compared with those with small/no deletion of HSP110 T 17 . However, HSP110 T 17 deletion size was not an independent prognostic factor in multivariate analysis. In summary, deletion of the HSP110 T 17 repeat was frequently observed in MSI-H GCs, and HSP110 T 17 deletion size was inversely correlated with HSP110wt expression status. Large HSP110 T 17 was not a prognostic indicator in MSI-H GCs. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. 40 CFR 405.110 - Applicability; description of the condensed whey subcategory.

    Science.gov (United States)

    2010-07-01

    ... condensed whey subcategory. 405.110 Section 405.110 Protection of Environment ENVIRONMENTAL PROTECTION... Condensed Whey Subcategory § 405.110 Applicability; description of the condensed whey subcategory. The... whey and condensed acid whey. ...

  8. Hematoma subdural agudo traumático: estudo de 110 pacientes Acute traumatic subdural haematomas: study of 110 cases

    Directory of Open Access Journals (Sweden)

    Nicandro de Figueiredo Neto

    1996-06-01

    Full Text Available Apresentamos uma série consecutiva de 110 pacientes com hematoma subdural agudo traumático (HSDA admitidos no serviço de emergência do HBDF no período de 1°-janeiro a 1°-dezembro-1994. Todos os pacientes foram atendidos de acordo com o mesmo protocolo. Houve predominância do sexo masculino (79%, com idade variando entre 14 e 70 anos, sendo os atropelamentos (34% e os acidentes automobilísticos (20% as causas mais comuns. A maioria dos pacientes (85,7% foi admitida muito grave, com 8 pontos ou menos na Escala de Coma Glasgow (ECG, o que influenciou diretamente na mortalidade. A tomografia computadorizada de crânio foi o exame diagnóstico de escolha que mostrou serem as contusões e o inchaço cerebral ("swelling" as lesões intracranianas associadas mais freqüentes. A cirurgia foi realizada em 45,1% dos pacientes, e, em sua maioria, através de craniotomia fronto-têmporo-parietal ampla, com drenagem do hematoma, seguida de plástica da dura-mater. Em 54,9% as condições clínicas não permitiram a realização da cirurgia; neste grupo, cerca de 69,6% estavam em coma profundo à admissão, com 3 pontos na ECG. A letalidade cirúrgica foi de 61,2% e esteve diretamente relacionada à condição clínica inicial e à idade do paciente. A letalidade, incluindo todos os pacientes cirúrgicos e não cirúrgicos com HSDA, mesmo aqueles admitidos já com sinais de falência de tronco cerebral, foi de 79,5%. Além destes pacientes que faleceram, cerca de 7% evoluíram sem seqüelas ou com seqüelas mínimas; outros 11,4% com seqüelas de moderadas a paves e 2,1 % permaneceram em estado vegetativo persistente. Nossos dados estão de acordo com os da literatura no que se refere a elevada taxa de morbidade e mortalidade dos pacientes com HSDA.We report a series of 110 patients with acute traumatic subdural hematoma (ASDH admitted at HBDF emergency within 1994 (January Is1 to December PJ.All patients were treated according to the same protocol

  9. Characteristics of first loaded IG-110 graphite in HTTR core

    International Nuclear Information System (INIS)

    Sumita, Junya; Shibata, Taiju; Iyoku, Tatsuo; Sawa, Kazuhiro; Hanawa, Satoshi; Ishihara, Masahiro

    2006-10-01

    IG-110 graphite is a fine-grained isotropic and nuclear-grade graphite with excellent resistivity on both irradiation and corrosion and with high strength. The IG-110 graphite is used for the graphite components of High Temperature Engineering Test Reactor (HTTR) such as fuel and control rod guide blocks and support posts. In order to design and fabricate the graphite components in the HTTR, the Japan Atomic Energy Research Institute (the Japan Atomic Energy Agency at present) had established the graphite structural design code and design data on the basis of former research results. After the design code establishment, the IG-110 graphite components were fabricated and loaded in the HTTR core. This report summarized the characteristics of the first loaded IG-110 graphite as basic data for surveillance test, measuring material characteristics changed by neutron irradiation and oxidation. By comparing the design data, it was shown that the first loaded IG-110 graphite had excellent strength properties and enough safety margins to the stress limits in the design code. (author)

  10. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)

    2012-05-15

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  11. The DOE/NASA SRG110 Program Overview

    Science.gov (United States)

    Shaltens, R. K.; Richardson, R. L.

    2005-12-01

    The Department of Energy is developing the Stirling Radioisotope Generator (SRG110) for NASAs Science Mission Directorate for potential surface and deep space missions. The SRG110 is one of two new radioisotope power systems (RPSs) currently being developed for NASA space missions, and is capable of operating in a range of planetary atmospheres and in deep space environments. It has a mass of approximately 27 kg and produces more than 125We(dc) at beginning of mission (BOM), with a design lifetime of fourteen years. Electrical power is produced by two (2) free-piston Stirlings convertor heated by two General Purpose Heat Source (GPHS) modules. The complete SRG110 system is approximately 38 cm x 36 cm and 76 cm long. The SRG110 generator is being designed in 3 stages: Engineering Model, Qualification Generator, and Flight Generator. Current plans call for the Engineering Model to be fabricated and tested by October 2006. Completion of testing of the Qualification Generator is scheduled for mid-2009. This development is being performed by Lockheed Martin, Valley Forge, PA and Infinia Corporation, Kennewick, WA under contract to the Department of Energy, Germantown, Md. Glenn Research Center, Cleveland, Ohio is providing independent testing and support for the technology transition for the SRG110 Program.

  12. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    International Nuclear Information System (INIS)

    Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.

    2012-01-01

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  13. Polymorphisms of SP110 are associated with both pulmonary and extra-pulmonary tuberculosis among the Vietnamese.

    Directory of Open Access Journals (Sweden)

    Gregory J Fox

    Full Text Available Tuberculosis (TB is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results.To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam.Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451 under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860 and one with extra-pulmonary TB (rs10498244.SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection.

  14. Polymorphisms of SP110 Are Associated with both Pulmonary and Extra-Pulmonary Tuberculosis among the Vietnamese

    Science.gov (United States)

    Fox, Gregory J.; Sy, Dinh Ngoc; Nhung, Nguyen Viet; Yu, Bing; Ellis, Magda K.; Van Hung, Nguyen; Cuong, Nguyen Kim; Thi Lien, Luu; Marks, Guy B.; Saunders, Bernadette M.; Britton, Warwick J.

    2014-01-01

    Background Tuberculosis (TB) is an infectious disease that remains a major cause of morbidity and mortality worldwide, yet the reasons why only 10% of people infected with Mycobacterium tuberculosis go on to develop clinical disease are poorly understood. Genetically determined variation in the host immune response is one factor influencing the response to M. tuberculosis. SP110 is an interferon-responsive nuclear body protein with critical roles in cell cycling, apoptosis and immunity to infection. However association studies of the gene with clinical TB in different populations have produced conflicting results. Methods To examine the importance of the SP110 gene in immunity to TB in the Vietnamese we conducted a case-control genetic association study of 24 SP110 variants, in 663 patients with microbiologically proven TB and 566 unaffected control subjects from three tertiary hospitals in northern Vietnam. Results Five SNPs within SP110 were associated with all forms of TB, including four SNPs at the C terminus (rs10208770, rs10498244, rs16826860, rs11678451) under a dominant model and one SNP under a recessive model, rs7601176. Two of these SNPs were associated with pulmonary TB (rs10208770 and rs16826860) and one with extra-pulmonary TB (rs10498244). Conclusion SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary TB in the Vietnamese. Genetic variants in SP110 may influence macrophage signaling responses and apoptosis during M. tuberculosis infection, however further research is required to establish the mechanism by which SP110 influences immunity to tuberculosis infection. PMID:25006821

  15. Videofluoroscopy of the pharynx and esophagus in patients with globus pharyngis. Comparison with static radiography; Die radiologische Abklaerung des Globus pharyngis. Vergleich der diagnostischen Wertigkeit von konventionellem Roentgen mit der Videokinematographie

    Energy Technology Data Exchange (ETDEWEB)

    Schober, E. [Abt. Roentgen fuer Konservative Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria); Schima, W. [Abt. Roentgen fuer Konservative Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria); Pokieser, P. [Abt. Roentgen fuer Chirurgische Faecher, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria)

    1995-10-01

    The symptom is associated with a multitude of pharyngoesophageal abnormalities. Our study compares the diagnostic yield of videofluoroscopy to that of static radiography in patients suffering from globus pharnygis. A total of 150 consecutive patients complaining of a lump in the throat, but without evidence of dysphagia, were studied in a standardized fashion with both methods. Videofluoroscopy combined with static radiography revealed morphological or functional abnormalities in 75% of our patients. The combination of the two methods yielded significantly more abnormalities in the pharynx and esophagus than videofluoroscopy or static radiography alone. Esophageal motor disorders, pharyngoesophageal sphincter dysfunction and pharyngeal residue of contrast material proved to be the most common abnormalities. In conclusion, videofluoroscopy combined with static radiography is mandatory in the radiological assessment of patients suffering from the globus sensation. (orig.) [Deutsch] Unsere Studie vergleicht die diagnostische Wertigkeit des konventionellen Roentgens mit jener der Videokineamtographie von Pharynx und Oesophagus bei der Abklaerung des Globusgefuehls. Wir haben 150 konsekutive Patienten mit Globusgefuehl, jedoch ohne Dysphagie mit beiden Methoden nach einem standardisierten Protokoll untersucht. Mittels der Kombination von konventionellem Roentgen mit der Videokinematographie fanden sich bei 75% der Patienten pathologische Veraenderungen. Durch die Kombination beider Methoden konnten signifikant mehr morphologische und funktionelle Stoerungen des Pharynx sowie Oesophagus aufgezeigt werden, als mit der alleinigen konventionellen Technik oder der alleinigen Videokinematographie. Die haeufigsten pathologischen Veraenderungen in unserem Kollektiv waren Oesophagusmotilitaetsstoerungen, eine Dyskinesie des pharyngooesophagealen Sphinkters sowie eine abnorme pharyngeale Kontrastmittelretention. Unsere Ergebnisse belegen eindeutig, dass die radiologische

  16. Epitaxial graphene-encapsulated surface reconstruction of Ge(110)

    Science.gov (United States)

    Campbell, Gavin P.; Kiraly, Brian; Jacobberger, Robert M.; Mannix, Andrew J.; Arnold, Michael S.; Hersam, Mark C.; Guisinger, Nathan P.; Bedzyk, Michael J.

    2018-04-01

    Understanding and engineering the properties of crystalline surfaces has been critical in achieving functional electronics at the nanoscale. Employing scanning tunneling microscopy, surface x-ray diffraction, and high-resolution x-ray reflectivity experiments, we present a thorough study of epitaxial graphene (EG)/Ge(110) and report a Ge(110) "6 × 2" reconstruction stabilized by the presence of epitaxial graphene unseen in group-IV semiconductor surfaces. X-ray studies reveal that graphene resides atop the surface reconstruction with a 0.34 nm van der Waals (vdW) gap and provides protection from ambient degradation.

  17. 33 CFR 110.87 - Henderson Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Henderson Harbor, N.Y. 110.87... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.87 Henderson Harbor, N.Y. (a) Area A. The area in the... latitude 43°51′08.8″ N, longitude 76°12′08.9″ W, thence to latitude 43°51′09.0″ N, longitude 76°12′19.0″ W...

  18. Graphene nanoribbons synthesized from molecular precursor polymerization on Au(110)

    Energy Technology Data Exchange (ETDEWEB)

    Massimi, Lorenzo; Ourdjini, Oualid; Della Pia, Ada; Mariani, Carlo; Betti, Maria Grazia [Dipartimento di Fisica, Università di Roma La Sapienza, Piazzale Aldo Moro 2, I - 00185 Roma (Italy); Cavaliere, Emanuele; Gavioli, Luca [i-LAMP & Dipartimento di Matematica e Fisica, Università Cattolica, 25121 Brescia (Italy)

    2015-06-23

    A spectroscopic study of 10,10-dibromo-9,9 bianthracene (DBBA) molecules deposited on the Au(110) surface is presented, by means of ultraviolet and X-ray photoemission, and X-ray absorption spectroscopy. Through a thermally activated procedure, these molecular precursors polymerize and eventually form graphene nanoribbons (GNRs) with atomically controlled shape and width, very important building blocks for several technological applications. The GNRs observed by scanning tunneling microscopy (STM) appear as short segments on top of the gold surface reconstruction, pointing out the delicate balance among surface diffusion and surface corrugation in their synthesis on the Au(110) surface.

  19. 7 CFR 1221.110 - Powers and duties.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.110 Powers and duties. The Board shall have the following powers and duties: (a) To...

  20. 25 CFR 900.110 - What does this subpart cover?

    Science.gov (United States)

    2010-04-01

    ... management, and the actual construction of the building or facility in accordance with the construction... construction management services as defined in § 900.113 may be included in a construction contract under this... Construction § 900.110 What does this subpart cover? (a) This subpart establishes requirements for issuing...

  1. 43 CFR 46.110 - Incorporating consensus-based management.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Incorporating consensus-based management... § 46.110 Incorporating consensus-based management. (a) Consensus-based management incorporates direct... carry out those plans and activities. For the purposes of this Part, consensus-based management involves...

  2. 27 CFR 1.10 - Meaning of terms.

    Science.gov (United States)

    2010-04-01

    ..., NONINDUSTRIAL USE OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Definitions § 1.10... the Federal Alcohol Administration Act, Nonindustrial Use of Distilled Spirits and Wine, Bulk Sales... to engage in activities at a particular location. Brandy. Brandy or wine spirits for addition to...

  3. 21 CFR 520.110 - Apramycin sulfate soluble powder.

    Science.gov (United States)

    2010-04-01

    ... apramycin for each 66 pounds of body weight. Water consumption should be monitored to determine that the... water consumption which varies depending on ambient temperature, humidity, and other factors. (3... 520.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  4. Novel and simple synthesis of brominated 1,10-phenanthrolines

    Czech Academy of Sciences Publication Activity Database

    Výprachtický, Drahomír; Kaňková, Dana; Pokorná, Veronika; Kmínek, Ivan; Dzhabarov, Vagif; Cimrová, Věra

    2014-01-01

    Roč. 67, č. 6 (2014), s. 915-921 ISSN 0004-9425 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : 1,10-phenanthroline * electrophilic aromatic substitution * bromination Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.558, year: 2014

  5. 15 CFR 2011.110 - Suspension of certificate system.

    Science.gov (United States)

    2010-01-01

    ..., SYRUPS AND MOLASSES Certificate of Quota Eligibility § 2011.110 Suspension of certificate system. (a... of such suspension and the effective date thereof shall be published in the Federal Register. (b... such reinstatement and the effective date thereof shall be published in the Federal Register. (c...

  6. Mechanisms of self-diffusion on Pt(110)

    DEFF Research Database (Denmark)

    Lorensen, Henrik Qvist; Nørskov, Jens Kehlet; Jacobsen, Karsten Wedel

    1999-01-01

    The self-diffusion of Pt on the missing row reconstructed Pt(110) surface is discussed based on density functional calculations of activation energy barriers. Different competing diffusion mechanisms are considered and we show that several different diffusion paths along the reconstruction troughs...

  7. 12 CFR 221.110 - Questions arising under this part.

    Science.gov (United States)

    2010-01-01

    ... technical circumstances under which a loan is made. Instead, the fundamental purpose of the loan is... solely toward purchases of stock for speculative or investment purposes. The Board answered that a margin... Section 221.110 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL...

  8. 29 CFR 4.110 - What contracts are covered.

    Science.gov (United States)

    2010-07-01

    ...'Hara Service Contract Act Covered Contracts Generally § 4.110 What contracts are covered. The Act... mean that the contract is not within the coverage of the Act. The amount of the contract is not determinative of the Act's coverage, although the requirements are different for contracts in excess of $2,500...

  9. Isomerization of 2-phospha-4-silabicyclo[1.10]butane

    NARCIS (Netherlands)

    Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.

    2004-01-01

    In analogy with the valence isomerism of the hydrocarbons bicyclobutane, 1,3-butadiene and cyclobutene, the rearrangements for 2-phospha-4-sila- bicyclo[1.1.0]butane were studied at the B3LYP/6-311+G** level of theory. The monocyclic 1,2-dihydro-1,2-phosphasilete is shown to be the thermodynamically

  10. 48 CFR 49.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Settlement negotiation... CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.110 Settlement negotiation memorandum. (a) The TCO shall, at the conclusion of negotiations, prepare a settlement negotiation memorandum...

  11. 45 CFR 2490.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.110 Self-evaluation. (a) The agency shall, by November 28...

  12. 45 CFR 1706.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the effects thereof...

  13. 45 CFR 1181.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... HUMANITIES INSTITUTE OF MUSEUM AND LIBRARY SERVICES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE INSTITUTE OF MUSEUM AND LIBRARY SERVICES § 1181.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies and practices, and the...

  14. Directional uv photoemission from (100) and (110) molybdenum surfaces

    DEFF Research Database (Denmark)

    Cinti, R. C.; Khoury, E. Al; Chakraverty, B. K.

    1976-01-01

    A study of the (100) and (110) molybdenum surfaces by directional photoemission spectroscopy is presented. Energy distribution spectra formed by photoelectrons emitted normal to the surfaces have been measured for photon energies between 10.2 and 21.2 eV. The results are discussed in terms of cal......-transition and surface-emission processes. Two extra structures are interpreted in terms of surface states or resonances: on the (100) surface, 0.5 eV below EF; on the (110) surface, 4.5 eV below EF in the s-d hybridization gap....... of calculated band structure within the framework of the K∥-conservation assumption. A good agreement is found between the main features of the experimental spectra and the emission expected from the band structure along the corresponding symmetry line in the Brillouin zone, assuming essentially direct...

  15. Nitrogen adsorption on Fe(111), (100), and (110) surfaces

    DEFF Research Database (Denmark)

    Mortensen, Jens Jørgen; Ganduglia-Pirovano, Veronica; Hansen, Lars Bruno

    1999-01-01

    Adsorption energies and structures for N atoms on three low-index surfaces of Fe have been calculated using density functional theory (DFT) and the generalized gradient approximation (GGA). At low N coverage the adsorption energy on Fe(100) is found to be similar to 0.7 eV higher than on the (111......) and (110) surfaces - particularly the c(2 x 2)-N/Fe(100) structure with the N atoms in four-fold sites is very stable. We attribute the differences in adsorption energy to the lack of four-fold sites on the (111) and (110) surfaces, We suggest that at higher N coverages, islands with a structure similar...

  16. Spin transport anisotropy in (110)GaAs

    Energy Technology Data Exchange (ETDEWEB)

    Odilon, D.D.C. Jr.; Rudolph, Joerg; Hey, Rudolf; Santos, Paulo V. [Paul-Drude-Institut fuer Festkoerperelektronik, Berlin (Germany); Iikawa, Fernando [Universidade Estadual de Campinas, IFGW, Campinas SP (Brazil)

    2007-07-01

    Mobile piezoelectric potentials are used to coherently transport electron spins in GaAs(110) quantum wells (QW) over distances exceeding 60{mu}m. We demonstrate that the dynamics of mobile spins under external magnetic fields depends on the direction of motion in the QW plane. The weak piezoelectric fields impart a non-vanishing average velocity to the carriers, allowing for the direct observation of the carrier momentum dependence of the spin polarization dynamics. While transport along [001] direction presents high in-plane spin relaxation rates, transport along [ anti 110] shows a much weaker external field dependence due to the non-vanishing internal magnetic field. We show that the anisotropy is an intrinsic property of the underling GaAs matrix, associated with the bulk inversion asymmetry contribution to the LS-coupling.

  17. Double life of centrioles: CP110 in the spotlight.

    Science.gov (United States)

    Bettencourt-Dias, Mónica; Carvalho-Santos, Zita

    2008-01-01

    Centrioles lead an important double life: they can give rise to the centrosome or convert to basal bodies and template cilia. Little is known about the control of centriole fate. Spektor and colleagues have now identified a centriolar complex, composed of CP110 and CEP97, which inhibits centriole to basal body conversion, preventing cilia formation. This work paves the way to understanding centriole and cilia biogenesis, which are two processes misregulated in human diseases, such as cancer and polycystic kidney disease.

  18. cis-Dichloridobis(1,10-phenanthrolinechromium(III chloride

    Directory of Open Access Journals (Sweden)

    Xiaoli Gao

    2011-02-01

    Full Text Available In the title complex, [CrCl2(C12H8N22]Cl, the CrIII ion is situated on a twofold rotation axis and displays a slightly distorted octahedral CrCl2N4 coordination geometry. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline and two chloride ligands. The chloride counter-anion exhibits half-occupation and is equally disordered over two positions.

  19. Systolic blood pressure criteria in the National Trauma Triage Protocol for geriatric trauma: 110 is the new 90.

    Science.gov (United States)

    Brown, Joshua B; Gestring, Mark L; Forsythe, Raquel M; Stassen, Nicole A; Billiar, Timothy R; Peitzman, Andrew B; Sperry, Jason L

    2015-02-01

    Undertriage is a concern in geriatric patients. The National Trauma Triage Protocol (NTTP) recognized that systolic blood pressure (SBP) less than 110 mm Hg may represent shock in those older than 65 years. The objective was to evaluate the impact of substituting an SBP of less than 110 mm Hg for the current SBP of less than 90 mm Hg criterion within the NTTP on triage performance and mortality. Subjects undergoing scene transport in the National Trauma Data Bank (2010-2012) were included. The outcome of trauma center need was defined as Injury Severity Score (ISS) greater than 15, intensive care unit admission, urgent operation, or emergency department death. Geriatric (age > 65 years) and adult (age, 16-65 years) cohorts were compared. Triage characteristics and area under the curve (AUC) were compared between SBP of less than 110 mm Hg and SBP of less than 90 mm Hg. Hierarchical logistic regression was used to determine whether geriatric patients newly triaged positive under this change (SBP, 90-109 mm Hg) have a risk of mortality similar to those triaged positive with SBP of less than 90 mm Hg. There were 1,555,944 subjects included. SBP of less than 110 mm Hg had higher sensitivity but lower specificity in geriatric (13% vs. 5%, 93% vs. 99%) and adult (23% vs. 10%, 90% vs. 98%) cohorts. AUC was higher for SBP of less than 110 mm Hg individually in both geriatric and adult (p AUC was similar for SBP of less than 110 mm Hg and SBP of less than 90 mm Hg in geriatric subjects but was higher for SBP of less than 90 mm Hg in adult subjects (p < 0.01). Substituting SBP of less than 110 mm Hg resulted in an undertriage reduction of 4.4% with overtriage increase of 4.3% in the geriatric cohort. Geriatric subjects with SBP of 90 mm Hg to 109 mm Hg had an odds of mortality similar to those of geriatric patients with SBP of less than 90 mm Hg (adjusted odds ratio, 1.03; 95% confidence interval, 0.88-1.20; p = 0.71). SBP of less than 110 mm Hg increases sensitivity. SBP of

  20. High temperature behaviour of E110G and E110 fuel claddings in various mixtures of steam and air

    International Nuclear Information System (INIS)

    Perez-Feró, Erzsébet; Novotny, Tamás; Horváth, Márta; Kunstár, Mihály; Vér, Nóra; Hózer, Zoltán

    2014-01-01

    Experiments with sponge base E110G and the traditional E110 were carried out to compare the oxidation kinetics of these alloys in steam, in hydrogen rich steam, in steam-air and in air atmosphere and to study the effect of hydrogen- and nitrogen-containing environment on the oxidation. The effect of oxidizing atmosphere on the mechanical behaviour of the claddings was also investigated. The new and the traditional types of cladding rings were oxidised at high temperature (600°C – 1200°C). Oxidation of both alloys in steam-air mixture and in air atmosphere resulted in faster oxidation kinetics compared to steam. In many cases bumpy, porous oxide layer have been found. The presence of hydrogen in the steam atmosphere had no significant effect on the oxidation kinetics. Comparing the two alloys, more favourable behaviour of oxidised E110G was observed regarding the oxidation kinetics, breakaway oxidation and load bearing capability in all cases. (author)

  1. Tuberous sclerosis: A clinicoradiological evaluation of 110 cases with particular reference to atypical presentation

    International Nuclear Information System (INIS)

    Kingsley, D.P.E.; Kendall, B.E.; Fitz, C.R.; Hospital for Sick Children, London

    1986-01-01

    CT scans on 110 children with a diagnosis of tuberous sclerosis have been compared with the clinical features of the disease. Patients with definite radiological as well as definite or suggestive clinical features accounted for only 80% of cases. 16% had positive radiological and negative clinical features and 4% had positive clinical and negative radiological features. There is little relationship between the mental development and the incidence of periventricular tubers or cortical and parenchymal lesions. In 15 patients older than 7 years the diagnosis was only made at the time of CT. Cerebral atrophy was not a prominent feature. Giant cell astrocytomas were present in 14%, one third of whom presented for the first time. (orig.)

  2. p110α and p110β isoforms of PI3K signaling: are they two sides of the same coin?

    Science.gov (United States)

    Singh, Paramjeet; Dar, Mohd Saleem; Dar, Mohd Jamal

    2016-09-01

    Class-1 phosphatidylinositol-3-kinases (PI3Ks) are activated by a variety of extracellular stimuli and have been implicated in a wide range of cellular processes. p110α and p110β are the two most studied isoforms of the class-1A PI3K signaling pathway. Although these two isoforms are ubiquitously expressed and play multiple redundant roles, they also have distinct functions within the cell. More recently, p110α and p110β isoforms have been shown to translocate into the nucleus and play a role in DNA replication and repair, and in cell cycle progression. In the following Review article, we discuss the overlapping and unique roles of p110α and p110β isoforms with a particular focus on their structure, expression analysis, subcellular localization, and signaling contributions in various cell types and model organisms. © 2016 Federation of European Biochemical Societies.

  3. Production cross sections and isomeric ratios for sup(110m)In/sup(110g)In formed in Cd (d,xn) reactions

    International Nuclear Information System (INIS)

    Herreros Usher, Oscar; Maceiras de Jefimowicz, Elena; De la Vega Vedoya, Mario; Jorge Nassiff, Sonia

    1980-01-01

    Excitation functions and isomeric cross sections ratios have been measured for the 110 Cd (d,2n) and 111 Cd (d,3n) reactions in which the isomeric pair sup(110m)In/sup(110g)In is produced. Activation method was employed and the irradiations were performed at the synchrocyclotron of the Comision Nacional de Energia Atomica, Argentina, with an incident energy of 27.MeV. (author) [es

  4. 33 CFR 110.129a - Apra Harbor, Guam. (Datum: WGS 84)

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. (Datum: WGS 84) 110.129a Section 110.129a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.129a Apra Harbor, Guam. (Datum: WGS 84) (a...

  5. 24 CFR 598.110 - Tests of pervasive poverty, unemployment and general distress.

    Science.gov (United States)

    2010-04-01

    ..., unemployment and general distress. 598.110 Section 598.110 Housing and Urban Development Regulations Relating... TWO AND THREE DESIGNATIONS Eligibility Requirements § 598.110 Tests of pervasive poverty, unemployment...) Unemployment. Unemployment is demonstrated by: (1) The most recent data available indicating that the annual...

  6. 33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

  7. 33 CFR 118.110 - Daymarks and lateral lighting on bridges.

    Science.gov (United States)

    2010-07-01

    ... bridges. 118.110 Section 118.110 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.110 Daymarks and lateral lighting on bridges. (a... through bridges with U.S. aids to navigation system lateral marks and lights installed on the...

  8. 12 CFR 516.110 - Who may submit a written comment?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who may submit a written comment? 516.110 Section 516.110 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPLICATION PROCESSING PROCEDURES Comment Procedures § 516.110 Who may submit a written comment? Any person may submit a...

  9. 33 CFR 110.31 - Hull Bay and Allerton Harbor at Hull, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull Bay and Allerton Harbor at Hull, Mass. 110.31 Section 110.31 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.31 Hull Bay and Allerton Harbor at...

  10. 24 CFR 100.110 - Discriminatory practices in residential real estate-related transactions.

    Science.gov (United States)

    2010-04-01

    ... residential real estate-related transactions. 100.110 Section 100.110 Housing and Urban Development... Discrimination in Residential Real Estate-Related Transactions § 100.110 Discriminatory practices in residential real estate-related transactions. (a) This subpart provides the Department's interpretation of the...

  11. 44 CFR 19.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.110 Remedial and... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 19.110 Section 19.110 Emergency Management and Assistance FEDERAL EMERGENCY...

  12. 33 CFR 110.27 - Lynn Harbor in Broad Sound, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lynn Harbor in Broad Sound, Mass. 110.27 Section 110.27 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.27 Lynn Harbor in Broad Sound, Mass. North of...

  13. 33 CFR 110.74c - Bahia de San Juan, PR.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bahia de San Juan, PR. 110.74c Section 110.74c Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.74c Bahia de San Juan, PR. The waters of San Antonio...

  14. 48 CFR 1337.110-71 - Additional DOC clauses related to service contracting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Additional DOC clauses related to service contracting. 1337.110-71 Section 1337.110-71 Federal Acquisition Regulations System....110-71 Additional DOC clauses related to service contracting. (a) Insert a clause substantially...

  15. 41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?

    Science.gov (United States)

    2010-07-01

    ... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...

  16. 40 CFR 415.110 - Applicability; description of the potassium metal production subcategory.

    Science.gov (United States)

    2010-07-01

    ... potassium metal production subcategory. 415.110 Section 415.110 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Potassium Metal Production Subcategory § 415.110 Applicability; description of the potassium metal production subcategory. The provisions of this subpart are applicable to discharges...

  17. 33 CFR 110.156 - Randall Bay, Freeport, Long Island, N.Y.

    Science.gov (United States)

    2010-07-01

    ... Island, N.Y. 110.156 Section 110.156 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.156 Randall Bay, Freeport, Long Island, N.Y. (a) The anchorage grounds. Southward of a line 312 feet south of and parallel to the south side...

  18. 10 CFR Appendix M to Part 110 - Categorization of Nuclear Material d

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Categorization of Nuclear Material d M Appendix M to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. M Appendix M to Part 110—Categorization of Nuclear Material d [From IAEA INFCIRC/225...

  19. 45 CFR 2523.110 - Can Federal agencies submit multiple applications?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Can Federal agencies submit multiple applications? 2523.110 Section 2523.110 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION... AMERICORPS PROGRAM ASSISTANCE § 2523.110 Can Federal agencies submit multiple applications? No. The...

  20. 24 CFR 811.110 - Refunding of obligations issued to finance Section 8 projects.

    Science.gov (United States)

    2010-04-01

    ... finance Section 8 projects. 811.110 Section 811.110 Housing and Urban Development Regulations Relating to... RELATED AMENDMENTS § 811.110 Refunding of obligations issued to finance Section 8 projects. (a) This... refunding which generate the McKinney Act savings and, if necessary, HUD will finance in refunding bond debt...

  1. 33 CFR 110.179 - Skidaway River, Isle of Hope, Ga.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Skidaway River, Isle of Hope, Ga. 110.179 Section 110.179 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.179 Skidaway River, Isle of Hope, Ga. (a) The...

  2. 33 CFR 110.70a - Northeast River, North East, Md.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast River, North East, Md. 110.70a Section 110.70a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.70a Northeast River, North East, Md. The water...

  3. 29 CFR 779.110 - Employees in retailing whose activities may bring them under the Act.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Employees in retailing whose activities may bring them under the Act. 779.110 Section 779.110 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR... Production of Goods for Commerce § 779.110 Employees in retailing whose activities may bring them under the...

  4. 41 CFR 101-25.110-3 - Tires accompanying new motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... motor vehicles. 101-25.110-3 Section 101-25.110-3 Public Contracts and Property Management Federal...-GENERAL 25.1-General Policies § 101-25.110-3 Tires accompanying new motor vehicles. The tire identifications and recordkeeping regulations issued by the Department of Transportation require each motor...

  5. 40 CFR 417.110 - Applicability; description of the SO3 solvent and vacuum sulfonation subcategory.

    Science.gov (United States)

    2010-07-01

    ... solvent and vacuum sulfonation subcategory. 417.110 Section 417.110 Protection of Environment... POINT SOURCE CATEGORY SO3 Solvent and Vacuum Sulfonation Subcategory § 417.110 Applicability; description of the SO3 solvent and vacuum sulfonation subcategory. The provisions of this subpart are...

  6. Fissionlike phenomena for systems with mass A=110

    International Nuclear Information System (INIS)

    Heusch, B.

    1984-01-01

    We present a part of the considerable amount of data we obtained these last years in the study of composite systems of mass around 110. From the rotating liquid drop models, theses systems are known as nearly the most stable nuclei, i.e. angular momenta as large as 90 h can be fully absorbed. Only bombarding energies less than 8MeV/nucleon will be considered here avoiding therefore that imcomplete fusion, projectile fragmentation of other such mechanisms play a measurable role

  7. Wakefield calculation for superconducting TM110 cavity without azimuthal symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Bellantoni, Leo; /Fermilab; Burt, Graeme; /Lancaster U.

    2006-08-01

    The 3.9GHz TM{sub 110} mode deflecting cavity developed at FNAL has many applications, including use as a longitudinal bunch profile diagnostic, and as a crab cavity candidate for the ILC. These applications involve beams with substantial time structure. For the 13-cell version intended for the bunch profile application, long-range wakes have been evaluated in the frequency domain and short-range wakes have been evaluated in the time domain. Higher-order interactions of the main field in the cavity with the beam have also been parameterized. Pedagogic derivations are included as appendices.

  8. Transport characteristics of a silicene nanoribbon on Ag(110

    Directory of Open Access Journals (Sweden)

    Ryoichi Hiraoka

    2017-08-01

    Full Text Available We present the transport characteristics of individual silicene nanoribbons (SiNRs grown on Ag(110. By lifting up a single SiNR with a low-temperature scanning tunneling microscope tip, a nanojunction consisting of tip, SiNR and Ag is fabricated. In the differential conductance spectra of the nanojunctions fabricated by this methodology, a peak appears at the Fermi level which is not observed in the spectra measured either for the SiNRs before being lifted up or the clean Ag substrate. We discuss the origin of the peak as it relates to the SiNR.

  9. Substrate strain induced interaction of adatoms on W (110)

    Science.gov (United States)

    Kappus, W.

    1980-09-01

    The interaction of adatoms due to elastic strains created in an elastically isotropic substrate is investigated. For cases where the adatoms occupy sites with low symmetry, an angular dependent interaction results which falls off as s-3 at large distances. An exact expression is given for the long range interaction in terms of an anisotropy parameter of the force dipole tensor. The short range interaction is calculated by introducing a smooth cutoff. Interactions of adatoms on near neighbour sites on W (110) are given.

  10. Large-angle positronium emission for Al(110)

    International Nuclear Information System (INIS)

    Schultz, P.J.; Lynn, K.G.; Frieze, W.E.

    1984-10-01

    Mono-energetic positrons have been used to study the time-of-flight distribution of ortho-positronium (o-Ps) formed just outside the surface of an Al(110) single crystal. The data are interpreted in terms of two predominant angular distributions for the directly formed o-Ps: one that is peaked towards the surface normal and another that is directed towards large angles. These processes are shown to be very sensitive to both oxygen exposure and Ar + ion sputtering. Ps emitted at large-angles may be evidence of formation with electrons propagating in a two-dimensional surface state

  11. Seeking asymmetric rotors in mass region A∼100-110

    International Nuclear Information System (INIS)

    Varshney, Mani; Gupta, D K; Singh, M; Singh, Yuvraj; Bihari, Chhail; Varshney, A K; Gupta, K K

    2011-01-01

    The staggering indices S(I, I-1, I-2) versus spin (I) graphs have been plotted using known experimental data along with empirical calculations of Varshney et al (2007 Phys. Scr. 75 451) in some nuclei of mass region A∼100-110. Most of the transional nuclei of Mo, Ru and Pd isotopes have been found to be triaxial. The known B(E2) values of these nuclei are also close to the triaxial rotor model predictions (Davydov A S and Filippov G F 1958 Nucl. Phys. 8 237).

  12. 110例丙型肝炎患者流行病学特征和疾病谱分析

    Directory of Open Access Journals (Sweden)

    HUANG Yanwu

    2014-06-01

    Full Text Available ObjectiveTo investigate the epidemiological features and disease spectrum of inpatients with hepatitis C in recent years and to provide reference for the control of hepatitis C. MethodsA retrospective study of demography, epidemiology, and laboratory examination was performed in 110 hospitalized patients with hepatitis C. ResultsOf the 110 patients, 60 were male and 50 were female, with a male-to-female ratio of 1.2:1. The main transmission routes included blood product transfusion (33.6%, surgery (30.0%, intravenous drug use (14.5%, and sexual transmission (4.5%. The other 19 cases (17.4% were of unknown transmission route. The annual numbers of cases from 2008 to 2011 were 16, 18, 32, and 44, respectively. The genotype proportions in patients were as follows: 1b, 60.7% (17/28; 2a, 28.6% (8/28; 1b/2a mixed type, 7.1% (2/28; 3b, 3.6% (1/28. Of all patients, 13.6% (15/110 were found with acute hepatitis C, 67.3% (74/110 with chronic hepatitis C, 19.1% (21/110 with liver cirrhosis, and 109% (12/110 with decompensated cirrhosis. ConclusionThe incidence of HCV infection has been increasing year by year. The major HCV genotypes are 1b and 2a. Hepatitis C is apt to develop into liver cirrhosis. It is necessary to reinforce monitoring and to carry out specific epidemiological study among the target population.

  13. First-in-human phase 1 of YS110, a monoclonal antibody directed against CD26 in advanced CD26-expressing cancers.

    Science.gov (United States)

    Angevin, Eric; Isambert, Nicolas; Trillet-Lenoir, Véronique; You, Benoit; Alexandre, Jérôme; Zalcman, Gérard; Vielh, Philippe; Farace, Françoise; Valleix, Fanny; Podoll, Thomas; Kuramochi, Yu; Miyashita, Itaru; Hosono, Osamu; Dang, Nam H; Ohnuma, Kei; Yamada, Taketo; Kaneko, Yutaro; Morimoto, Chikao

    2017-04-25

    YS110 is a humanised IgG1 monoclonal antibody with high affinity to the CD26 antigen. YS110 demonstrated preclinical anti-tumour effects without significant side effects. This FIH study was designed to determine the maximal tolerated dose (MTD) and recommended phase 2 dose (RP2D) to assess the tolerance, pharmacokinetics (PK) and pharmacodynamics profiles of YS110 and preliminary efficacy. YS110 were initially administered intravenously once every 2 weeks (Q2W) for three doses and then, based on PK data, once every week (Q1W) for five doses in patients with CD26-expressing solid tumours. Thirty-three patients (22 mesothelioma) received a median of 3 (range 1-30) YS110 infusions across six dose levels (0.1-6 mg kg -1 ). MTD was not reached and two dose-limiting toxicities (infusion hypersensitivity reactions) led to the institution of a systemic premedication. Low-grade asthenia (30.3%), hypersensitivity (27.3%), nausea (15.2%), flushing (15.2%), chills (12.1%) and pyrexia (12.1%) were reported as ADRs. Pharmacokinetic parameters (AUC and C max ) increased in proportion with the dose. sCD26/DPPIV assays indicated CD26 modulation. Prolonged stable diseases were observed in 13 out of 26 evaluable patients. YS110 is well tolerated up to 6 mg kg -1 Q1W, which has been defined as the RP2D, with encouraging prolonged disease stabilisations observed in a number of patients with advanced/refractory mesothelioma.

  14. Quantitative XRD analysis of {110} twin density in biotic aragonites.

    Science.gov (United States)

    Suzuki, Michio; Kim, Hyejin; Mukai, Hiroki; Nagasawa, Hiromichi; Kogure, Toshihiro

    2012-12-01

    {110} Twin densities in biotic aragonite have been estimated quantitatively from the peak widths of specific reflections in powder X-ray diffraction (XRD) patterns, as well as direct confirmation of the twins using transmission electron microscopy (TEM). Influence of the twin density on the peak widths in the XRD pattern was simulated using DIFFaX program, regarding (110) twin as interstratification of two types of aragonite unit layers with mirrored relationship. The simulation suggested that the twin density can be estimated from the difference of the peak widths between 111 and 021, or between 221 and 211 reflections. Biotic aragonite in the crossed-lamellar microstructure (three species) and nacreous microstructure (four species) of molluscan shells, fish otoliths (two species), and a coral were investigated. The XRD analyses indicated that aragonite crystals in the crossed-lamellar microstructure of the three species contain high density of the twins, which is consistent with the TEM examination. On the other hand, aragonite in the nacre of the four species showed almost no difference of the peak widths between the paired reflections, indicating low twin densities. The results for the fish otoliths were varied between the species. Such variation of the twin density in biotic aragonites may reflect different schemes of crystal growth in biomineralization. Copyright © 2012 Elsevier Inc. All rights reserved.

  15. Preparation technology of 103Pd-110Agm composite alloy membranes

    International Nuclear Information System (INIS)

    Liu Zhuo; Chen Daming; Jin Xiaohai; Li Zhongyong; Guo Feihu; Qin Hongbin

    2012-01-01

    The preparation of 103 Pd- 110 Ag m alloy membranes was the basis for the production of 103 Pd- 125 I composite sources. Taking 103 Pd and 110 Ag m as trace elements, the method of non-electrolytical plating was chosen to prepare the alloy membrane. A γ-detector and electron microscope (SEM) were used for quantitative and qualitative analysis, respectively. The pre-treatment of the support before the preparation of Palladium-silver composite membranes was discussed in detail. It was found that when the concentration of PdCl 2 was between 0.5 and 2.0 mmol/L the result was good. The effects of various factors were investigated, including the proportion of Pd and Ag, the concentrations of the total metal, ammonium hydroxide hydrazine and ethylenediaminetetraacetic acid, temperature, the time, and the rotation speed. By improving the reaction conditions the alloy membrane with metallic luster was obtained. Besides, the presence of Pd and Ag was observed in the alloy membranes by qualitative analysis. (authors)

  16. THE HEAT TREATMENT ANALYSIS OF E110 CASE HARDENING STEEL

    Directory of Open Access Journals (Sweden)

    MAJID TOLOUEI-RAD

    2016-03-01

    Full Text Available This paper investigates mechanical and microstructural behaviour of E110 case hardening steel when subjected to different heat treatment processes including quenching, normalizing and tempering. After heat treatment samples were subjected to mechanical and metallographic analysis and the properties obtained from applying different processes were analysed. The heat treatment process had certain effects on the resultant properties and microstructures obtained for E110 steel which are described in details. Quenching produced a martensitic microstructure characterized by significant increase in material’s hardness and a significant decreased in its impact energy. Annealed specimens produced a coarse pearlitic microstructure with minimal variation in hardness and impact energy. For normalized samples, fine pearlitic microstructure was identified with a moderate increase in hardness and significant reduction in impact energy. Tempering had a significant effect on quenched specimens, with a substantial rise in material ductility and reduction of hardness with increasing tempering temperature. Furthermore, Results provide additional substantiation of temper embrittlement theory for low-carbon alloys, and indicate potential occurrence of temper embrittlement for fine pearlitic microstructures.

  17. Magnetoelastic coupling in TbFe2 (110) thin films

    International Nuclear Information System (INIS)

    Ciria, M.; Arnaudas, J.I.; Dufour, C.; Oderno, V.; Dumesnil, K.; del Moral, A.

    1997-01-01

    We have determined the rhombohedral magnetoelastic stress of a Laves phase TbFe 2 (110) single-crystal film, grown by molecular-beam epitaxy. The film thickness was 1300 Angstrom. The magnetoelastic stress was directly measured by using a low-temperature cantilever capacitive method, between 300 and 10 K. The isotherms clearly display the coercive field but, unlike bulk alloy behavior, do not saturate even at the maximum field of 12 T. The determined rhombohedral magnetoelastic parameter of the film is B ε,2 =-0.43 GPa, at 0 K and 12 T, which is 0.67 times the value for bulk TbFe 2 . B ε,2 follows a power m 3 of the reduced magnetization m, indicating a single-ion volume origin for the rhombohedral magnetoelastic stress of this film. Measurements performed in a 300 Angstrom TbFe 2 (110) film deposited onto a YFe 2 buffer show that the coercive field is drastically lowered and that the magnetoelastic distortion is negligible. copyright 1997 American Institute of Physics

  18. Controlling Self-Assembly in Al(110) Homoepitaxy

    Science.gov (United States)

    Tiwary, Yogesh; Fichthorn, Kristen

    2010-03-01

    Homoepitaxial growth on Al(110) exhibits nanoscale self-assembly into huts with well-defined (100) and (111) facets [1]. Although some of the diffusion mechanisms underlying this kinetic self-assembly were identified and incorporated into a two-dimensional model [2], we used density-functional theory (DFT) to identify many other mechanisms that are needed to describe the three-dimensional assembly seen experimentally [3]. We developed a three-dimensional kinetic Monte Carlo (KMC) model of Al(110) homoepitaxy. The inputs to the model were obtained from DFT [3,4]. Our model is in agreement with experimentally observed trends for this system. We used KMC to predict self-assembly under various growth conditions. To achieve precise placement of Al nanohuts, we simulated thermal-field-directed assembly [5]. Our results indicate that this technique can be used to create uniform arrays of nanostructures. [1] F. Buatier de Mongeot, W. Zhu, A. Molle, R. Buzio, C. Boragno, U. Valbusa, E. Wang, and Z. Zhang, Phys. Rev. Lett. 91, 016102 (2003). [2] W. Zhu, F. Buatier de Mongeot, U. Valbusa, E. G. Wang, and Z. Y. Zhang, Phys. Rev. Lett. 92, 106102 (2004). [3] Y. Tiwary and K. A. Fichthorn, submitted to Phys. Rev. B. [4] Y. Tiwary and K. A. Fichthorn, Phys. Rev. B 78, 205418 (2008). [5] C. Zhang and R. Kalyanaraman, Appl. Phys. Lett. 83, 4827 (2003).

  19. Surface Preparation of InAs (110 Using Atomic Hydrogen

    Directory of Open Access Journals (Sweden)

    T.D. Veal

    2002-06-01

    Full Text Available Atomic hydrogen cleaning has been used to produce structurally and electronically damage-free InAs(110 surfaces.  X-ray photoelectron spectroscopy (XPS was used to obtain chemical composition and chemical state information about the surface, before and after the removal of the atmospheric contamination. Low energy electron diffraction (LEED and high-resolution electron-energy-loss spectroscopy (HREELS were also used, respectively, to determine the surface reconstruction and degree of surface ordering, and to probe the adsorbed contaminant vibrational modes and the collective excitations of the clean surface. Clean, ordered and stoichiometric  InAs(110-(1×1 surfaces were obtained by exposure to thermally generated atomic hydrogen at a substrate temperature as low as 400ºC.  Semi-classical dielectric theory analysis of HREEL spectra of the phonon and plasmon excitations of the clean surface indicate that no electronic damage or dopant passivation were induced by the surface preparation method.

  20. Cu induced reactions on 110Cd-108Cd-106Cd, 109Ag-107Ag and 110Pd. New rhenium, osmium and iridium isotopes

    International Nuclear Information System (INIS)

    Cabot, C.; Della Negra, S.; Deprun, C.; Gauvin, H.; Le Beyec, Y.

    1978-01-01

    By 63 Cu induced reactions on 110 Cd, 108 Cd, 106 Cd, 109 Ag, 107 Ag and 110 Pd targets, new isotopes were searched in the Ir, Os, Re region. Cross bombardments and excitation function measurements were used to identify new α emitting isotopes. The α-decay measurements are compared to the Qα values obtained from different mass predictions

  1. Contemporary management of spinal AVFs and AVMs: lessons learned from 110 cases.

    Science.gov (United States)

    Rangel-Castilla, Leonardo; Russin, Jonathan J; Zaidi, Hasan A; Martinez-Del-Campo, Eduardo; Park, Min S; Albuquerque, Felipe C; McDougall, Cameron G; Nakaji, Peter; Spetzler, Robert F

    2014-09-01

    Spinal arteriovenous fistulas (AVFs) and arteriovenous malformations (AVMs) are rare, complex spinal vascular lesions that are challenging to manage. Recently, understanding of these lesions has increased thanks to neuroimaging technology. Published reports of surgical results and clinical outcome are limited to small series. The authors present a large contemporary series of patients with spinal AVFs and AVMs who were treated at Barrow Neurological Institute in Phoenix, Arizona. Retrospective detailed review of a prospective vascular database was performed for all patients with spinal AVFs and AVMs treated between 2000 and 2013. Patient demographic data, AVF and AVM characteristics, surgical results, clinical outcomes, complications, and long-term follow-up were reviewed. Between 2000 and 2013, 110 patients (57 male and 53 female) underwent obliteration of spinal AVFs and AVMs. The mean age at presentation was 42.3 years (range 18 months-81 years). There were 44 patients with AVFs and 66 with AVMs. The AVM group included 27 intramedullary, 21 conus medullaris, 12 metameric, and 6 extradural. The most common location was thoracic spine (61%), followed by cervical (22.7%), lumbar (14.5%), and sacral (1.8%). The most common presenting signs and symptoms included paresis/paralysis (75.5%), paresthesias (60%), pain (51.8%), bowel/bladder dysfunction (41.8%), and myelopathy (36.4%). Evidence of rupture was seen in 26.4% of patients. Perioperative embolization was performed in 42% of patients. Resection was performed in 95 patients (86.4%). Embolization alone was the only treatment in 14 patients (12.7%). One patient was treated with radiosurgery alone. Angiographically verified AVF and AVM obliteration was achieved in 92 patients (83.6%). At a mean follow-up duration of 30.5 months (range 1-205 months), 43 patients (97.7%) with AVFs and 57 (86.4%) with AVMs remained functionally independent (McCormick Scale scores ≤ 2). Perioperative complications were seen in 8

  2. Bench-scale crossflow filtration of Hanford tank C-106, C-107, B-110, and U-110 sludge slurries

    International Nuclear Information System (INIS)

    Geeting, J.G.H.; Reynolds, B.A.

    1997-09-01

    Pacific Northwest National Laboratory has a bench-scale crossflow filter installed in a shielded hot cell for testing radioactive feeds. During FY97 experiments were conducted on slurries from radioactive Hanford waste from tanks C-106, C-107, B-110, and U-110. Each tank was tested at three slurry concentrations (8, 1.5, and 0.05 wt% solids). A two-parameter central composite design which tested transmembrane pressure from 5 to 40 psig and axial velocity from 3 to 9 ft/s was used for all feeds. Crossflow filtration was found to remove solids effectively, as judged by filtrate clarity and radiochemical analysis. If the filtrates from these tests were immobilized in a glass matrix, the resulting transuranic and ( 90 Sr) activity would not breach low activity waste glass limits of 100nCi/g (TRU) and 20 μCi/ml ( 90 Sr). Two exceptions were the transuranic activity in filtrates from processing 1.5 and 8 wt% C-106 tank waste. Subsequent analyses indicated that the source of the TRU activity in the filtrate was most likely due to soluble activity, but obviously proved ineffective at removing the soluble plutonium species. Re-testing of the C-106 supported this hypothesis. These data suggest the need to control carbonate and pH when processing tank wastes for immobilization

  3. Dielectric Spectroscopy of Biomolecules up to 110 GHz

    Science.gov (United States)

    Laux, Eva-Maria; Ermilova, Elena; Pannwitz, Daniel; Gibbons, Jessica; Hölzel, Ralph; Bier, Frank F.

    2018-03-01

    Radio-frequency fields in the GHz range are increasingly applied in biotechnology and medicine. In order to fully exploit both their potential and their risks detailed information about the dielectric properties of biological material is needed. For this purpose a measuring system is presented that allows the acquisition of complex dielectric spectra over 4 frequency decade up to 110 GHz. Routines for calibration and for data evaluation according to physicochemical interaction models have been developed. The frequency dependent permittivity and dielectric loss of some proteins and nucleic acids, the main classes of biomolecules, and of their sub-units have been determined. Dielectric spectra are presented for the amino acid alanine, the proteins lysozyme and haemoglobin, the nucleotides AMP and ATP, and for the plasmid pET-21, which has been produced by bacterial culture. Characterisation of a variety of biomolecules is envisaged, as is the application to studies on protein structure and function.

  4. CP110 exhibits novel regulatory activities during centriole assembly in Drosophila

    Science.gov (United States)

    Franz, Anna; Roque, Hélio; Saurya, Saroj; Dobbelaere, Jeroen

    2013-01-01

    CP110 is a conserved centriole protein implicated in the regulation of cell division, centriole duplication, and centriole length and in the suppression of ciliogenesis. Surprisingly, we report that mutant flies lacking CP110 (CP110Δ) were viable and fertile and had no obvious defects in cell division, centriole duplication, or cilia formation. We show that CP110 has at least three functions in flies. First, it subtly influences centriole length by counteracting the centriole-elongating activity of several centriole duplication proteins. Specifically, we report that centrioles are ∼10% longer than normal in CP110Δ mutants and ∼20% shorter when CP110 is overexpressed. Second, CP110 ensures that the centriolar microtubules do not extend beyond the distal end of the centriole, as some centriolar microtubules can be more than 50 times longer than the centriole in the absence of CP110. Finally, and unexpectedly, CP110 suppresses centriole overduplication induced by the overexpression of centriole duplication proteins. These studies identify novel and surprising functions for CP110 in vivo in flies. PMID:24297749

  5. First excited states in doubly-odd 110Sb: Smooth band termination in the A ∼ 110 region

    International Nuclear Information System (INIS)

    Lane, G.J.; Fossan, D.B.; Thorslund, I.

    1996-01-01

    Excited states have been identified for the first time in 110 Sb in a comprehensive series of γ-spectroscopy experiments, including recoil-mass and neutron-field measurements. Three high-spin decoupled bands with configurations based on 2p-2h excitations across the Z = 50 shell gap, are observed to show the features of smooth band termination, the first such observation in an odd-odd nucleus. The yrast intruder band has been connected to the low spin levels and is tentatively identified up to its predicred termination at I π = (45 + ). Detailed configuration assignments are made through comparison with configuration-dependent cranked Nilsson-Strutinsky calculations; excellent agreement with experiment is obtained. The systematic occurrence of smoothly terminating bands in the neighboring isotopes is discussed

  6. Tank characterization report for single-shell tank 241-U-110. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, T.M.; Jensen, L.

    1993-09-01

    Tank 241-U-110 (U-110) is a Hanford Site waste tank that was ;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report.

  7. Tank characterization report for single-shell tank 241-U-110

    International Nuclear Information System (INIS)

    Brown, T.M.; Jensen, L.

    1993-09-01

    Tank 241-U-110 (U-110) is a Hanford Site waste tank that was;most recently sampled in November and December 1989. Analysis of the samples obtained from tank U-110 was conducted to support the characterization of the contents of this tank and to support Hanford Federal Facility Agreement and Consent Order milestone M-10-00 (Ecology, et al. 1992). Because of incomplete recovery of the waste during sampling, there may be bias in the results of this characterization report

  8. Topical corticosteroid-induced rosacea-like dermatitis: A clinical study of 110 cases

    Directory of Open Access Journals (Sweden)

    Sanjay K Rathi

    2011-01-01

    Full Text Available Background: Prolonged and continuous use of topical steroids leads to rosacea-like dermatitis with variable clinical presentations. Aims: To study the various clinical presentations of patients with topical corticosteroid-induced rosacea-like dermatitis (TCIRD, who had a history of prolonged and repeated use of topical steroids for reasons other than the known disease entities. Methods: A total of 110 patients were enrolled for the study over a period of 2 years, excluding all those with the known disease entity in which topical steroids were commonly used. Detailed history which also included the source and the type of topical steroid use was taken along with clinical examination. Results: There were 12 males and 98 females with their age ranging from 18 to 54 years. The duration of topical steroid use ranged from 4 months to 20 years. The most common clinical presentation was diffuse erythema of the face. Most of the patients had rebound phenomenon on discontinuation of the steroid. The most common topical steroid used was Betamethasone valerate, which could be due to its easy availability and low cost. Conclusion: Varied clinical presentations are seen with prolonged and continuous use of topical steroids. The treatment of this dermatitis is difficult, requiring complete cessation of the offending steroid, usually done in a tapering fashion.

  9. Structure and optical properties of water covered Cu(110) surfaces

    International Nuclear Information System (INIS)

    Baghbanpourasl, A.

    2014-01-01

    In this thesis structural and optical properties of the water covered Cu(110) surface is studied using density functional theory within independent particle approximation. Several stable adsorption structures are studied such as water clusters (monomer, dimer, trimer, tetramer and pentamer), different hexagonal monolayers, partially dissociated water monolayers and three different types of chains among them a chain that consists of pentagon rings. For a copper surface in contact with water vapor, the energetically stable H 2 O/OH adsorbed structures are compared thermodynamically using adsorption free energy (change of free energy due to adsorption). Several phase diagrams with respect to temperature and pressure are calculated. It is found that among the large number of energetically stable structures (i.e. structures with positive adsorption energy ) only limited number of them are thermodynamically stable. These thermodynamically stable structures are the class of almost energetically degenerate hexagonal overlayers, one type of partially dissociated water structure that contains Bjerrum defect in the hydrogen bond network and pentagon chain. Since hydrogen atoms are light weight their vibrational effects can be considerable. Zero point vibration decreases the adsorption energy up to 0.1 eV and free energy of adsorbed molecules arising from vibrational degree of freedom can go up to -0.2 eV per adsorbed molecule at 500 Kelvin. However zero point energy and vibrational free energy of adsorbed molecules do not alter relative stability of the adsorbed structures. To account for the long range van der Waals interactions, a semi-empirical scheme is applied. Reflectance Anisotropy Spectroscopy (RAS) is a fast and non destructive optical method that can be used to prob the surface in different conditions such as vacuum and electro-chemical environment. Elasto-optic coeficients of bulk are calculated from first principles and the change of the RA spectrum of the bare Cu

  10. Efficient reduction of Cys110 thiyl radical by glutathione in human myoglobin

    OpenAIRE

    Nagao, Satoshi; Asami, Osamu; Yasui, Hiroyuki; Hirota, Shun

    2011-01-01

    Human myoglobin (hMb) possesses a cysteine (Cys) residue which is rare among mammalian Mbs. To investigate the effects of this unique Cys residue at the amino acid position 110 (Cys110) on hMb reactions, we studied the reactions of wild type (WT) methMb and its alanine mutant at Cys110 (C110A) with H2O2, particularly in the presence of reduced glutathione (GSH) which is well known as a reducing agent. The formation rates of the ferryloxo (Fe(IV) = O) species by H2O2 under air were about the s...

  11. Dosimetric advantages of proton therapy over conventional radiotherapy with photons in young patients and adults with low-grade glioma

    Energy Technology Data Exchange (ETDEWEB)

    Harrabi, S.B.; Herfarth, K. [Heidelberg Institute of Radiation Oncology (HIRO), Heidelberg (Germany); Heidelberg Ion-Beam Therapy Center (HIT), Heidelberg (Germany); University Hospital Heidelberg, Dept. of Radiation Oncology, Heidelberg (Germany); Bougatf, N. [Heidelberg Institute of Radiation Oncology (HIRO), Heidelberg (Germany); University Hospital Heidelberg, Dept. of Radiation Oncology, Heidelberg (Germany); German Cancer Research Center (DKFZ), Department of Medical Physics in Radiation Oncology, Heidelberg (Germany); Mohr, A. [Heidelberg Institute of Radiation Oncology (HIRO), Heidelberg (Germany); University Hospital Heidelberg, Dept. of Radiation Oncology, Heidelberg (Germany); Haberer, T. [Heidelberg Institute of Radiation Oncology (HIRO), Heidelberg (Germany); Heidelberg Ion-Beam Therapy Center (HIT), Heidelberg (Germany); Combs, S.E. [Helmholtz Zentrum Muenchen, Department of Radiation Sciences (DRS), Institute of Innovative Radiotherapy (iRT), Oberschleissheim (Germany); Deutsches Konsortium fuer Translationale Krebsforschung (dktk), Partner Site Munich, Munich (Germany); Debus, J.; Adeberg, S. [Heidelberg Institute of Radiation Oncology (HIRO), Heidelberg (Germany); Heidelberg Ion-Beam Therapy Center (HIT), Heidelberg (Germany); University Hospital Heidelberg, Dept. of Radiation Oncology, Heidelberg (Germany); German Cancer Research Center (DKFZ), Clinical Cooperation Unit Radiation Oncology, Heidelberg (Germany)

    2016-11-15

    Low-grade glioma (LGG) is a very common brain tumor in pediatric patients typically associated with a very good prognosis. This prognosis makes it imperative that the risk of long-term treatment-related side effects be kept at an absolute minimum. Proton therapy (PRT) provides a radiation technique that has the potential to further reduce the genesis of radiogenic impairment. We retrospectively assessed 74 patients with LGG who underwent PRT. Conventional three-dimensional photon and PRT plans were generated after contouring structures of neurogenesis, crucial neuronal structures, and areas susceptible to secondary malignancies. Target volume coverage was evaluated using the homogeneity index (HI) and inhomogeneity coefficient (IC). Results were compared using the Wilcoxon-signed rank test, with p < 0.05 being statistically significant. Target volume coverage was comparable for the photon and proton plans. Overall, we could show an essential reduction in maximal, mean, and integral doses in critical neurologic structures, areas of neurogenesis, and structures of neurocognitive function. The study indicated specifically how contralaterally located structures could be spared with PRT. PRT is a highly conformal radiation technique offering superior dosimetric advantages over conventional radiotherapy by allowing significant dose reduction for organs at risk (OAR) that are essential for neurologic function, neurocognition, and quality of life, thus demonstrating the potential of this technique for minimizing long-term sequelae. (orig.) [German] Niedriggradige Gliome (LGG) zaehlen zu den haeufigsten Hirntumoren im Kindesalter und sind ueblicherweise mit einer sehr guten Prognose vergesellschaftet. Es gilt daher, das Risiko fuer therapieassoziierte Spaetfolgen so gering wie moeglich zu halten. Mit der Protonenbestrahlung steht eine Bestrahlungsmodalitaet zur Verfuegung, mit der das Auftreten radiogener Spaetfolgen im Vergleich zu konventionellen Bestrahlungstechniken

  12. The DIII-D 3 MW, 110 GHz ECH System

    International Nuclear Information System (INIS)

    Callis, R.W.; Lohr, J.; Ponce, D.; O'Neill, R.C.; Prater, R.; Luce, T.C.

    1999-01-01

    Three 110 GHz gyrotrons with nominal output power of 1 MW each have been installed and are operational on the DIII-D tokamak. One gyrotron is built by Gycom and has a nominal rating of 1 MW and a 2 s pulse length, with the pulse length being determined by the maximum temperature allowed on the edge cooled Boron Nitride window. The second and third gyrotrons were built by Communications and Power Industries (CPI). The first CPI gyrotron uses a double disc FC-75 cooled sapphire window which has a pulse length rating of 0.8 s at 1 MW, 2s at 0.5 MW and 10s at 0.35 MW. The second CPI gyrotron, utilizes a single disc chemical-vapor-deposition diamond window, that employs water cooling around the edge of the disc. Calculation predict that the diamond window should be capable of full 1 MW cw operation. All gyrotrons are connected to the tokamak by a low-loss-windowless evacuated transmission line using circular corrugated waveguide for propagation in the HEl 1 mode. Each waveguide system incorporates a two mirror launcher which can steer the rf beam poloidally from the center to the outer edge of the plasma. Central current drive experiments with the two gyrotrons with 1.5 MW of injected power drove about 0.17 MA. Results from using the three gyrotron systems will be reported as well as the plans to upgrade the system to 6 MW

  13. p110α Hot Spot Mutations E545K and H1047R Exert Metabolic Reprogramming Independently of p110α Kinase Activity.

    Science.gov (United States)

    Chaudhari, Aditi; Krumlinde, Daniel; Lundqvist, Annika; Akyürek, Levent M; Bandaru, Sashidhar; Skålén, Kristina; Ståhlman, Marcus; Borén, Jan; Wettergren, Yvonne; Ejeskär, Katarina; Rotter Sopasakis, Victoria

    2015-10-01

    The phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) catalytic subunit p110α is the most frequently mutated kinase in human cancer, and the hot spot mutations E542K, E545K, and H1047R are the most common mutations in p110α. Very little is known about the metabolic consequences of the hot spot mutations of p110α in vivo. In this study, we used adenoviral gene transfer in mice to investigate the effects of the E545K and H1047R mutations on hepatic and whole-body glucose metabolism. We show that hepatic expression of these hot spot mutations results in rapid hepatic steatosis, paradoxically accompanied by increased glucose tolerance, and marked glycogen accumulation. In contrast, wild-type p110α expression does not lead to hepatic accumulation of lipids or glycogen despite similar degrees of upregulated glycolysis and expression of lipogenic genes. The reprogrammed metabolism of the E545K and H1047R p110α mutants was surprisingly not dependent on altered p110α lipid kinase activity. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  14. Targeting p110gamma in gastrointestinal cancers: attack on multiple fronts

    Directory of Open Access Journals (Sweden)

    Marco eFalasca

    2014-10-01

    Full Text Available Phosphoinositide 3-kinases (PI3Ks regulate several cellular functions that are critical for cancer progression and development, including cell survival, proliferation and migration. Three classes of PI3Ks exist with the class I PI3K encompassing four isoforms of the catalytic subunit known as p110α, p110β, p110γ and p110δ. Although for many years attention has been mainly focused on p110α recent evidence supports the conclusion that p110β, p110γ and p110δ can also have a role in cancer. Amongst these, accumulating evidence now supports the conclusion that p110γ is involved in several cellular processes associated with cancer development and progression and indeed this specific isoform has emerged as a novel important player in cancer progression. Studies from our laboratory have identified a specific overexpression of p110γ in human pancreatic ductal adenocarcinoma (PDAC and in hepatocellular carcinoma (HCC tissues compared to their normal counterparts. Our data have further established that selective inhibition of this PI3K isoform is able to block PDAC and HCC cell proliferation, strongly suggesting that pharmacological inhibition of this enzyme can directly affect these tumors growth. Furthermore increasing evidence suggests that p110γ plays also a key role in the interactions between cancer cells and tumor microenvironment and in particular in tumor-associated immune response. It has also been reported that p110γ can regulate invasion of myeloid cells into tumors and tumor angiogenesis. Finally p110γ has also been directly involved in regulation of cancer cell migration. Taken together these data indicate that p110γ plays multiple roles in regulation of several processes that are critical for tumor progression and metastasis. This review will discuss the role of p110γ in gastrointestinal tumor development and progression and how targeting this enzyme might represent a way to target very aggressive tumors such as pancreatic and

  15. Development of API 5 CT grade P110 steel casing; Desenvolvimento de tubos casing API 5 CT grau P110

    Energy Technology Data Exchange (ETDEWEB)

    Kojima, Sergio Seijo; Roza, Juliana Espinossi

    2003-07-01

    This paper has as objective to discuss the results gotten in experiences carried through in industrial scale for the development of pipes class API 5CT P110 (1), with 244 mm of diameter and 12 mm of thickness. The pipes were welded longitudinally by process ERW (electric resistance welding) and submitted to quenching and tempering heat treatments. A C-Mn-Cr alloy with adequate quenching ability was used for the attainment of a martensite microstructure after quenching. The pipes at a temperature of 880 deg C were quenched in water and subsequently tempered at 515 deg C. The integrity of the weld region was evaluated through non destructive tests and flattening tests, Charpy impact tests and fracture toughness tests (CTOD). The pipes achieved the tension properties stipulated in the standard (yield strength bigger limit of 758 Mpa), and also the energy in the Charpy impact test (transversal), considering that the energy value obtained was 55 J (at 0 deg C) for base metal and 44 J in the weld metal. (author)

  16. Translocation, accumulation and distribution of 110mAg in carp

    International Nuclear Information System (INIS)

    Li Chuanzhao; Zhao Wenhu; Xu Shiming

    1995-01-01

    The experimental carp were raised in the water with 110m Ag specific activity of 3.7 x 10 2 Bq/L, 3.7 x 10 3 Bq/L, 3.7 x 10 4 Bq/L respectively. The carp were sampled after raising 1,2,3,5,7,9,12,15,18,21 and 23 days, and separated into scale, bone, muscle, gill, alimentary canal, heart and heptapancreas for measuring the radioactivity. The results showed that 110m Ag was absorbed rapidly by carp via gill and alimentary canal from water, and distributed into all parts of the body, mainly in soft tissue with blood circulation. 110m Ag accumulation of the body increased with the 110m Ag specific activity in the water in the same raising time. The accumulation of 110m Ag in gill, alimentary canal, heart, muscle and bone appeared mono-peak curves with raising time. There was a linear relationship between the specific activity of 110m Ag in heptapancreas and the carp's raising time in 110m Ag water. The concentration abilities for 110m Ag in all organs were in the order of heptapancreas>gill>alimentary>canal>heart>muscle>bone

  17. 32 CFR 37.110 - What type of instruments are technology investment agreements (TIAs)?

    Science.gov (United States)

    2010-07-01

    ... investment agreements (TIAs)? 37.110 Section 37.110 National Defense Department of Defense OFFICE OF THE... What type of instruments are technology investment agreements (TIAs)? TIAs are assistance instruments used to stimulate or support research. As discussed in appendix B to this part, a TIA may be either a...

  18. 42 CFR 415.110 - Conditions for payment: Medically directed anesthesia services.

    Science.gov (United States)

    2010-10-01

    ... anesthesia services. 415.110 Section 415.110 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... directed anesthesia services. (a) General payment rule. Medicare pays for the physician's medical direction of anesthesia services for one service or two through four concurrent anesthesia services furnished...

  19. 33 CFR 110.190 - Tortugas Harbor, in vicinity of Garden Key, Dry Tortugas, Fla.

    Science.gov (United States)

    2010-07-01

    ... Garden Key, Dry Tortugas, Fla. 110.190 Section 110.190 Navigation and Navigable Waters COAST GUARD..., in vicinity of Garden Key, Dry Tortugas, Fla. (a) The anchorage grounds. All of Bird Key Harbor, southwest of Garden Key, bounded by the surrounding reefs and shoals and, on the northeast, by a line...

  20. 40 CFR 427.110 - Applicability; description of the wet dust collection subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the wet dust collection subcategory. 427.110 Section 427.110 Protection of Environment ENVIRONMENTAL PROTECTION... (particulates) from atmospheric emissions by means of wet scrubbers. ...

  1. 33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.

    Science.gov (United States)

    2010-07-01

    ... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi Sound...

  2. 22 CFR 208.110 - What is the purpose of the nonprocurement debarment and suspension system?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the purpose of the nonprocurement debarment and suspension system? 208.110 Section 208.110 Foreign Relations AGENCY FOR INTERNATIONAL... the nonprocurement debarment and suspension system? (a) To protect the public interest, the Federal...

  3. 47 CFR 25.110 - Filing of applications, fees, and number of copies.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Filing of applications, fees, and number of copies. 25.110 Section 25.110 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing...

  4. 33 CFR 110.168 - Hampton Roads, Virginia and adjacent waters (Datum: NAD 83).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hampton Roads, Virginia and adjacent waters (Datum: NAD 83). 110.168 Section 110.168 Navigation and Navigable Waters COAST GUARD..., Virginia and adjacent waters (Datum: NAD 83). (a) Anchorage Grounds—(1) Anchorage A [Naval Anchorage]. The...

  5. 33 CFR 110.235 - Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). 110.235 Section 110.235 Navigation and Navigable Waters COAST... Pacific Ocean (Mamala Bay), Honolulu Harbor, Hawaii (Datum: NAD 83). (a) The anchorage grounds—(1...

  6. 49 CFR 110.90 - Grant monitoring, reports, and records retention.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION HAZARDOUS MATERIALS PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.90 Grant monitoring, reports... originally planned. (4) Financial reporting, except as provided in § 110.70 and 49 CFR 18.41, shall be... accordance with 49 CFR 18.42, all financial and programmatic records, supporting documents, statistical...

  7. 33 CFR 110.8 - Lake Champlain, N.Y. and Vt.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Champlain, N.Y. and Vt. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.8 Lake Champlain, N.Y. and Vt. (a) Ticonderoga, N.Y. An area shoreward of a line bearing 312° from Ticonderoga Light to the southeast corner of the...

  8. Bismuth-induced restructuring of the GaSb(110) surface

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.

    1998-01-01

    The structure of the GaSb(110)(1 x 2)-Bi reconstruction has been solved using surface x-ray diffraction, scanning tunneling microscopy, and photoelectron spectroscopy. The ideal GaSb(110) surface is terminated with zigzag chains of anions and cations running in the [1 (1) over bar 0] direction...

  9. 10 CFR 110.26 - General license for the export of nuclear reactor components.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false General license for the export of nuclear reactor components. 110.26 Section 110.26 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF... Denmark Finland France Germany Greece Indonesia Ireland Italy Japan Latvia Lithuania Luxembourg...

  10. 10 CFR 110.30 - Members of the Nuclear Suppliers Group.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Members of the Nuclear Suppliers Group. 110.30 Section 110.30 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND... Italy Japan Latvia Luxembourg Netherlands New Zealand Norway Poland Portugal Republic of Korea Romania...

  11. 41 CFR 101-4.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    .... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... action and self-evaluation. 101-4.110 Section 101-4.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 4-NONDISCRIMINATION...

  12. 31 CFR 28.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    ..., 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall, within... self-evaluation. 28.110 Section 28.110 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL...

  13. 45 CFR 618.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 3 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 618.110 Section 618.110 Public Welfare Regulations Relating to Public Welfare (Continued...

  14. 45 CFR 2555.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... 45 Public Welfare 4 2010-10-01 2010-10-01 false Remedial and affirmative action and self-evaluation. 2555.110 Section 2555.110 Public Welfare Regulations Relating to Public Welfare (Continued...

  15. 40 CFR 5.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    .... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 5.110 Section 5.110 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...

  16. 24 CFR 3.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... self-evaluation. 3.110 Section 3.110 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR...

  17. 13 CFR 113.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...

  18. 18 CFR 1317.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... affirmative action and self-evaluation. 1317.110 Section 1317.110 Conservation of Power and Water Resources TENNESSEE VALLEY AUTHORITY NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...

  19. 15 CFR 8a.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-01-01

    .... 264. (c) Self-evaluation. Each recipient education institution shall, within one year of September 29... self-evaluation. 8a.110 Section 8a.110 Commerce and Foreign Trade Office of the Secretary of Commerce NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...

  20. 29 CFR 36.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Remedial and affirmative action and self-evaluation. 36.110 Section 36.110 Labor Office of the Secretary of Labor NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...

  1. 36 CFR 1211.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... action and self-evaluation. 1211.110 Section 1211.110 Parks, Forests, and Public Property NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... affirmative action and self-evaluation. (a) Remedial action. If the designated agency official finds that a...

  2. 38 CFR 23.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... action and self-evaluation. 23.110 Section 23.110 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES...

  3. 10 CFR 5.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Remedial and affirmative action and self-evaluation. 5.110 Section 5.110 Energy NUCLEAR REGULATORY COMMISSION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION... action and self-evaluation. (a) Remedial action. If the designated agency official finds that a recipient...

  4. 21 CFR 212.110 - How must I maintain records of my production of PET drugs?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false How must I maintain records of my production of PET drugs? 212.110 Section 212.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... those not stored at the inspected establishment, must be legible, stored to prevent deterioration or...

  5. 30 CFR 260.110 - What bidding systems may MMS use?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What bidding systems may MMS use? 260.110 Section 260.110 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OUTER... MMS use? We will apply a single bidding system selected from those listed in this section to each...

  6. 12 CFR 1.110 - Taxing powers of a State or political subdivision.

    Science.gov (United States)

    2010-01-01

    ... impact of any possible limitations regarding the State's or political subdivision's taxing powers, as... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Taxing powers of a State or political subdivision. 1.110 Section 1.110 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY...

  7. 47 CFR 68.110 - Compatibility of the public switched telephone network and terminal equipment.

    Science.gov (United States)

    2010-10-01

    ... changes in its communications facilities, equipment, operations or procedures, where such action is... in this part. If such changes can be reasonably expected to render any customer's terminal equipment... network and terminal equipment. 68.110 Section 68.110 Telecommunication FEDERAL COMMUNICATIONS COMMISSION...

  8. 37 CFR 1.10 - Filing of correspondence by “Express Mail.”

    Science.gov (United States)

    2010-07-01

    ... Office to Addressee” service of the United States Postal Service (USPS) will be considered filed with the...Express Mail.â 1.10 Section 1.10 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions General...

  9. 33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Galveston Harbor, Bolivar Roads Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following...

  10. Modification of male adult simulator posture of ICRP 110 reference

    International Nuclear Information System (INIS)

    Galeano, Diego C.; Souza, Divanizia N.; Santos, Willian S.; Carvalho Junior, Alberico B.

    2014-01-01

    Voxel simulators are usually constructed based on computed tomography and magnetic resonance, so the supine position (lying) is the most used. This may result in a overestimated or underestimated the radiation dose, depending on the exposure scenario adopted. Thus, the objective was to change the attitude of the male adult simulator reference ICRP 110, AM (Adult Male), to a sitting posture. For change of posture were possible, it was necessary increasing the number of slices that comprise AM simulator by reducing the height of the voxel of 8.0 mm to 2.0 mm, thus making each voxel approximately cubic. A subroutine was created in Visual Monte Carlo software (VMC) to rotate the thigh region of the simulator and position it between the region of the leg and trunk. The ScionImage software was used to rebuild and soften the contours of the knee and hip of the simulator in a sitting posture, and 3D visualization of the simulator was used VolView software. The AM simulator in the seated position has the same anatomical features of the simulator in the standing posture. Using the MCNPX code [ref] was carried out the conversion coefficients for calculating the AP irradiation geometry (anteroposterior) comparing the AM simulator standing and sitting in order to evaluate the difference scattering and absorption of radiation by the two simulators. The result shows a difference up to 100% in the fluency conversion coefficients in nearby organs located in the pelvic region and in organs with distribution in the whole body (such as skin, muscle, lymph nodes and skeletal)

  11. Quasi-optical internal mode converters for 110 GHz gyrotrons

    International Nuclear Information System (INIS)

    Harper, B.M.; Lorbeck, J.A.; Vernon, R.J.

    1995-01-01

    Many early gyrotrons had a microwave output in the same mode that was produced in the microwave cavity, e.g. the TE 02 mode. These modes were often converted outside of the tube to a more desirable mode for plasma heating using a system of perturbed-wall waveguide mode converters. The current generation of gyrotrons commonly have cavity modes with a high azimuthal index, such as the rotating TE 22,6 mode. Mode conversion by means of waveguide mode converters is not usually practical for such cases. However, an output of a Gaussian beam or other desirable field pattern can be obtained by using a Vlasov-type launcher feeding a series of two or more reflectors. This system may be placed outside or inside of the gyrotron but there are advantages to placing it within the tube, e.g. allowing for a larger collector and smaller reflectors. When such a converter system is placed inside the gyrotron, it is usually preferable to use a modification to the simple Vlasov launcher such as the Denisov-type launcher, which incorporates a series of perturbations within it. The authors have designed both internal and external versions of such quasi-optical converters. They discuss an internal converter which was designed for use inside of a Varian 110 GHz gyrotron producing the TE 22,6 cavity mode. This design consists of four reflectors which are fed by a Denisov-type launcher. Design techniques for the reflector system are discussed and experimental results are presented

  12. Diffusion of cesium and iodine in compressed IG-110 graphite compacts

    International Nuclear Information System (INIS)

    Carter, L.M.; Brockman, J.D.; Robertson, J.D.; Loyalka, S.K.

    2016-01-01

    Nuclear graphite grade IG-110 is currently used in the High Temperature Engineering Test Reactor (HTTR) in Japan for certain permanent and replaceable core components, and is a material of interest in general. Therefore, transport parameters for fission products in this material are needed. Measurement of diffusion through pressed compacts of IG-110 graphite is experimentally attractive because they are easy to prepare with homogeneous distributions of fission product surrogates. In this work, we measured diffusion coefficients for Cs and I in pressed compacts made from IG-110 powder in the 1079–1290 K temperature range, and compared them to those obtained in as-received IG-110. - Highlights: • A method for analysis of fission product diffusion in graphite by ICP-MS was applied to pressed IG-110 graphite compacts containing cesium and iodine. • Diffusion coefficients for cesium and iodine were obtained. • The measurement design simulates HTGR conditions of high temperature and flowing helium.

  13. Host transcription factor Speckled 110 kDa (Sp110), a nuclear body protein, is hijacked by hepatitis B virus protein X for viral persistence.

    Science.gov (United States)

    Sengupta, Isha; Das, Dipanwita; Singh, Shivaram Prasad; Chakravarty, Runu; Das, Chandrima

    2017-12-15

    Promyelocytic leukemia nuclear bodies (PML-NB) are sub-nuclear organelles that are the hub of numerous proteins. DNA/RNA viruses often hijack the cellular factors resident in PML-NBs to promote their proliferation in host cells. Hepatitis B virus (HBV), belonging to Hepadnaviridae family, remains undetected in early infection as it does not induce the innate immune response and is known to be the cause of several hepatic diseases leading to cirrhosis and hepatocellular carcinoma. The association of PML-NB proteins and HBV is being addressed in a number of recent studies. Here, we report that the PML-NB protein Speckled 110 kDa (Sp110) is SUMO1-modified and undergoes a deSUMOylation-driven release from the PML-NB in the presence of HBV. Intriguingly, Sp110 knockdown significantly reduced viral DNA load in the culture supernatant by activation of the type I interferon-response pathway. Furthermore, we found that Sp110 differentially regulates several direct target genes of hepatitis B virus protein X (HBx), a viral co-factor. Subsequently, we identified Sp110 as a novel interactor of HBx and found this association to be essential for the exit of Sp110 from the PML-NB during HBV infection and HBx recruitment on the promoter of these genes. HBx, in turn, modulates the recruitment of its associated transcription cofactors p300/HDAC1 to these co-regulated genes, thereby altering the host gene expression program in favor of viral persistence. Thus, we report a mechanism by which HBV can evade host immune response by hijacking the PML-NB protein Sp110, and therefore, we propose it to be a novel target for antiviral therapy. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Spin-polarized scanning tunneling microscopy of magnetic nanostructures at the example of bcc-Co/Fe(110), Fe/Mo(110), and copper phthalocyanine/Fe(1110); Spinpolarisierte Rastertunnelmikroskopie magnetischer Nanostrukturen am Beispiel von bcc-Co/Fe(110), Fe/Mo(110) und Kupfer-Phthalocyanin/Fe(110)

    Energy Technology Data Exchange (ETDEWEB)

    Methfessel, Torsten

    2010-12-09

    This thesis provides an introduction into the technique of spin-polarized scanning tunnelling microscopy and spectroscopy as an experimental method for the investigation of magnetic nanostructures. Experimental results for the spin polarized electronic structure depending on the crystal structure of ultrathin Co layers, and depending on the direction of the magnetization for ultrathin Fe layers are presented. High-resolution measurements show the position-dependent spin polarization on a single copper-phthalocyanine molecule deposited on a ferromagnetic surface. Co was deposited by molecular beam epitaxy on the (110) surface of the bodycentered cubic metals Cr and Fe. In contrast to previous reports in the literature only two layers of Co can be stabilized in the body-centered cubic (bcc) structure. The bcc-Co films on the Fe(110) surface show no signs of epitaxial distortions. Thicker layers reconstruct into a closed-packed structure (hcp / fcc). The bcc structure increases the spin-polarization of Co to P=62 % in comparison to hcp-Co (P=45 %). The temperature-dependent spin-reorientation of ultrathin Fe/Mo(110) films was investigated by spin-polarized spectroscopy. A reorientation of the magnetic easy axis from the [110] direction along the surface normal to the in-plane [001] axis is observed at T (13.2{+-}0.5) K. This process can be identified as a discontinuous reorientation transition, revealing two simultaneous minima of the free energy in a certain temperature range. The electronic structure of mono- and double-layer Fe/Mo(110) shows a variation with the reorientation of the magnetic easy axis and with the direction of the magnetization. The investigation of the spin-polarized charge transport through a copper-phthalocyanine molecule on the Fe/Mo(110) surface provides an essential contribution to the understanding of spin-transport at the interface between metal and organic molecule. Due to the interaction with the surface of the metal the HOMO-LUMO energy

  15. 38 CFR 13.110 - Escheat; post fund.

    Science.gov (United States)

    2010-07-01

    ... of a veteran intestate while a member or patient in any facility while being furnished care or... death. (See also § 14.514(c) of this chapter.) (c) Refusal of fiduciary or personal representative to...

  16. Proportion quantitative analysis and etching of {110} planes on tungsten single crystal coating surface

    Energy Technology Data Exchange (ETDEWEB)

    Mu, Rende, E-mail: dallasbiam@163.com [Beijing Institute of Aeronautical Materials, Aviation Key Laboratory of Science and Technology on Advanced Corrosion and Protection for Aviation Material, Department 5, P.O. Box 81-5, Beijing 100095 (China); Tan, Chengwen; Yu, Xiaodong [School of Material Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China)

    2016-05-05

    Tungsten single crystal and poly crystal were treated by electrolytic etching in a 3% by weight solution of NaOH in distilled water. The method for determining the proportion of {110} planes and characteristic morphology on the coating surface after electrolytic etching were investigated using EBSD and auto-focusing microscope. Then the optimization of process parameters for electrolytic etching is achieved. In order to compare the effect of process parameters, three process parameters were selected for the tungsten single crystal electrolytic etching. Through analyzing the change of {110} planes' proportion, we found that when the coatings are etched with 1.4 amp/cm{sup 2} and 3 min, {110} planes can be exposed in the greatest degree that can reach 61.4% on tubular surfaces. The proposed approach greatly improves the proportion of {110} planes relative to the original surface. - Highlights: • Tungsten single/poly crystals treated by electrolytic etching in solution of NaOH. • The {110} planes have the lower surface free energy than {112}. • Some {112} planes etched firstly, the {110} planes exposed at last during etching. • {110} planes exposed to the greatest extent with 1.4 amp/cm{sup 2} and 3 min.

  17. A study on behaviour of 110mAg in marine environment

    International Nuclear Information System (INIS)

    Xie Yunmian; Tang Wenqiao; Meng Jianyi

    2000-01-01

    The author describes a study on the behaviour of 110m Ag in marine environment. It includes the chemical species of 110m Ag in seawater, the absorption factor K d in/on sea sediment and biological concentration factor B f of marine biome for 110m Ag. The experiment and theoretical calculation indicate that 110 Ag exists as 110m AgCl 2 - : 110m Ag + ≅10 5 in seawater and AgCl precipitation is formed when [Ag + ][Cl - ]≥1.56 x 10 -10 . K d in/on sediment decreases with increasing of temperature and/or liquid/solid ratio. The effect of water nature on K d is very considerable. And the K d on sediment is in the order of 10 2 mL/g under the seawater atmosphere, which is two orders lower than under the freshwater atom sphere, 110m Ag is concentrated by marine biome strongly. B f is in the range of 10 2 -10 4 depending on different kind of marine biome

  18. Detection of stacking faults breaking the [110]/[110] symmetry in ferromagnetic semiconductors (Ga,Mn)As and (Ga,Mn)(As,P)

    International Nuclear Information System (INIS)

    Kopecky, M.; Kub, J.; Maca, F.; Masek, J.; Pacherova, O.; Rushforth, A. W.; Gallagher, B. L.; Campion, R. P.; Novak, V.; Jungwirth, T.

    2011-01-01

    We report on high-resolution x-ray diffraction measurements of (Ga,Mn)As and (Ga,Mn)(As,P) epilayers. We observe a structural anisotropy in the form of stacking faults that are present in the (111) and (111) planes and absent in the (111) and (111) planes. They occupy 10 -2 %-10 -1 % of the ferromagnetic epilayer volume while no stacking faults are detected in the controlled, undoped GaAs epilayer. Full-potential density functional calculations provide additional evidence that the formation of the stacking faults is promoted by Mn attracted to these structural defects. The enhanced Mn density along the common [110] direction of the stacking fault planes produces a symmetry-breaking mechanism of a strength and sense that can account for the uniaxial [110]/[110] magnetocrystalline anisotropy of these ferromagnetic semiconductors.

  19. Silencing p110β prevents rapid depletion of nuclear pAkt

    International Nuclear Information System (INIS)

    Ye, Zhi-wei; Ghalali, Aram; Högberg, Johan; Stenius, Ulla

    2011-01-01

    Highlights: ► p110β was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. ► p110β knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. ► Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110β subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110β in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110β knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110β is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110β knock out cells. We also found that p110β was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110β is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.

  20. Uptake and excretion of 110mAg by Mud carp Cirrhina molitorella

    International Nuclear Information System (INIS)

    Chen Shunhua; Zhong Chuangguang

    2004-01-01

    Accumulation, excretion and tissue distribution of 110m Ag from both labeled food and water pathways in juvenile mud carp Cirrhina molitorella were investigated. Results indicated that the excretion rate of 110m Ag uptaken from artificial food pathway was very fast. 24 hours after feeding, the radioactivity of the fish decreased rapidly to 2.62% of the initial one and maintained the similar level afterwards in the 7 days excretion experiment. On the 7th day of excretion, the fish were dissected to separate the organs and tissues. The distribution of 110m Ag in the fish was uneven. Radioactivity of 110m Ag in the organs and tissues was in the order as liver>intestine>gall bladder>eye>gill>remainder>muscle. The radioactivity in liver, intestine and gall bladder were 48.14%, 18/43% and 15.43% of the total radioactivity of the fish, respectively. The accumulation of waterborne 110m Ag by mud carp showed that 110m Ag was easy to be uptaken by the fish. the concentration factors at 8th hour and 13th day were 23.8 and 208.6 respectively. Excretion of 110m Ag uptaken from water pathway was slower than that from food pathway. The radioactivity decreased to 20.1% and 16.7% on 15th and 28th day, respectively. The excretion procedure was composed of fast excretion phase (0-2d) and slow excretion phase (2-28d). The half-life of 110m Ag in mud carp in the slow excretion phase was 22d during the slow excretion phase. The distribution of 110m Ag in organs and tissues was mainly in viscera, which accounted for about 80% of the total radioactivity of the fish

  1. Silencing p110{beta} prevents rapid depletion of nuclear pAkt

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Zhi-wei; Ghalali, Aram; Hoegberg, Johan [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden); Stenius, Ulla, E-mail: ulla.stenius@ki.se [Institute of Environmental Medicine, Karolinska Institutet, S-17177 Stockholm (Sweden)

    2011-12-02

    Highlights: Black-Right-Pointing-Pointer p110{beta} was essential for the statin- and ATP-induced depletion of nuclear pAkt and an associated inhibition of growth. Black-Right-Pointing-Pointer p110{beta} knock-out inhibited statin-induced changes in binding between FKBP51, pAkt and PTEN. Black-Right-Pointing-Pointer Data supports the hypothesis that nuclear pAkt is important for anti-cancer effects of statins. -- Abstract: The p110{beta} subunit in the class IA PI3K family may act as an oncogene and is critical for prostate tumor development in PTEN knockout mice. We tested the possible involvement of p110{beta} in a recently described rapid depletion of phosphorylated Akt (pAkt) in the nucleus. Previous work showed that this down-regulation is induced by extracellular ATP or by statins and is mediated by the purinergic receptor P2X7. Here, we used p110{beta} knock out mouse embryonic fibroblasts (MEFs) and siRNA-treated cancer cells. We found that p110{beta} is essential for ATP- or statin-induced nuclear pAkt depletion in MEFs and in several cancer cell lines including prostate cancer cells. ATP, statin or the selective P2X7 agonist BzATP also inhibited cell growth, and this inhibition was not seen in p110{beta} knock out cells. We also found that p110{beta} was necessary for statin-induced changes in binding between FKBP51, pAkt and PTEN. Our data show that p110{beta} is essential for the ATP- and statin-induced effects and support a role of nuclear pAkt in cancer development. They also provide support for a chemopreventive effect of statins mediated by depletion of nuclear pAkt.

  2. First-principles studies on the adsorption of molecular oxygen on Ba(110) surface

    International Nuclear Information System (INIS)

    Li, S.F.; Xue Xinlian; Li Pinglin; Li Xinjian; Jia Yu

    2006-01-01

    The adsorption of O 2 on Ba(110) surface is studied with first-principles calculations based on density functional theory. Our calculations predict that O 2 may prefer to dissociative adsorption on Ba(110) surface without obvious barrier. Also our results do not support the model of charge transfer from the surface to the molecule as a bond breaking mechanism. Instead, the increasing hybridization between O 2 orbitals and the d states of Ba(110) surface may play an important role in the dissociation adsorption

  3. LSMO-STO(110) multilayered structure grown by metalorganic aerosol deposition

    International Nuclear Information System (INIS)

    Sapoval, Oleg; Belenchuk, Alexander; Canter, Valeriu; Zasavitsky, Efim; Moshnyaga, Vasily

    2013-01-01

    La 0.67 Sr 0.33 MnO 3 -SrTiO 3 multilayered structure was grown on SrTiO 3 (110) substrates by metalorganic aerosol deposition technique. The crystal structure was examined by X-ray analysis including simulation of diffraction and reflection patterns. The magneto transport properties of superlattice are presented. The critical thickness of (110)-oriented LSMO layers is lower than 7 perovskite unite cells. The oxygen stoichiometry provided due to high gas pressure conditions is responsible for reducing of critical thickness of LSMO layers at LSMO-STO(110) interfaces. (authors)

  4. Real-time simulation of an F110/STOVL turbofan engine

    Science.gov (United States)

    Drummond, Colin K.; Ouzts, Peter J.

    1989-01-01

    A traditional F110-type turbofan engine model was extended to include a ventral nozzle and two thrust-augmenting ejectors for Short Take-Off Vertical Landing (STOVL) aircraft applications. Development of the real-time F110/STOVL simulation required special attention to the modeling approach to component performance maps, the low pressure turbine exit mixing region, and the tailpipe dynamic approximation. Simulation validation derives by comparing output from the ADSIM simulation with the output for a validated F110/STOVL General Electric Aircraft Engines FORTRAN deck. General Electric substantiated basic engine component characteristics through factory testing and full scale ejector data.

  5. Effect of different treatments on 110m Ag plant uptake in various soil types

    International Nuclear Information System (INIS)

    Szerbin, P.; Koblinger-Bokori, E.

    1996-01-01

    110m Ag contamination may occur as a result of atmospheric release either during normal operation of nuclear power plants or in accidental circumstances. The gamma peaks of 110m Ag and radiocaesium are very close, and not every laboratory could make distinction between them. Therefore very few references are available on 110m Ag environmental behaviour and plant uptake. In the present study plant uptake of 110m Ag from four different types of soil was investigated, and the results are presented in relation to major soil characteristics. In addition, effects of two different treatments (phosphate and organic matter fertilizations) are determined in each type of soil. Our study clearly demonstrates that a carefully selected post-accident treatment can significantly reduce the environmental consequences of radioactive releases. Methods to be developed on bases of such studies could be used for remedial actions of agricultural lands polluted with radioactive substances

  6. Magnetic properties of deformed dipole bands in 110,112Te

    International Nuclear Information System (INIS)

    Evans, A O; Paul, E S; Boston, A J; Chantler, H J; Chiara, C J; Devlin, M; Fletcher, A M; Fossan, D B; LaFosse, D R; Lane, G J; Lee, I Y; Macchiavelli, A O; Nolan, P J; Sarantites, D G; Sears, J M; Semple, A T; Smith, J F; Starosta, K; Vaman, C; Ragnarsson, I; Afanasjev, A V

    2006-01-01

    A lifetime analysis using the Doppler-shift attenuation method has been performed on the Tellurium isotopes 110,112 Te. The experiment was performed using the Gammasphere array in conjunction with the MICROBALL charged-particle detector. Three strongly coupled bands were previously established in 110,112 Te which were observed up to unusually high spins. In the current experiment, it has been possible to extract lifetime measurements using a Doppler broadened lineshape analysis on one of the ΔI=1 band structures in 110 Te. In contrast to similar ΔI=1 structures in other nuclei in this mass region, the extracted B(M1) values did not rapidly decrease with increasing angular momentum. Instead, the strongly coupled band in 110 Te represents a deformed 1p-1h structure, rather than a weakly deformed structure showing the shears mechanism

  7. DNA bases assembled on the Au(110)/electrolyte interface: A combined experimental and theoretical study

    DEFF Research Database (Denmark)

    Salvatore, Princia; Nazmutdinov, Renat R.; Ulstrup, Jens

    2015-01-01

    Among the low-index single-crystal gold surfaces, the Au(110) surface is the most active toward molecular adsorption and the one with fewest electrochemical adsorption data reported. Cyclic voltammetry (CV), electrochemically controlled scanning tunneling microscopy (EC-STM), and density functional......, accompanied by a pair of strong voltammetry peaks in the double-layer region in acid solutions. Adsorption of the DNA bases gives featureless voltammograms with lower double-layer capacitance, suggesting that all the bases are chemisorbed on the Au(110) surface. Further investigation of the surface structures...... of the adlayers of the four DNA bases by EC-STM disclosed lifting of the Au(110) reconstruction, specific molecular packing in dense monolayers, and pH dependence of the A and G adsorption. DFT computations based on a cluster model for the Au(110) surface were performed to investigate the adsorption energy...

  8. Clean air issues in the 110th Congress : climate change, air quality standards, and oversight

    Science.gov (United States)

    2008-07-28

    Attention to environmental issues in the 110th Congress focused early and heavily on climate change the state of the science, and whether (and, if so, how) to address greenhouse gas (GHG) emissions. Fourteen bills had been introduced to establish...

  9. Synthesis of Responses to Vatican Statement from 110 U.S. Catholic Colleges.

    Science.gov (United States)

    Gallin, Sr. Alice

    1986-01-01

    The situation of U.S. Catholic colleges and universities is outlined, and the responses of 110 American Catholic college and university presidents to the Vatican's statement concerning the role and relationships of Catholic universities worldwide are synthesized. (MSE)

  10. 2 CFR 182.110 - What do subparts A through F of this part do?

    Science.gov (United States)

    2010-01-01

    ... FOR GRANTS AND AGREEMENTS Reserved GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 182.110 What do subparts A through F of this part do? Subparts A through F...

  11. 49 CFR 25.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 25.110 Remedial and affirmative action and self-evaluation. (a) Remedial action. If the...

  12. 22 CFR 146.110 - Remedial and affirmative action and self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 146.110 Remedial and affirmative action and self-evaluation. (a) Remedial action. If the...

  13. 36 CFR 1212.110 - Are any of my Federal assistance awards exempt from this part?

    Science.gov (United States)

    2010-07-01

    ... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 1212.110 Are any of my Federal assistance awards...

  14. 5 CFR 3101.110 - Additional rules for United States Customs Service employees.

    Science.gov (United States)

    2010-01-01

    ... SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE DEPARTMENT OF THE TREASURY § 3101.110 Additional... shall be disqualified from participation in any matter involving the relative or the relative's employer...

  15. 24 CFR 1000.110 - Under what conditions may non low-income Indian families participate in the program?

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Under what conditions may non low-income Indian families participate in the program? 1000.110 Section 1000.110 Housing and Urban... ACTIVITIES Affordable Housing Activities § 1000.110 Under what conditions may non low-income Indian families...

  16. 10 CFR Appendix N to Part 110 - Illustrative List of Lithium Isotope Separation Facilities, Plants and Equipment Under NRC's...

    Science.gov (United States)

    2010-01-01

    ..., Plants and Equipment Under NRC's Export Licensing Authority N Appendix N to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. N Appendix N to Part 110—Illustrative List of Lithium Isotope Separation Facilities, Plants and Equipment...

  17. 10 CFR Appendix H to Part 110 - Illustrative List of Electromagnetic Enrichment Plant Equipment and Components Under NRC Export...

    Science.gov (United States)

    2010-01-01

    ... Equipment and Components Under NRC Export Licensing Authority H Appendix H to Part 110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Pt. 110, App. H Appendix H to Part 110—Illustrative List of Electromagnetic Enrichment Plant Equipment and Components Under...

  18. 21 CFR 111.110 - What quality control operations are required for laboratory operations associated with the...

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for laboratory operations associated with the production and process control system? 111.110 Section 111.110 Food... § 111.110 What quality control operations are required for laboratory operations associated with the...

  19. 48 CFR 570.110 - Cost or pricing data and information other than cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Cost or pricing data and information other than cost or pricing data. 570.110 Section 570.110 Federal Acquisition Regulations System... PROPERTY General 570.110 Cost or pricing data and information other than cost or pricing data. (a) The...

  20. Orphan receptor GPR110, an oncogene overexpressed in lung and prostate cancer

    International Nuclear Information System (INIS)

    Lum, Amy M; Wang, Bruce B; Beck-Engeser, Gabriele B; Li, Lauri; Channa, Namitha; Wabl, Matthias

    2010-01-01

    GPR110 is an orphan G protein-coupled receptor--a receptor without a known ligand, a known signaling pathway, or a known function. Despite the lack of information, one can assume that orphan receptors have important biological roles. In a retroviral insertion mutagenesis screen in the mouse, we identified GPR110 as an oncogene. This prompted us to study the potential isoforms that can be gleaned from known GPR110 transcripts, and the expression of these isoforms in normal and transformed human tissues. Various epitope-tagged isoforms of GPR110 were expressed in cell lines and assayed by western blotting to determine cleavage, surface localization, and secretion patterns. GPR110 transcript and protein levels were measured in lung and prostate cancer cell lines and clinical samples, respectively, by quantitative PCR and immunohistochemistry. We found four potential splice variants of GPR110. Of these variants, we confirmed three as being expressed as proteins on the cell surface. Isoform 1 is the canonical form, with a molecular mass of about 100 kD. Isoforms 2 and 3 are truncated products of isoform 1, and are 25 and 23 kD, respectively. These truncated isoforms lack the seven-span transmembrane domain characteristic of GPR proteins and thus are not likely to be membrane anchored; indeed, isoform 2 can be secreted. Compared with the median gene expression of ~200 selected genes, GPR110 expression was low in most tissues. However, it had higher than average gene expression in normal kidney tissue and in prostate tissues originating from older donors. Although identified as an oncogene in murine T lymphomas, GPR110 is greatly overexpressed in human lung and prostate cancers. As detected by immunohistochemistry, GPR110 was overexpressed in 20 of 27 (74%) lung adenocarcinoma tissue cores and in 17 of 29 (59%) prostate adenocarcinoma tissue cores. Additionally, staining with a GPR110 antibody enabled us to differentiate between benign prostate hyperplasia and potential

  1. High-temperature oxidation kinetics of sponge-based E110 cladding alloy

    Science.gov (United States)

    Yan, Yong; Garrison, Benton E.; Howell, Mike; Bell, Gary L.

    2018-02-01

    Two-sided oxidation experiments were recently conducted at 900°C-1200 °C in flowing steam with samples of sponge-based Zr-1Nb alloy E110. Although the old electrolytic E110 tubing exhibited a high degree of susceptibility to nodular corrosion and experienced breakaway oxidation rates in a relatively short time, the new sponge-based E110 demonstrated steam oxidation behavior comparable to Zircaloy-4. Sample weight gain and oxide layer thickness measurements were performed on oxidized E110 specimens and compared to oxygen pickup and oxide layer thickness calculations using the Cathcart-Pawel correlation. Our study shows that the sponge-based E110 follows the parabolic law at temperatures above 1015 °C. At or below 1015 °C, the oxidation rate was very low when compared to Zircaloy-4 and can be represented by a cubic expression. No breakaway oxidation was observed at 1000 °C for oxidation times up to 10,000 s. Arrhenius expressions are given to describe the parabolic rate constants at temperatures above 1015 °C and cubic rate constants are provided for temperatures below 1015 °C. The weight gains calculated by our equations are in excellent agreement with the measured sample weight gains at all test temperatures. In addition to the as-fabricated E110 cladding sample, prehydrided E110 cladding with hydrogen concentrations in the 100-150 wppm range was also investigated. The effect of hydrogen content on sponge-based E110 oxidation kinetics was minimal. No significant difference was found between as-fabricated and hydrided samples with regard to oxygen pickup and oxide layer thickness for hydrogen contents below 150 wppm.

  2. Structure of the cobalt-filled missing-row reconstruction of Pt(110)

    International Nuclear Information System (INIS)

    Klein, C.; Koller, R.; Schmid, M.; Varga, P.; Lundgren, E.; Maca, F.; Redinger, J.

    2004-01-01

    The atomic structure of 0.5 monolayer (ML) Co deposited on Pt(110) was investigated by quantitative low-energy electron diffraction and ab initio density functional theory calculations, showing a pronounced inward relaxation and a filling of the missing-row sites of the Pt(110) substrate by Co atoms. Up to this Co coverage no significant intermixing of Pt atoms with Co atoms was observed by scanning tunneling microscopy, resulting in an alternating arrangement of pure Co and Pt rows

  3. Geometric structures of thin film: Pt on Pd(110) and NiO on Ni(100)

    Energy Technology Data Exchange (ETDEWEB)

    Warren, Oden L. [Iowa State Univ., Ames, IA (United States)

    1993-07-01

    This thesis is divided into 3 papers: dynamical low-energy electron- diffraction investigation of lateral displacements in topmost layer of Pd(110); determination of (1x1) and (1x2) structures of Pt thin films on Pd(110) by dynamical low-energy electron-diffraction analysis; and structural determination of a NiO(111) film on Ni(100) by dynamical low-energy electron-diffraction analysis.

  4. 33 CFR 110.150 - Block Island Sound, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Block Island Sound, N.Y. 110.150... ANCHORAGE REGULATIONS Anchorage Grounds § 110.150 Block Island Sound, N.Y. (a) The anchorage ground. A 3/4... following coordinates: latitude 41°06′12″ N., longitude 72°00′05″ W., latitude 41°07′40″ N., longitude 72°01...

  5. Phosphoinositide-3-kinases p110alpha and p110beta mediate S phase entry in astroglial cells in the marginal zone of rat neocortex

    Directory of Open Access Journals (Sweden)

    Rabea eMüller

    2013-03-01

    Full Text Available In cells cultured from neocortex of newborn rats, phosphoinositide-3-kinases of class I regulate the DNA synthesis in a subgroup of astroglial cells. We have studied the location of these cells as well as the kinase isoforms which facilitate the S phase entry. Using dominant negative isoforms as well as selective pharmacological inhibitors we quantified S phase entry by nuclear labeling with bromodeoxyuridine. Only in astroglial cells harvested from the marginal zone of the neocortex inhibition of phosphoinositide-3-kinases reduced the nuclear labeling with bromodeoxyuridine, indicating that neocortical astroglial cells differ in the regulation of proliferation. The two kinase isoforms p110 and p110were essential for S phase entry. p110 diminished the level of the p27Kip1 which inactivates the complex of cyclin E and CDK2 necessary for entry into the S phase. p110phosphorylated and inhibited glycogen synthase kinase-3which can prevent S-phase entry. Taken together, both isoforms mediated S phase in a subgroup of neocortical astroglial cells and acted via distinct pathways.

  6. Facile Dehydrogenation of Ethane on the IrO2(110) Surface.

    Science.gov (United States)

    Bian, Yingxue; Kim, Minkyu; Li, Tao; Asthagiri, Aravind; Weaver, Jason F

    2018-02-21

    Realizing the efficient and selective conversion of ethane to ethylene is important for improving the utilization of hydrocarbon resources, yet remains a major challenge in catalysis. Herein, ethane dehydrogenation on the IrO 2 (110) surface is investigated using temperature-programmed reaction spectroscopy (TPRS) and density functional theory (DFT) calculations. The results show that ethane forms strongly bound σ-complexes on IrO 2 (110) and that a large fraction of the complexes undergo C-H bond cleavage during TPRS at temperatures below 200 K. Continued heating causes as much as 40% of the dissociated ethane to dehydrogenate and desorb as ethylene near 350 K, with the remainder oxidizing to CO x species. Both TPRS and DFT show that ethylene desorption is the rate-controlling step in the conversion of ethane to ethylene on IrO 2 (110) during TPRS. Partial hydrogenation of the IrO 2 (110) surface is found to enhance ethylene production from ethane while suppressing oxidation to CO x species. DFT predicts that hydrogenation of reactive oxygen atoms of the IrO 2 (110) surface effectively deactivates these sites as H atom acceptors, and causes ethylene desorption to become favored over further dehydrogenation and oxidation of ethane-derived species. The study reveals that IrO 2 (110) exhibits an exceptional ability to promote ethane dehydrogenation to ethylene near room temperature, and provides molecular-level insights for understanding how surface properties influence selectivity toward ethylene production.

  7. Surface science study of selective ethylene epoxidation catalyzed by the Ag(110) surface: Structural sensitivity

    International Nuclear Information System (INIS)

    Campbell, C.T.

    1984-01-01

    The selective oxidation of ethylene to ethylene epoxide (C 2 H 4 +1/2O 2 →C 2 H 4 O) over Ag is the simplest example of kinetically controlled, selective heterogeneous catalysis. We have studied the steady-state kinetics and selectivity of this reaction for the first time on a clean, well-characterized Ag(110) surface by using a special apparatus which allows rapid (approx.20 s) transfer between a high-pressure catalytic microreactor and an ultrahigh vacuum surface analysis (AES, XPS, LEED, TDS) chamber. The effects of temperature and reactant pressures upon the rate and selectivity are virtually identical on Ag(110) and supported, high surface area Ag catalysts. The absolute specific rate (per Ag surface atom) is, however, some 100-fold higher for Ag(110) than for high surface area catalysts. This is related to the well-known structural sensitivity of this reaction. It is postulated that a small percentage of (110) planes (or [110]-like sites) are responsible for most of the catalytic activity of high surface area catalysts. The high activity of the (110) plane is attributed to its high sticking probability for dissociative oxygen adsorption, since the rate of ethylene epoxidation is shown in a related work [Ref. 1: C. T. Campbell and M. T. Paffett, Surf. Sci. (in press)] to be proportional to the coverage of atomically adsorbed oxygen at constant temperature and ethylene pressure

  8. The impact of renal artery stent revascularization on blood pressure: 1-year follow-up of 110 cases

    International Nuclear Information System (INIS)

    Wang Chao; Zou Yinghua; Yang Min; Wang Jian; Tong Xiaoqiang; Song Li

    2007-01-01

    Objective: To investigate the effect of renal artery revascularization through renal artery stenting(PTRAS)on blood pressure in patients with renal artery stenosis. Methods: During April 2000 through May 2005 110 cases of renal artery stenosis received PTRAS and followed up for at least 1 year with blood pressure measurements pre-and 1 year post-PTRAS. Results: The technical success rate was 100% for all 110 cases. The renal artery stenosis were decreased from 60%-100% before PTRAS to 0%-15% after the stent placement. There was significant difference between blood pressure pre-and 1 year post PTRAS. Systolic pressures decreased from(153 ± 32) mmHg to(131 ± 27) mmHg and diastolic pressures from(87 ± 19) mmHg to(75 ± 19) mmHg. The administration of antihypertensive diugs reduced from(2.6 ± 0.9 ) sorts to(1.9 ± 0.9) sorts. Conclusions: PTRAS revascularization is an effective procedure for blood pressure control in renal vascular hypertension during one year follow up. (authors)

  9. High resolution spectroscopy on adsorbed molecules on a Ni (110)-surface: vibrational states and electronic levels

    International Nuclear Information System (INIS)

    Kardinal, I.

    1998-01-01

    The complementary techniques of HR-XPS and HREELS have been applied to two distinct problems. The first studies adsorption and dissociation of C 2 N 2 on Ni (110) at room temperature (RT) and at 90 K and its co-adsorption with CO. At RT C 2 N 2 dissociates and forms a c(2x2)-CN structure. The resulting CN is found to be bound in the grooves of the (110) surface yielding the lowest C-N vibrational energy yet observed. C 2 N 2 was found to dissociate even at 90 K however the resulting CN overlayer after warming to RT showed remarkable differences to that of the RT adsorption. As well as the in-groove species a number of adsorption sites on the ridges with a bond order higher have been identified. Preadsorbed CO is completely driven of the Ni (110) surface by co-adsorption of CN at RT. HREELS indicates that first CO is desorbed from the on-top-sites and then from the bridge-sites of the (110)-ridges involving a considerable increase of the HREELS cross section for the CO on the bridge-sites. Also the signal intensity of the coadsorbed CN is suppressed by the CO present on the surface. The second study investigated the adsorption of bithiophene (BiT) on clean Ni (110) and the S-modified c(2x2)-S-Ni (110) and p(4x1)-S-Ni (110). The latter provided a strongly structured substrate which forced the assembly of the adsorbed BiT-molecules. The high degree of order of this adsorbate/substrate system was obvious in both the HR-XPS results and the BREELS results with strong azimuthal anisotropy. This system was used to asses the ability to use the HREELS impact selection rules to determine molecular orientation of a reasonably complex adsorbate overlayer. (author)

  10. A first principles study of adhesion and electronic structure at Fe (110)/graphite (0001) interface

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yangzhen; Xing, Jiandong; Li, Yefei, E-mail: yefeili@126.com; Sun, Liang; Wang, Yong

    2017-05-31

    Highlights: • The surface energy of graphite (0001) and Fe (110) has been calculated and the number of layers of graphite slab and Fe slab has been estimated. • The work of adhesion of Fe (110)/graphite (0001) interface with different interfacial separation d{sub 0} (1.7–3 Å) has been systematically discussed. • The total electron density and electron density difference of Fe (110)/graphite (0001) are used to study the bonding characteristics. • The Interfacial energy and fracture toughness of Fe (110)/graphite (0001) are estimated. - Abstract: Using first–principles calculations, we discuss the bulk properties of bcc Fe and graphite and that of the surface, the work of adhesion, and the electronic structure of Fe (110)/graphite (0001) interface. In this study, the experimental results of the bulk properties of bcc Fe and graphite reveal that our adopted parameters are reliable. Moreover, the results of surface energy demonstrate that nine atomic layers of graphite (0001) and five atomic layers of Fe (110) exhibit bulk–like interiors. The lattice mismatch of Fe (110)/graphite (0001) interface is about 6%. The results also exhibit that the Fe atom residing on top of the second layer of graphite slab (HCP structure) is the preferred stacking sequence. The work of adhesion (W{sub ad}) of the optimized Fe/graphite interface of HCP structure is 1.36 J/m{sup 2}. Electronic structures indicate that the bonding characteristics are a mixture of covalent and ionic bonds in the HCP interface. Moreover, the magnetic moment of atoms at the interface was studied using the spin polarized density of states.

  11. Class IA phosphatidylinositol 3-kinase p110α regulates phagosome maturation.

    Directory of Open Access Journals (Sweden)

    Emily P Thi

    Full Text Available Of the various phosphatidylinositol 3- kinases (PI3Ks, only the class III enzyme Vps34 has been shown to regulate phagosome maturation. During studies of phagosome maturation in THP-1 cells deficient in class IA PI3K p110α, we discovered that this PI3K isoform is required for vacuole maturation to progress beyond acquisition of Rab7 leading to delivery of lysosomal markers. Bead phagosomes from THP-1 cells acquired p110α and contained PI3P and PI(3,4,5P3; however, p110α and PI(3,4,5P3 levels in phagosomes from p110α knockdown cells were decreased. Phagosomes from p110α knock down cells showed normal acquisition of both Rab5 and EEA-1, but were markedly deficient in the lysosomal markers LAMP-1 and LAMP-2, and the lysosomal hydrolase, β-galactosidase. Phagosomes from p110α deficient cells also displayed impaired fusion with Texas Red dextran-loaded lysosomes. Despite lacking lysosomal components, phagosomes from p110α deficient cells recruited normal levels of Rab7, Rab-interacting lysosomal protein (RILP and homotypic vacuole fusion and protein sorting (HOPs components Vps41 and Vps16. The latter observations demonstrated that phagosomal Rab7 was active and capable of recruiting effectors involved in membrane fusion. Nevertheless, active Rab7 was not sufficient to bring about the delivery of lysosomal proteins to the maturing vacuole, which is shown for the first time to be dependent on a class I PI3K.

  12. A comparative DFT study on the dehydrogenation of methanol on Rh(100) and Rh(110)

    Science.gov (United States)

    Zhang, Minhua; Wu, Xingyu; Yu, Yingzhe

    2018-04-01

    Numerous density functional theory calculations have been performed to investigate the complete mechanisms of methanol dehydrogenation on Rh(100) and Rh(110) surfaces. The adsorption properties of relevant species were discussed in details. In addition, a comprehensive reaction network including four reaction pathways was built and analyzed. It is found that the initial Osbnd H bond scission of CH3OH seems to be more favorable than Csbnd H bond cleavage on both Rh(100) and Rh(110) surfaces from the perspective of activation barriers. It is also concluded that path1 (CH3OH → CH3O → CH2O → CHO → CO) is the predominant pathway on both Rh(100) and Rh (110) surfaces. On the whole, in most of the dehydrogenation reactions investigated, the energy barriers on Rh(100) are lower than those on Rh (110). Remarkable differences in the activity and predominant reaction pathway on Rh(100), Rh(110) and Rh(111) indicate that the dehydrogenation of methanol might be structure-sensitive.

  13. Uniform Si nano-dot fabrication using reconstructed structure of Si(110)

    Science.gov (United States)

    Yano, Masahiro; Uozumi, Yuki; Yasuda, Satoshi; Asaoka, Hidehito

    2018-06-01

    Si nano-dot (ND) formation on Si(110) is observed by means of a scanning tunneling microscope (STM). The initial Si-NDs are Si crystals that are continuous from the substrate and grow during the oxide layer desorption. The NDs fabricated on the flat surface of Si(110)-1 × 1 are surrounded by four types of facets with almost identical appearance probabilities. An increase in the size of the NDs increases the variety of its morphology. In contrast, most Si-NDs fabricated on straight-stepped surface of Si(110)-16 × 2 reconstructed structure are surrounded by only a single type of facet, namely the \\text{Si}(17,15,1)-2 × 1 plane. An appearance probability of the facet in which the base line is along the step of Si(110)-16 × 2 exceeds 75%. This finding provides a fabrication technique of uniformed structural Si-NDs by using the reconstructed structure of Si(110).

  14. Studies on the syntheses, structural Characterization, antimicrobial of the CO-CRYSTAL 1,10-phenanthrolin-1-IUM(1,10-phenH+)-caffeine(caf)-hexafluorophosphate

    Science.gov (United States)

    El Hamdani, H.; El Amane, M.; Duhayon, C.

    2018-03-01

    Co-crystal of 1,10-phenanthrolin-1-ium-caffeine-hexafluorophosphate was synthesized, studied by FTIR, 1H, 13C NMR, DSC and X-ray structure and crystallized in the monoclinic space group C2/c. The unit cell parameters are a = 19.3761 (3), b = 17.9548 (3), c = 13.8074 (3) with β = 117.8132 (10). The final R value is 0.069 for 29,522 measured reflections. The co-crystal structure analysis indicate the 1,10-phenanthroline is protonated by one nitrogen atom and formed the 1,10-phenanthrolin-1-ium cation, which is stabilized by hydrogen bonds N+-H…Odbnd C interaction with carbonyl and imidazol ring in caffeine molecule. The intermolecular hydrogen bonds: Csbnd H...O, Csbnd H...N, Nsbnd H...O, Csbnd H...F and intramolecular hydrogen bond: C1sbnd H12...O14, together play a vital role in stabilizing the structure of co-crystal. The X-ray structural analysis confirm the assignments of the structure from infrared, 1H, 13C NMR, spectroscopic data DSC and molar conductivity analysis. The antimicrobial activity of the co-crystal was studied.

  15. The study of geometric structure of Na films on Cu(110)

    International Nuclear Information System (INIS)

    Zeybek, O.

    2004-01-01

    In order to understand the geometric structure of Na films on Cu( 110) substrate, a couple of surface science techniques have been applied in this study. The thickness of the Na films were calculated using X-ray Photoelectron Spectroscopy data and Mean Free Path. The coverages were compared with the work function changes in this study and other investigations. Sub-monolayer and up to 2 ML thickness of Na films on Cu(110) have been investigated using Low Energy Electron Diffraction (LEED) and Ultra Violet Inverse Photoelectron Spectroscopy. It is found that the (1 x 1) LEED pattern of Cu(110) changes to (1 x 2) with increasing Na coverage up to 1 ML. Af ter 1 ML Na films, LEED shows again (1 x 1) structure

  16. Characteristic electron energy loss in lanthanum films adsorbed on tungsten (110) single crystal

    International Nuclear Information System (INIS)

    Gorodetskij, D.A.; Gorchinskij, A.D.; Kobylyanskij, A.V.

    1988-01-01

    The spectrum of electron energy loss (ELS) in a wide range of energy loss 0-150 eV has been studied for La films adsorbed on W(110) single crystal with the coverage Θ from submonolayer to a few monolayers. The concentration dependence of loss energy peaks amplitude of different nature has been studied for the adsorption of rare earth element on refractory substrate. It has been shown that the essential information for the interpretation of the energy loss nature may be obtained by the investigation of such dependences for La adsorption on W(110). It is found that the surface and bulk plasmons peaks appear in ELS of La-W(110) system before the completion of the physical monolayer. Thus, the collectivization of valence electrons in the rare earth element film at the transition metal surface ensues for the submonolayer coverage like in the case of collective processes in alkali and alkaline earth element films

  17. Effective electron collection in highly (110)-oriented ZnO porous nanosheet framework photoanode

    International Nuclear Information System (INIS)

    Wang Xiangyan; Tian Zhipeng; Yu Tao; Tian Hanmin; Zhang Jiyuan; Yuan Shikui; Zhang Xiaobo; Li Zhaosheng; Zou Zhigang

    2010-01-01

    A highly (110)-oriented ZnO porous nanosheet framework is designed as the photoanode in photoelectrochemical systems, by virtue of its anisotropic electronic properties. It can be facilely prepared in large scale via a hydrothermal method. X-ray diffraction (XRD) analyses show that the orientation index of the (110) diffraction plane is 3.54, indicating the films possess (110) preferred orientation. Field-emission scanning electron microscope (FE-SEM) images exhibit that most of the nanosheets stand nearly perpendicularly on the substrate. The {002} lattice planes work just like conducting wires and induce the electrons to transport to the substrate. Chronoamperometry measurement demonstrates an effective electron collection. When the nanostructured photoanode is introduced to dye-sensitized solar cells, a conversion efficiency of 3.7% is obtained. The photoanode also has potential application in the other photoelectrochemical systems, such as photocatalytical splitting of water.

  18. Simple countermeasures against the TM110-beam-blowup-mode in biperiodic structures

    International Nuclear Information System (INIS)

    Euteneuer, H.; Herminghaus, H.; Schoeler, H.

    1984-01-01

    The two fundamental methods of fighting beam blow-up in rf-accelerating-structures are staggered detuning and selective Q-spoiling of their higher order modes. Biperiodic structures offer a very simple way of applying the latter technique of the most dangerous TM 110 -like blowup mode at 1.7 times the accelerating frequency: letting this mode propagate but giving a large gap to the TM 110 -passband. This gap must be positive for electric coupling (f(phi=0) =1.7c. With asymmetric coupling elements between the cavities of a structure, one has a simple tool for staggered detuning: a change of the relative orientation of these elements spreads the resonance frequencies not only of the TM 110 -mode, but of at least all dipole modes. (orig.)

  19. Magnetic anisotropy basis sets for epitaxial (110) and (111) REFe2 nanofilms

    International Nuclear Information System (INIS)

    Bowden, G J; Martin, K N; Fox, A; Rainford, B D; Groot, P A J de

    2008-01-01

    Magnetic anisotropy basis sets for the cubic Laves phase rare earth intermetallic REFe 2 compounds are discussed in some detail. Such compounds can be either free standing, or thin films grown in either (110) or (111) mode using molecular beam epitaxy. For the latter, it is useful to rotate to a new coordinate system where the z-axis coincides with the growth axes of the film. In this paper, three symmetry adapted basis sets are given, for multi-pole moments up to n = 12. These sets can be used for free-standing compounds and for (110) and (111) epitaxial films. In addition, the distortion of REFe 2 films, grown on sapphire substrates, is also considered. The distortions are different for the (110) and (111) films. Strain-induced harmonic sets are given for both specific and general distortions. Finally, some predictions are made concerning the preferred direction of easy magnetization in (111) molecular beam epitaxy grown REFe 2 films

  20. Effect of Current Density on Optical Properties of Anisotropic Photoelectrochemical Etched Silicon (110)

    Science.gov (United States)

    Amirhoseiny, M.; Hassan, Z.; Ng, S. S.

    2012-08-01

    Photoelectrochemical etched Si layers were prepared on n-type (110) oriented silicon wafer. The photoluminescence (PL), Fourier transformed infrared (FTIR) absorption and Raman spectroscopies of etched Si (110) at two different current densities were studied. Both samples showed PL peak in the visible spectral range situated from 650 nm to 750 nm. The corresponding changes in Raman spectra at different current density are discussed. The blue shift in the PL and Raman peaks is consequent of the quantum confinement effect and defect states of surface Si nanocrystallites complexes and hydrogen atoms of the photoelectrochemical etched Si (110) samples. The attenuated total reflection (ATR) results show both hydrogen and oxygen related IR modes in the samples which can be used to explain the PL effect.

  1. Corrosion behaviour of E110- and E635- type zirconium alloys under PWR irradiation simulating conditions

    International Nuclear Information System (INIS)

    Markelov, V.A.; Novikov, V.V.; Kon'kov, V.F.; Tselishchev, A.V.; Dologov, A.B.; Zmitko, M.; Maserik, V.; Kocik, J.

    2008-01-01

    As structural materials for VVER 1000 fuel rod claddings and FA components use is made of zirconium alloys E110 (Zr 1Nb) and E635 (Zr 1.2Sn 1Nb 0.35Fe) that meet the design parameters of operation. Nonetheless, the work is in progress to perfect those alloys to reach higher corrosion and shape change resistance. At VNIINM updated E110M and E635M alloys have been developed on E110 and E635 bases. To assess the corrosion behaviour of the updated alloys in comparison to the base alloys their cladding samples were tested in RVS 3 loop of LWR 15 reactor (NRI, Rez) in PWR water chemistry with coolant surface and volume boiling. The data are presented on the influence effected by in pile irradiation for up to 324 days on oxide coat thickness and microstructure of fuel claddings produced from the four tested alloys. It has been revealed that E110 alloy its updated version E110M and E635M alloy compared to E635 have higher corrosion resistances. The paper discusses th+e results on the in pile corrosion of cladding samples from the alloys under study in comparison to the results acquired for similar samples tested in LWR 15 inactive channel and under autoclave conditions. Using methods of TEM, EDX analyses of extraction replicas dislocation structure and phase composition changes were studied in samples of all four alloy claddings LWR 15 reactor irradiated to the material damage dose of 1.5 dpa. The interrelation is discussed between irradiation effected strengthening and corrosion of fuel claddings made of E110 and E635 type zirconium alloys and the evolution of their structure and phase states

  2. Studies of biological effects of fluoride stannous and UV short in Escherichia coli BH110

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira da C, R., E-mail: rogercosta1@hotmail.com [Federal Institute of Education, Science and Technology of Goias, Campus Uruacu, Rua Formosa Qd 28 e 29, Loteamento Santana, 76400-000 Uruacu, Goias (Brazil)

    2015-10-15

    Full text: The amount of UV rays on the Earth's surface has increased due to depletion of the ozone layer, and this has worried society, since these radiation although not considered ionizing can cause damage to biological membrane and especially to DNA. The DNA has cell repair mechanisms that can work in lesions caused by electromagnetic radiation such as ultraviolet -short (UV C)and agents causing oxidative stress, such as tin salts. Among the repair mechanisms can highlight the adaptive repair, which consists of smaller doses to cells pre-exposure of an oxidizing agent, and when these cells are exposed to larger doses of the agent even if there is a reduction in mortality rate which leads to complete that repair mechanisms are activated in the pre-exposure reducing cell mortality. Several publications have shown the genotoxic effects of stannous salts such as stannous fluoride (SnF{sub 2}), which shows the importance of the study, since these salts are widely used in industry as components in toothpastes and mouthwashes. So we check whether pretreatment with UV C is able to induce adaptive response reducing the cytotoxic effects caused by exposure of the strains to SnF{sub 2}. We use a strain of Escherichia coli BH110 (BH110 E. coli) deficient in three genes (fpg, nfo and xth) involved in the excision repair bases. To verify the induction of adaptive response to strain BH110 was exposed to various doses of UV C and then treated with SnF{sub 2} a concentration of 110 u M. Our results showed that the LD10 of strain BH110 is 20 J/m{sup 2} and pre-treatment with UV C does not seem to induce adaptive repair in BH110 strains. (Author)

  3. 110 °C range athermalization of wavefront coding infrared imaging systems

    Science.gov (United States)

    Feng, Bin; Shi, Zelin; Chang, Zheng; Liu, Haizheng; Zhao, Yaohong

    2017-09-01

    110 °C range athermalization is significant but difficult for designing infrared imaging systems. Our wavefront coding athermalized infrared imaging system adopts an optical phase mask with less manufacturing errors and a decoding method based on shrinkage function. The qualitative experiments prove that our wavefront coding athermalized infrared imaging system has three prominent merits: (1) working well over a temperature range of 110 °C; (2) extending the focal depth up to 15.2 times; (3) achieving a decoded image being approximate to its corresponding in-focus infrared image, with a mean structural similarity index (MSSIM) value greater than 0.85.

  4. Micropore x-ray optics using anisotropic wet etching of (110) silicon wafers.

    Science.gov (United States)

    Ezoe, Yuichiro; Koshiishi, Masaki; Mita, Makoto; Mitsuda, Kazuhisa; Hoshino, Akio; Ishisaki, Yoshitaka; Yang, Zhen; Takano, Takayuki; Maeda, Ryutaro

    2006-12-10

    To develop x-ray mirrors for micropore optics, smooth silicon (111) sidewalls obtained after anisotropic wet etching of a silicon (110) wafer were studied. A sample device with 19 microm wide (111) sidewalls was fabricated using a 220 microm thick silicon (110) wafer and potassium hydroxide solution. For what we believe to be the first time, x-ray reflection on the (111) sidewalls was detected in the angular response measurement. Compared to ray-tracing simulations, the surface roughness of the sidewalls was estimated to be 3-5 nm, which is consistent with the atomic force microscope and the surface profiler measurements.

  5. Growth morphology and structure of bismuth thin films on GaSb(110)

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.

    1998-01-01

    Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....

  6. Micropore x-ray optics using anisotropic wet etching of (110) silicon wafers

    International Nuclear Information System (INIS)

    Ezoe, Yuichiro; Koshiishi, Masaki; Mita, Makoto; Mitsuda, Kazuhisa; Hoshino, Akio; Ishisaki, Yoshitaka; Yang Zhen; Takano, Takayuki; Maeda, Ryutaro

    2006-01-01

    To develop x-ray mirrors for micropore optics, smooth silicon (111)sidewalls obtained after anisotropic wet etching of a silicon (110) wafer were studied. A sample device with 19 μm wide (111) sidewalls was fabricated using a 220 μm thick silicon (110) wafer and potassium hydroxide solution. For what we believe to be the first time,x-ray reflection on the (111) sidewalls was detected in the angular response measurement. Compared to ray-tracing simulations, the surface roughness of the sidewalls was estimated to be 3-5 nm, which is consistent with the atomic force microscope and the surface profiler measurements

  7. Magnetic properties of smooth terminating dipole bands in 110,112Te

    International Nuclear Information System (INIS)

    Evans, A.O.; Paul, E.S.; Boston, A.J.; Chantler, H.J.; Chiara, C.J.; Devlin, M.; Fletcher, A.M.; Fossan, D.B.; LaFosse, D.R.; Lane, G.J.; Lee, I.Y.; Macchiavelli, A.O.; Nolan, P.J.; Sarantites, D.G.; Sears, J.M.; Semple, A.T.; Smith, J.F.; Starosta, K.; Vaman, C.; Afanasjev, A.V.; Ragnarsson, I.

    2006-01-01

    Three strongly coupled sequences have been established in 110,112 Te up to high spins. They are interpreted in terms of deformed structures built on proton 1-particle-1-hole excitations that reach termination at I∼40-bar . This is the first observation of smooth terminating dipole structures in this mass region. Lifetime measurements have allowed the extraction of experimental B(M1;I->I-1) and B(E2;I->I-2) reduced transition rates for one of the dipole bands in 110 Te. The results support the deformed interpretation

  8. 2,2',-bipyridine and 1,10-phenanthroline complexes of lanthanide(III) trifluoroacetates

    International Nuclear Information System (INIS)

    Misra, S.N.; Singh, M.

    1983-01-01

    The syntheses and characterization of lanthanide(III) triflloroacetate complexes with 2,2'-bipyridine and 1,10-phenanthroline are reported. Lanthanide(III) trifluoroacetates yield compounds of the type Ln(CF 3 COO) 3 .bipy or phen with 2,2'-bipyridine and 1,10-phenanthroline. Their properties and structures have been studied using chemical analyses. electronic and infrared spectra. Thermal analysis of a few complexes have also been done. The infrared data show that the trifluoroacetate group acts as a bidentate ligand making the coordination number of lanthanide eight. (author)

  9. Research on Line Patrol Strategy of 110kV Transmission Line after Lightning Strike

    Directory of Open Access Journals (Sweden)

    Li Mingjun

    2016-01-01

    Full Text Available Lightning faults occupy in the majority of instantaneous fault and reclosing can usually be successful, so power supply can be restored without immediate patrol in many cases. Firstly, this paper introduces the lightning fault positioning and identifying method. Then test electrical performance of insulators after lightning strike from 110kV lines. Data shows that lightning strike has little effect on the electric performance of insulator. Finally, illustrating disposal process of the 110 kV transmission line after lightning fault, certifying that the power supply reliability be ensured without line patrol.

  10. Waste compatibility safety issues and final results for tank 241-T-110 push mode samples

    International Nuclear Information System (INIS)

    Nuzum, J.L.

    1997-01-01

    This document is the final laboratory report for Tank 241-T-110. Push mode core segments were removed from risers 2 and 6 between January 29, 1997, and February 7, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-110 Push Mode Core Sampling and analysis Plan (TSAP) and Safety Screening Data Quality Objective (DQO). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO

  11. Percutaneous implantation of intra-arterial port system for regional drug infusion: results and complications in 110 cases

    International Nuclear Information System (INIS)

    Won, Je Hwan; Lee, Jong Hyuk; Ko, Kyung Hee; Won, Jong Yoon; Park, Sung Il; Lee, Do Yun; Kang, Byung Chul

    2000-01-01

    To investigate the feasibility and complications of a percutaneously implantable port system for regional drug infusion. For intra-arterial drug infusion, a 5.8 or 5-F pediatric venous port system was implanted in 110 patients with hepatocellular carcinoma (n=79), liver metastasis (n=16), gallbladder cancer (n=4), stomach cancer (n=3), pancreatic cancer (n=3), Burger's diseases mellitus (n=2), or lymphoma (n=1). All intra-arterial port implantations were performed percutaneously in an angiographic ward through the common femoral artery (n=98), left subclavian artery (n=10), or left superficial femoral artery (n=2). Complications were evaluated during the follow-up period, which ranged from 21 to 530 (mean, 163) days. The technical success rate for percutaneous implantation of the system was 97.3% (107 of 110 patients). The tips of the port catheter were located in the common hepatic artery (n=34), proper hepatic artery (n=49), right hepatic artery quick resulthepatic artery (n=1), descending aorta at T9 level (n=10), left popliteal artery (n=2), right external iliac artery (n=1), left external iliac artery (n=1), or left deep femoral artery (n=1). Complications were encountered in 24 patients (22.4%), namely chamber site infection (n=7), catheter dislodgement (n=7), catheter occlusion (n=3), migration of coil (n=2), disconnection between chamber and catheter (n=1), kinking of catheter (n=1), arterial occlusion (n=1), necrosis of overlying skin (n=1), and leakage around port chamber (n=1). Outcomes of complications included removal of port systems or cessation of therapy in 12 cases (11.2%), correction of catheter location using a guide wire in five (4.7%), thrombolysis with urokinase in three (2.8%), and straightening using a snare in one (0.9%). In three patients, the port system was used without reintervention. Percutaneous implantation of an intra-arterial port system showed a high technical success rate and a low rate of serious complications. The method may be

  12. Increased genitourinary fistula rate after bevacizumab in recurrent cervical cancer patients initially treated with definitive radiochemotherapy and image-guided adaptive brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Sturdza, Alina; Kirisits, Christian; Poetter, Richard [Medical University of Vienna, Department of Radiation Oncology, Comprehensive Cancer CenterVienna, Vienna (Austria); Hofmann, Sandra; Kranawetter, Marlene; Grimm, Christoph; Schwameis, Richard [Medical University Vienna, Department of general Gynecology and Gynecologic Oncology, Comprehensive Cancer Center Vienna, Vienna (Austria); Polterauer, Stephan; Reinthaller, Alexander [Medical University Vienna, Department of general Gynecology and Gynecologic Oncology, Comprehensive Cancer Center Vienna, Vienna (Austria); Karl Landsteiner Institute for General Gynecology and Experimental Gynecologic Oncology, Vienna (Austria); Krainer, Michael [Medical University Vienna, Clinical Division of Oncology, Department of Medicine 1, Comprehensive Cancer Center, Vienna (Austria)

    2017-12-15

    Patients with recurrent cervical cancer (RecCC) who received definitive radiochemotherapy including image-guided adaptive brachytherapy (IGABT) as primary treatment are currently treated in our institution with palliative intent by chemotherapy (CHT) combined with bevacizumab (BEV). We aim to evaluate the risk of gastrointestinal (GI)/genitourinary (GU) fistula formation in these patients. Data of 35 consecutive patients with RecCC treated initially with radiochemotherapy and IGABT were collected. Known and presumed risk factors associated with fistula formation were evaluated. Fistula rate was compared between patients receiving CHT or CHT+BEV. Of the 35 patients, 25 received CHT and 10 patients received CHT+BEV. Clinical characteristics were comparable. Fistulae were reported in 6 patients: two fistulae (8%) in the CHT group, four (40%) in the CHT+BEV group. GU fistula occurred in the CHT+BEV group only (3/4). Of these 6 patients with fistulae, 5 (83%) had undergone previous invasive procedures after the diagnosis of RecCC and 1 patient had undergone pelvic re-irradiation; 3/6 patients had developed a local recurrence. No other risk factors for fistula formation were identified. In patients with RecCC after definitive radiochemotherapy including IGABT, the addition of BEV to CHT may increase the risk for GU fistula formation, particularly after invasive pelvic procedures. Future clinical studies are required to identify predictors for fistula formation to subsequently improve patient selection for the addition of BEV in the RecCC setting. (orig.) [German] Patientinnen mit Rezidiv eines Zervixkarzinoms (RecCC), die primaer eine bildgesteuerte adaptive Brachytherapie (IGABT) und kombinierte Radiochemotherapie (RCHT) erhalten hatten, werden derzeit in unserem Institut mit einer Kombination aus Chemotherapie (CHT) und Bevacizumab (BEV) behandelt. Ziel dieser Studie war es, das Risiko fuer das Auftreten gastrointestinaler (GI) sowie urogenitaler (GU) Fisteln unter CHT

  13. Silver-mediated oxidative C-H difluoromethylation of phenanthridines and 1,10-phenanthrolines.

    Science.gov (United States)

    Zhu, Sheng-Qing; Xu, Xiu-Hua; Qing, Feng-Ling

    2017-10-17

    A silver-mediated oxidative difluoromethylation of phenanthridines and 1,10-phenanthrolines with TMSCF 2 H is disclosed. This C-H difluoromethylation of N-containing polycyclic aromatics constitutes an efficient method for the regioselective synthesis of difluoromethylated N-heterocycles.

  14. 40 CFR 81.110 - Camden-Sumter Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... Quality Control Regions § 81.110 Camden-Sumter Intrastate Air Quality Control Region. The Camden-Sumter Intrastate Air Quality Control Region (South Carolina) consists of the territorial area encompassed by the... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Camden-Sumter Intrastate Air Quality...

  15. 21 CFR 211.110 - Sampling and testing of in-process materials and drug products.

    Science.gov (United States)

    2010-04-01

    ... PHARMACEUTICALS Production and Process Controls § 211.110 Sampling and testing of in-process materials and drug... capsule weight variation; (2) Disintegration time; (3) Adequacy of mixing to assure uniformity and... production process, e.g., at commencement or completion of significant phases or after storage for long...

  16. 76 FR 41100 - Approval and Promulgation of Implementation Plans; Alabama; 110(a)(1) and (2) Infrastructure...

    Science.gov (United States)

    2011-07-13

    ... designate such a model.\\19\\ The petition in question was submitted by Robert Ukeiley on behalf of the Sierra... law to carry out the SIP; section 110(a)(2)(C) provides that states must have a substantive program to... required the deployment of a system of new monitors to measure ambient levels of that new indicator species...

  17. Modified energetics and growth kinetics on H-terminated GaAs (110)

    International Nuclear Information System (INIS)

    Galiana, B.; Benedicto, M.; Díez-Merino, L.; Tejedor, P.; Lorbek, S.; Hlawacek, G.; Teichert, C.

    2013-01-01

    Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As 4 , has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å 2 measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As 4 molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed

  18. 11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...

  19. 30 CFR 250.110 - What must I include in my welding plan?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What must I include in my welding plan? 250.110... must I include in my welding plan? You must include all of the following in the Welding Plan that you... qualified personnel weld; (c) Practices and procedures for safe welding that address: (1) Welding in...

  20. Energies controlling nucleation and growth processes: The case of Ag/W(110)

    DEFF Research Database (Denmark)

    Jones, G. W.; Marcano, J. M.; Nørskov, Jens Kehlet

    1990-01-01

    The nucleation density Nx(T) of Ag islands on the 2-monolayer-thick silver intermediate layer on W(110) is measured by UHV scanning electron microscopy and compared with kinetic nucleation equations. This yields a well-determined value of Ed+2Eb=0.65±0.03 eV, with pair-binding energy Eb=0...

  1. 49 CFR 41.110 - New DOT owned buildings and additions to buildings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false New DOT owned buildings and additions to buildings....110 New DOT owned buildings and additions to buildings. (a) DOT Operating Administrations responsible for the design and construction of new DOT Federally owned buildings will ensure that each building is...

  2. Preliminary tank characterization report for single-shell tank 241-TX-110: Best-basis inventory

    International Nuclear Information System (INIS)

    Place, D.E.

    1997-01-01

    An effort is underway to provide waste inventory estimates that will serve as standard characterization source terms for the various waste management activities. As part of this effort, an evaluation of available information for single-shell tank 241-TX-110 was performed, and a best-basis inventory was established. This work follows the methodology that was established by the standard inventory task

  3. 33 CFR 110.60 - Captain of the Port, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Captain of the Port, New York... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.60 Captain of the Port, New York. (a) Western... point of origin. (d) New York Harbor. (1) Newark Bay, Southeast. All waters bound by the following...

  4. Diagnosis of Acute Groin Injuries: A Prospective Study of 110 Athletes

    NARCIS (Netherlands)

    Serner, Andreas; Tol, Johannes L.; Jomaah, Nabil; Weir, Adam; Whiteley, Rodney; Thorborg, Kristian; Robinson, Matthew; Hölmich, Per

    2015-01-01

    Acute groin injuries are common in high-intensity sports, but there are insufficient data on injury characteristics such as injury mechanisms and clinical and radiological findings. To describe these characteristics in a cohort of athletes. Cross-sectional study; Level of evidence, 3. A total of 110

  5. 40 CFR 1065.110 - Work inputs and outputs, accessory work, and operator demand.

    Science.gov (United States)

    2010-07-01

    ... engine to operate a fuel system, and as another example you may supply compressor work to the engine to... AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Equipment Specifications § 1065.110... resistor load bank to simulate electrical loads. (3) Pump, compressor, and turbine work. Use pumps...

  6. 40 CFR 266.110 - Waiver of DRE trial burn for boilers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waiver of DRE trial burn for boilers... HAZARDOUS WASTE MANAGEMENT FACILITIES Hazardous Waste Burned in Boilers and Industrial Furnaces § 266.110 Waiver of DRE trial burn for boilers. Boilers that operate under the special requirements of this section...

  7. Bonding of gold nanoclusters to oxygen vacancies on rutile TiO2(110)

    DEFF Research Database (Denmark)

    Lopez, Nuria; schaub, R.; Thostrup, P.

    2003-01-01

    Through an interplay between scanning tunneling microscopy (STM) and density functional theory (DFT) calculations, we show that bridging oxygen vacancies are the active nucleation sites for Au clusters on the rutile TiO2(110) surface. We find that a direct correlation exists between a decrease in...

  8. 110mAg root and foliar uptake in vegetables and its migration in soil

    International Nuclear Information System (INIS)

    Shang, Z.R.; Leung, J.K.C.

    2003-01-01

    110m Ag, as a radionuclide of corrosion products in water-cooled nuclear reactors, was detected in the liquid effluents of Guangdong Daya Bay Nuclear Power Station (GNPS) of Daya Bay under normal operation conditions. Experiments on a simulated terrestrial agricultural ecosystem were carried out using the pot experiment approach. The most common plants in Hong Kong and the South China vegetable gardens such as lettuce, Chinese spinach, kale, carrot, pepper, eggplant, bean, flowering cabbage, celery, European onion and cucumber were selected for 110m Ag root and foliar uptake tests. The results show that carrot, kale and flowering cabbage have the greatest values of soil to plant transfer factor among the vegetables, while 110m Ag can be transferred to Chinese spinach via foliar uptake. Flowering cabbage, the most popular leafy vegetable locally, could be used as a biomonitor for the radioisotope contamination in vegetables. Soil column and adsorption tests were also carried out to study the leaching ability and distributio coefficient (K d ) of 110m Ag in the soil. The results show that most of the radionuclide was adsorbed in the top 1 cm of soil regardless of the pH value. The K d was also determined

  9. 29 CFR 1952.110 - Description of the plan as initially approved.

    Science.gov (United States)

    2010-07-01

    ... the covered occupational safety and health issues as defined by the Secretary of Labor in 29 CFR 1902... Section 1952.110 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH... requirements of part 1902. Under this legislation all occupational safety and health standards and amendments...

  10. Modified energetics and growth kinetics on H-terminated GaAs (110)

    Energy Technology Data Exchange (ETDEWEB)

    Galiana, B. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Departamento de Física, Universidad Carlos III de Madrid, Avenida de la Universidad 30, 28911 Madrid (Spain); Benedicto, M.; Díez-Merino, L.; Tejedor, P. [Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Inés de la Cruz 3, 28049 Madrid (Spain); Lorbek, S.; Hlawacek, G.; Teichert, C. [Institut für Physik, Montanuniversität Leoben, Franz Josef St., 18A-8700 Leoben (Austria)

    2013-10-28

    Atomic hydrogen modification of the surface energy of GaAs (110) epilayers, grown at high temperatures from molecular beams of Ga and As{sub 4}, has been investigated by friction force microscopy (FFM). The reduction of the friction force observed with longer exposures to the H beam has been correlated with the lowering of the surface energy originated by the progressive de-relaxation of the GaAs (110) surface occurring upon H chemisorption. Our results indicate that the H-terminated GaAs (110) epilayers are more stable than the As-stabilized ones, with the minimum surface energy value of 31 meV/Å{sup 2} measured for the fully hydrogenated surface. A significant reduction of the Ga diffusion length on the H-terminated surface irrespective of H coverage has been calculated from the FFM data, consistent with the layer-by-layer growth mode and the greater As incorporation coefficient determined from real-time reflection high-energy electron diffraction studies. Arsenic incorporation through direct dissociative chemisorption of single As{sub 4} molecules mediated by H on the GaAs (110) surface has been proposed as the most likely explanation for the changes in surface kinetics observed.

  11. 31 CFR 103.110 - Voluntary information sharing among financial institutions.

    Science.gov (United States)

    2010-07-01

    ... Information Sharing Procedures To Deter Money Laundering and Terrorist Activity § 103.110 Voluntary.... 5312(a)(2) that is required under this part to establish and maintain an anti-money laundering program... suspects may involve possible terrorist activity or money laundering. (2) Notice requirement. A financial...

  12. 77 FR 63234 - Approval and Promulgation of Implementation Plans; North Carolina 110(a)(1) and (2...

    Science.gov (United States)

    2012-10-16

    .... All documents in the docket are listed on the www.regulations.gov web site. Although listed in the... existing emissions rates for the Allen and Asheville coal-fired power plants provided at 15A N.C. Admin... requirement for section 110(a)(2)(C) and (J). \\7\\ See North Carolina's PSD regulations at 15A NC Admin. Code...

  13. 7 CFR 110.5 - Availability of records to facilitate medical treatment.

    Science.gov (United States)

    2010-01-01

    ... pesticide required to be maintained under § 110.3 is necessary to provide medical treatment or first aid to... care professional, to be a medical emergency, the record information of the restricted use pesticide, relating to the medical emergency, shall be provided immediately. (b)(1) The attending licensed health care...

  14. Effects of quenched impurities on surface diffusion, spreading, and ordering of O/W(110)

    DEFF Research Database (Denmark)

    Nikunen, P.; Vattulainen, Ilpo Tapio; Ala-Nissila, T.

    2002-01-01

    We study how quenched impurities affect the surface diffusion and ordering of strongly interacting adsorbate atoms on surfaces. To this end, we carry out Monte Carlo simulations for a lattice-gas model of O/W(110), including small concentrations of immobile impurities which block their adsorption...

  15. Atomic and electronic structure of V-Rh(110) near-surface alloy

    Czech Academy of Sciences Publication Activity Database

    Píš, I.; Stetsovych, V.; Mysliveček, J.; Kettner, M.; Vondráček, Martin; Dvořák, F.; Mazur, D.; Matolín, V.; Nehasil, V.

    2013-01-01

    Roč. 117, č. 24 (2013), s. 12679-12688 ISSN 1932-7447 Institutional support: RVO:68378271 Keywords : V−Rh(110) near-surface alloy * STM * XPS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.835, year: 2013

  16. 12 CFR 585.110 - How do I apply for a case-by-case exemption?

    Science.gov (United States)

    2010-01-01

    ... PROHIBITED SERVICE AT SAVINGS AND LOAN HOLDING COMPANIES Exemptions § 585.110 How do I apply for a case-by-case exemption? (a) Who may file. (1) A savings and loan holding company or a person who was convicted... exemption only for a designated position (or positions) with respect to a named savings and loan holding...

  17. High-Statistics Study of the β+/EC-Decay of 110In

    Science.gov (United States)

    Diaz Varela, A.; Garrett, P. E.; Ball, G. C.; Banjay, J. C.; Cross, D. S.; Demand, G. A.; Finlay, P.; Garnsworthy, A. B.; Green, K. L.; Hackman, G.; Kulp, W. D.; Leach, K. G.; Orce, J. N.; Phillips, A. A.; Rand, E. T.; Svensson, C. E.; Sumithrarachchi, C.; Triambak, S.; Wong, J.; Wood, J. L.; Yates, S. W.

    2014-03-01

    A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC) facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ - γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ - γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ) reaction with monoenergetic neutrons for the calculation of B(E2) values and these results have lead to the proposal of a γ-soft rotor, or O(6) nucleus, rather than a vibrational, or U(5) pattern for the nature of the low-lying, low-spin levels in 110Cd.

  18. Structural and spectroscopic studies of 2,9-dimethyl-1,10 ...

    African Journals Online (AJOL)

    The crystal structures of the pronated ligand, 2,9-dimethyl-1,10-phenanthrolinium (DPH) cation with selected counter anions (chloride (1), triflate (2), and gold dicyanide (3)) are reported. The role of a hydrogen bond interaction in influencing the solid state p-p stacking found in all three compounds has been investigated.

  19. Metal-ion complexes of functionalised 1,10-Phenanthrolines as hydrolytic synzymes

    NARCIS (Netherlands)

    Weijnen, J.G.J.

    1993-01-01

    In this thesis metal-ion complexes of functionalised 1,10-phenanthroline derivatives have been studied as model systems for hydrolytic metallo-enzymes. Amphiphilic metallo- complexes incorporated into micelles or vesicles and water-soluble complexes in pure aqueous buffer solutions, have

  20. Role of wave functions in electromagnetism : RAS from GaAs (110)

    NARCIS (Netherlands)

    Wijers, C.M.J.; de Boeij, P.L.

    2001-01-01

    We have calculated the reflectance anisotropy for the GaAs (110) surface using the discrete cellular method. This method extends the range of application of standard discrete dipole calculations by incorporating nonlocal polarizabilitites. The method adds a second quantum mechanical channel of

  1. Role of step stiffness and kinks in the relaxation of vicinal (001) with zigzag [110] steps

    Science.gov (United States)

    Mahjoub, B.; Hamouda, Ajmi BH.; Einstein, TL.

    2017-08-01

    We present a kinetic Monte Carlo study of the relaxation dynamics and steady state configurations of 〈110〉 steps on a vicinal (001) simple cubic surface. This system is interesting because 〈110〉 (fully kinked) steps have different elementary excitation energetics and favor step diffusion more than 〈100〉 (nominally straight) steps. In this study we show how this leads to different relaxation dynamics as well as to different steady state configurations, including that 2-bond breaking processes are rate determining for 〈110〉 steps in contrast to 3-bond breaking processes for 〈100〉-steps found in previous work [Surface Sci. 602, 3569 (2008)]. The analysis of the terrace-width distribution (TWD) shows a significant role of kink-generation-annihilation processes during the relaxation of steps: the kinetic of relaxation, toward the steady state, is much faster in the case of 〈110〉-zigzag steps, with a higher standard deviation of the TWD, in agreement with a decrease of step stiffness due to orientation. We conclude that smaller step stiffness leads inexorably to faster step dynamics towards the steady state. The step-edge anisotropy slows the relaxation of steps and increases the strength of step-step effective interactions.

  2. 42 CFR 421.110 - Requirements for approval of an agreement.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICARE PROGRAM MEDICARE CONTRACTING Intermediaries § 421.110 Requirements for... regulatory authorities of the State or States in which it, or any subcontractor performing some or all of its... only providers located in a single State; (5) Has acted in good faith to achieve effective cooperation...

  3. 46 CFR 199.110 - Survival craft muster and embarkation arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft muster and embarkation arrangements. 199... § 199.110 Survival craft muster and embarkation arrangements. (a) Each muster station must have... emergency source of electrical power. (e) Each davit-launched and free-fall survival craft muster station...

  4. 46 CFR 133.110 - Survival craft muster and embarkation arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft muster and embarkation arrangements. 133... VESSELS LIFESAVING SYSTEMS Requirements for All OSVs § 133.110 Survival craft muster and embarkation... lighting supplied from the emergency source of electrical power. (e) Each davit-launched survival craft...

  5. Mixed-ligand copper(II) complexes of dipicolylamine and 1,10 ...

    Indian Academy of Sciences (India)

    Unknown

    DNA repair mechanism.13,14 Copper(II) complexes containing heterocyclic bases have received consid- erable current interest in nucleic acid chemistry due to their diverse applications following the discovery of the “chemical nuclease” activity of the [Cu. (phen)2]+ (phen = 1,10-phenanthroline) complex in the presence of ...

  6. Enhanced Bonding of Silver Nanoparticles on Oxidized TiO2(110)

    DEFF Research Database (Denmark)

    Hansen, Jonas Ørbæk; Salazar, Estephania Lira; Galliker, Patrick

    2010-01-01

    The nucleation and growth of silver nanoclusters on TiO2(110) surfaces with on-top O adatoms (oxidized TiO2), surface O vacancies and H adatoms (reduced TiO2) have been studied. From the interplay of scanning tunneling microscopy/photoelectron spectroscopy experiments and density functional theor...

  7. {sup 110m}Ag root and foliar uptake in vegetables and its migration in soil

    Energy Technology Data Exchange (ETDEWEB)

    Shang, Z.R.; Leung, J.K.C. E-mail: jkcleung@hku.hk

    2003-07-01

    {sup 110m}Ag, as a radionuclide of corrosion products in water-cooled nuclear reactors, was detected in the liquid effluents of Guangdong Daya Bay Nuclear Power Station (GNPS) of Daya Bay under normal operation conditions. Experiments on a simulated terrestrial agricultural ecosystem were carried out using the pot experiment approach. The most common plants in Hong Kong and the South China vegetable gardens such as lettuce, Chinese spinach, kale, carrot, pepper, eggplant, bean, flowering cabbage, celery, European onion and cucumber were selected for {sup 110m}Ag root and foliar uptake tests. The results show that carrot, kale and flowering cabbage have the greatest values of soil to plant transfer factor among the vegetables, while{sup 110m}Ag can be transferred to Chinese spinach via foliar uptake. Flowering cabbage, the most popular leafy vegetable locally, could be used as a biomonitor for the radioisotope contamination in vegetables. Soil column and adsorption tests were also carried out to study the leaching ability and distributio coefficient (K{sub d}) of {sup 110m}Ag in the soil. The results show that most of the radionuclide was adsorbed in the top 1 cm of soil regardless of the pH value. The K{sub d} was also determined.

  8. High-Statistics Study of the β+/EC-Decay of 110In

    Directory of Open Access Journals (Sweden)

    Varela A. Diaz

    2014-03-01

    Full Text Available A study of the 110In β+/EC decay was performed at the TRIUMF Isotope Separator and Accelerator (ISAC facility to probe the nuclear structure of 110Cd. The data were collected in scaled-down γ-ray singles, γ − γ coincidence, and γ-electron coincidence mode. The data were sorted and a random-background subtracted γ − γ matrix was created containing a total of 850 million events. We expanded the level scheme of 110Cd significantly by identifying 75 levels under 3.8 MeV, including 12 new ones, and increased the number of previously observed transitions from these levels to 273. The γ-ray branching intensities have been extracted through an analysis of the coincidence intensities. The branching ratios were combined with a reanalysis of lifetimes measurements obtained in an (n, n'γ reaction with monoenergetic neutrons for the calculation of B(E2 values and these results have lead to the proposal of a γ-soft rotor, or O(6 nucleus, rather than a vibrational, or U(5 pattern for the nature of the low-lying, low-spin levels in 110Cd.

  9. Mechanism of oxidation of L-methionine by iron(III)-1,10 ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Kinetics and mechanism of oxidation of L-methionine by iron(III)–1,10- phenanthroline complex have been studied in perchloric acid medium. The reaction is first order each in iron(III) and methionine. Increase in [phenanthroline] increases the rate while increase in [HClO4] decreases it. While the reactive species ...

  10. High-temperature steam oxidation kinetics of the E110G cladding alloy

    International Nuclear Information System (INIS)

    Király, Márton; Kulacsy, Katalin; Hózer, Zoltán; Perez-Feró, Erzsébet; Novotny, Tamás

    2016-01-01

    In the course of recent years, several experiments were performed at MTA EK (Centre for Energy Research, Hungarian Academy of Sciences) on the isothermal high-temperature oxidation of the improved Russian cladding alloy E110G in steam/argon atmosphere. Using these data and designing additional supporting experiments, the oxidation kinetics of the E110G alloy was investigated in a wide temperature range, between 600 °C and 1200 °C. For short durations (below 500 s) or high temperatures (above 1065 °C) the oxidation kinetics was found to follow a square-root-of-time dependence, while for longer durations and in the intermediate temperature range (800–1000 °C) it was found to approach a cube-root-of-time dependence rather than a square-root one. Based on the results a new best-estimate and a conservative oxidation kinetics model were created. - Highlights: • Steam oxidation kinetics of E110G was studied at MTA EK based on old and new data. • New best-estimate and conservative steam oxidation kinetics were proposed for E110G. • The exponent of oxidation time changed depending on oxidation temperature. • A simple exponential curve was used instead of Arrhenius-type curve for the factor.

  11. 22 CFR 96.110 - Dissemination and reporting of information about temporarily accredited agencies.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Dissemination and reporting of information... ACT OF 2000 (IAA) Procedures and Standards Relating to Temporary Accreditation § 96.110 Dissemination and reporting of information about temporarily accredited agencies. The accrediting entity must...

  12. Hydrogen-promoted chlorination of RuO2(110)

    NARCIS (Netherlands)

    Hofmann, J.P.; Zweidinger, S.; Knapp, M.; Seitsonen, A.P.; Schulte, K.; Andersen, J.N.; Lundgren, E.; Over, H.

    2010-01-01

    High-resolution core-level photoemission spectroscopy and temperature-programmed reaction experiments together with density functional theory calculations were used to elucidate on the atomic scale the chlorination mechanism of ruthenium dioxide RuO2(110) by hydrogen chloride exposure. The

  13. 41 CFR 101-25.110 - Tire identification/registration program.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tire identification...-General Policies § 101-25.110 Tire identification/registration program. The regulations issued by the Department of Transportation in 49 CFR part 574, Tire Identification and Recordkeeping, require that tire...

  14. Incorporation of detailed eye model into polygon-mesh versions of ICRP-110 reference phantoms.

    Science.gov (United States)

    Nguyen, Thang Tat; Yeom, Yeon Soo; Kim, Han Sung; Wang, Zhao Jun; Han, Min Cheol; Kim, Chan Hyeong; Lee, Jai Ki; Zankl, Maria; Petoussi-Henss, Nina; Bolch, Wesley E; Lee, Choonsik; Chung, Beom Sun

    2015-11-21

    The dose coefficients for the eye lens reported in ICRP 2010 Publication 116 were calculated using both a stylized model and the ICRP-110 reference phantoms, according to the type of radiation, energy, and irradiation geometry. To maintain consistency of lens dose assessment, in the present study we incorporated the ICRP-116 detailed eye model into the converted polygon-mesh (PM) version of the ICRP-110 reference phantoms. After the incorporation, the dose coefficients for the eye lens were calculated and compared with those of the ICRP-116 data. The results showed generally a good agreement between the newly calculated lens dose coefficients and the values of ICRP 2010 Publication 116. Significant differences were found for some irradiation cases due mainly to the use of different types of phantoms. Considering that the PM version of the ICRP-110 reference phantoms preserve the original topology of the ICRP-110 reference phantoms, it is believed that the PM version phantoms, along with the detailed eye model, provide more reliable and consistent dose coefficients for the eye lens.

  15. The interaction of He with 1/2 110 edge dislocation in W and Mo

    International Nuclear Information System (INIS)

    Hosson, J.Th.M. de; Sleeswyk, A.W.; Caspers, L.M.; Heugten, W. van; Veen, A. van.

    1976-01-01

    The positions of the metal atoms around a 1/2 [110] edge dislocation in Mo and W are calculated using the Wilson-Johnson potentials. The boundary conditions are given by anisotropic elasticity theory. The He-metal potential, also developed by Wilson and Johnson, is used to calculate the position with maximum energy gain for a He-atom. (author)

  16. 24 CFR 110.30 - Effect of failure to display poster.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effect of failure to display poster... FAIR HOUSING FAIR HOUSING POSTER Enforcement § 110.30 Effect of failure to display poster. Any person... Secretary pursuant to part 105 of this chapter. A failure to display the fair housing poster as required by...

  17. Microscopic calculation of parameters of the sdg interacting boson model for 104-110Pd isotopes

    International Nuclear Information System (INIS)

    Liu Yong

    1995-01-01

    The parameters of the sdg interacting boson model Hamiltonian are calculated for the 104-110 Pd isotopes. The calculations utilize the microscopic procedure based on the Dyson boson mapping proposed by Yang-Liu-Qi and extended to include the g boson effects. The calculated parameters reproduce those values from the phenomenological fits. The resulting spectra are compared with the experimental spectra

  18. 30 CFR 291.110 - Who may MMS require to produce information?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may MMS require to produce information? 291... § 291.110 Who may MMS require to produce information? (a) MMS may require any lessee, operator of a lease or unit, shipper, grantee, or transporter to provide information that MMS believes is necessary to...

  19. Tank 241-BY-110 vapor sampling and analysis tank characterization report

    International Nuclear Information System (INIS)

    Huckaby, J.L.

    1995-01-01

    Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples

  20. Water adsorption and dissociation on Ni(110): How is it different from its close packed counterparts?

    Energy Technology Data Exchange (ETDEWEB)

    Seenivasan, H.; Tiwari, Ashwani K., E-mail: ashwani@iiserkol.ac.in [Indian Institute of Science Education and Research Kolkata, Mohanpur 741252 (India)

    2014-05-07

    Water adsorption and dissociation on Ni(110) surface is studied in detail and compared with its close packed counterparts using density functional theory calculations. Water adsorption occurs on the top site as found on Ni(100) and Ni(111) but the adsorption is stronger on Ni(110). H and OH preferably adsorb on the short bridge sites (brgshort) opposed to hollow sites on (100) and (111) surfaces. Energy barriers for water molecule dissociation on Ni(110) as obtained from the transition state (TS) calculations were low compared to other Ni low indexed surfaces. TS geometries at different positions of the lattice coordinate, Q, were obtained to study the effect of surface temperature on dissociation of H{sub 2}O molecules. These calculations revealed that second layer atoms were also involved in the TS. Dissociation probabilities are obtained using a semi-classical approximation by sampling Q for a Boltzmann distribution at different temperatures. Results showed that the increasing surface temperature significantly increases the dissociation probabilities at lower energies and saturates near the barrier for dissociation. Although the contribution from both top and second layers is similar at low surface temperatures, motion of top layer atoms contribute more towards dissociation probability at higher surface temperatures. Dissociation probabilities obtained are more than one order of magnitude higher than that on Ni(100) and Ni(111) surfaces suggesting Ni(110) to be more reactive among the low indexed Ni surfaces.

  1. 34 CFR 110.1 - What is the purpose of ED's age discrimination regulations?

    Science.gov (United States)

    2010-07-01

    ... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 110.1 What is the purpose of ED's age discrimination regulations? The purpose of these regulations is to set out ED's rules for implementing the Age... 34 Education 1 2010-07-01 2010-07-01 false What is the purpose of ED's age discrimination...

  2. Mothers Who Kill Their Offspring: Testing Evolutionary Hypothesis in a 110-Case Italian Sample

    Science.gov (United States)

    Camperio Ciani, Andrea S.; Fontanesi, Lilybeth

    2012-01-01

    Objectives: This research aimed to identify incidents of mothers in Italy killing their own children and to test an adaptive evolutionary hypothesis to explain their occurrence. Methods: 110 cases of mothers killing 123 of their own offspring from 1976 to 2010 were analyzed. Each case was classified using 13 dichotomic variables. Descriptive…

  3. 26 CFR 509.110 - Patent and copyright royalties and film rentals.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Patent and copyright royalties and film rentals... (CONTINUED) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.110 Patent and copyright... copyrights, artistic and scientific works, patents, designs, plans, secret processes and formulae, trademarks...

  4. 20 CFR 703.110 - Other forms of endorsements and policies.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Other forms of endorsements and policies. 703... Insurance Carriers § 703.110 Other forms of endorsements and policies. Where the form of endorsement prescribed by § 703.109 is not appropriate when used in conjunction with a form of policy approved for use by...

  5. 21 CFR 510.110 - Antibiotics used in food-producing animals.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Antibiotics used in food-producing animals. 510... Rulings and Decisions § 510.110 Antibiotics used in food-producing animals. (a) The Food and Drug... has requested an evaluation of the public health aspects of the use of antibiotics in veterinary...

  6. Oxygen adsorption on Pt(110)-(1x2): new high-coverage structures

    DEFF Research Database (Denmark)

    Helveg, Stig; Lorensen, Henrik Qvist; Horch, Sebastian

    1999-01-01

    From an interplay between scanning tunneling microscopy (STM) experiments and density functional theory (DFT) calculations, a comprehensive picture is obtained for oxygen adsorption on the Pt(110)-(1 x 2) surface, from single isolated oxygen atoms chemisorbed in FCC sites along the platinum ridges...... adsorption and platinum lattice distortions. (C) 1999 Elsevier Science B.V. All rights reserved....

  7. 33 CFR 110.250 - St. Thomas Harbor, Charlotte Amalie, V.I.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false St. Thomas Harbor, Charlotte... SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.250 St. Thomas Harbor, Charlotte Amalie.... Thomas, V.I. of the United States and approaches thereto, including all waters under its jurisdiction, as...

  8. Methanol oxidation on stepped Pt[n(111) x (110)] electrodes: a chronoamperometric study

    NARCIS (Netherlands)

    Housmans, T.H.M.; Koper, M.T.M.

    2003-01-01

    The methanol oxidation reaction has been studied on Pt[n(111) × (110)]-type electrodes in a 0.5 M sulfuric acid and 0.025 M methanol solution, using cyclic voltammetry and chronoamperometry. The voltammetric behavior of methanol on the three electrodes under investigation [Pt(111), Pt(554), and

  9. A theoretical study of hydrogen atoms adsorption and diffusion on PuO_2 (110) surface

    International Nuclear Information System (INIS)

    Yu, H.L.; Tang, T.; Zheng, S.T.; Shi, Y.; Qiu, R.Z.; Luo, W.H.; Meng, D.Q.

    2016-01-01

    The mechanisms of adsorption and diffusion of hydrogen atoms on the PuO_2 (110) surface are investigated by density functional theory corrected for onsite Coulombic interactions (GGA + U). In order to find out the energetically more favorable adsorption site and optimum diffusion path, adsorption energy of atomic H on various sites and the diffusion energy barrier are derived and compared. Our results show that both chemisorption and physisorption exist for H atoms adsorption configurations on PuO_2 (110) surface. Two processes for H diffusion are investigated using the climbing nudged-elastic-band (cNEB) approach. We have identified two diffusion mechanisms, leading to migration of atomic H on the surface and diffusion from surface to subsurface. The energy barriers indicate that it is energetically more favorable for H atom to be on the surface. Hydrogen permeation through purity PuO_2 surface is mainly inhibited from hydrogen atom diffusion from surface to subsurface. - Highlights: • H atoms adsorption on PuO_2 (110) surface are investigated by GGA + U. • Both chemisorption and physisorption exist for H atoms adsorption configurations. • H atoms migration into PuO_2 (100) surface are inhibited with the barrier of 2.15 eV. • H atoms diffusion on PuO_2 (110) surface are difficult at room temperature.

  10. 76 FR 20853 - Approval and Promulgation of Air Quality Implementation Plans; Kentucky; Approval of Section 110...

    Science.gov (United States)

    2011-04-14

    ... include contingency measures. On December 22, 2006, the United States Court of Appeals for the District of... Commenters' view that Kentucky's Prevention of Significant Deterioration (PSD) program does not require new... CAA section 110(a)(1). The Courts have agreed with EPA's longstanding view that a maintenance...

  11. Tank characterization report for single-shell tank 241-b-110

    International Nuclear Information System (INIS)

    Field, J.G.

    1997-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-110. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05

  12. Webmedia sai 110 miljonit krooni Aafrika ja Aasia vallutamiseks / Ilmar Kahro

    Index Scriptorium Estoniae

    Kahro, Ilmar

    2010-01-01

    Poolast pärit Kesk- ja Ida-Euroopa riskikapitalifond Enterprise Investors saab Eesti suurimas tarkvaraettevõttes Webmedia Group 36-protsendise osaluse ja investeerib selleks 110 mln. kooni. Webmedia üks eesmärke on laieneda Pärsia lahe riikidesse, firma on välja arendanud Katari riigiportaali

  13. 12 CFR 563b.110 - Who must review my business plan?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who must review my business plan? 563b.110... business plan? (a) Your chief executive officer and members of the board of directors must review, and at least two-thirds of your board of directors must approve, the business plan. (b) Your chief executive...

  14. 21 CFR 2.110 - Definition of ammonia under Federal Caustic Poison Act.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Definition of ammonia under Federal Caustic Poison... SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS Caustic Poisons § 2.110 Definition of ammonia under Federal Caustic Poison Act. For the purpose of determining whether an article containing ammonia...

  15. X-ray diffraction investigation of the sulphur induced 4x1 reconstruction of Ni(110)

    DEFF Research Database (Denmark)

    Foss, M.; Feidenhans'l, R.; Nielsen, M.

    1993-01-01

    The atomic structure of the Ni(110)4 x 1-S reconstruction has been determined on the basis of surface X-ray diffraction measurements. An analysis of the in-plane diffraction data shows that the model consists of Ni rows along the [001] direction, two for every 4 x 1 unit cell, corresponding to 0....

  16. Adsorption of guaiacol on Fe (110) and Pd (111) from first principles

    Science.gov (United States)

    Hensley, Alyssa J. R.; Wang, Yong; McEwen, Jean-Sabin

    2016-06-01

    The catalytic properties of surfaces are highly dependent upon the effect said surfaces have on the geometric and electronic structure of adsorbed reactants, products, and intermediates. It is therefore crucial to have a surface-level understanding of the adsorption of the key species in a reaction in order to design active and selective catalysts. Here, we study the adsorption of guaiacol on Fe (110) and Pd (111) using dispersion-corrected density functional theory calculations as both of these metals are of interest as hydrodeoxygenation catalysts for the conversion of bio-oils to useable biofuels. Both vertical (via the oxygen functional groups) and horizontal (via the aromatic ring) adsorption configurations were examined and the resulting adsorption and molecular distortion energies showed that the vertical sites were only physisorbed while the horizontal sites were chemisorbed on both metal surfaces. A comparison of guaiacol's horizontal adsorption on Fe (110) and Pd (111) showed that guaiacol had a stronger adsorption on Pd (111) while the Fe (110) surface distorted the Csbnd O bonds to a greater degree. Electronic analyses on the horizontal systems showed that the greater adsorption strength for guaiacol on Pd (111) was likely due to the greater charge transfer between the aromatic ring and the surface Pd atoms. Additionally, the greater distortion of the Csbnd O bonds in adsorbed guaiacol on Fe (110) is likely due to the greater degree of interaction between the oxygen and surface Fe atoms. Overall, our results show that the Fe (110) surface has a greater degree of interaction with the functional groups and the Pd (111) surface has a greater degree of interaction with the aromatic ring.

  17. Sparing of contralateral major salivary glands has a significant effect on oral health in patients treated with radical radiotherapy of head and neck tumors

    Energy Technology Data Exchange (ETDEWEB)

    Beer, K.T.; Greiner, R.H. [Klinik fuer Radio-Onkologie, Univ. Bern, Inselspital (Switzerland); Zehnder, D.; Lussi, A. [Klinik fuer Zahnerhaltung, Kinder- und Praeventivmedizin, Univ. Bern, Inselspital (Switzerland)

    2002-12-01

    Background: Has a conscious exclusion of the contralateral major salivary glands (parotid, submandibular, and sublingual glands) a significant impact on the milieu of the oral cavity (saliva flow, pH, buffer capacity, and colonisation with Streptococcus mutans) in patients with ENT tumors receiving radical radiotherapy? Patients and Methods: 20 consecutive consentient patients with ENT tumors were evaluated once before, weekly during, and 6 weeks after the end of treatment in regard to saliva flow, pH, buffer capacity, and colonisation with Streptococcus mutans. In 13 patients the major salivary glands on both sides were included in the treated volume, in seven patients the treatment portals excluded consciously the contralateral major salivary glands. Results: The stimulated saliva flow decreases already during the 1st week of radiotherapy, the decrease follows the dose exponentially; the saliva flow is further reduced in the weeks after the end of treatment. The effect is less pronounced in patients with sparing of contralateral major salivary glands. The majority of patients with unilateral sparing of the major salivary glands retain the baseline value of buffer capacity, whereas buffer capacity of all patients with inclusion of all major salivary glands is markedly reduced with 20 Gy already, without signs of recovery when treatment has stopped. With unilateral salivary gland sparing the pH always remains basic, in bilaterally irradiated patients the pH changes from a mean of 7.3 to 5.8 during treatment. The colonisation with Streptococcus mutans varies little in both groups during the radiotherapy; after the end of therapy, it is higher in bilaterally irradiated patients. Conclusions: The conscious arrangement of irradiation portals in order to spare contralateral major salivary glands in patients with radical radiotherapy of ENT tumors has a significant influence on the oral environment: the stimulated saliva flow is higher, the buffer capacity retains the

  18. Membrane binding properties of EBV gp110 C-terminal domain; evidences for structural transition in the membrane environment

    International Nuclear Information System (INIS)

    Park, Sung Jean; Seo, Min-Duk; Lee, Suk Kyeong; Lee, Bong Jin

    2008-01-01

    Gp110 of Epstein-Barr virus (EBV) mainly localizes on nuclear/ER membranes and plays a role in the assembly of EBV nucleocapsid. The C-terminal tail domain (gp110 CTD) is essential for the function of gp110 and the nuclear/ER membranes localization of gp110 is ruled by its C-terminal unique nuclear localization signal (NLS), consecutive four arginines. In the present study, the structural properties of gp110 CTD in membrane mimics were investigated using CD, size-exclusion chromatography, and NMR, to elucidate the effect of membrane environment on the structural transition and to compare the structural feature of the protein in the solution state with that of the membrane-bound form. CD and NMR analysis showed that gp110 CTD in a buffer solution appears to adopt a stable folding intermediate which lacks compactness, and a highly helical structure is formed only in membrane environments. The helical content of gp110 CTD was significantly affected by the negative charge as well as the size of membrane mimics. Based on the elution profiles of the size-exclusion chromatography, we found that gp110 CTD intrinsically forms a trimer, revealing that a trimerization region may exist in the C-terminal domain of gp110 like the ectodomain of gp110. The mutation of NLS (RRRR) to RTTR does not affect the overall structure of gp110 CTD in membrane mimics, while the helical propensity in a buffer solution was slightly different between the wild-type and the mutant proteins. This result suggests that not only the helicity induced in membrane environment but also the local structure around NLS may be related to trafficking to the nuclear membrane. More detailed structural difference between the wild-type and the mutant in membrane environment was examined using synthetic two peptides including the wild-type NLS and the mutant NLS

  19. Detection of human antibodies binding with smooth and rough LPSs from Proteus mirabilis O3 strains S1959, R110, R45.

    Science.gov (United States)

    Gleńska-Olender, J; Durlik, K; Konieczna, I; Kowalska, P; Gawęda, J; Kaca, W

    2017-11-01

    Bacteria of the genus Proteus of the family Enterobacteriaceae are facultative human pathogens responsible mainly for urinary tract and wound infections, bacteremia and the development of rheumatoid arthritis (RA). We have analyzed and compared by ELISA the titer of antibodies in plasmas of healthy individuals and in sera of rheumatoid arthritis patients recognizing a potential host cross-reactive epitope (lysine-galacturonic acid epitopes) present in Proteus lipopolysaccharide (LPS). In our experiments LPSs isolated from two mutants of smooth Proteus mirabilis 1959 (O3), i.e. strains R110 and R45, were used. R110 (Ra type mutant) is lacking the O-specific polysaccharide, but possesses a complete core oligosaccharide, while R45 (Re type) has a reduced core oligosaccharide and contains two 3-deoxy-D-manno-oct-2-ulosonic acid residues and one of 4-amino-4-deoxy-L-arabinopyranose residues. Titer of P. mirabilis S1959 LPS-specific-antibodies increased with the age of blood donors. RA and blood donors' sera contained antibodies against S and Ra and Re type of P. mirabilis O3 LPSs. Antibodies recognizing lysine-galacturonic acid epitopes of O3 LPS were detected by ELISA in some plasmas of healthy individuals and sera of rheumatoid arthritis patients. RA patients antibodies reacting with P. mirabilis S1959 S and R LPSs may indicate a potential role of anti-LPS antibodies in molecular mimicry in RA diseases.

  20. 21 CFR 56.110 - Expedited review procedures for certain kinds of research involving no more than minimal risk...

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Expedited review procedures for certain kinds of research involving no more than minimal risk, and for minor changes in approved research. 56.110 Section 56.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL...

  1. 41 CFR 101-25.110-2 - Tires obtained through Federal Supply Schedules or regional term contracts.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tires obtained through Federal Supply Schedules or regional term contracts. 101-25.110-2 Section 101-25.110-2 Public Contracts... Federal Supply Schedules or regional term contracts. When tire manufacturers ship tires direct against...

  2. A new NH 3 orbital of the NH 3/Ni(110) surface observed by metastable quenching spectroscopy

    Science.gov (United States)

    Lee, Lihwa; Arias, Jose; Hanrahan, Ciaran; Martin, Richard M.; Metiu, Horia

    1986-01-01

    By using metastable quenching spectroscopy we have found a new NH 3 filled orbital (in the language of one electron theory) for NH 3/Ni(110), located at the Fermi level of the surface. The orbital is not observed when NH 3 is adsorbed on Ni(110), but it is detected for NH 3 adsorbed on polycrystalline Al.

  3. 29 CFR 780.110 - Operations included in “cultivation and tillage of the soil.”

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Operations included in âcultivation and tillage of the soil.â 780.110 Section 780.110 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS EXEMPTIONS APPLICABLE TO AGRICULTURE, PROCESSIN...

  4. 33 CFR 110.84 - Black Rock Channel opposite foot of Porter Avenue, Buffalo, N.Y.

    Science.gov (United States)

    2010-07-01

    ... of Porter Avenue, Buffalo, N.Y. 110.84 Section 110.84 Navigation and Navigable Waters COAST GUARD... Channel opposite foot of Porter Avenue, Buffalo, N.Y. An area extending northwesterly between Black Rock... Triangulation Marker “N-5” on Bird Island Pier; thence southeasterly along the pier a distance of approximately...

  5. A new practical approach towards the synthesis of unsymmetric and symmetric 1,10-phenanthroline derivatives at room temperature.

    Science.gov (United States)

    Cheng, Yongfeng; Han, Xuesong; Ouyang, Huangche; Rao, Yu

    2012-03-18

    An efficient method towards synthesis of 1,10-phenanthrolines is described. Through Lewis acid-catalyzed annulation reaction between 3-ethoxycyclobutanones and 8-aminoquinolines, a variety of unsymmetric and symmetric 1,10-phenanthroline derivatives were readily prepared with high regioselectivity at room temperature.

  6. Structural, electronic and adsorption properties of Rh(111)/Mo(110) bimetallic catalyst: A DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Palotás, K., E-mail: palotas@phy.bme.hu [Budapest University of Technology and Economics, Department of Theoretical Physics, H-1111 Budapest (Hungary); Slovak Academy of Sciences, Institute of Physics, Department of Complex Physical Systems, Center for Computational Materials Science, SK-84511 Bratislava (Slovakia); Bakó, I. [Hungarian Academy of Sciences, Research Center for Natural Sciences, Institute of Organic Chemistry, H-1117 Budapest (Hungary); Bugyi, L. [MTA-SZTE, Reaction Kinetics and Surface Chemistry Research Group, Rerrich B. Sqr. 1, H-6720 Szeged (Hungary)

    2016-12-15

    Highlights: • 1 ML of Rh on Mo(110) forms a wavy structure propagating along the [001] direction. • Strain & ligand effects in the Rh film cause a downward shift of the d-band center. • CO adsorption energies are decreased by about 35% compared to pure Rh(111). • Depending on adsorption site, 0.28–0.46 e is transferred to adsorbed CO from Rh film. • CO adsorption generates 0.15–0.22 e transfer from Rh film to Mo in the unit cell. - Abstract: Geometric and electronic characterizations of one monolayer rhodium with Nishiyama-Wassermann (NW) structure on Mo(110) substrate have been performed by density functional theory (DFT) calculations. In the NW structure the Rh atoms form a wavy structure propagating along the [001] direction, characterized by an amplitude of 0.26 Å in the [110] direction and by 0.10 Å in the [110] direction of the Mo(110) substrate. Strain and ligand effects operating in the rhodium film are distinguished and found to be manifested in the downward shift of the d-band center of the electron density of states (DOS) by 0.11 eV and 0.18 eV, respectively. The shift in the d-band center of Rh DOS predicts a decrease in the surface reactivity toward CO adsorption, which has been verified by detailed calculations of bond energies of CO located at on-top, bridge and hollow adsorption sites. The CO adsorption energies are decreased by about 35% compared to those reported for pure Rh(111), offering novel catalytic pathways for the molecule. An in-depth analysis of the charge transfer and the partial DOS characters upon CO adsorption on the NW-structured Rh(111)/Mo(110) bimetallic catalyst and on the pure Rh(111) surface sheds light on the bonding mechanism of CO and on the governing factors determining its lowered bond energy on the bimetallic surface.

  7. The reorientation precession technique, REPREC, and the quadrupole moments of /sup 108/ /sup 110/Pd. [Sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Hasselgren, L; Fahlander, C; Edvardson, L O; Thun, J E; Falk, F; Ghumman, B S

    1975-04-01

    The orientation precession technique, REPREC, for measurements of quadrupole moments is described. The application of REPREC to the measurement of the static electric quadrupole moments of the first excited 2/sup +/-states in /sup 108/ /sup 110/Pd is presented. The possibility to measure the matrix product P/sub 4/ = M/sub 02/M/sub 22/,M/sub 02/M/sub 22/ is also discussed. Such measurements are presented for /sup 108/ /sup 110/Pd. The results of these measurements are P/sub 4/O for both /sup 108/Pd and /sup 110/Pd. For /sup 108/Pd the quadrupole moment of the first excited 2/sup +/-state was found to be -.66 +- .18 eb and for /sup 110/Pd -.72 +- .14 eb. Intrinsic nuclear properties for /sup 106 -110/Pd are derived using the sum rules suggested by Kumar.

  8. Reorientation precession measurements on /sup 108/ /sup 110/Pd and the quadrupole moments of their first 2/sup +/ states

    Energy Technology Data Exchange (ETDEWEB)

    Hasselgren, L; Fahlander, C; Falk, F; Edvardson, L O; Thun, J E; Ghuman, B S [Uppsala Univ. (Sweden). Fysiska Institutionen; Skaali, B [Oslo Univ. (Norway). Fysisk Institutt

    1976-06-28

    The reorientation precession technique, REPREC, for measurements of quadrupole moments is described. The application of REPREC to the measurement of the static electric quadrupole moments of the first excited 2/sup +/ states in /sup 108/ /sup 110/Pd is presented. The possibility to measure the sign of the matrix product P/sub 4/ = M/sub 02/Msub(22')Msub(02')M/sub 22/ is also discussed. Such measurements are presented for /sup 108/ /sup 110/Pd. The results of these measurements are P/sub 4/ < 0 for both /sup 108/Pd and /sup 110/Pd. For /sup 108/Pd the quadrupole moment of the first excited 2/sup +/ state was found to be -0.66+-0.18e.b and for /sup 110/Pd, -0.72+-0.14e.b. Intrinsic nuclear properties for /sup 106 -110/Pd are derived using the sum rules suggested by Kumar.

  9. Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test

    International Nuclear Information System (INIS)

    Komine, Kuniaki; Konno, Mutsuo

    1999-01-01

    NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)

  10. Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test

    Energy Technology Data Exchange (ETDEWEB)

    Komine, Kuniaki [Nuclear Power Engineering Corp., Tokyo (Japan); Konno, Mutsuo

    1999-07-01

    NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)

  11. Tyrosine 110 in the measles virus phosphoprotein is required to block STAT1 phosphorylation

    International Nuclear Information System (INIS)

    Devaux, Patricia; Messling, Veronika von; Songsungthong, Warangkhana; Springfeld, Christoph; Cattaneo, Roberto

    2007-01-01

    The measles virus (MV) P gene encodes three proteins: P, an essential polymerase cofactor, and C and V, which have multiple functions including immune evasion. We show here that the MV P protein also contributes to immune evasion, and that tyrosine 110 is required to block nuclear translocation of the signal transducer and activator of transcription factors (STAT) after interferon type I treatment. In particular, MV P inhibits STAT1 phosphorylation. This is shown not only by transient expression but also by reverse genetic analyses based on a new functional infectious cDNA derived from a MV vaccine vial (Moraten strain). Our study also identifies a conserved sequence around P protein tyrosine 110 as a candidate interaction site with a cellular protein

  12. Migration under the effect of an electric field of 110Ag and 124Sb in silver

    International Nuclear Information System (INIS)

    Nguyen Van, Doan; Brebec, G.

    1968-04-01

    The most recent theories relative to the influence of an electric field on the migration of point defects in metals are briefly recalled stressing their similarities and the different hypotheses on which they are based. In order to relate the various physical constants of the phenomenon, the flux of a solute is expressed in terms of diffusion coefficients and 'effective valences' defined in thermodynamics of irreversible processes. Experimental results on the electromigration of 124 Sb and 110 Ag in silver show that these atoms migrate towards the anode with effective valences of - 95 and - 16 respectively for 124 Sb and 110 Ag at temperatures in the region of 900 deg. C. Estimates were made on the resistivities that should be used in the different theories in order to compare their predictions with experimental results. (authors) [fr

  13. Internal services simulation control in 220/110kV power transformer station Mintia

    Science.gov (United States)

    Ciulica, D.; Rob, R.

    2018-01-01

    The main objectives in developing the electric transport and distribution networks infrastructure are satisfying the electric energy demand, ensuring the continuity of supply to customers, minimizing electricity losses in the transmission and distribution networks of public interest. This paper presents simulations in functioning of the internal services system 400/230 V ac in the 220/110 kV power transformer station Mintia. Using simulations in Visual Basic, the following premises are taken into consideration. All the ac consumers of the 220/110 kV power transformer station Mintia will be supplied by three 400/230 V transformers for internal services which can mutual reserve. In case of damaging at one transformer, the others are able to assume the entire consumption using automatic release of reserves. The simulation program studies three variants in which the continuity of supply to customers are ensured. As well, by simulations, all the functioning situations are analyzed in detail.

  14. Surface Chirality of Gly-Pro Dipeptide Adsorbed on a Cu(110) Surface.

    Science.gov (United States)

    Cruguel, Hervé; Méthivier, Christophe; Pradier, Claire-Marie; Humblot, Vincent

    2015-07-01

    The adsorption of chiral Gly-Pro dipeptide on Cu(110) has been characterized by combining in situ polarization modulation infrared reflection absorption spectroscopy (PM-RAIRS) and X-ray photoelectron spectroscopy (XPS). The chemical state of the dipeptide, and its anchoring points and adsorption geometry, were determined at various coverage values. Gly-Pro molecules are present on Cu(110) in their anionic form (NH2 /COO(-)) and adsorb under a 3-point binding via both oxygen atoms of the carboxylate group and via the nitrogen atom of the amine group. Low-energy electron diffraction (LEED) and scanning tunneling microscopy (STM) have shown the presence of an extended 2D chiral array, sustained via intermolecular H-bonds interactions. Furthermore, due to the particular shape of the molecule, only one homochiral domain is formed, creating thus a truly chiral surface. © 2015 Wiley Periodicals, Inc.

  15. Tailored TiO2(110) surfaces and their reactivity

    International Nuclear Information System (INIS)

    Pang, C L; Bikondoa, O; Humphrey, D S; Papageorgiou, A C; Cabailh, G; Ithnin, R; Chen, Q; Muryn, C A; Onishi, H; Thornton, G

    2006-01-01

    Electron bombardment from a filament as well as voltage pulses from a scanning tunnelling microscope tip have been employed to modify the surface of TiO 2 (110). Individual H atoms are selectively desorbed with electrical pulses of +3 V from the scanning tunnelling microscope tip, whilst leaving the oxygen vacancies intact. This allows us to distinguish between oxygen vacancies and hydroxyl groups, which have a similar appearance in scanning tunnelling microscopy images. This then allows the oxygen vacancy-promoted dissociation of water and O 2 to be followed with the microscope. Electrical pulses between +5 and +10 V induce local TiO 2 (110)1 x 2 reconstructions centred around the pulse. As for electron bombardment of the surface, relatively low fluxes increase the density of oxygen vacancies whilst higher fluxes lead to the 1 x 2 and other 1 x n reconstructions

  16. Self-organized patterns along sidewalls of iron silicide nanowires on Si(110) and their origin

    Energy Technology Data Exchange (ETDEWEB)

    Das, Debolina; Mahato, J. C.; Bisi, Bhaskar; Dev, B. N., E-mail: msbnd@iacs.res.in [Department of Materials Science, Indian Association for the Cultivation of Science, Kolkata 700032 (India); Satpati, B. [Surface Physics and Material Science Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700064 (India)

    2014-11-10

    Iron silicide (cubic FeSi{sub 2}) nanowires have been grown on Si(110) by reactive deposition epitaxy and investigated by scanning tunneling microscopy and scanning/transmission electron microscopy. On an otherwise uniform nanowire, a semi-periodic pattern along the edges of FeSi{sub 2} nanowires has been discovered. The origin of such growth patterns has been traced to initial growth of silicide nanodots with a pyramidal Si base at the chevron-like atomic arrangement of a clean reconstructed Si(110) surface. The pyramidal base evolves into a comb-like structure along the edges of the nanowires. This causes the semi-periodic structure of the iron silicide nanowires along their edges.

  17. An x-ray standing wave study of silver nano-wires on Cu(110)

    International Nuclear Information System (INIS)

    Stampfl, A.P.J.; Nyberg, G.

    1998-01-01

    Full text: The growth of Ag on Cu(110) is a well characterised adsorption system. At low coverages (under 1 ML), several reconstructions have been reported. Silver is believed to occupy the troughs of the Cu(110) surface, forming one-dimensional linear chains. We have carried out X-ray standing wave measurements especially in the low coverage limit (< 0.5 ML) using the [200], [220] and [111] Bragg reflection planes of copper and several core and auger lines. The usual dipole approximation analysis scheme was replaced by a more accurate description of the standing wave process which allowed use of the intense high energy core levels. We show that Ag does indeed sit along the troughs of the copper surface: the coherent fraction of the silver increased with decreasing coverage, its position being nearly the same as the bulk lattice at low coverages

  18. Experimental results for a 1.5 MW, 110 GHz gyrotron oscillator with reduced mode competition

    Science.gov (United States)

    Choi, E. M.; Marchewka, C. D.; Mastovsky, I.; Sirigiri, J. R.; Shapiro, M. A.; Temkin, R. J.

    2006-02-01

    A new result from a 110GHz gyrotron at MIT is reported with an output power of 1.67MW and an efficiency of 42% when operated at 97kV and 41A for 3μs pulses in the TE22,6 mode. These results are a major improvement over results obtained with an earlier cavity design, which produced 1.43MW of power at 37% efficiency. These new results were obtained using a cavity with a reduced output taper angle and a lower ohmic loss when compared with the earlier cavity. The improved operation is shown experimentally to be the result of reduced mode competition from the nearby TE19,7 mode. The reduced mode competition agrees well with an analysis of the startup scenario based on starting current simulations. The present results should prove useful in planning long pulse and CW versions of the 110GHz gyrotron.

  19. Experimental results for a 1.5 MW, 110 GHz gyrotron oscillator with reduced mode competition

    International Nuclear Information System (INIS)

    Choi, E.M.; Marchewka, C.D.; Mastovsky, I.; Sirigiri, J.R.; Shapiro, M.A.; Temkin, R.J.

    2006-01-01

    A new result from a 110 GHz gyrotron at MIT is reported with an output power of 1.67 MW and an efficiency of 42% when operated at 97 kV and 41 A for 3 μs pulses in the TE 22,6 mode. These results are a major improvement over results obtained with an earlier cavity design, which produced 1.43 MW of power at 37% efficiency. These new results were obtained using a cavity with a reduced output taper angle and a lower ohmic loss when compared with the earlier cavity. The improved operation is shown experimentally to be the result of reduced mode competition from the nearby TE 19,7 mode. The reduced mode competition agrees well with an analysis of the startup scenario based on starting current simulations. The present results should prove useful in planning long pulse and CW versions of the 110 GHz gyrotron

  20. Synthesis and crystal structure of two lead (II) complexes with 1,10-phenanthroline ligand

    International Nuclear Information System (INIS)

    Olivera, Fiorella L.; Santillan, Guillermo A.

    2012-01-01

    Two coordination complexes have been synthesized by the reaction of lead nitrate (II) with 1,10-phenanthroline in methanol/water. The crystals of these complexes were obtained by using the diffusion method and structurally characterized by X-ray single crystal diffraction. Both complexes crystallized in the monoclinic space group P2 1 /c. The analysis by crystal X-ray diffraction reveals that in both complexes the coordination around the lead (II) ion is a distorted octahedral structure where the ion is bonded to the heterocyclic nitrogen atoms of chelating ligand 1,10-phenanthroline, three oxygen atoms of three nitrate groups and one oxygen from the water molecule. The difference between the complexes lies in the way of nitrate ion in presence of carboxylic acid aromatics. In addition, the crystal structure of complexes can be regarded as a 3D coordination polymer through Pb-O weak interactions, hydrogen bonds and π-π stacking interactions. (author).

  1. Traveling interface modulations and anisotropic front propagation in ammonia oxidation over Rh(110)

    Energy Technology Data Exchange (ETDEWEB)

    Rafti, Matías [Instituto de Investigaciones Fisicoquímicas Teóricas y Aplicadas (INIFTA), Fac. Cs. Exactas, Universidad Nacional de La Plata, 64 y Diag. 113 (1900), La Plata (Argentina); Institut für Physikalische Chemie und Elektrochemie, Leibniz-Universität Hannover, Callinstr. 3-3a, D-30167 Hannover (Germany); Borkenhagen, Benjamin; Lilienkamp, Gerhard [Institut für Energieforschung und Physikalische Technologien, Technische Universität Clausthal, Leibnizstr. 4, 38678 Clausthal-Zellerfeld (Germany); Lovis, Florian; Smolinsky, Tim; Imbihl, Ronald, E-mail: imbihl@pci.uni-hannvover.de [Institut für Physikalische Chemie und Elektrochemie, Leibniz-Universität Hannover, Callinstr. 3-3a, D-30167 Hannover (Germany)

    2015-11-14

    The bistable NH{sub 3} + O{sub 2} reaction over a Rh(110) surface was explored in the pressure range 10{sup −6}–10{sup −3} mbar and in the temperature range 300–900 K using photoemission electron microscopy and low energy electron microscopy as spatially resolving methods. We observed a history dependent anisotropy in front propagation, traveling interface modulations, transitions with secondary reaction fronts, and stationary island structures.

  2. Comparison of surface fractal dimensions of chromizing coating and P110 steel for corrosion resistance estimation

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Naiming, E-mail: lnmlz33@163.com [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Guo, Junwen [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Xie, Faqin [School of Aeronautics, Northwestern Polytechnical University, Xi’an 710072 (China); Zou, Jiaojuan; Tian, Wei [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China); Yao, Xiaofei [School of Materials and Chemical Engineering, Xi’an Technological University, Xi’an 710032 (China); Zhang, Hongyan; Tang, Bin [Research Institute of Surface Engineering, Taiyuan University of Technology, Taiyuan 030024 (China)

    2014-08-30

    Highlights: • Continuous chromizing coating was synthesized on P110 steel by pack cementation. • The chromizing coating showed better corrosion resistance. • Comparison of surface fractal dimensions can estimate corrosion resistance. - Abstract: In the field of corrosion research, mass gain/loss, electrochemical tests and comparing the surface elemental distributions, phase constitutions as well as surface morphologies before and after corrosion are extensively applied to investigate the corrosion behavior or estimate the corrosion resistance of materials that operated in various environments. Most of the above methods are problem oriented, complex and longer-period time-consuming. However from an object oriented point of view, the corroded surfaces of materials often have self-similar characterization: fractal property which can be employed to efficiently achieve damaged surface analysis. The present work describes a strategy of comparison of the surface fractal dimensions for corrosion resistance estimation: chromizing coating was synthesized on P110 steel surface to improve its performance via pack cementation. Scanning electron microscope (SEM) was used to investigate the surface morphologies of the original and corroded samples. Surface fractal dimensions of the detected samples were calculated by binary images related to SEM images of surface morphologies with box counting algorithm method. The results showed that both surface morphologies and surface fractal dimensions of P110 steel varied greatly before and after corrosion test, but the chromizing coating changed slightly. The chromizing coating indicated better corrosion resistance than P110 steel. Comparison of surface fractal dimensions of original and corroded samples can rapidly and exactly realize the estimation of corrosion resistance.

  3. A 110 m long prototype helium transfer line for the HERA project

    International Nuclear Information System (INIS)

    Horvath, I.; Ming, P.; Von Burg, M.; Horlitz, G.; Sindt, H.

    1986-01-01

    A prototype helium transfer line of 110-m length was designed and constructed at SIN for the HERA project. This rendered a study of the assembly and handling processes as well as the determination of the heat losses into the transfer line. In this paper the transfer line structure is described and first results of heat transfer measurement for the specially developed super-insulation are presented

  4. 2 MW 110 GHz ECH heating system for DIII-D

    International Nuclear Information System (INIS)

    Moeller, C.; Prater, R.; Callis, R.; Remsen, D.; Doane, J.; Cary, W.; Phelps, R.; Tupper, M.

    1990-09-01

    A 2 MW 110 GHz ECH system using Varian 0.5 MW gyrotrons is under construction for use on the DIII-D tokamak by late 1991. Most of the components are being design and fabricated at General Atomics, including the gyrotron tanks, superconducting magnets, and transmission line. These components are intended for operation with 10 second pulses and, in the future, with 1 MW gyrotrons. 6 refs., 5 figs

  5. cis-Difluoridobis(1,10-phenanthroline)chromium(III) perchlorate monohydrate

    DEFF Research Database (Denmark)

    Birk, Torben; Bendix, Jesper; Weihe, Högni

    2008-01-01

    The title complex, [CrF(2)(C(12)H(8)N(2))(2)]ClO(4)·H(2)O, displays a slightly distorted octa-hedral coordination geometry around the central chromium(III) ion. The Cr environment is composed of a cis arrangement of two 1,10-phenanthroline [average Cr(III)-N = 2.0726 (10) Å] and two fluoride [ave...

  6. InGaAs/GaAs (110) quantum dot formation via step meandering

    Energy Technology Data Exchange (ETDEWEB)

    Diez-Merino, Laura; Tejedor, Paloma [Department of Nanostructures and Surfaces, Instituto de Ciencia de Materiales de Madrid, CSIC, Sor Juana Ines de la Cruz 3, 28049-Madrid (Spain)

    2011-07-01

    InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.

  7. InGaAs/GaAs (110) quantum dot formation via step meandering

    International Nuclear Information System (INIS)

    Diez-Merino, Laura; Tejedor, Paloma

    2011-01-01

    InGaAs (110) semiconductor quantum dots (QDs) offer very promising prospects as a material base for a new generation of high-speed spintronic devices, such as single electron transistors for quantum computing. However, the spontaneous formation of InGaAs QDs is prevented by two-dimensional (2D) layer-by-layer growth on singular GaAs (110) substrates. In this work we have studied, by using atomic force microscopy and photoluminescence spectroscopy (PL), the growth of InGaAs/GaAs QDs on GaAs (110) stepped substrates by molecular beam epitaxy (MBE), and the modification of the adatom incorporation kinetics to surface steps in the presence of chemisorbed atomic hydrogen. The as-grown QDs exhibit lateral dimensions below 100 nm and emission peaks in the 1.35-1.37 eV range. It has been found that a step meandering instability derived from the preferential attachment of In adatoms to [110]-step edges relative to [11n]-type steps plays a key role in the destabilization of 2D growth that leads to 3D mound formation on both conventional and H-terminated vicinal substrates. In the latter case, the driving force for 3D growth via step meandering is enhanced by H-induced upward mass transport in addition to the lower energy cost associated with island formation on H-terminated substrates, which results in a high density array of InGaAs/GaAs dots selectively nucleated on the terrace apices with reduced lateral dimensions and improved PL efficiency relative to those of conventional MBE-grown samples.

  8. Comparison of surface fractal dimensions of chromizing coating and P110 steel for corrosion resistance estimation

    International Nuclear Information System (INIS)

    Lin, Naiming; Guo, Junwen; Xie, Faqin; Zou, Jiaojuan; Tian, Wei; Yao, Xiaofei; Zhang, Hongyan; Tang, Bin

    2014-01-01

    Highlights: • Continuous chromizing coating was synthesized on P110 steel by pack cementation. • The chromizing coating showed better corrosion resistance. • Comparison of surface fractal dimensions can estimate corrosion resistance. - Abstract: In the field of corrosion research, mass gain/loss, electrochemical tests and comparing the surface elemental distributions, phase constitutions as well as surface morphologies before and after corrosion are extensively applied to investigate the corrosion behavior or estimate the corrosion resistance of materials that operated in various environments. Most of the above methods are problem oriented, complex and longer-period time-consuming. However from an object oriented point of view, the corroded surfaces of materials often have self-similar characterization: fractal property which can be employed to efficiently achieve damaged surface analysis. The present work describes a strategy of comparison of the surface fractal dimensions for corrosion resistance estimation: chromizing coating was synthesized on P110 steel surface to improve its performance via pack cementation. Scanning electron microscope (SEM) was used to investigate the surface morphologies of the original and corroded samples. Surface fractal dimensions of the detected samples were calculated by binary images related to SEM images of surface morphologies with box counting algorithm method. The results showed that both surface morphologies and surface fractal dimensions of P110 steel varied greatly before and after corrosion test, but the chromizing coating changed slightly. The chromizing coating indicated better corrosion resistance than P110 steel. Comparison of surface fractal dimensions of original and corroded samples can rapidly and exactly realize the estimation of corrosion resistance

  9. Tank 241-BY-110 vapor sampling and analysis tank characterization report. Revision 1

    International Nuclear Information System (INIS)

    Huckaby, J.L.

    1995-01-01

    This report presents the details of the Hanford waste tank characterization study for tank 241-BY-110. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedures that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to the tank farm workers due to fugitive emissions from the tank

  10. Theory of the oxygen-induced restructuring of Cu(110) and Cu(100) surfaces

    DEFF Research Database (Denmark)

    Jacobsen, Karsten Wedel; Nørskov, Jens Kehlet

    1990-01-01

    A model calculation based on the effective-medium theory of the oxygen-induced reconstruction of the (110) and (100) surfaces of Cu is presented. Equilibrium structures are calculated from a minimization of the total energy of the system. Missing-row-type reconstructions are found to be most stable...... in both cases, and an analysis is presented, showing what the driving force is behind these reconstructions....

  11. Study on the GaAs(110) surface using emitted atom spectrometry

    International Nuclear Information System (INIS)

    Gayone, J.E.; Sanchez, E.A.; Grizzi, O.; Universidad Nacional de Cuyo, Mendoza

    1998-01-01

    The facilities implemented at Bariloche for the ion scattering spectrometry is described, and recent examples of the technique application to determine the atomic structure and the composition of metallic and semiconductor surfaces, pure and with different adsorbates. The surface analysis technique using emitted atom spectrometry is discussed. The sensitivity to the GaAs(110) surface atomic relaxation is presented, and the kinetic of hydrogen adsorption by the mentioned surface is studied

  12. 33 CFR 110.85 - Niagara River, Youngstown, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River, Youngstown, N.Y... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.85 Niagara River, Youngstown, N.Y. (a) Area 1... of the Niagara River at latitude 43°14′33″ N, longitude 79°03′7.5″ W; thence westerly to a point at...

  13. Application of genetic algorithm in modeling on-wafer inductors for up to 110 Ghz

    Science.gov (United States)

    Liu, Nianhong; Fu, Jun; Liu, Hui; Cui, Wenpu; Liu, Zhihong; Liu, Linlin; Zhou, Wei; Wang, Quan; Guo, Ao

    2018-05-01

    In this work, the genetic algorithm has been introducted into parameter extraction for on-wafer inductors for up to 110 GHz millimeter-wave operations, and nine independent parameters of the equivalent circuit model are optimized together. With the genetic algorithm, the model with the optimized parameters gives a better fitting accuracy than the preliminary parameters without optimization. Especially, the fitting accuracy of the Q value achieves a significant improvement after the optimization.

  14. Tank characterization report for single-shell tank 241-U-110

    International Nuclear Information System (INIS)

    Brown, T.M.; Jensen, L.

    1993-04-01

    This report investigates the nature of the waste in tank U-110 using historical and current information. When characterizing tank waste, several important properties are considered. First, the physical characteristics of the waste are presented, including waste appearance, density, and size of waste particles. The existence of any exotherms in the tank that may present a safety concern is investigated. Finally, the radiological and chemical composition of the tank are presented

  15. Energetics and dynamics of Pt dimers on Pt(110)-(1x2)

    International Nuclear Information System (INIS)

    Linderoth, T.R.; Horch, S.; Petersen, L.; Helveg, S.; Schoenning, M.; Laegsgaard, E.; Stensgaard, I.; Besenbacher, F.

    2000-01-01

    The stability and dynamics of Pt dimers on Pt(110)-(1x2) are studied using fast-scanning, variable-temperature STM. The kinetics of both dissociation and association of dimers have been quantified from a direct analysis of time-lapse STM movies. The extracted barriers are at variance with results from ab initio calculations, and we speculate that the discrepancies are due to trace amounts of gas impurities such as CO

  16. Semiconductor-based, large-area, flexible, electronic devices on {110} oriented substrates

    Science.gov (United States)

    Goyal, Amit

    2014-08-05

    Novel articles and methods to fabricate the same resulting in flexible, oriented, semiconductor-based, electronic devices on {110} textured substrates are disclosed. Potential applications of resulting articles are in areas of photovoltaic devices, flat-panel displays, thermophotovoltaic devices, ferroelectric devices, light emitting diode devices, computer hard disc drive devices, magnetoresistance based devices, photoluminescence based devices, non-volatile memory devices, dielectric devices, thermoelectric devices and quantum dot laser devices.

  17. [100] or [110] aligned, semiconductor-based, large-area, flexible, electronic devices

    Science.gov (United States)

    Goyal, Amit

    2015-03-24

    Novel articles and methods to fabricate the same resulting in flexible, large-area, [100] or [110] textured, semiconductor-based, electronic devices are disclosed. Potential applications of resulting articles are in areas of photovoltaic devices, flat-panel displays, thermophotovoltaic devices, ferroelectric devices, light emitting diode devices, computer hard disc drive devices, magnetoresistance based devices, photoluminescence based devices, non-volatile memory devices, dielectric devices, thermoelectric devices and quantum dot laser devices.

  18. HKUST-1 Membranes Anchored on Porous Substrate by Hetero MIL-110 Nanorod Array Seeds.

    Science.gov (United States)

    Mao, Yiyin; Cao, Wei; Li, Junwei; Sun, Luwei; Peng, Xinsheng

    2013-09-02

    Great anchors and seeds: Hetero-seeding growth processes and anchored nanorod arrays were successfully utilized in the synthesis of HKUST-1 membranes. These arrays were firmly anchored on porous substrates by using a MIL-110 nanorod array as both the anchor and seed. The resulting HKUST-1 membranes demonstrated good separation factors for binary gases exceeding the Knudson selectivity. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Tank characterization report for single-shell Tank 241-B-110

    International Nuclear Information System (INIS)

    Amato, L.C.; De Lorenzo, D.S.; DiCenso, A.T.; Rutherford, J.H.; Stephens, R.H.; Heasler, P.G.; Brown, T.M.; Simpson, B.C.

    1994-08-01

    Single-shell Tank 241-B-110 is an underground storage tank containing radioactive waste. The tank was sampled at various times between August and November of 1989 and later in April of 1990. The analytical data gathered from these sampling efforts were used to generate this Tank Characterization Report. Tank 241-B-110, located in the 200 East Area B Tank Farm, was constructed in 1943 and 1944, and went into service in 1945 by receiving second cycle decontamination waste from the B and T Plants. During the service life of the tank, other wastes were added including B Plant flush waste, B Plant fission product waste, B Plant ion exchange waste, PUREX Plant coating waste, and waste from Tank 241-B-105. The tank currently contains 246,000 gallons of non-complexed waste, existing primarily as sludge. Approximately 22,000 gallons of drainable interstitial liquid and 1,000 gallons of supernate remain. The solid phase of the waste is heterogeneous, for the top layer and subsequent layers have significantly different chemical compositions and are visually distinct. A complete analysis of the top layer has not been done, and auger sampling of the top layer is recommended to fully characterize the waste in Tank 241-B-110. The tank is not classified as a Watch List tank; however, it is a Confirmed Leaker, having lost nearly 10,000 gallons of waste. The waste in Tank 241-B-110 is primarily precipitated salts, some of which are composed of radioactive isotopes. The most prevalent analytes include water, bismuth, iron, nitrate, nitrite, phosphate, silicon, sodium, and sulfate. The major radionuclide constituents are 137 Cs and 90 Sr

  20. The Peierls stress of the moving 1/2{110} screw dislocation in Ta

    International Nuclear Information System (INIS)

    Liu Ruiping; Wang Shaofeng; Wu Xiaozhi

    2009-01-01

    The Peierls stress of the moving 1/2 {110} screw dislocation with a planar and non-dissociated core structure in Ta has been calculated. The elastic strain energy which is associated with the discrete effect of the lattice and ignored in classical Peierls-Nabarro (P-N) theory has been taken into account in calculating the Peierls stress, and it can make the Peierls stress become smaller. The Peierls stress we obtain is very close to the experimental data. As shown in the numerical calculations and atomistic simulations, the core structure of the screw dislocation undergoes significant changes under the explicit stress before the screw dislocation moves. Moreover, the mechanism of the screw dislocation is revealed by our results and the experimental data that the screw dislocation retracts its extension in three {110} planes and transforms its dissociated core structure into a planar configuration. Therefore, the core structure of the moving 1/2 {110} screw dislocation in Ta is proposed to be planar.

  1. Decarbonylation and hydrogenation reactions of allyl alcohol and acrolein on Pd(110)

    Science.gov (United States)

    Shekhar, Ratna; Barteau, Mark A.

    1994-11-01

    Allyl alcohol and acrolein reactions on the Pd(110) surface were investigated using temperature programmed desorption. For both unsaturated oxygenates, three coverage-dependent reaction pathways were observed. At low coverages, allyl alcohol decomposed completely to CO, hydrogen and carbonaceous species on the surface. For θ > 0.15 monolayer, ethylene (and small amounts of ethane) desorbed at ca. 295 K. Near saturation coverages, desorption of propanal was detected at ca. 235 K. The parent molecule, allyl alcohol, desorbed only after exposures sufficient to saturate these channels. Acrolein decomposition spectra were similar to those observed for allyl alcohol decomposition on the clean surface. Additional experiments with allyl alcohol on hydrogen- and deuterium-precoveredPd(110) surfaces demonstrated increased hydrogenation of the C 2-hydrocarbon products along with hydrogenation of allyl alcohol to 1-propanol. However, in contrast to previous results for allyl alcohol on the Pd(111) surface, there was no evidence for C-O scission reactions of any C 3 oxygenate on Pd(110).

  2. Promotion effect of monovalent metals (K and Cs) on the GaAs (110) surface oxidation

    International Nuclear Information System (INIS)

    Valeri, S.; Sberveglieri, P.; Angeli, E.

    1987-01-01

    The effect of thin (∼ 1 monolayer) overlayers of low electronegativity metals (Cs and K) on the RT oxidation behaviour of GaAs(110) cleavage surface is studied. This study was with Auger and Photoemission spectroscopies. Attention has been focused on the core-valence-valence and Auger lineshapes on the Ga and As 3d peaks. Presence of the alkali metal enhances the GaAs (110) oxidation rate several orders of magnitude above the clean surface value has been found. The range 0-100 Langmuir is investigated in detail. The oxidation process of the GaAs(110) surface in the presence of both K and Cs overlayer follows a multi-step kinetic and reaches a saturation at exposure lower than 100 Langmuir. Both Ga and As atoms are involved in the oxygen bonding. The metal enhanced semiconductor oxidation is generally reported to be a process involving predominantly the semiconductor surface atoms. However in the Cs - and K - GaAs case, an involvement of the alkali metal atoms too, reflected in the shape modification of their Auger line has been found. The promotion effect of K and Cs is discussed in terms of their low electronegativity and in comparison with the results recently reported in the literature for the other low electronegativity metals

  3. Negative ion formation in the scattering of state-selected NO+ on GaAs(110)

    International Nuclear Information System (INIS)

    Martin, J.S.; Greeley, J.N.; Morris, J.R.; Ferenchok, B.T.; Jacobs, D.C.

    1993-01-01

    A hyperthermal beam of state-selected NO + X 1 Σ + (v,j) impinges on a clean, well characterized GaAs(110) surface. The resulting two-electron transfer products NO-and O- are independently interrogated with a novel ion imaging technique as a function of NO + translational and vibrational energies. The products are shown to have different appearance thresholds, product translational energy distributions, and NO + vibrational energy dependencies. Most notably, vibrational energy is an order of magnitude more effective that translational energy in activating O- formation at a collision energy of 45 eV. The O- angular distribution exhibits a correlation with translational energy which is asymmetric about the surface normal. These results suggest that the probability of O- formation is dependent on the molecules point of impact with the GaAs (110) surface. The dynamical features of the NO + /GaAs(110) reaction will be discussed in terms of the three independent coordinates addressed in this experiment: the diatom internuclear separation, the molecule-surface distance, and the surface impact parameter

  4. The Relaxation of Vicinal (001) with ZigZag [110] Steps

    Science.gov (United States)

    Hawkins, Micah; Hamouda, Ajmi Bh; González-Cabrera, Diego Luis; Einstein, Theodore L.

    2012-02-01

    This talk presents a kinetic Monte Carlo study of the relaxation dynamics of [110] steps on a vicinal (001) simple cubic surface. This system is interesting because [110] steps have different elementary excitation energetics and favor step diffusion more than close-packed [100] steps. In this talk we show how this leads to relaxation dynamics showing greater fluctuations on a shorter time scale for [110] steps as well as 2-bond breaking processes being rate determining in contrast to 3-bond breaking processes for [100] steps. The existence of a steady state is shown via the convergence of terrace width distributions at times much longer than the relaxation time. In this time regime excellent fits to the modified generalized Wigner distribution (as well as to the Berry-Robnik model when steps can overlap) were obtained. Also, step-position correlation function data show diffusion-limited increase for small distances along the step as well as greater average step displacement for zigzag steps compared to straight steps for somewhat longer distances along the step. Work supported by NSF-MRSEC Grant DMR 05-20471 as well as a DOE-CMCSN Grant.

  5. Development of axial asymmetry in the neutron-rich nucleus {sup 110}Mo

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, H., E-mail: hiroshi@ribf.riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yamaguchi, K.; Odahara, A. [Department of Physics, Osaka University, Machikaneyama-machi 1-1, Osaka 560-0043 Toyonaka (Japan); Sumikama, T. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Nishimura, S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yoshinaga, K. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Li, Z. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Miyashita, Y. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Sato, K. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Prochniak, L. [Institute of Physics, Maria Curie-Sklodowska University, pl. M. Curie-Sklodowskiej 1, 20-031 Lublin (Poland); Baba, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Berryman, J.S. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Blasi, N. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Bracco, A.; Camera, F. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Dipartimento di Fisica, Universita di Milano, via Celoria 16, I-20133 Milano (Italy); Chiba, J. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Doornenbal, P. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Go, S.; Hashimoto, T.; Hayakawa, S. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan)

    2011-10-19

    The neutron-rich nucleus {sup 110}Mo has been investigated by means of {gamma}-ray spectroscopy following the {beta}-decay of {sup 110}Nb, produced using in-flight fission of a {sup 238}U beam at 345 MeV/nucleon at the RIBF facility. In addition to the ground-band members reported previously, spectroscopic information on the low-lying levels of the quasi-{gamma} band built on the second 2{sup +} state at 494 keV has been obtained for the first time. The experimental finding of the second 2{sup +} state being lower than the yrast 4{sup +} level suggests that axially-asymmetric {gamma} softness is substantially enhanced in this nucleus. The experimental results are compared with model calculations based on the general Bohr Hamiltonian method. The systematics of the low-lying levels in even-even A{approx}110 nuclei is discussed in comparison with that in the neutron-rich A{approx}190 region, by introducing the quantity E{sub S}/E(2{sub 1}{sup +}), E{sub S}=E(2{sub 2}{sup +})-E(4{sub 1}{sup +}), as a global signature of the structural evolution involving axial asymmetry.

  6. Reactions of OH Radicals with Tris (1,10-Phenanthroline) Iron (II) Studied by Pulse Radiolysis

    DEFF Research Database (Denmark)

    Siekierska Floryan, E.; Pagsberg, Palle Bjørn

    1976-01-01

    The reaction of OH radicals with aqueous tris(1,10-phenanthroline)iron(II) leads to the formation of an adduct, which exhibits a broad absorption band at rmpH = 6, λmax = 460 nm, and epsilon (Porson)460 = 6700 (molar, decadic, 1 mol−1 cm−1). The rate of formation of the adduct is first order...... in complex concentration with a bimolecular rate constant Image independent of pH in the range pH 3–11. The adduct decays by mixed-order kinetics, but at 310 nm a second-order formation of a decay product can be directly observed. The reaction of OH radicals with aqueous 1,10-phenanthroline leads also...... to the formation of an adduct which absorbs in the whole visible region with a maximum at 425 nm and ε425 = 2612 (molar, decadic, 1 mol−1 cm−1) in neutral solution. The adduct exhibits a red shift in acidic and alkaline media. The formation is first order in 1,10-phenanthroline with a bimolecular rate constant...

  7. 108mAg and 110mAg in crassostrea gigas

    International Nuclear Information System (INIS)

    Ishikawa, Y.; Sato, N.; Nakamura, E.; Sekine, T.; Yoshihara, K.

    1992-01-01

    Accumulation of radiosilver 108m Ag and 110m Ag in oysters (Crassostrea gigas) and their behavior in marine environments has been studied in the northeast Pacific coast in Japan. Enrichment of radiosilver in oysters depends on topographical conditions; significant bioaccumulation occurred in open bays, while it was hardly observed in bays with narrow shaped entrances. From these observations difference of the behavior of radiosilver between open and nearly closed bays is suggested. 110m Ag in oysters decayed with an effective half-life of about 150 days for both the Chinese nuclear weapon test and the Chernobyl accident. In contrast to radiosilver, the fission product nuclide 137 Cs was almost independent of topographical conditions, and its concentration was constant. 110m Ag bioaccumulation in oysters after the Chernobyl accident in 1986 was found in both open and nearly closed bays, the lattershowing much lower concentration of radiosilver than the former. Specific activity of 108m Ag in oysters was determined in bays open to the Pacific Oceans. (author) 13 refs.; 4 figs.; 3 tabs

  8. Tensile and high cycle fatigue behaviors of high-Mn steels at 298 and 110 K

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Wongyu; Jeong, Daeho; Sung, Hyokyung; Kim, Sangshik, E-mail: sang@gnu.ac.kr

    2017-02-15

    Tensile and high cycle fatigue behaviors of high-Mn austenitic steels, including 25Mn, 25Mn0.2Al, 25Mn0.5Cu, 24Mn4Cr, 22Mn3Cr and 16Mn2Al specimens, were investigated at 298 and 110 K. Depending on the alloying elements, tensile ductility of high-Mn steels either increased or decreased with decreasing temperature from 298 to 110 K. Reasonable correlation between the tendency for martensitic tranformation, the critical twinning stress and the percent change in tensile elongation suggested that tensile deformation of high-Mn steels was strongly influenced by SFE determining TRIP and TWIP effects. Tensile strength was the most important parameter in determining the resistance to high cycle fatigue of high-Mn steels with an exceptional work hardening capability at room and cryogenic temperatures. The fatigue crack nucleation mechanism in high-Mn steels did not vary with decreasing tempertature, except Cr-added specimens with grain boundary cracking at 298 K and slip band cracking at 110 K. The EBSD (electron backscatter diffraction) analyses suggested that the deformation mechanism under fatigue loading was significantly different from tensile deformation which could be affected by TRIP and TWIP effects. - Highlights: •The resistances to HCF of various high-Mn steels were measured. •The variables affecting tensile and HCF behaviors of high-Mn steels were assessed. •The relationship between tensile and the HCF behaviors of high-Mn steels was established.

  9. Influence of pre-hydriding on embrittlement of E110 alloy under LOCA conditions

    International Nuclear Information System (INIS)

    VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Fedotov, P.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Kuznetsov, V.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Nechaeva, O.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Novikov, V.; VNIINM, Moscow (Russian Federation))" data-affiliation=" (SC VNIINM, Moscow (Russian Federation))" >Salatov, A.; Ignatiev, D.; Mokrushin, A.; Soldatkin, D.; Urusov, A.

    2015-01-01

    The researches presented in this paper were carried out in the framework of TVS-K project developed by JSC “TVEL”. The data on the corrosion and residual ductility of unirradiated and pre-hydrided E110 alloy under LACA conditions at temperature range from 1100 to 1200°C are presented. The hydrogen concentration was varied from 30 (as-received) to 600 wppm. The initial concentration of hydrogen has no effect on the oxidation kinetics, while the oxidation kinetics are parabolic and the breakaway oxidation is not observed. Oxide films on surfaces of claddings are black and shining. There are no cracks, visual spots and peelings. The residual ductility of oxidised samples decrease with hydrogen concentration rise. The residual ductility of claddings oxidized at 1100 °C, generally higher than the same of the claddings oxidized at 1200 °C. E110 alloy has a good residual ductility in comparison to Zry-4, ZIRLO, M5. Joint analysis of the test results allowed us to formulate embrittlement criteria of the E110 alloy under LOCA conditions. This embrittlement criterion is preliminary, because the experimental data base must to be enlarged by results of tests with claddings of another geometry and quench experiments. (author)

  10. Tailoring Graphene Morphology and Orientation on Cu(100), Cu(110), and Cu(111)

    Science.gov (United States)

    Jacobberger, Robert; Arnold, Michael

    2013-03-01

    Graphene CVD on Cu is phenomenologically complex, yielding diverse crystal morphologies, such as lobes, dendrites, stars, and hexagons, of various orientations. We present a comprehensive study of the evolution of these morphologies as a function of Cu surface orientation, pressure, H2:CH4, and nucleation density. Growth was studied on ultra-smooth, epitaxial Cu films inside Cu enclosures to minimize factors that normally complicate growth. With low H2:CH4, Mullins-Sekerka instabilities propagate to form dendrites, indicating transport limited growth. In LPCVD, the dendrites extend hundreds of microns in the 100, 111, and 110 directions on Cu(100), (110), and (111) and are perturbed by twin boundaries. In APCVD, multiple preferred dendrite orientations exist. With increasing H2:CH4, the dendritic nature of growth is suppressed. In LPCVD, square, rectangle, and hexagon crystals form on Cu(100), (110) and (111), reflecting the Cu crystallography. In APCVD, the morphology becomes hexagonal on each surface. If given ample time, every growth regime yields high-quality monolayers with D:G Raman ratio rationally tailor the graphene crystal morphology and orientation.

  11. Nuclear-physical properties of 105,106m,110mAg

    International Nuclear Information System (INIS)

    Popov, Yu. S.; Zakharova, L. V.; Sadulin, V. V.; Andreev, O. I.; Pakhomov, A. N.

    2005-01-01

    The nuclear-physical properties of the nuclides 105,106m,110m Ag, which are concomitant nuclides in reactor production of 103 Pd and 109 Cd used in metrology of ionizing radiations and in nuclear medicine, were studied. The following quantities were determined by semiconductor X-ray and γ-ray spectrometry: the parameter K α /K β of X-ray K radiation accompanying the decay of 110m Ag and the intensities of γ-ray quanta with the energies of 280 and 345 keV ( 105 Ag); 430, 451, and 512 keV ( 106m Ag); 658, 764, 885, 938, and 1384 keV ( 110m Ag). The half-lives determined using the above γ-ray lines are as follows: T 1/2 ( 105 Ag) = 41.2 ± 0.1 days; T 1/2 ( 106m Ag) = 8.30 ± 0.07 days. The errors are given for 95% confidence level [ru

  12. Bias Dependent Spin Relaxation in a [110]-InAs/AlSb Two Dimensional Electron System

    Science.gov (United States)

    Hicks, J.; Holabird, K.

    2005-03-01

    Manipulation of electron spin is a critical component of many proposed semiconductor spintronic devices. One promising approach utilizes the Rashba effect by which an applied electric field can be used to reduce the spin lifetime or rotate spin orientation through spin-orbit interaction. The large spin-orbit interaction needed for this technique to be effective typically leads to fast spin relaxation through precessional decay, which may severely limit device architectures and functionalities. An exception arises in [110]-oriented heterostructures where the crystal magnetic field associated with bulk inversion asymmetry lies along the growth direction and in which case spins oriented along the growth direction do not precess. These considerations have led to a recent proposal of a spin-FET that incorporates a [110]-oriented, gate-controlled InAs quantum well channel [1]. We report measurements of the electron spin lifetime as a function of applied electric field in a [110]-InAs 2DES. Measurements made using an ultrafast, mid-IR pump-probe technique indicate that the spin lifetime can be reduced from its maximum to minimum value over a range of less than 0.2V per quantum well at room temperature. This work is supported by DARPA, NSERC and the NSF grant ECS - 0322021. [1] K. C. Hall, W. H. Lau, K. Gundogdu, M. E. Flatte, and T. F. Boggess, Appl. Phys. Lett. 83, 2937 (2003).

  13. Comparison of NBG-18, NBG-17, IG-110 and IG-11 oxidation kinetics in air

    Science.gov (United States)

    Lee, Jo Jo; Ghosh, Tushar K.; Loyalka, Sudarshan K.

    2018-03-01

    The oxidation rates of several nuclear-grade graphites, NBG-18, NBG-17, IG-110 and IG-11, were measured in air using thermogravimetry. Kinetic parameters and oxidation behavior for each grade were compared by coke type, filler grain size and microstructure. The thickness of the oxidized layer for each grade was determined by layer peeling and direct density measurements. The results for NBG-17 and IG-11 were compared with those available in the literature and our recently reported results for NBG-18 and IG-110 oxidation in air. The finer-grained graphites IG-110 and IG-11 were more oxidized than medium-grained NBG-18 and NBG-17 because of deeper oxidant penetration, higher porosity and higher probability of available active sites. Variation in experimental conditions also had a marked effect on the reported kinetic parameters by several studies. Kinetic parameters such as activation energy and transition temperature were sensitive to air flow rates as well as sample size and geometry.

  14. Optical properties of new 5-(4-phenylethynyl)-substituted-1,10-phenanthroline derivatives

    International Nuclear Information System (INIS)

    Guerin, Juliette; Aronica, Christophe; Boeuf, Gaelle; Chauvin, Jerome; Moreau, Juliette; Lemercier, Gilles

    2011-01-01

    The synthesis and optical properties of a novel family of 5-substituted-1,10-phenanthroline derivatives are reported herein. One carbon-carbon triple-bond function was introduced using a Sonogashira cross-coupling reaction. The effects on optical properties, of the substitution with electro-withdrawing or -donating substituents in the 5th position of the 1,10-phenanthroline are investigated. Experimental chemical structure-polarisability relationship is analyzed according to the Lippert-Mataga correlation and compared to a theoretical study carried out with DFT calculations. These compounds are promising candidates for a fine-tuning of the internal charge-transfers but also as potential nonlinear chromophores and ligands within multifunctional coordination complexes. - Highlights: → Synthesis and optical properties of new 5-substituted-1,10-phenanthroline derivatives. → Sonogashira reaction was used for the substitution. → Structure-polarisability relationship analyzed according to Lippert-Mataga correlation. → Theoretical study was carried out with DFT calculations. → Fine-tuning of the internal charge-transfers within nonlinear compounds.

  15. Spin dynamics in GaAs and (110)-GaAs heterostructures; Spindynamik in GaAs und (110)-GaAs-Heterostrukturen

    Energy Technology Data Exchange (ETDEWEB)

    Oertel, Stefan

    2012-07-01

    This thesis investigates the spin dynamics in both bulk GaAs and (llO)GaAs heterostructures using time- and polarization-resolved photoluminescence spectroscopy. In bulk GaAs the spin relaxation t ime is measured for the first time in the high temperature regime from 280 K to 400 K and is compared to numerical calculations. The numerical calculations are based on the spin relaxation theory of the Dyakonov-Perel mechanism effected by momentum scattering with polar optical phonons and electron-electron scattering and are in good agreement with the experimental results. Measurements of the dependence on the electron density serve to determine the energy dependent proportional factor between the electron density and the effective electron-electron scattering time. Also in bulk GaAs the interaction between the electron spin system and the nuclear spin system is investigated. The measured electron Lande g-factor under the influence of the nuclear magnetic field is used as an indicator to monitor the temporal evolution of the nuclear magnetic field under sustained dynamic nuclear polarization. Measurements with polarization modulated excitation enable the determination of the relevant time scale at which dynamic nuclear polarization takes place. Furthermore, the temporal evolution of the measured electron Lande g-factor shows the complex interplay of the dynamic nuclear polarization, the nuclear spin diffusion and the nuclear spin relaxation. In symmetric (110)-GaAs quantum wells the dependence of the inplane anisotropy of the electron Lande g-factor on the quantum well thickness is determined experimentally. The measurements are in very good agreement with calculations based upon k . p-theory and reveal a maximum of the anisotropy at maximum carrier localization in the quantum well. The origin of the anisotropy that is not present in symmetric (001) quantum wells is qualitatively described by means of a simplified model based on fourth-order perturbation theory. A

  16. Perioperative glycemic control in diabetic patients undergoing coronary artery bypass graft surgery

    Directory of Open Access Journals (Sweden)

    Ehab A. Wahby

    2016-08-01

    Conclusion: Tight glycemic control improved perioperative outcome in diabetic CABG patients. Maintaining perioperative blood glucose level between 110 and 149 mg/dl is safe and should be recommended as a routine practice in diabetic patients undergoing CABG surgery.

  17. Additional androgen deprivation makes the difference. Biochemical recurrence-free survival in prostate cancer patients after HDR brachytherapy and external beam radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Schiffmann, Jonas; Tennstedt, Pierre; Beyer, Burkhard; Boehm, Katharina; Tilki, Derya; Salomon, Georg; Graefen, Markus [University Medical Center Hamburg-Eppendorf, Martini-Clinic Prostate Cancer Center, Hamburg (Germany); Lesmana, Hans; Platz, Volker; Petersen, Cordula; Kruell, Andreas; Schwarz, Rudolf [University Medical Center Hamburg-Eppendorf, Department of Radiation oncology, Hamburg (Germany)

    2015-04-01

    The role of additional androgen deprivation therapy (ADT) in prostate cancer (PCa) patients treated with combined HDR brachytherapy (HDR-BT) and external beam radiotherapy (EBRT) is still unknown. Consecutive PCa patients classified as D'Amico intermediate and high-risk who underwent HDR-BT and EBRT treatment ± ADT at our institution between January 1999 and February 2009 were assessed. Multivariable Cox regression models predicting biochemical recurrence (BCR) were performed. BCR-free survival was assessed with Kaplan-Meier analyses. Overall, 392 patients were assessable. Of these, 221 (56.4 %) underwent trimodality (HDR-BT and EBRT and ADT) and 171 (43.6 %) bimodality (HDR-BT and EBRT) treatment. Additional ADT administration reduced the risk of BCR (HR: 0.4, 95 % CI: 0.3-0.7, p < 0.001). D'Amico high-risk patients had superior BCR-free survival when additional ADT was administered (log-rank p < 0.001). No significant difference for BCR-free survival was recorded when additional ADT was administered to D'Amico intermediate-risk patients (log-rank p = 0.2). Additional ADT administration improves biochemical control in D'Amico high-risk patients when HDR-BT and EBRT are combined. Physicians should consider the oncological benefit of ADT administration for these patients during the decision-making process. (orig.) [German] Der Nutzen einer zusaetzlichen Hormonentzugstherapie (ADT, ''androgen deprivation therapy'') fuer Patienten mit Prostatakarzinom (PCa), welche mit einer Kombination aus HDR-Brachytherapie (HDR-BT) und perkutaner Bestrahlung (EBRT) behandelt werden, ist weiterhin ungeklaert. Fuer diese Studie wurden konsekutive, nach der D'Amico-Risikoklassifizierung in ''intermediate'' und ''high-risk'' eingeteilte Patienten ausgewaehlt, die zwischen Januar 1999 und Februar 2009 in unserem Institut eine kombinierte Therapie aus HDR-BT, EBRT ± ADT erhalten haben. Eine

  18. The Effect of Phase-to-earth Faults on the Operating Conditions of a Separated 110 kV Grid Normally Operated with Effectively Earthed Neutral, and Temporarily Supplied from a Compensated 110 kV Grid

    Directory of Open Access Journals (Sweden)

    Wilhelm Rojewski

    2015-06-01

    Full Text Available The paper discusses the interoperability of the German compensated 110 kV grid and the Polish effectively earthed 110 kV grid. It is assumed that an area of one grid, separated from its power system, will be temporarily supplied from the other grid in its normal regime. Reference is made to the risks associated with phase-to-earth faults in grids so interconnected. Particular attention is paid to the working conditions of surge arresters and voltage transformers in the Polish 110 kV grid deprived of its neutral earthing when supplied from the German grid.

  19. The effect of feeding Bt MON810 maize to pigs for 110 days on intestinal microbiota.

    Directory of Open Access Journals (Sweden)

    Stefan G Buzoianu

    Full Text Available OBJECTIVE: To assess the effects of feeding Bt MON810 maize to pigs for 110 days on the intestinal microbiota. METHODOLOGY/PRINCIPAL FINDINGS: Forty male pigs (∼40 days old were blocked by weight and litter ancestry and assigned to one of four treatments; 1 Isogenic maize-based diet for 110 days (Isogenic; 2 Bt maize-based diet (MON810 for 110 days (Bt; 3 Isogenic maize-based diet for 30 days followed by a Bt maize-based diet for 80 days (Isogenic/Bt; 4 Bt maize-based diet for 30 days followed by an isogenic maize-based diet for 80 days (Bt/Isogenic. Enterobacteriaceae, Lactobacillus and total anaerobes were enumerated in the feces using culture-based methods on days 0, 30, 60 and 100 of the study and in ileal and cecal digesta on day 110. No differences were found between treatments for any of these counts at any time point. The relative abundance of cecal bacteria was also determined using high-throughput 16 S rRNA gene sequencing. No differences were observed in any bacterial taxa between treatments, with the exception of the genus Holdemania which was more abundant in the cecum of pigs fed the isogenic/Bt treatment compared to pigs fed the Bt treatment (0.012 vs 0.003%; P≤0.05. CONCLUSIONS/SIGNIFICANCE: Feeding pigs a Bt maize-based diet for 110 days did not affect counts of any of the culturable bacteria enumerated in the feces, ileum or cecum. Neither did it influence the composition of the cecal microbiota, with the exception of a minor increase in the genus Holdemania. As the role of Holdemania in the intestine is still under investigation and no health abnormalities were observed, this change is not likely to be of clinical significance. These results indicate that feeding Bt maize to pigs in the context of its influence on the porcine intestinal microbiota is safe.

  20. Organic adsorbates on metal surfaces. PTCDA and NTCDA on AG(110)

    Energy Technology Data Exchange (ETDEWEB)

    Abbasi, Afshin

    2010-02-22

    Polyaromatic molecules functionalized with carboxylic groups have served as model systems for the growth of organic semiconducting films on a large variety of substrates. Most non-reactive substrates allow for a growth mode compatible with the bulk phase of the molecular crystal with two molecules in the unit cell, but some more reactive substrates including Ag(111) and Ag(110) can induce substantial changes in the first monolayer (ML). In the specific case of Ag(110), the adsorbate unit cell of both NTCDA and PTCDA resembles a brickwall structure, with a single molecule in the unit cell. From this finding, it can be concluded that the adsorbate-substrate interaction is stronger than typical inter-molecular binding energies in the respective bulk phases. In the present work, the interactions between small Ag(110) clusters and a single NTCDA or PTCDA molecule are investigated with different ab initio techniques. Four major ingredients contribute to the binding between adsorbate and substrate: Directional bonds between Ag atoms in the topmost layer and the oxygen atoms of the molecule, Pauli repulsion between filled orbitals of molecule and substrate, an attractive van-der-Waals interaction, and a negative net charge on the molecule inducing positive image charges in the substrate, resulting therefore in an attractive Coulomb interaction between these opposite charges. As both Hartree-Fock theory and density functional theory with typical gradient-corrected density functional do not contain any long range correlation energy required for dispersion interactions, we compare these approaches with the fastest numerical technique where the leading term of the van-der-Waals interaction is included, i.e. second order Moeller-Plesset theory (MP2). Both Hartree-Fock and density functional theory result in bended optimized geometries where the adsorbate is interacting mainly via the oxygen atoms, with the core of the molecule repelled from the substrate. Only at the MP2 level

  1. WR 110: A SINGLE WOLF-RAYET STAR WITH COROTATING INTERACTION REGIONS IN ITS WIND?

    International Nuclear Information System (INIS)

    Chene, A.-N.; Moffat, A. F. J.; Fahed, R.; St-louis, N.; Muntean, V.; Chevrotiere, A. De La; Cameron, C.; Matthews, J. M.; Gamen, R. C.; Lefevre, L.; Rowe, J. F.; Guenther, D. B.; Kuschnig, R.; Weiss, W. W.; Rucinski, S. M.; Sasselov, D.

    2011-01-01

    A 30 day contiguous photometric run with the Microvariability and Oscillations of STars (MOST) satellite on the WN5-6b star WR 110 (HD 165688) reveals a fundamental periodicity of P = 4.08 ± 0.55 days along with a number of harmonics at periods P/n, with n ∼ 2, 3, 4, 5, and 6, and a few other possible stray periodicities and/or stochastic variability on timescales longer than about a day. Spectroscopic radial velocity studies fail to reveal any plausible companion with a period in this range. Therefore, we conjecture that the observed light-curve cusps of amplitude ∼0.01 mag that recur at a 4.08 day timescale may arise in the inner parts, or at the base, of a corotating interaction region (CIR) seen in emission as it rotates around with the star at constant angular velocity. The hard X-ray component seen in WR 110 could then be a result of a high velocity component of the CIR shock interacting with the ambient wind at several stellar radii. Given that most hot, luminous stars showing CIRs have two CIR arms, it is possible that either the fundamental period is 8.2 days or, more likely in the case of WR 110, there is indeed a second weaker CIR arm for P = 4.08 days, that occurs ∼two-thirds of a rotation period after the main CIR. If this interpretation is correct, WR 110 therefore joins the ranks with three other single WR stars, all WN, with confirmed CIR rotation periods (WR 1, WR 6, and WR 134), albeit with WR 110 having by far the lowest amplitude photometric modulation. This illustrates the power of being able to secure intense, continuous high-precision photometry from space-based platforms such as MOST. It also opens the door to revealing low-amplitude photometric variations in other WN stars, where previous attempts have failed. If all WN stars have CIRs at some level, this could be important for revealing sources of magnetism or pulsation in addition to rotation periods.

  2. Regulation of PI-2b Pilus Expression in Hypervirulent Streptococcus agalactiae ST-17 BM110.

    Directory of Open Access Journals (Sweden)

    Bruno Périchon

    Full Text Available The widely spread Streptococcus agalactiae (also known as Group B Streptococcus, GBS "hypervirulent" ST17 clone is strongly associated with neonatal meningitis. The PI-2b locus is mainly found in ST17 strains but is also present in a few non ST17 human isolates such as the ST-7 prototype strain A909. Here, we analysed the expression of the PI-2b pilus in the ST17 strain BM110 as compared to the non ST17 A909. Comparative genome analyses revealed the presence of a 43-base pair (bp hairpin-like structure in the upstream region of PI-2b operon in all 26 ST17 genomes, which was absent in the 8 non-ST17 strains carrying the PI-2b locus. Deletion of this 43-bp sequence in strain BM110 resulted in a 3- to 5-fold increased transcription of PI-2b. Characterization of PI-2b promoter region in A909 and BM110 strains was carried out by RNAseq, primer extension, qRT-PCR and transcriptional fusions with gfp as reporter gene. Our results indicate the presence of a single promoter (Ppi2b with a transcriptional start site (TSS mapped 37 bases upstream of the start codon of the first PI-2b gene. The large operon of 16 genes located upstream of PI-2b codes for the group B carbohydrate (also known as antigen B, a major constituent of the bacterial cell wall. We showed that the hairpin sequence located between antigen B and PI-2b operons is a transcriptional terminator. In A909, increased expression of PI-2b probably results from read-through transcription from antigen B operon. In addition, we showed that an extended 5' promoter region is required for maximal transcription of gfp as a reporter gene in S. agalactiae from Ppi2b promoter. Gene reporter assays performed in Lactococcus lactis strain NZ9000, a related non-pathogenic Gram-positive species, revealed that GBS-specific regulatory factors are required to drive PI-2b transcription. PI-2b expression is up-regulated in the BM110ΔcovR mutant as compared to the parental BM110 strain, but this effect is probably

  3. THE EFFICACY OF THE CABLES OF 6–110 KW WITH XLPE INSULATION. Part 2

    Directory of Open Access Journals (Sweden)

    M. A. Korotkevich

    2017-01-01

    Full Text Available The assessment of the suitability of cables of 6–110 kW with XLPE insulation in comparison with cables of the same voltage but possessing paper-oil insulation has been fulfilled on the basis of the method of multi-objective optimization that makes it possible to account not only the quantitative characteristics (of reduced costs, but also qualitative ones. As an indicator of the reliability of the cable line the maximum mean time to failure (the value inversely proportional to the parameter of succession of failures, which is an order more for cable lines with XLPE insulation than for cable lines with paper insulation, is adopted. A comprehensive assessment of the convenience of installation of cable lines revealed that the installation of cable with XLPE insulation features a 1.2–1.6 times easier installation as compared to three-wire (voltage 10 kW and 1.4 times easier installation as compared to single-core oil-filled cables (voltage of 110 kW. The efficacy of the cables 6–110 kW with XLPE insulation is proved on the basis on the method of multi-objective optimization, that took into account as the costs for the construction and operation of cable lines and the reliability of its operation, ease of its installation and other quality indicators. If the goals taken into account are considered as equally important, the polyethylene-insulated cables for a voltage of 10–110 kW is more efficient as compared to three-wire (voltage 10 kW and solid (110 kW cables with paper insulation. Herewith, the cost of the cable with XLPE insulation may exceed the cost of cable with paper insulation up to two times. If the most important aim is to provide the minimum reduced costs for the construction and operation of the cable line, the use of cables with XLPE insulation for voltage of 10 kW is most advisable in individual cases.

  4. Catalytic hydrolysis of COS over CeO_2 (110) surface: A density functional theory study

    International Nuclear Information System (INIS)

    Song, Xin; Ning, Ping; Wang, Chi; Li, Kai; Tang, Lihong; Sun, Xin

    2017-01-01

    Graphical abstract: CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. H_2O plays a role as a bridge in the process of joint adsorption. Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Highlights: • H_2O is easier adsorbed on the CeO_2 (110) surface than COS. • When COS and H_2O jointly adsorb on the CeO_2 (110) surface, the H_2O molecule plays a role as a bridge. • Ce−O−H bond can enhance the adsorption effect. • Catalytic effect of CeO_2 in the hydrolysis of COS is mainly reflected on the C−O channel. - Abstract: Density functional theory (DFT) calculations were performed to investigate the reaction pathways for catalytic hydrolysis of COS over CeO_2 (110) surface using Dmol"3 model. The thermodynamic stability analysis for the suggested routes of COS hydrolysis to CO_2 and H_2S was evaluated. The absolute values of adsorption energy of H_2O-CeO_2 are higher than that of COS-CeO_2. Meanwhile, the adsorption energy and geometries show that H_2O is easier adsorbed on the surface of CeO_2 (110) than COS. H_2O plays a role as a bridge in the process of joint adsorption. H_2O forms more Ce−O−H groups on the CeO_2 (110) surface. CeO_2 decreases the maximum energy barrier by 76.15 kcal/mol. The migration of H from H_2O to COS is the key for the hydrolysis reaction. C−O channel is easier to occur than C−S channel. Experimental result shows that adding of CeO_2 can increase COS removal rate and prolong the 100% COS removal rate from 180 min to 210 min. The difference between Fe_2O_3 and CeO_2 for the hydrolysis of COS is characterized in the atomic charge transfer and the formation of H−O bond and H−S bond. The transfer effect of H in H_2O to S in COS over CeO_2 decreases the energy barriers of hydrolysis reaction, and enhances the reaction activity of COS hydrolysis.

  5. Scanning tunnel microscopic image of tungsten (100) and (110) real surfaces and nature of conduction electron reflection

    International Nuclear Information System (INIS)

    Pryadkin, S.L.; Tsoj, V.S.

    1988-01-01

    The electrically polished (100) and (110) surfaces of tungsten are studied with the aid of a scanning tunnel microscope at atmospheric pressure. The (110) surface consists of a large number of atomically plane terraces whereas the (100) surface is faceted. The scanning tunnel microscope data can explain such results of experiments on transverse electron focussing as the strong dependence of the probability for specular reflection of conduction electrons scattered by the (100) surface on the electron de Broglie wavelength and the absence of a dependence of the probability for specular reflection on the wavelength for the (110) surface

  6. ICP-MS measurement of silver diffusion coefficient in graphite IG-110 between 1048K and 1284K

    Science.gov (United States)

    Carter, L. M.; Seelig, J. D.; Brockman, J. D.; Robertson, J. D.; Loyalka, S. K.

    2018-01-01

    Silver-110m has been shown to permeate intact silicon carbide and pyrolytic carbon coating layers of the TRISO fuel particles during normal High Temperature Gas-Cooled Reactor (HTGR) operational conditions. The diffusion coefficients for silver in graphite IG-110 measured using a release method designed to simulate HTGR conditions of high temperature and flowing helium in the temperature range 1048-1253 K are reported. The measurements were made using spheres milled from IG-110 graphite that were infused with silver using a pressure vessel technique. The Ag diffusion was measured using a time release technique with an ICP-MS instrument for detection. The results of this work are:

  7. Up to 40 Gb/s wireless signal generation and demodulation in 75-110 GHz band using photonic techniques

    DEFF Research Database (Denmark)

    Sambaraju, R.; Zibar, Darko; Caballero Jambrina, Antonio

    2010-01-01

    Record wireless signal capacity of up to 40 Gb/s is demonstrated in the 75-110 GHz band. All-optical OFDM and photonic up-conversion are used for generation and digital coherent detection for demodulation....

  8. Acoustically induced spin transport in (110)GaAs quantum wells

    Energy Technology Data Exchange (ETDEWEB)

    Couto, Odilon D.D. Jr.

    2008-09-29

    In this work, we employ surface acoustic waves (SAWs) to transport and manipulate optically generated spin ensembles in (110) GaAs quantum wells (QWs). The strong carrier confinement into the SAW piezoelectric potential allows for the transport of spin-polarized carrier packets along well-defined channels with the propagation velocity of the acoustic wave. In this way, spin transport over distances exceeding 60 m is achieved, corresponding to spin lifetimes longer than 20 ns. The demonstration of such extremely long spin lifetimes is enabled by three main factors: (i) Suppression of the D'yakonov-Perel' spin relaxation mechanism for z-oriented spins in (110) IIIV QWs; (ii) Suppression of the Bir-Aronov-Pikus spin relaxation mechanism caused by the type-II SAW piezoelectric potential; (iii) Suppression of spin relaxation induced by the mesoscopic carrier confinement into narrow stripes along the SAW wave front direction. A spin transport anisotropy under external magnetic fields (B{sub ext}) is demonstrated for the first time. Employing the well-defined average carrier momentum impinged by the SAW, we analyze the spin dephasing dynamics during transport along the [001] and [1 anti 10] in-plane directions. For transport along [001], fluctuations of the internal magnetic field (B{sub int}), which arises from the spin-orbit interaction associated with the bulk inversion asymmetry of the crystal, lead to decoherence within 2 ns as the spins precess around B{sub ext}. In contrast, for transport along the [1 anti 10] direction, the z-component of the spin polarization is maintained for times one order of magnitude longer due to the non-zero average value of B{sub int}. The dephasing anisotropy between the two directions is fully understood in terms of the dependence of the spin-orbit coupling on carrier momentum direction, as predicted by the D'yakonov-Perel' mechanism for the (110) system. (orig.)

  9. Structural and electronic properties of Pt induced nanowires on Ge(110)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, L.; Bampoulis, P.; Safaei, A.; Zandvliet, H.J.W.; Houselt, A. van, E-mail: A.vanHouselt@utwente.nl

    2016-11-30

    Highlights: • Deposition of Pt induces regularly spaced (1.13 nm, 1.97 nm and 3.38 nm) nanowires on Ge(110). • In the troughs between the wires spaced 6× the Ge lattice consant pentagons are observed. • Spatially resolved STS reveals a filled electronic state at −0.35 eV. • This state has its highest intensity above the pentagons. • For 2 ML Pt, nanowires coexist with PtGe clusters, which become liquid like above 1040 K. - Abstract: The structural and electronic properties of Pt induced nanowires on Ge(110) surfaces have been studied by scanning tunneling microscopy and low energy electron microscopy. The deposition of a sub-monolayer amount of Pt and subsequent annealing at 1100 (±30) K results into nanowires which are aligned along the densely packed [1–10] direction of the Ge(110) surface. With increasing Pt coverage the nanowires form densely packed arrays with separations of 1.1 ± 0.1 nm, 2.0 ± 0.1 nm and 3.4 ± 0.1 nm. Ge pentagons reside in the troughs for nanowire separations of 3.4 nm, however for smaller nanowire separations no pentagons are found. Spatially resolved scanning tunneling spectroscopy measurements reveal a filled electronic state at −0.35 eV. This electronic state is present in the troughs as well as on the nanowires. The −0.35 eV state has the strongest intensity on the pentagons. For Pt depositions exceeding two monolayers, pentagon free nanowire patches are found, that coexist with Pt/Ge clusters. Upon annealing at 1040 K these Pt/Ge clusters become liquid-like, indicating that we are dealing with eutectic Pt{sub 0.22}Ge{sub 0.78} clusters. Low energy electron microscopy videos reveal the formation and spinodal decomposition of these eutectic Pt/Ge clusters.

  10. Induced Rashba splitting of electronic states in monolayers of Au, Cu on a W(110) substrate

    International Nuclear Information System (INIS)

    Shikin, A M; Rybkina, A A; Rybkin, A G; Marchenko, D; Korshunov, A S; Kudasov, Yu B; Frolova, N V; Sánchez-Barriga, J; Varykhalov, A; Rader, O

    2013-01-01

    The paper sums up a theoretical and experimental investigation of the influence of the spin–orbit coupling in W(110) on the spin structure of electronic states in deposited Au and Cu monolayers. Angle-resolved photoemission spectroscopy reveals that in the case of monolayers of Au and Cu spin–orbit split bands are formed in a surface-projected gap of W(110). Spin resolution shows that these states are spin polarized and that, therefore, the spin–orbit splitting is of Rashba type. The states evolve from hybridization of W 5d, 6p-derived states with the s, p states of the deposited metal. Interaction with Au and Cu shifts the original W 5d-derived states from the edges toward the center of the surface-projected gap. The size of the spin–orbit splitting of the formed states does not correlate with the atomic number of the deposited metal and is even higher for Cu than for Au. These states can be described as W-derived surface resonances modified by hybridization with the p, d states of the adsorbed metal. Our electronic structure calculations performed in the framework of the density functional theory correlate well with the experiment and demonstrate the crucial role of the W top layer for the spin–orbit splitting. It is shown that the contributions of the spin–orbit interaction from W and Au act in opposite directions which leads to a decrease of the resulting spin–orbit splitting in the Au monolayer on W(110). For the Cu monolayer with lower spin–orbit interaction the resulting spin splitting is higher and mainly determined by the W. (paper)

  11. Identification of an isomer in 110Ag at 1-keV excitation energy

    International Nuclear Information System (INIS)

    Clark, D.D.; Kostroun, V.O.; Siems, N.E.

    1975-01-01

    The existence of a new isomeric state in 110 Ag at approx. 1 keV excitation has been established in two experiments using a new instrument, the inner-shell-vacancy (ISV) detector. In the first experiment, a transition with a half-life of 660 plus-or-minus 40 ns was observed to follow the well-known 116-keV M4 transition that depopulates the 6 + 250-day isomeric level in 110 Ag; the energy of the new transition was deduced to be 109 Ag(n, γ) 110 Ag reaction to follow γ transitions previously assigned by others to populate a 1-keV excited state. The two results indicate the existence of a 2 - 660-ns isomer at 1.11 keV. Under the assumption that the newly observed transition is from a 2 - 1.11-keV state to the 1 + ground state, its hindrance factor with respect to the Moszkowski estimate is approx. 2.6 times 10 3 . Possible chemical-state perturbations of the measured half-life are estimated to be much smaller than the measurement error. In both experiments the approx. 1-keV transition was detected with the ISV detector, a new device based on the well-established atomic effect that within approx. 10 -14 s after the formation of an inner shell vacancy an atom will undergo a multiple loss of []lectrons ranging from several to 20 or more, the number being a function of Z and subshell. The emitted electrons, which are very soft, are collected with an accelerating and focusing electrostatic lens and detected with a plastic scintillator and a photomultiplier tube. Nuclear transitions that cause ISVs can thus be sensed. Experiments are described that show the detector is fast, sensitive, selective, and efficient in responding to ISVs.

  12. Growth and electronic properties of two-dimensional systems on (110) oriented GaAs

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, F.

    2005-07-01

    As the only non-polar plane the (110) surface has a unique role in GaAs. Together with Silicon as a dopant it is an important substrate orientation for the growth of n-type or p-type heterostructures. As a consequence, this thesis will concentrate on growth and research on that surface. In the course of this work we were able to realize two-dimensional electron systems with the highest mobilities reported so far on this orientation. Therefore, we review the necessary growth conditions and the accompanying molecular process. The two-dimensional electron systems allowed the study of a new, intriguing transport anisotropy not explained by current theory. Moreover, we were the first growing a two-dimensional hole gas on (110) GaAs with Si as dopant. For this purpose we invented a new growth modulation technique necessary to retrieve high mobility systems. In addition, we discovered and studied the metal-insulator transition in thin bulk p-type layers on (110) GaAs. Besides we investigated the activation process related to the conduction in the valence band and a parallelly conducting hopping band. The new two-dimensional hole gases revealed interesting physics. We studied the zero B-field spin splitting in these systems and compared it with the known theory. Furthermore, we investigated the anisotropy of the mobility. As opposed to the expectations we observed a strong persistent photoconductivity in our samples. Landau levels for two dimensional hole systems are non-linear and can show anticrossings. For the first time we were able to resolve anticrossings in a transport experiment and study the corresponding activation process. Finally, we compared these striking results with theoretical calculations. (orig.)

  13. 46 CFR 52.01-110 - Water-level indicators, water columns, gauge-glass connections, gauge cocks, and pressure gauges...

    Science.gov (United States)

    2010-10-01

    ... § 52.01-110 Water-level indicators, water columns, gauge-glass connections, gauge cocks, and pressure... 46 Shipping 2 2010-10-01 2010-10-01 false Water-level indicators, water columns, gauge-glass connections, gauge cocks, and pressure gauges (modifies PG-60). 52.01-110 Section 52.01-110 Shipping COAST...

  14. Systemic Assessment of Patients Undergoing Dental Implant ...

    African Journals Online (AJOL)

    Background: Procedure‑related and patient‑related factors influence the prognosis of dental implants to a major extent. Hence, we aimed to evaluate and analyze various systemic factors in patients receiving dental implants. Materials and Methods: Fifty‑one patients were included in the study, in which a total of 110 dental ...

  15. 45-110 GHz Quad-Ridge Horn With Stable Gain and Symmetric Beam

    Science.gov (United States)

    Manafi, Sara; Al-Tarifi, Muhannad; Filipovic, Dejan S.

    2017-09-01

    A quad-ridge horn antenna with stabilized gain and minimum difference between Eand H-plane half-power beamwidths (HPBWs) is demonstrated for operation over 45-110 GHz bandwidth. Multistep flaring and corrugations on a finite ground plane are applied to obtain stable radiation patterns with 16-dBi minimum gain over the entire range. The computational studies are validated through measurements of a 3-D printed prototype using the direct metal laser sintering (DMLS) process. Accurate fabrication with achieved surface roughness of DMLS is a viable fabrication process for wideband horn antennas at millimeter-wave frequencies.

  16. 儿童抽动障碍110例临床分析

    Institute of Scientific and Technical Information of China (English)

    刘莹

    2005-01-01

    儿童抽动障碍(Tic disorder,TD)是指儿童时期一种不随意的突发、快速、重复、非节律性、刻板的单一或多部位肌肉运动和(或)发声为特点的复杂的慢性神经精神障碍。我院儿科于1999年至2004年9月门诊诊治TD 110例,现报告如下。

  17. High-Tg TOPAS mPOF strain sensing at 110 degrees

    DEFF Research Database (Denmark)

    Nielsen, Kristian; Markos, Christos; Stefani, Alessio

    2013-01-01

    We demonstrate a mPOF made of high-Tg TOPAS grade 5013 with Tg = 135°C. We inscribe FBGs into the fiber and demonstrate strain sensing of 2.5% strain at 98°C, further we also demonstrate strain sensing at a record high temperature of 110°C. The Bragg wavelengths of the FBGs are around 860 nm, whe...... the propagation loss is 5.1dB/m, close to the fiber loss minimum of 3.67dB/m at 787nm....

  18. Positron-annihilation-induced ion desorption from TiO2(110)

    Science.gov (United States)

    Tachibana, T.; Hirayama, T.; Nagashima, Y.

    2014-05-01

    We have investigated the positron-stimulated desorption of ions from a TiO2(110) surface. Desorbed O+ ions were detected in coincidence with the emission of annihilation γ rays. The energy dependence of the ion yields shows that the O+ ions were detected at energies much lower than the previously reported threshold for electron impact desorption corresponding to the excitation energy of Ti(3p) core electrons. These results provide evidence that core-hole creation by positron annihilation with electrons in the core levels leads to ion desorption.

  19. Photochemistry of 1,1,1-Trifluoroacetone on Rutile TiO2(110)

    International Nuclear Information System (INIS)

    Zehr, Robert T.; Deskins, N. Aaron; Henderson, Michael A.

    2010-01-01

    The ultraviolet (UV) photon-induced photodecomposition of 1,1,1-trifluoroacetone (TFA) adsorbed on the rutile TiO2(110) surface has been investigated with photon stimulated desorption (PSD), temperature programmed desorption (TPD) and density functional theory (DFT). TFA adsorbed molecularly on the reduced surface (8% oxygen vacancies) in states desorbing below 300 K with trace thermal decomposition observed in TPD. Adsorption of TFA on a preoxidized TiO2(110) surface (accomplished by pre-exposure with 20 L O2) led to formation of a new TFA desorption state at 350 K, assigned to decomposition of a TFA-diolate species ((CF3)(CH3)COO). No TFA photochemistry was detected on the reduced surface. UV irradiation of TFA on the oxidized surface depleted TFA in the 350 K state, with TFA molecules in other TPD states unaffected. PSD measurements reveal that both carbonyl substituents (CH3 and CF3), as well as CO, were liberated during UV exposure at 95 K. Post-irradiation TPD showed evidence for both acetate (evolving as ketene at 650 K) and trifluoroacetate (evolving as CO2 at 600 K) as surface-bound photodecomposition products. The CO PSD product was not due to adsorbed CO, to mass spectrometer cracking of a CO-containing PSD product, or from background effects, but originated from complete fragmentation of an unidentified adsorbed TFA species. Thermodynamic analysis using DFT indicated that the photodecomposition of the TFA-diolate was likely not driven by thermodynamics alone as both pathways (CH3+trifluoroacetate and CF3+acetate) were detected when thermodynamics shows a clear preference for only one (CF3+acetate). These observations are in contrast to the photochemical behavior of acetone, butanone and acetaldehyde on TiO2(110), where only one of the two carbonyl substituent groups was observed, with a stoichiometric amount of carboxylate containing the other substituent left on the surface. We conclude that fluorination significantly alters the electronic structure of

  20. Unoccupied Surface State on Ag(110) as Revealed by Inverse Photoemission

    Science.gov (United States)

    Reihl, B.; Schlittler, R. R.; Neff, H.

    1984-05-01

    By use of the new technique of k-resolved inverse photoemission spectroscopy, an unoccupied s-like surface state on Ag(110) has been detected, which lies within the projected L2'-->L1 gap of the bulk. At the X¯ point of the surface Brillouin zone, the energy of the surface state is 1.65 eV above the Fermi level EF, and exhibits a band dispersion E(k∥) towards higher energies. The surface-state emission is immediately quenched when the surface is exposed to very small amounts of oxygen or hydrogen.

  1. Spectral-luminescent investigation of polymers doped with europium trisphenoyltrifluoroacetonate compound with 1,10-phenanthroline

    International Nuclear Information System (INIS)

    Karasev, V.E.; Mirochnik, A.G.; Shchelokov, R.N.

    1983-01-01

    Spectral-luminescent characteristics of europium tristhenoyltrifluoroacetonate with 1.10-phenanthpoline in polystyrepe and polyvinyl chloride are investigated. E 4 (TTA) 3 phen during introduction into polymers preserves its composition and structure. Weak temperature dependence of half-Width of luminescent lines qualitatively different from the case of crystal chelate is characteristic for polymers doped with E 4 (TTA) 3 xphen. Investigation into temperature dependence of E 4 3+ luminescent intensity in chelate doped polymers proves the conclusion on weakening processes of excitation energy relaxation by vibration constituents of close and far environment during chelate introduction into polymers

  2. Tank characterization report for single-shell tank 241-C-110. Revision 1

    International Nuclear Information System (INIS)

    Benar, C.J.

    1997-01-01

    One of the major functions of the Tank Waste Remediation System (IWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendixes serve as the TCR for single-shell tank 241-C-110. The objectives of this report are to use characterization data in response to technical issues associated with 241-C-110 waste and to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Supporting data and information are contained in the appendixes. This report also supports the requirements of the Hanford Federal Facility Agreement and Consent Order milestone M-44-05. Characterization information presented in this report originated from sample analyses and known historical sources. While only the results from recent sample events will be used to fulfill the requirements of the data quality objectives (DQOs), other information can be used to support or question conclusions derived from these results. Historical information for tank 241-C-110 are provided included surveillance information, records pertaining to waste transfers and tank operations, and 1124 expected tank contents derived from a process knowledge model. The sampling events are listed, as well as sample data obtained before 1989. The results of the 1992 sampling events are also reported in the data package. The statistical analysis and numerical manipulation of data used in issue resolution are reported in Appendix C. Appendix D contains the evaluation to establish the best basis for the inventory estimate and the statistical analysis performed for this evaluation. A bibliography that resulted from an in-depth literature search of all known information sources applicable to tank 241-C-110 and its respective waste types is contained in Appendix E

  3. Triaqua(1,10-phenanthroline-2,9-dicarboxylatocobalt(II dihydrate

    Directory of Open Access Journals (Sweden)

    Zi-Fa Shi

    2010-04-01

    Full Text Available The title compound, [Co(C14H6N2O4(H2O3]·2H2O, has twofold crystallographic symmetry. The CoII atom is in a distorted pentagonal-bipyramidal coordination environment with two N atoms and two O atoms from a tetradentate 1,10-phenanthroline-2,9-dicarboxylate ligand and one O atom from a water molecule forming the pentagonal plane, and two O atoms from two water molecules occupying axial positions. In the crystal, adjacent molecules are linked by O—H...O hydrogen bonds, forming a three-dimensional network.

  4. Spin-resolved photoemission of surface states of W(110)-(1x1)H

    International Nuclear Information System (INIS)

    Hochstrasser, M.; Tobin, J.G.; Rotenberg, Eli; Kevan, S.D.

    2002-01-01

    The surface electronic states of W(110)-(1x1)H have been measured using spin- and angle-resolved photoemission. We directly demonstrate that the surface bands are both split and spin-polarized by the spin-orbit interaction in association with the loss of inversion symmetry near a surface. We observe 100 percent spin polarization of the surface states, with the spins aligned in the plane of the surface and oriented in a circular fashion relative to the S-bar symmetry point. In contrast, no measurable polarization of nearby bulk states is observed

  5. Substitutional Co dopant on the GaAs(110) surface: A first principles study

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Zhou; Yi, Zhijun, E-mail: zhijunyi@cumt.edu.cn

    2016-12-01

    Using the first principles ground state method, the electronic properties of single Co dopant replacing one Ga atom on the GaAs(110) surface are studied. Our calculated local density of states (LDOS) at Co site presents several distinct peaks above the valence band maximum (VBM), and this agrees with recent experiments. Moreover, the calculated STM images at bias voltages of 2 eV and −2 eV also agree with experiments. We discussed the origin of Co impurity induced distinct peaks, which can be characterized with the hybridization between Co d orbitals and p-like orbitals of surface As and Ga atoms.

  6. Internal stress distribution for generating closure domains in laser-irradiated Fe–3%Si(110) steels

    International Nuclear Information System (INIS)

    Iwata, Keiji; Imafuku, Muneyuki; Orihara, Hideto; Sakai, Yusuke; Ohya, Shin-Ichi; Suzuki, Tamaki; Shobu, Takahisa; Akita, Koichi; Ishiyama, Kazushi

    2015-01-01

    Internal stress distribution for generating closure domains occurring in laser-irradiated Fe–3%Si(110) steels was investigated using high-energy X-ray analysis and domain theory based on the variational principle. The measured triaxial stresses inside the specimen were compressive and the stress in the rolling direction became more dominant than stresses in the other directions. The calculations based on the variational principle of magnetic energy for closure domains showed that the measured triaxial stresses made the closure domains more stable than the basic domain without closure domains. The experimental and calculation results reveal that the laser-introduced internal stresses result in the occurrence of the closure domains

  7. High-spin states in odd-odd 106,108,110,112Rh

    International Nuclear Information System (INIS)

    Fotiades, N.; Cizewski, J.A.; Kruecken, R.; McNabb, D.P.; Becker, J.A.; Bernstein, L.A.; Younes, W.; Clark, R.M.; Fallon, P.; Lee, I.Y.; Macchiavelli, A.O.

    2003-01-01

    The level structures of 106,108,110,112 Rh have been studied in the fission of the compound system formed in three different heavy-ion induced reactions. Sequences of five transitions, together with weak crossover transitions, have been assigned to each isotope based on coincidences with known transitions in the complementary fragments. Comparison with the lighter odd-odd Rh isotopes supports assignment of these sequences as the yrast bands built on the πg 9/2 xνh 11/2 configuration

  8. Influence of uranium dioxide nonstoichiometric oxygen on the work function of Mo(110) single crystal

    International Nuclear Information System (INIS)

    Bekmukhabetov, E.S.; Dzhajmurzin, A.A.; Imanbekov, Zh.Zh.

    1985-01-01

    The influence of the uranium dioxide nonstoichiometric oxygen on the work function of a Mo(110) single crystal has been studied. When the surface diffusion of oxygen on the tested surface takes place, the work function is shown to decrease and, subsequently, to increase until it becomes stable. The dependence of the work function on the temperature of the specimen in the range of 1600-1900 K with a minimum at 1730 K has been found. The minimum is attributed to the dipole layer formation

  9. Photoemission and STM, STS study of Cs/p-GaAs(110)

    International Nuclear Information System (INIS)

    Yamada, T.; Fujii, J.; Mizoguchi, T.

    2001-01-01

    Various stage of adsorbed Cs, i.e., one-dimensional (1D) lines, polygons and coherently c(4x4)-ordered polygons, on cleaved p-GaAs(110) are studied by scanning tunneling microscopy (STM) and scanning tunneling spectroscopies (STS) with an interest in relation to the photo-electron emission. It is understood that only the coherently c(4x4)-ordered Cs polygon surface (Cs coverage of 0.6 ML and 0.7 ML) can emit photo-electrons due to a sufficient reduction of the local work function down to 1.3 eV to get a negative electron affinity state

  10. STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.

  11. STS-110 M.S. Ross in M-113 personnel carrier during TCDT

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.

  12. Measurement of velocity deficit at the downstream of a 1:10 axial hydrokinetic turbine model

    Energy Technology Data Exchange (ETDEWEB)

    Gunawan, Budi [ORNL; Neary, Vincent S [ORNL; Hill, Craig [St. Anthony Falls Laboratory, 2 Third Avenue SE, Minneapolis, MN 55414; Chamorro, Leonardo [St. Anthony Falls Laboratory, 2 Third Avenue SE, Minneapolis, MN 55414

    2012-01-01

    Wake recovery constrains the downstream spacing and density of turbines that can be deployed in turbine farms and limits the amount of energy that can be produced at a hydrokinetic energy site. This study investigates the wake recovery at the downstream of a 1:10 axial flow turbine model using a pulse-to-pulse coherent Acoustic Doppler Profiler (ADP). In addition, turbine inflow and outflow velocities were measured for calculating the thrust on the turbine. The result shows that the depth-averaged longitudinal velocity recovers to 97% of the inflow velocity at 35 turbine diameter (D) downstream of the turbine.

  13. The preparation of radioactive sources with radioactivities of less than 110 kilobecquerels

    International Nuclear Information System (INIS)

    Wyllie, H.A.

    1989-03-01

    A description is given of the various radioactive sources prepared in the ANSTO Radioisotope Standards Laboratory and the procedures associated with their preparation. ANSTO is authorised by CSIRO to maintain the Commonwealth standard of activity of radionuclides. Counting sources are required for the standardisation of solutions of radionuclides. Calibration sources are required for equipment used to detect radioactivity, such as gamma-ray spectrometers, and can be supplied to clients in other organisations. The maximum radioactivity supplied is 110 kBq. 7 refs., 65 figs

  14. Growth kinetics of metastable (331) nanofacet on Au and Pt(110) surfaces

    International Nuclear Information System (INIS)

    Ndongmouo, U.T.; Houngninou, E.; Hontinfinde, F.

    2006-12-01

    A theoretical epitaxial growth model with realistic barriers for surface diffusion is investigated by means of kinetic Monte Carlo simulations to study the growth modes of metastable (331) nanofacets on Au and Pt(110) surfaces. The results show that under experimental atomic fluxes, the (331) nanofacets grow by 2D nucleation at low temperature in the submonolayer regime. A metastable growth phase diagram that can be useful to experimentalists is presented and looks similar to the one found for the stationary growth of the bcc(001) surface in the kinetic 6-vertex model. (author)

  15. Luminescent properties of Europium(III) nitrate with 1,10-phenantroline and cinnamic acid in light - Transforming polymer materials

    Science.gov (United States)

    Kalinovskaya, I. V.; Zadorozhnaya, A. N.

    2018-04-01

    Influence of cinnamic acid on the luminescent properties of the europium(III) nitrate with 1,10-phenantroline in a polymer materials was studied. It was shown that combined use of these rare earth complexes leads to intense luminescence in the 400-700 nm region. Samples containing polymer europium nitrate with 1,10-phenantroline and cinnamic acid at a molar ratio of 1:2,0 had the maximum luminescence intensity and photostability.

  16. Vapor and gas sampling of single-shell tank 241-BX-110 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    Lockrem, L.L.

    1997-01-01

    The Vapor Issue Resolution Program tasked the Vapor Team (the team) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-BX-110. This document presents sampling data resulting from the April 30, 1996 sampling of SST 241-BX-110. Analytical results will be presented in a separate report issued by Pacific Northwest National Laboratory (PNNL), which supplied and analyzed the sampling media

  17. A survey of 110 cases of primary hyperparathyroidism in Dr.Shariati Hospital and the results of localizing the adenoma via MIBI scanning

    Directory of Open Access Journals (Sweden)

    Hedayat A

    1998-07-01

    Full Text Available Primary Hyperparathyroidism is a fairly common disease that is much more predominant in females. Treatment is surgery and includes removing the parathyroid adenoma or the hyperplastic parathyroid glands. Considering the difficulty of this operation procedure, localization test are utilized including ultrasound, MRI, CT scan, Thallium-Technesium subtraction scan, MIBI scan and a series of other tests. According to the studies regarding these tests, MIBI scan is superior to all the others. In this survery we have studied 110 primary hyperparathyroidism patients that were operated on in Dr.Shariati Hospital between 1356 and 1376. In order to localize the adenoma ultrasound was used in ten patients, thallium-technesium subtraction scan in 38 patients. MIBI scan in 30 patients and CT scan in 3 patients. The sensitivity of MIBI scan was 86% and its specificity was 100%. In comparison, the sensitivity of thallium-technesium scan was found to be about 65%. Our results show that MIBI scan has had a high degree of sensitivity and specificity in our patients and has shown to be the best localization test. Therefore we suggest this test for the localization of all parathyroid adenomas.

  18. Combined blockade of ADP receptors and PI3-kinase p110β fully prevents platelet and leukocyte activation during hypothermic extracorporeal circulation.

    Directory of Open Access Journals (Sweden)

    Stefanie Krajewski

    Full Text Available Extracorporeal circulation (ECC and hypothermia are used to maintain stable circulatory parameters and improve the ischemia tolerance of patients in cardiac surgery. However, ECC and hypothermia induce activation mechanisms in platelets and leukocytes, which are mediated by the platelet agonist ADP and the phosphoinositide-3-kinase (PI3K p110β. Under clinical conditions these processes are associated with life-threatening complications including thromboembolism and inflammation. This study analyzes effects of ADP receptor P(2Y(12 and P(2Y(1 blockade and PI3K p110β inhibition on platelets and granulocytes during hypothermic ECC. Human blood was treated with the P(2Y(12 antagonist 2-MeSAMP, the P(2Y(1 antagonist MRS2179, the PI3K p110β inhibitor TGX-221, combinations thereof, or PBS and propylene glycol (controls. Under static in vitro conditions a concentration-dependent effect regarding the inhibition of ADP-induced platelet activation was found using 2-MeSAMP or TGX-221. Further inhibition of ADP-mediated effects was achieved with MRS2179. Next, blood was circulated in an ex vivo ECC model at 28°C for 30 minutes and various platelet and granulocyte markers were investigated using flow cytometry, ELISA and platelet count analysis. GPIIb/IIIa activation induced by hypothermic ECC was inhibited using TGX-221 alone or in combination with P(2Y blockers (p<0.05, while no effect of hypothermic ECC or antiplatelet agents on GPIIb/IIIa and GPIbα expression and von Willebrand factor binding was observed. Sole P(2Y and PI3K blockade or a combination thereof inhibited P-selectin expression on platelets and platelet-derived microparticles during hypothermic ECC (p<0.05. P(2Y blockade alone or combined with TGX-221 prevented ECC-induced platelet-granulocyte aggregate formation (p<0.05. Platelet adhesion to the ECC surface, platelet loss and Mac-1 expression on granulocytes were inhibited by combined P(2Y and PI3K blockade (p<0.05. Combined blockade of P

  19. Detailed spectroscopy of 110Cd: Evidence for weak mixing and the emergence of γ-soft behavior

    Science.gov (United States)

    Garrett, P. E.; Bangay, J.; Diaz Varela, A.; Ball, G. C.; Cross, D. S.; Demand, G. A.; Finlay, P.; Garnsworthy, A. B.; Green, K. L.; Hackman, G.; Hannant, C. D.; Jigmeddorj, B.; Jolie, J.; Kulp, W. D.; Leach, K. G.; Orce, J. N.; Phillips, A. A.; Radich, A. J.; Rand, E. T.; Schumaker, M. A.; Svensson, C. E.; Sumithrarachchi, C.; Triambak, S.; Warr, N.; Wong, J.; Wood, J. L.; Yates, S. W.

    2012-10-01

    A study of the β+-electron capture decay of 110In into levels of 110Cd is combined with a reanalysis of data from a previous study of 110Cd with the (n,n'γ) reaction with monoenergetic neutrons. The γγ coincidences from the 110In decay leads to many new assignments of γ rays observed in the (n,n'γ) reaction, permitting the observation of weak low-energy transitions, and setting stringent upper limits on unobserved decay branches. The uncertainties on many of the lifetimes from the (n,n'γ) reaction are significantly reduced, and limits are established for the lifetimes of levels too long for a direct measurement. The absence of enhanced transitions between the previously assigned phonon states and the deformed intruder states strongly suggests that mixing between the configurations is generally weak, refuting the strong-mixing scenario as an explanation of the decay pattern of the excited 0+ states in 110Cd. The decay pattern of the nonintruder states is suggestive of a γ-soft rotor, or O(6) nucleus, rather than a vibrational, or U(5), pattern. The existence of a four-particle-six-hole proton excitation in 110Cd is also suggested.

  20. Influence of chemical composition of zirconium alloy E110 on embrittlement under LOCA conditions - Part 1: Oxidation kinetics and macrocharacteristics of structure and fracture

    Science.gov (United States)

    Nikulin, S. A.; Rozhnov, A. B.; Belov, V. A.; Li, E. V.; Glazkina, V. S.

    2011-11-01

    Exploratory investigations of the influence of alloying and impurity content in the E110 alloy cladding tubes on the behavior under conditions of Loss of Coolant Accidents (LOCA) has been performed. Three alloys of E110 type have been tested: E110 alloy of nominal composition Zr-1%Nb (E110), E110 alloy of modified composition Zr-1%Nb-0.12%Fe-0.13%O (E110M), E110 alloy of nominal composition Zr-1%Nb with reduced impurity content (E110G). Alloys E110 and E110M were manufactured on the electrolytic basis and alloy E110G was manufactured on the basis of zirconium sponge. The high temperature oxidation tests in steam ( T = 1100 °C, 18% of equivalent cladding reacted (ECR)) have been conducted, kinetics of oxidation was investigated. Quantitative research of structure and fracture macrocharacteristics was performed by means of optical and electron microscopy. The results received were compared with the residual ductility of specimens. The results of the investigation showed the existence of "breakaway oxidation" kinetics and white spalling oxide in E110 and E110M alloys while the specimen oxidation kinetics in E110G alloy was characterized by a parabolic law and specimens had a dense black oxide. Oxygen and iron alloying in the E110 alloy positively changed the macrocharacteristics of structure and fracture. However, in general, it did not improve the resistance to embrittlement in LOCA conditions apparently because of a strong impurity influence caused by electrolytic process of zirconium production.