WorldWideScience

Sample records for delta 17-tetranor-prostaglandin e1

  1. Infectivity and expression of the early adenovirus proteins are important regulators of wild-type and DeltaE1B adenovirus replication in human cells.

    Science.gov (United States)

    Steegenga, W T; Riteco, N; Bos, J L

    1999-09-09

    An adenovirus mutant lacking the expression of the large E1B protein (DeltaE1B) has been reported to replicate selectively in cells lacking the expression of functionally wild-type (wt) p53. Based on these results the DeltaE1B or ONYX-015 virus has been proposed to be an oncolytic virus which might be useful to treat p53-deficient tumors. Recently however, contradictory results have been published indicating that p53-dependent cell death is required for productive adenovirus infection. Since there is an urgent need for new methods to treat aggressive, mutant p53-expressing primary tumors and their metastases we carefully examined adenovirus replication in human cells to determine whether or not the DeltaE1B virus can be used for tumor therapy. The results we present here show that not all human tumor cell lines take up adenovirus efficiently. In addition, we observed inhibition of the expression of adenovirus early proteins in tumor cells. We present evidence that these two factors rather than the p53 status of the cell determine whether adenovirus infection results in lytic cell death. Furthermore, the results we obtained by infecting a panel of different tumor cell lines show that viral spread of the DeltaE1B is strongly inhibited in almost all p53-proficient and -deficient cell lines compared to the wt virus. We conclude that the efficiency of the DeltaE1B virus to replicate efficiently in tumor cells is determined by the ability to infect cells and to express the early adenovirus proteins rather than the status of p53.

  2. Observational $\\Delta\

    CERN Document Server

    Hernández, Antonio García; Monteiro, Mário J P F G; Suárez, Juan Carlos; Reese, Daniel R; Pascual-Granado, Javier; Garrido, Rafael

    2015-01-01

    Delta Scuti ($\\delta$ Sct) stars are intermediate-mass pulsators, whose intrinsic oscillations have been studied for decades. However, modelling their pulsations remains a real theoretical challenge, thereby even hampering the precise determination of global stellar parameters. In this work, we used space photometry observations of eclipsing binaries with a $\\delta$ Sct component to obtain reliable physical parameters and oscillation frequencies. Using that information, we derived an observational scaling relation between the stellar mean density and a frequency pattern in the oscillation spectrum. This pattern is analogous to the solar-like large separation but in the low order regime. We also show that this relation is independent of the rotation rate. These findings open the possibility of accurately characterizing this type of pulsator and validate the frequency pattern as a new observable for $\\delta$ Sct stars.

  3. Delta robot

    NARCIS (Netherlands)

    Herder, J.L.; Van der Wijk, V.

    2010-01-01

    The invention relates to a delta robot comprising a stationary base (2) and a movable platform (3) that is connected to the base with three chains of links (4,5,6), and comprising a balancing system incorporating at least one pantograph (7) for balancing the robot's center of mass, wherein the at le

  4. Delta robot

    NARCIS (Netherlands)

    Herder, J.L.; Van der Wijk, V.

    2010-01-01

    The invention relates to a delta robot comprising a stationary base (2) and a movable platform (3) that is connected to the base with three chains of links (4,5,6), and comprising a balancing system incorporating at least one pantograph (7) for balancing the robot's center of mass, wherein the at le

  5. The isolation of the ectodomain of the alphavirus E1 protein as a soluble hemagglutinin and its crystallization.

    Science.gov (United States)

    Wengler, G; Wengler, G; Rey, F A

    1999-05-10

    Alphaviruses are isometric enveloped viruses approximately 70 nm in diameter. The viral surface contains 80 glycoprotein spikes arranged in a T = 4 lattice. Each of these spikes consists of three heterodimers of the viral membrane proteins E1 (approximately 49 kDa) and E2 (approximately 51 kDa). Cryoelectron microscopic analyses have shown that the spikes form a protein shell on the viral surface. We have made an attempt to isolate biologically active protein fragments from this surface and to grow crystals from such fragments. To this end membrane proteins were extracted with Nonidet-P40 from the Semliki Forest alphavirus and the proteins were separated from detergent by centrifugation. A protein complex containing the E1 and E2 molecules in quantitative yield was obtained by this procedure. This complex has the following properties: It sediments at approximately 30S, it chromatographs with an apparent molecular mass of approximately 580,000 Da during gel filtration, it cannot be dissociated by either nonionic detergents or 6 M urea, and at acid pH it is a highly active hemagglutinin. The data indicate that this 30S hemagglutinin complex, which has not been hitherto described for alphaviruses, may represent a variant form of the protein lattice present on the alphavirus surface. Cleavage of this complex by subtilisin selectively removes carboxy-terminal sequences from the E1 and E2 proteins, which contain the cytoplasmic and transmembrane segments of the proteins and a small part of their ectodomain. The remaining ectodomains are called E1DeltaS and E2DeltaS. This proteolysis also leads to dissociation of the 30S complex. The cleavage products accumulate in the form of a heterodimer of the E1DeltaS and E2DeltaS proteins. Treatment of the heterodimer with PNGase F leads to rapid removal of carbohydrate from the E2DeltaS protein and a dissociation of the complex into the constituent molecules, which can be separated by chromatography. The finding that the

  6. Delta III—an evolutionary delta growth

    Science.gov (United States)

    Arvesen, R. J.; Simpson, J. S.

    1996-03-01

    In order to remain competitive in the future and expand the McDonnell Douglas Aerospace market share, MDA has developed an expendable launch system strategy that devices cost-effective launch systems from the Delta II with a growth vehicle configuration called Delta III. The Delta III evolves from the Delta II launch system through development of a larger payload fairing (4-meter diameter), new cryogenically propelled upper stage, new first stage fuel tank, and larger strap-on solid rocket motors. We are developing the Delta III using Integrated Product Development Teams that capitalize on the experience base that has led us to a world record breaking mission success of 49 consecutive Delta II missions. The Delta III first-launch capability is currently planned for the spring of 1998 in support of our first spacecraft customer, Hughes Space and Communications International.

  7. The Delta 2 launcher

    Science.gov (United States)

    Ousley, Gilbert W., Sr.

    1991-12-01

    The utilization of the Delta 2 as the vehicle for launching Aristoteles into its near Sun synchronous orbit is addressed. Delta is NASA's most reliable launch vehicle and is well suited for placing the present Aristoteles spacecraft into a 400 m circular orbit. A summary of some of the Delta 2 flight parameters is presented. Diagrams of a typical Delta 2 two stage separation are included along with statistics on delta reliability and launch plans.

  8. Delta Plaza kohvik = Delta Plaza cafe

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Pärnu mnt 141 asuva kohviku Delta Plaza sisekujundusest. Sisearhitektid Tiiu Truus ja Marja Viltrop (Stuudio Truus OÜ). Tiiu Truusi tähtsamate tööde loetelu. Büroohoone Delta Plaza arhitektid Marika Lõoke ja Jüri Okas (AB J. Okas & M. Lõoke)

  9. Delta Plaza kohvik = Delta Plaza cafe

    Index Scriptorium Estoniae

    2010-01-01

    Tallinnas Pärnu mnt 141 asuva kohviku Delta Plaza sisekujundusest. Sisearhitektid Tiiu Truus ja Marja Viltrop (Stuudio Truus OÜ). Tiiu Truusi tähtsamate tööde loetelu. Büroohoone Delta Plaza arhitektid Marika Lõoke ja Jüri Okas (AB J. Okas & M. Lõoke)

  10. The Implementation of E1 Clock Recovery

    Directory of Open Access Journals (Sweden)

    Wang Ziyu

    2016-01-01

    Full Text Available Clock transform and recovery is of significant importance in microwave TDM service, and it is always extracted from the E1 line data stream in most cases. However, intrinsically uncertain delay and jitter caused by packet transmission of E1 data information, may lead to the indexes of the data recovery clock exceed the clock performance template. Through analysis of the E1 clock indexes and measuring methods, this paper proposes a new clock recovery method. The method employs two buffers, the first RAM is used as a buffer to deduct excess information, and the second FIFO is used as a buffer to recovery the clock and data. The first buffer has a feedback from the second one, and is able to actively respond to changes in the data link and requests from the second one. The test results validate the effectiveness of the method, and the corresponding scheme is also valuable for the other communication systems.

  11. Melanoma cultures show different susceptibility towards E1A-, E1B-19 kDa- and fiber-modified replication-competent adenoviruses.

    Science.gov (United States)

    Schmitz, M; Graf, C; Gut, T; Sirena, D; Peter, I; Dummer, R; Greber, U F; Hemmi, S

    2006-06-01

    Replicating adenovirus (Ad) vectors with tumour tissue specificity hold great promise for treatment of cancer. We have recently constructed a conditionally replicating Ad5 AdDeltaEP-TETP inducing tumour regression in a xenograft mouse model. For further improvement of this vector, we introduced four genetic modifications and analysed the viral cytotoxicity in a large panel of melanoma cell lines and patient-derived melanoma cells. (1) The antiapoptotic gene E1B-19 kDa (Delta19 mutant) was deleted increasing the cytolytic activity in 18 of 21 melanoma cells. (2) Introduction of the E1A 122-129 deletion (Delta24 mutant), suggested to attenuate viral replication in cell cycle-arrested cells, did not abrogate this activity and increased the cytolytic activity in two of 21 melanoma cells. (3) We inserted an RGD sequence into the fiber to extend viral tropism to alphav integrin-expressing cells, and (4) swapped the fiber with the Ad35 fiber (F35) enhancing the tropism to malignant melanoma cells expressing CD46. The RGD-fiber modification strongly increased cytolysis in all of the 11 CAR-low melanoma cells. The F35 fiber-chimeric vector boosted the cytotoxicity in nine of 11 cells. Our results show that rational engineering additively enhances the cytolytic potential of Ad vectors, a prerequisite for the development of patient-customized viral therapies.

  12. E1 strength in N = 82 nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, T.; Volz, S.; Babilon, M.; Mohr, P.; Vogt, K.; Zilges, A

    2003-05-19

    Recently the importance of small contributions of electric dipole strength near the particle threshold to the production rates of atomic nuclei has become evident. Prior estimates concentrated on the Giant Dipole Resonance (GDR) which dominates photoabsorption in all nuclei. Extrapolations to smaller excitation energies were assumed to be sufficiently reliable. However, new measurements reveal that collective E1 strength can be found in the threshold region.

  13. Delta hedging strategies comparison

    DEFF Research Database (Denmark)

    De Giovanni, Domenico; Ortobelli, S.; Rachev, S.T.

    2008-01-01

    In this paper we implement dynamic delta hedging strategies based on several option pricing models. We analyze different subordinated option pricing models and we examine delta hedging costs using ex-post daily prices of S&P 500. Furthermore, we compare the performance of each subordinated model ...

  14. E1M1 and E1E2 transition probabilities in one-electron ions

    Science.gov (United States)

    Labzowsky, L. N.; Shonin, A. V.

    2004-12-01

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s→2γ(E1)+1s transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p→γ(E1)+γ(E2)+1s and 2p→γ(E1)+γ(M1)+1s are also calculated for the nuclear charge Z values 1⩽Z⩽100. This is the first calculation of the two latter probabilities. The results are given in two different gauges.

  15. Horizontal Symmetries $\\Delta(150)$ and $\\Delta(600)$

    CERN Document Server

    Lam, C S

    2013-01-01

    Using group theory of mixing to examine all finite subgroups of SU(3) with an order less than 512, we found recently that only the group $\\Delta(150)$ can give rise to a correct reactor angle $\\th_{13}$ of neutrino mixing without any free parameter. It predicts $\\sin^22\\th_{13}=0.11$ and a sub-maximal atmospheric angle with $\\sin^22\\th_{23}=0.94$, in good agreement with experiment. The solar angle $\\th_{12}$, the CP phase $\\d$, and the neutrino masses $m_i$ are left as free parameters. In this article we provide more details of this case, discuss possible gain and loss by introducing right-handed symmetries, and/or valons to construct dynamical models. A simple model is discussed where the solar angle agrees with experiment, and all its mixing parameters can be obtained from the group $\\Delta(600)$ by symmetry alone. The promotion of $\\Delta(150)$ to $\\Delta(600)$ is on the one hand analogous to the promotion of $S_3$ to $S_4$ in the presence of tribimaximal mixing, and on the other hand similar to the extens...

  16. On the width of N-Delta and Delta-Delta states

    CERN Document Server

    Niskanen, J A

    2016-01-01

    It is seen by a coupled-channel calculation that in the two-baryon N-Delta or Delta-Delta system the width of the state is greatly diminished due to the relative kinetic energy of the two baryons, since the internal energy of the particles, available for pionic decay, is smaller. A similar state dependent effect arises from the centrifugal barrier in N-Delta or Delta-Delta systems with non-zero orbital angular momentum. The double-Delta width can become even smaller than the free width of a single Delta. This has some bearing to the interpretation of the d'(2380) resonance recently discovered at COSY.

  17. geomorphology_delta

    Data.gov (United States)

    California Department of Resources — Surficial geology of the Delta area of California by Brian Atwater of the U.S. Geological Survey. Source maps are from the USGS publication MF-1401. This digital...

  18. Delta-Reliability

    OpenAIRE

    Eugster, P.; Guerraoui, R.; Kouznetsov, P.

    2001-01-01

    This paper presents a new, non-binary measure of the reliability of broadcast algorithms, called Delta-Reliability. This measure quantifies the reliability of practical broadcast algorithms that, on the one hand, were devised with some form of reliability in mind, but, on the other hand, are not considered reliable according to the ``traditional'' notion of broadcast reliability [HT94]. Our specification of Delta-Reliability suggests a further step towards bridging the gap between theory and...

  19. E1M1 and E1E2 transition probabilities in one-electron ions

    Energy Technology Data Exchange (ETDEWEB)

    Labzowsky, L.N. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation) and Petersburg Nuclear Physics Institute, Gatchina, 188350 St. Petersburg (Russian Federation)]. E-mail: leonti@landau.phys.spbu.ru; Shonin, A.V. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation)

    2004-12-06

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s1/2->2{gamma}(E1)+1s1/2 transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p1/2->{gamma}(E1)+{gamma}(E2)+1s1/2 and 2p1/2->{gamma}(E1)+{gamma}(M1)+1s1/2 are also calculated for the nuclear charge Z values 1=

  20. Adenovirus E1A/E1B Transformed Amniotic Fluid Cells Support Human Cytomegalovirus Replication

    Directory of Open Access Journals (Sweden)

    Natascha Krömmelbein

    2016-02-01

    Full Text Available The human cytomegalovirus (HCMV replicates to high titers in primary human fibroblast cell cultures. A variety of primary human cells and some tumor-derived cell lines do also support permissive HCMV replication, yet at low levels. Cell lines established by transfection of the transforming functions of adenoviruses have been notoriously resistant to HCMV replication and progeny production. Here, we provide first-time evidence that a permanent cell line immortalized by adenovirus type 5 E1A and E1B (CAP is supporting the full HCMV replication cycle and is releasing infectious progeny. The CAP cell line had previously been established from amniotic fluid cells which were likely derived from membranes of the developing fetus. These cells can be grown under serum-free conditions. HCMV efficiently penetrated CAP cells, expressed its immediate-early proteins and dispersed restrictive PML-bodies. Viral DNA replication was initiated and viral progeny became detectable by electron microscopy in CAP cells. Furthermore, infectious virus was released from CAP cells, yet to lower levels compared to fibroblasts. Subviral dense bodies were also secreted from CAP cells. The results show that E1A/E1B expression in transformed cells is not generally repressive to HCMV replication and that CAP cells may be a good substrate for dense body based vaccine production.

  1. {\\delta}M Formalism

    CERN Document Server

    Talebian-Ashkezari, Alireza; Abolhasani, Ali Akbar

    2016-01-01

    We study the evolution of the "non-perturbative" metric perturbations in a Bianchi background in the long-wavelength limit. By applying the gradient expansion to the equations of motion we exhibit a generalized "Separate Universe" approach to the cosmological perturbation theory. Having found this consistent separate universe picture, we introduce the "{\\delta}M formalism" for calculating the evolution of the tensor perturbations in anisotropic inflation models in almost similar way as the so-called {\\delta}N formula for the super-horizon dynamics of the curvature perturbations. Likewise its ancestor, {\\delta}N formalism, this new method can substantially reduce the amount of calculations related to the evolution of the tensor modes.

  2. The Niger Delta Crisis

    African Journals Online (AJOL)

    chifaou.amzat

    2013-09-28

    Sep 28, 2013 ... lions de barils par jour à environ 1 million au plus fort de la crise du Delta ... (JTF) between 13 May 2009 and 4 October 2009 (the deadline for embrac- ..... He had just ended his welcome address as the occasion's chairman.

  3. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  4. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  5. Probing Delta structure with pion electromagnetic production

    CERN Document Server

    Yang, S N; Yang, Shin Nan

    2003-01-01

    The Dubna-Mainz-Taipei dynamical model for pion electromagnetic production, which can describe well the existing data from threshold up to 1 GeV photon lab energy, is presented and used to analyze the recent precision data in the $\\Delta$ region. We find that, within our model, the bare Delta is almost spherical while the physical Delta is oblate. The deformation is almost saturated by the pion cloud effects. We further find that up to Q^2 = 4.0 (GeV/c)^2, the extracted helicity amplitude A_{3/2} and A_{1/2} remain comparable with each other, implying that hadronic helicity is not conserved at this range of Q^2. The ratio E_{1+}/M_{1+} obtained show, starting from a small and negative value at the real photon point, a clear tendency to cross zero, and to become positive with increasing Q^2. This is a possible indication of a very slow approach toward the pQCD region. Finally, we find that the bare helicity amplitude A_{1/2} and S_{1/2}, but not A_{3/2}, starts exhibiting the scaling behavior at about Q^2 \\ge ...

  6. DELTAS: A new Global Delta Sustainability Initiative (Invited)

    Science.gov (United States)

    Foufoula-Georgiou, E.

    2013-12-01

    Deltas are economic and environmental hotspots, food baskets for many nations, home to a large part of the world population, and hosts of exceptional biodiversity and rich ecosystems. Deltas, being at the land-water interface, are international, regional, and local transport hubs, thus providing the basis for intense economic activities. Yet, deltas are deteriorating at an alarming rate as 'victims' of human actions (e.g. water and sediment reduction due to upstream basin development), climatic impacts (e.g. sea level rise and flooding from rivers and intense tropical storms), and local exploration (e.g. sand or aggregates, groundwater and hydrocarbon extraction). Although many efforts exist on individual deltas around the world, a comprehensive global delta sustainability initiative that promotes awareness, science integration, data and knowledge sharing, and development of decision support tools for an effective dialogue between scientists, managers and policy makers is lacking. Recently, the international scientific community proposed to establish the International Year of Deltas (IYD) to serve as the beginning of such a Global Delta Sustainability Initiative. The IYD was proposed as a year to: (1) increase awareness and attention to the value and vulnerability of deltas worldwide; (2) promote and enhance international and regional cooperation at the scientific, policy, and stakeholder level; and (3) serve as a launching pad for a 10-year committed effort to understand deltas as complex socio-ecological systems and ensure preparedness in protecting and restoring them in a rapidly changing environment. In this talk, the vision for such an international coordinated effort on delta sustainability will be presented as developed by a large number of international experts and recently funded through the Belmont Forum International Opportunities Fund. Participating countries include: U.S., France, Germany, U.K., India, Japan, Netherlands, Norway, Brazil, Bangladesh

  7. Timelike gamma* N -> Delta form factors and Delta Dalitz decay

    CERN Document Server

    Ramalho, G

    2012-01-01

    We extend a covariant model, tested before in the spacelike region for the physical and lattice QCD regimes, to a calculation of the gamma* N -> Delta reaction in the timelike region, where the square of the transfered momentum, q^2, is positive (q^2>0). We estimate the Dalitz decay Delta -> Ne+e- and the Delta distribution mass distribution function. The results presented here can be used to simulate the NN -> NNe+e- reactions at moderate beam kinetic energies.

  8. Tamoxifen-regulated adenoviral E1A chimeras for the control of tumor selective oncolytic adenovirus replication in vitro and in vivo.

    Science.gov (United States)

    Sipo, I; Wang, X; Hurtado Picó, A; Suckau, L; Weger, S; Poller, W; Fechner, H

    2006-01-01

    Pharmacological control is a desirable safety feature of oncolytic adenoviruses (oAdV). It has recently been shown that oAdV replication may be controlled by drug-dependent transcriptional regulation of E1A expression. Here, we present a novel concept that relies on tamoxifen-dependent regulation of E1A activity through functional linkage to the mutated hormone-binding domain of the murine estrogen receptor (Mer). Four different E1A-Mer chimeras (ME, EM, E(DeltaNLS)M, MEM) were constructed and inserted into the adenoviral genome under control of a lung-specific surfactant protein B promoter. The highest degree of regulation in vitro was seen for the corresponding oAdVs Ad.E(DeltaNLS)M and Ad.MEM, which exhibited an up to 100-fold higher oAdV replication in the presence as compared with the absence of 4-OH-tamoxifen. Moreover, destruction of nontarget cells was six- and 13-fold reduced for Ad.E(DeltaNLS)M and Ad.MEM, respectively, as compared with Ad.E. Further investigations supported tamoxifen-dependent regulation of Ad.E(DeltaNLS)M and Ad.MEM in vivo. Induction of Ad.E(DeltaNLS)M inhibited growth of H441 lung tumors as efficient as a control oAdV expressing E1A. E(DeltaNLS)M and the MEM chimeras can be easily inserted into a single vector genome, which extends their application to existing oAdVs and strongly facilitates in vivo application.

  9. CYP2E1 Metabolism of Styrene Involves Allostery

    OpenAIRE

    2012-01-01

    We are the first to report allosterism during styrene oxidation by recombinant CYP2E1 and human liver microsomes. At low styrene concentrations, oxidation is inefficient because of weak binding to CYP2E1 (Ks = 830 μM). A second styrene molecule then binds CYP2E1 with higher affinity (Kss = 110 μM) and significantly improves oxidation to achieve a kcat of 6.3 nmol · min−1 · nmol CYP2E1−1. The transition between these metabolic cycles coincides with reported styrene concentrations in blood from...

  10. CYP2E1 autoantibodies in liver diseases

    Science.gov (United States)

    Sutti, Salvatore; Rigamonti, Cristina; Vidali, Matteo; Albano, Emanuele

    2014-01-01

    Autoimmune reactions involving cytochrome P4502E1 (CYP2E1) are a feature of idiosyncratic liver injury induced by halogenated hydrocarbons and isoniazid, but are also detectable in about one third of the patients with advanced alcoholic liver disease (ALD) and chronic hepatitis C (CHC). In these latter the presence of anti-CYP2E1 auto-antibodies is an independent predictor of extensive necro-inflammation and fibrosis and worsens the recurrence of hepatitis following liver transplantation, indicating that CYP2E1-directed autoimmunity can contribute to hepatic injury. The molecular characterization of the antigens recognized by anti-CYP2E1 auto-antibodies in ALD and CHC has shown that the targeted conformational epitopes are located in close proximity on the molecular surface. Furthermore, these epitopes can be recognized on CYP2E1 expressed on hepatocyte plasma membranes where they can trigger antibody-mediated cytotoxicity. This does not exclude that T cell-mediated responses against CYP2E1 might also be involved in causing hepatocyte damage. CYP2E1 structural modifications by reactive metabolites and molecular mimicry represent important factors in the breaking of self-tolerance against CYP2E1 in, respectively, ALD and CHC. However, genetic or acquired interferences with the mechanisms controlling the homeostasis of the immune system are also likely to contribute. More studies are needed to better characterize the impact of anti-CYP2E1 autoimmunity in liver diseases particularly in relation to the fact that common metabolic alterations such as obesity and diabetes stimulates hepatic CYP2E1 expression. PMID:25462068

  11. Delta II commercial space transportation

    Science.gov (United States)

    Meyers, J. F.

    1988-07-01

    Delta II is an upgraded variant of the Delta family of launch vehicles that has been in use by NASA since 1960. Among the design improvements incorporated by Delta II is a cryogenic-propellant second stage, a 2.89-m diameter satellite-protecting nose fairing, graphite/epoxy solid rocket motor cases, and 12:1 main engine expansion nozzle. The manufacturer/operator offers Delta II customers a dedicated, single satellite launch capability fully tailored to the given spacecraft's unique mission requirements.

  12. New insights into FoxE1 functions: identification of direct FoxE1 targets in thyroid cells.

    Directory of Open Access Journals (Sweden)

    Lara P Fernández

    Full Text Available BACKGROUND: FoxE1 is a thyroid-specific forkhead transcription factor essential for thyroid gland development, as well as for the maintenance of the thyroid differentiated state in adults. FoxE1 recognizes and binds to a short DNA sequence present in thyroglobulin (Tg and thyroperoxidase (Tpo promoters, but FoxE1 binding to regulatory regions other than Tg and Tpo promoters remains almost unexplored. Improving knowledge of the regulatory functions of FoxE1 is necessary to clarify its role in endocrine syndromes and cancer susceptibility. METHODOLOGY/PRINCIPAL FINDING: In order to further investigate downstream FoxE1 targets, we performed a genome-wide expression screening after knocking-down FoxE1 and obtained new insights into FoxE1 transcriptional networks in thyroid follicular cells. After validation, we confirmed Adamts9, Cdh1, Duox2 and S100a4 as upregulated genes and Casp4, Creld2, Dusp5, Etv5, Hsp5a, Nr4a2 and Tm4sf1 as downregulated genes when FoxE1 was silenced. In promoter regions of putative FoxE1-regulated genes and also in the promoters of the classical thyroid genes Nis, Pax8 and Titf1, we performed an in silico search of the FoxE1 binding motif that was in close proximity to the NF1/CTF binding sequence, as previously described for other forkhead factors. Using chromatin immunoprecipitation we detected specific in vivo FoxE1 binding to novel regulatory regions in two relevant thyroid genes, Nis and Duox2. Moreover, we demonstrated simultaneous binding of FoxE1 and NF1/CTF to the Nis upstream enhancer region, as well as a clear functional activation of the Nis promoter by both transcription factors. CONCLUSIONS/SIGNIFICANCE: In search for potential downstream mediators of FoxE1 function in thyroid cells, we identified two novel direct FoxE1 target genes. To our knowledge, this is the first evidence regarding the implication of Nis and Duox2 in executing the transcriptional program triggered by FoxE1. Furthermore, this study points

  13. 26 CFR 1.927(e)-1 - Special sourcing rule.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Special sourcing rule. 1.927(e)-1 Section 1.927... (CONTINUED) INCOME TAXES Earned Income of Citizens of United States § 1.927(e)-1 Special sourcing rule. (a... under section 925 with respect to such transaction applied to such transaction. This special sourcing...

  14. 26 CFR 1.514(e)-1 - Allocation rules.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Allocation rules. 1.514(e)-1 Section 1.514(e)-1... Allocation rules. Where only a portion of property is debt-financed property, proper allocation of the basis...)(iii) of § 1.514(b)-1 for illustrations of proper allocation....

  15. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent...

  16. Phenotypic expressions of CCR5-Delta 32/Delta 32 homozygosity

    NARCIS (Netherlands)

    Nguyen, GT; Carrington, M; Beeler, JA; Dean, M; Aledort, LM; Blatt, PM; Cohen, AR; DiMichele, D; Eyster, ME; Kessler, CM; Konkle, B; Leissinger, C; Luban, N; O'Brien, SJ; Goedert, JJ; O'Brien, TR

    1999-01-01

    Objective: As blockade of CC-chemokine receptor 5 (CCR5) has been proposed as therapy for HIV-1, we examined whether the CCR5-Delta 32/Delta 32 homozygous genotype has phenotypic expressions other than those related to HIV-1. Design: Study subjects were white homosexual men or men with hemophilia

  17. Phenotypic expressions of CCR5-Delta 32/Delta 32 homozygosity

    NARCIS (Netherlands)

    Nguyen, GT; Carrington, M; Beeler, JA; Dean, M; Aledort, LM; Blatt, PM; Cohen, AR; DiMichele, D; Eyster, ME; Kessler, CM; Konkle, B; Leissinger, C; Luban, N; O'Brien, SJ; Goedert, JJ; O'Brien, TR

    1999-01-01

    Objective: As blockade of CC-chemokine receptor 5 (CCR5) has been proposed as therapy for HIV-1, we examined whether the CCR5-Delta 32/Delta 32 homozygous genotype has phenotypic expressions other than those related to HIV-1. Design: Study subjects were white homosexual men or men with hemophilia wh

  18. Peat compaction in deltas : implications for Holocene delta evolution

    NARCIS (Netherlands)

    van Asselen, S.|info:eu-repo/dai/nl/304838101

    2010-01-01

    Many deltas contain substantial amounts of peat, which is the most compressible soil type. Therefore, peat compaction potentially leads to high amounts of subsidence in deltas. The main objective of this research was to quantify subsidence due to peat compaction in Holocene fluvial-deltaic settings

  19. Phenotypic expressions of CCR5-Delta 32/Delta 32 homozygosity

    NARCIS (Netherlands)

    Nguyen, GT; Carrington, M; Beeler, JA; Dean, M; Aledort, LM; Blatt, PM; Cohen, AR; DiMichele, D; Eyster, ME; Kessler, CM; Konkle, B; Leissinger, C; Luban, N; O'Brien, SJ; Goedert, JJ; O'Brien, TR

    1999-01-01

    Objective: As blockade of CC-chemokine receptor 5 (CCR5) has been proposed as therapy for HIV-1, we examined whether the CCR5-Delta 32/Delta 32 homozygous genotype has phenotypic expressions other than those related to HIV-1. Design: Study subjects were white homosexual men or men with hemophilia wh

  20. CYP2E1 Metabolism of Styrene Involves Allostery

    Science.gov (United States)

    Hartman, Jessica H.; Boysen, Gunnar

    2012-01-01

    We are the first to report allosterism during styrene oxidation by recombinant CYP2E1 and human liver microsomes. At low styrene concentrations, oxidation is inefficient because of weak binding to CYP2E1 (Ks = 830 μM). A second styrene molecule then binds CYP2E1 with higher affinity (Kss = 110 μM) and significantly improves oxidation to achieve a kcat of 6.3 nmol · min−1 · nmol CYP2E1−1. The transition between these metabolic cycles coincides with reported styrene concentrations in blood from exposed workers; thus, this CYP2E1 mechanism may be relevant in vivo. Scaled modeling of the in vitro-positive allosteric mechanism for styrene metabolism to its in vivo clearance led to significant deviations from the traditional model based on Michaelis-Menten kinetics. Low styrene levels were notably much less toxic than generally assumed. We interrogated the allosteric mechanism using the CYP2E1-specific inhibitor and drug 4-methylpyrazole, which we have shown binds two CYP2E1 sites. From the current studies, styrene was a positive allosteric effector on 4-methylpyrazole binding, based on a 10-fold increase in 4-methylpyrazole binding affinity from Ki 0.51 to Ksi 0.043 μM. The inhibitor was a negative allosteric effector on styrene oxidation, because kcat decreased 6-fold to 0.98 nmol · min−1 · nmol CYP2E1−1. Consequently, mixtures of styrene and other molecules can induce allosteric effects on binding and metabolism by CYP2E1 and thus mitigate the efficiency of their metabolism and corresponding effects on human health. Taken together, our elucidation of mechanisms for these allosteric reactions provides a powerful tool for further investigating the complexities of CYP2E1 metabolism of drugs and pollutants. PMID:22807108

  1. $\\Delta$-N Electromagnetic Transition

    CERN Document Server

    Loan, M

    1999-01-01

    The EM ratio for a free Delta electromagnetic transition is discussed within the frame work of nonrelativistic approach. Such an approach gives a good account of data for a free Delta but is less important for an intrinsically relativistic nuclear many body problem.

  2. Mida pakub Delta? / Teele Kurm

    Index Scriptorium Estoniae

    Kurm, Teele

    2011-01-01

    Politsei- ja Piirivalveamet võtab kasutusele ühise Siseministeeriumi infotehnoloogia- ja arenduskeskuse ning Webmedia AS koostööna loodud dokumendihaldussüsteemi Delta. Kust sai Delta oma nime? Projekti "Dokumendihaldussüsteemi juurutamine Siseministeeriumi haldusalas" eesmärgid

  3. Delta Electroproduction in 12-C

    Energy Technology Data Exchange (ETDEWEB)

    Steven McLauchlan

    2003-01-31

    The Delta-nucleus potential is a crucial element in the understanding of the nuclear system. Previous electroexcitation measurements in the delta region reported a Q2 dependence of the delta mass indicating that this potential is dependent on the momentum of the delta. Such a dependence is not observed for protons and neutrons in the nuclear medium. This thesis presents the experimental study of the electroexcitation of the delta resonance in 12C, performed using the high energy electron beam at the Thomas Jefferson National Accelerator Facility, and the near 4(pie) acceptance detector CLAS that enables the detection of the full reaction final state. Inclusive, semi inclusive, and exclusive cross sections were measured with an incident electron beam energy of 1.162GeV over the Q2 range 0.175-0.475 (GeV/c)2. A Q2 dependence of the delta mass was only observed in the exclusive measurements indicating that the delta-nucleus potential is affected by the momentum of the delta.

  4. Mida pakub Delta? / Teele Kurm

    Index Scriptorium Estoniae

    Kurm, Teele

    2011-01-01

    Politsei- ja Piirivalveamet võtab kasutusele ühise Siseministeeriumi infotehnoloogia- ja arenduskeskuse ning Webmedia AS koostööna loodud dokumendihaldussüsteemi Delta. Kust sai Delta oma nime? Projekti "Dokumendihaldussüsteemi juurutamine Siseministeeriumi haldusalas" eesmärgid

  5. Mackenzie River Delta, Canada

    Science.gov (United States)

    2007-01-01

    The Mackenzie River in the Northwest Territories, Canada, with its headstreams the Peace and Finley, is the longest river in North America at 4241 km, and drains an area of 1,805,000 square km. The large marshy delta provides habitat for migrating Snow Geese, Tundra Swans, Brant, and other waterfowl. The estuary is a calving area for Beluga whales. The Mackenzie (previously the Disappointment River) was named after Alexander Mackenzie who travelled the river while trying to reach the Pacific in 1789. The image was acquired on August 4, 2005, covers an area of 55.8 x 55.8 km, and is located at 68.6 degrees north latitude, 134.7 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.

  6. DELTA 3D PRINTER

    Directory of Open Access Journals (Sweden)

    ȘOVĂILĂ Florin

    2016-07-01

    Full Text Available 3D printing is a very used process in industry, the generic name being “rapid prototyping”. The essential advantage of a 3D printer is that it allows the designers to produce a prototype in a very short time, which is tested and quickly remodeled, considerably reducing the required time to get from the prototype phase to the final product. At the same time, through this technique we can achieve components with very precise forms, complex pieces that, through classical methods, could have been accomplished only in a large amount of time. In this paper, there are presented the stages of a 3D model execution, also the physical achievement after of a Delta 3D printer after the model.

  7. A distance regular graph of type E1 Ed

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In this note, the distance regular graph of type E1 Ed is considered and some characterization of the type graph is given. The results generalize the characterization of tight distance regular graphs.

  8. WORLD DELTAS AND THEIR EVOLUTION

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    In August 1998, an international symposium on the world deltas was held in New Orleans, Louisiana, USA. This symposium attracted discussion about more than 25 deltas from around the world with emphasis placed on those that are most densely populated and impacted by humans. Keynote papers printed details about the physical, biological, engineering and socioeconomic aspects of six deltas including the Mississippi, Nile, Ganges-Brahmaputra, Rhine-Meuse, Changjiang and Po. The main purpose of this symposium was to inform scientists, engineers and decision-makers about information that is currently available and to provide them a basis for working in such environments.

  9. Dynamical Casimir effect with $\\delta-\\delta^{\\prime}$ mirrors

    CERN Document Server

    Silva, Jeferson Danilo L; Alves, Danilo T

    2016-01-01

    We calculate the spectrum and the total rate of created particles for a real massless scalar field in $1+1$ dimensions, in the presence of a partially transparent moving mirror simulated by a Dirac $\\delta-\\delta^{\\prime}$ point interaction. We show that, strikingly, a partially reflecting mirror can produce a larger number of particles in comparison with a perfectly reflecting one. In the limit of a perfect mirror, our formulas recover those found in the literature for the Robin boundary condition.

  10. PARAMETRIC DESIGN OF DELTA ROBOT

    Directory of Open Access Journals (Sweden)

    Mert Gürgen

    2016-09-01

    Full Text Available This article describes a sophisticated determination and presentation of a workspace volume for a delta robot, with consideration of its kinematic behavior. With the help of theoretical equations, optimization is performed with the aid of the stiffness and dexterity analysis. Theoretical substructure is coded in Matlab and three-dimensional (3D data for delta robot are developed in computer-aided design (CAD environment. In later stages of the project, both 3D and theoretical data are linked together and thus, with the changing design parameter of the robot itself, the Solidworks CAD output adapts and regenerates output with a new set of parameters. To achieve an optimum workspace volume with predefined parameters, a different set of robot parameters are iterated through design optimization in Matlab, and the delta robot design is finalized and illustrated in the 3D CAD environment, Solidworks. This study provides a technical solution to accomplish a generic delta robot with optimized workspace volume.

  11. Oncolytic Replication of E1b-Deleted Adenoviruses

    Directory of Open Access Journals (Sweden)

    Pei-Hsin Cheng

    2015-11-01

    Full Text Available Various viruses have been studied and developed for oncolytic virotherapies. In virotherapy, a relatively small amount of viruses used in an intratumoral injection preferentially replicate in and lyse cancer cells, leading to the release of amplified viral particles that spread the infection to the surrounding tumor cells and reduce the tumor mass. Adenoviruses (Ads are most commonly used for oncolytic virotherapy due to their infection efficacy, high titer production, safety, easy genetic modification, and well-studied replication characteristics. Ads with deletion of E1b55K preferentially replicate in and destroy cancer cells and have been used in multiple clinical trials. H101, one of the E1b55K-deleted Ads, has been used for the treatment of late-stage cancers as the first approved virotherapy agent. However, the mechanism of selective replication of E1b-deleted Ads in cancer cells is still not well characterized. This review will focus on three potential molecular mechanisms of oncolytic replication of E1b55K-deleted Ads. These mechanisms are based upon the functions of the viral E1B55K protein that are associated with p53 inhibition, late viralmRNAexport, and cell cycle disruption.

  12. Primary scientific results of Chang’E-1 lunar mission

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The strategic plan for the development of the unmanned Chinese Lunar Exploration Program is characterized by three distinct stages: "orbiting around", "landing on" and "returning from" the Moon. The first Chinese lunar probe, Chang’E-1, which was successfully launched on October 24th, 2007 at Xichang Satellite Launch Center, and guided to crash on the Moon on March 1st, 2009, at 52.36°E, 1.50°S, in the north of Mare Fecunditatis, is the first step towards the "orbiting around" stage. The Chang’E-1 mission lasted 495 days, exceeding the expected life-span by about four months. A total of 1.37 TB raw data was received from Chang’E-1. It was then processed into 4 TB scientific data products at various levels. Many scientific results have been obtained by analyzing these data, including especially the "global lunar image from the first Chinese lunar explora- tion mission". All scientific goals of Chang’E-1 have been achieved. It provides much useful materials for further advances of lunar sciences and planetary chemistry. Meanwhile, these results will serve as a firm basis for future Chinese lunar missions.

  13. Performance Analysis of Two Ethernet over E1 Schemes

    Institute of Scientific and Technical Information of China (English)

    CHEN Wentao; JIN Depeng; ZENG Lieguang

    2007-01-01

    The Ethernet over E1 approach,which takes advantage of widely deployed telecom networks,is an efficient and economical way to interconnect two Ethernets in different regions.Two Ethernet over E1 schemes, namely a byte granularity scheme and a frame granularity scheme are discussed. The byte granularity scheme partitions Ethernet frames into several pieces for transmission and has a strict requirement on the maximum delay difference of multiple E1 links. To solve this problem, the newly proposed frame granularity scheme transmits separately each frame through E1 links without any partitioning. The architecture designs of both schemes are presented. This paper evaluates the throughput and delay performances of both schemes, both analytically from results calculated from delay models and using test results from field programmable gate array (FPGA) implementation. Although the frame granularity scheme has a slightly worse delay performance, it has a higher throughput, and is the only choice able to overcome large delay differences of the E1 links.

  14. Chang'e-1 Satellite Completed Its Preset Objectives

    Institute of Scientific and Technical Information of China (English)

    He Ying

    2008-01-01

    @@ By October 23, Chang'e-1 satellite with a one-year design lifetime has been operating in lunar orbit for one year, completed more than 4000 orbits, covering the entire moon 12 times. The satellite's platform works normally at present and all systems and equipment onboard work in their main mode. The satellite has obtained a large quantity of scientific data and achieved the preset objectives of precise orbit maneuver, successful moon orbiting, effective exploration and oneyear lifetime. The Chang'e-1 mission is a complete success.

  15. Sigma Delta Modulation Based Ternary FIR Filter Mapping on FPGA

    Directory of Open Access Journals (Sweden)

    Tayabuddin Memon

    2011-07-01

    Full Text Available In this paper single-bit SDM (Sigma Delta Modulation based TFF (Ternary FIR Filter with balanced ternary coefficients (i.e. -1/0/+1 has been mapped on small commercially available FPGAs (Field Programmable Gate Arrays. Filter coefficients were obtained using second order sigma delta modulator. The filter structure is based on a hierarchical adder tree that can easily be pipelined for high performance purpose. Filter structure was coded in VHDL (Very High Speed Integrated Circuit Hardware Description Language and simulated in Quartus-II software. The filter exhibits low I/O (Input Output and core area usage and high performance-achieving clock speeds close to 200MHz on a low-cost FPGA and over 500MHz on a latest FPGA commercially available device. This single-bit ternary filter is intended to support video and audio processing applications in mobile communication systems.

  16. 26 CFR 31.3302(e)-1 - Successor employer.

    Science.gov (United States)

    2010-04-01

    ... TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3302(e)-1 Successor employer. (a) In general. In addition to the credits against the tax allowable under section 3302(a) and...

  17. Student Difficulties with the Dirac Delta Function

    CERN Document Server

    Wilcox, Bethany R

    2014-01-01

    The Dirac delta function is a standard mathematical tool used in multiple topical areas in the undergraduate physics curriculum. While Dirac delta functions are usually introduced in order to simplify a problem mathematically, students often struggle to manipulate and interpret them. To better understand student difficulties with the delta function at the upper-division level, we examined responses to traditional exam questions and conducted think-aloud interviews. Our analysis was guided by an analytical framework that focuses on how students activate, construct, execute, and reflect on the Dirac delta function in physics. Here, we focus on student difficulties using the delta function to express charge distributions in the context of junior-level electrostatics. Challenges included: invoking the delta function spontaneously, constructing two- and three-dimensional delta functions, integrating novel delta function expressions, and recognizing that the delta function can have units.

  18. {Delta}I = 3/2 and {Delta}S = 2 Hyperon decays in chiral perturbation theory

    Energy Technology Data Exchange (ETDEWEB)

    He, X.G. [University of Melbourne, Parkville, VIC (Australia). School of Physics; Valencia, G. [Iowa State University, Ames, Iowa (United States). Department of Physics and Astronomy

    1997-05-01

    We study the| {Delta}I| = 3/2 and |{Delta}S| = 2 amplitudes for hyperon decays of the form B {yields} B`{pi} at lowest order in chiral perturbation theory. At this order, the {Delta}I = 3/2 amplitudes depend on only one constant. We extract the value of this constant from experiment and find a reasonable description of these processes within experimental errors. The same constant determines the {Delta}S = 2 transitions which, in the standard model, are too small to be observed. We find that new physics with parity odd {Delta}S = 2 interactions can produce observable rates in hyperon decays while evading the bounds from K{sup 0} - K-bar{sup 0} mixing. (authors) 10 refs., 3 tabs.

  19. Reactive versus anticipative adaptive management of Deltas: The Sacramento-San Joaquin Delta and the Rhine-Meuse Delta compared

    NARCIS (Netherlands)

    Vlieg, T.J.; Zandvoort, M.

    2013-01-01

    In this paper Californian Adaptive Management (AM) and Dutch Adaptive Delta Management (ADM) are compared. The concepts are introduced in a policy context to deal with prevailing types of uncertainty in water management in the Californian Sacramento-San Joaquin Delta and the Dutch Rhine-Meuse Delta

  20. Facts About Delta Pi Epsilon

    Science.gov (United States)

    Delta Pi Epsilon Journal, 1976

    1976-01-01

    The article discusses the purpose and structure of Delta Pi Epsilon and the general qualifications for membership. Service projects and publications, research awards, timely facts, the year of each chapter's origination, national presidents, and executive secretaries for the last 40 years are listed. (BP)

  1. Hydrological and Climatic Significance of Martian Deltas

    Science.gov (United States)

    Di Achille, G.; Vaz, D. A.

    2017-10-01

    We a) review the geomorphology, sedimentology, and mineralogy of the martian deltas record and b) present the results of a quantitative study of the hydrology and sedimentology of martian deltas using modified version of terrestrial model Sedflux.

  2. Yellow River Delta Faces a Historic Opportunity

    Institute of Scientific and Technical Information of China (English)

    Li Zhen

    2010-01-01

    @@ China's State Council has endorsed the Development Plan of an Efficient Eco-Economic Zone at Yellow River Delta. The plan is meant to create a more ecologically sustainable economic zone along the river delta.

  3. Yellow River Delta Faces a Historic Opportunity

    Institute of Scientific and Technical Information of China (English)

    Li Zhen

    2011-01-01

    @@ China's State Council has endorsed the Development Plan of an Efficient Eco-Economic Zone at Yellow River Delta.The plan is meant to create a more ecologically sustainable economic zone along the river delta.

  4. On the modelling of river delta formation

    NARCIS (Netherlands)

    Geleynse, N.

    2013-01-01

    This thesis presents approaches to the modelling of river delta formation. In particular, it provides results of numerical stratigraphic-morphodynamic modelling of river delta formation under various environmental forcings.

  5. Adaptive delta management: Roots and branches

    NARCIS (Netherlands)

    Timmermans, J.S.; Haasnoot, M.; Hermans, L.M.; Kwakkel, J.H.; Rutten, M.M.; Thissen, W.A.H.

    2015-01-01

    Deltas are generally recognized as vulnerable to climate change and therefore a salient topic in adaptation science. Deltas are also highly dynamic systems viewed from physical (erosion, sedimentation, subsidence), social (demographic), economic (trade), infrastructures (transport, energy, metropoli

  6. Delta Vegetation and Land Use [ds292

    Data.gov (United States)

    California Department of Resources — Vegetation and land use are mapped for the approximately 725,000 acres constituting the Legal Delta portion of the Sacramento and San Joaquin River Delta area....

  7. Phenomenology of heavy quarkonium radiative E1 transitions

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Hector E. [Physik-Department, Technische Universität München, James-Franck-Str. 1, 85748 Garching (Germany)

    2016-01-22

    We present preliminary results of the evaluation of the next-to-leading-order (NLO) relativistic corrections to the heavy quarkonium electric dipole transition (E1) rate. In our evaluation we use the quark-antiquark potential up to 1/m{sup 2} corrections that includes the effective string theory expression for the long range, a review on the method to construct this potential is given. Our results compare favorable with the experiments and may provide predictions for the rates for which no experimental data is yet available.

  8. The chang’E-1 topographic atlas of the Moon

    CERN Document Server

    Li, Chunlai; Mu, Lingli; Ren, Xin; Zuo, Wei

    2016-01-01

    This atlas is based on the lunar global Digital Elevation Models (DEM) of Chang'E-1 (CE-1), and presents CCD stereo image data with digital photogrammetry. The spatial resolution of the DEM in this atlas is 500m, with horizontal accuracy of 192m and vertical accuracy of 120m. Color-shaded relief maps with contour lines are used to show the lunar topographical characteristics. The topographical data gathered by CE-1 can provide fundamental information for the study of lunar topographical, morphological and geological structures, as well as for lunar evolution research.

  9. The role of cyclin E1 in hepatocellular carcinoma

    OpenAIRE

    Chan, Yan-yan; 陳茵茵

    2014-01-01

    Hepatocellular carcinoma (HCC) accounts for 70-85% of liver cancer, which is the sixth most common cancer in the world. Prognosis of HCC is dismal with little chance of complete recovery after diagnosis. It is of essence to discover the key molecules involved in the tumor progression. This could help earlier detection of HCC and establish targeted molecular therapies. Cyclin E1 (CCNE1) is a cyclin molecule responsible for the transition from G1 to S phase of the cell cycle and is often dysreg...

  10. Limited junctional diversity of V delta 5-J delta 1 rearrangement in multiple sclerosis patients.

    Science.gov (United States)

    Nowak, J S; Michałowska-Wender, G; Januszkiewicz, D; Wender, M

    1997-01-01

    T-cell receptor (TCR) delta gene repertoire, as assessed by V delta-J delta rearrangements, has been analyzed in nine multiple sclerosis (MS) cases and in 30 healthy individuals by seminested PCR technique. Among the V delta-J delta junctional diversities studied, the most striking result has been observed in V delta 5-J delta 1 rearrangement. The detection of repeated V delta 5-J delta 1 nucleotide sequences in all analyzed clones from seven out of nine patients studied proved the monoclonal nature of gamma delta T-cells with V delta 5-J delta 1 rearrangement. The clonal nature of this rearrangement proved by PAGE and sequencing analysis may suggest an antigen-driven expansion of gamma delta T cells and argues for a significant role of gamma delta T-cells with V delta 5-J delta 1 rearrangement in MS pathogenesis. However, it cannot be excluded that clonal expansion of these lymphocytes may represent secondary change to central nervous system damage.

  11. Reflections on Development Strategy of Pearl River Delta: In Comparison with Yangtze River Delta

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    <正>1. A comparison between Pearl River Delta and Yangtze River Delta 1.1 Basic conditions 1.1.1 Location, area and scope Located in the southeast of Guangdong Province, the Pearl River Delta (PRD) as an economic zone is a compound delta

  12. Crossover Analysis of CHANG'E-1 Laser Altimeter Data

    Science.gov (United States)

    Hu, W.; Yue, Z.; Di, K.

    2011-08-01

    This paper presents a preliminary result of crossover analysis and adjustment of Chang'E-1(CE-1) Laser Altimeter (LAM) data of the Moon for global and regional mapping applications. During the operation of Chang'E-1 from November 28, 2007 to December 4, 2008, the laser altimeter acquired 1400 orbital profiles with about 9.12 million altimetric points. In our experiment, we derived more than 1.38 million crossovers from 1395 ground tracks covering the entire lunar surface after eliminating outliers of orbits and altimetric points. A method of least-squares crossover adjustment with a series of basis functions of time (trigonometric functions and polynomials) is developed to reconcile the LAM data by minimizing the crossover residuals globally. The normal equations are very large but sparse; therefore they are stored and solved using sparse matrix technique. In a test area (0°N~60°N, 50°W~0°W), the crossover residuals are reduced from 62.1m to 32.8m, and the quality of the DEM generated from the adjusted LAM data is improved accordingly. We will optimize the method for the global adjustment to generate a high precision consistent global DEM, which can be used as absolute control for lunar mapping with orbital images.

  13. What is $\\Delta m^2_{ee}$ ?

    CERN Document Server

    Parke, Stephen

    2016-01-01

    The current short baseline reactor experiments, Daya Bay and RENO (Double Chooz) have measured (or are capable of measuring) an effective $\\Delta m^2$ associated with the atmospheric oscillation scale of 0.5 km/MeV in electron anti-neutrino disappearance. In this paper, I compare and contrast the different definitions of such an effective $\\Delta m^2$ and argue that the simple, L/E independent, definition given by $\\Delta m^2_{ee} \\equiv \\cos^2 \\theta_{12} \\Delta m^2_{31}+ \\sin^2 \\theta_{12} \\Delta m^2_{32}$, i.e. "the $\

  14. [delta-Aminolevulinate dehydratase deficiency].

    Science.gov (United States)

    Fujita, H; Ishida, N; Akagi, R

    1995-06-01

    delta-Aminolevulinate dehydratase (ALAD: E. C. 4.2.1.24), the second enzyme in the heme biosynthetic pathway, condenses two moles of delta-aminolevulinic acid to form porphobilinogen. ALAD deficiency is well known to develop signs and symptoms of typical hepatic porphyria, and classified into three categories as follows: (i) ALAD porphyria, a genetic defect of the enzyme, (ii) tyrosinemia type I, a genetic defect of fumarylacetoacetase in the tyrosine catabolic pathway, producing succinylacetone (a potent inhibitor of ALAD), and (iii) ALAD inhibition by environmental hazards, such as lead, trichloroethylene, and styrene. In the present article, we will describe molecular and biochemical mechanisms to cause the enzyme defect to discuss the significance of ALAD defect on human health.

  15. Periodicity in Delta-modulated feedback control

    Institute of Scientific and Technical Information of China (English)

    Xiaohua XIA; Guanrong CHEN; Rudong GAI; Alan S. I. ZINOBER

    2008-01-01

    The Delta-modulated feedback control of a linear system introduces nonlinearity into the system through switchings between two input values. It has been found that Delta-modulation gives rise to periodic orbits. The existence of periodic points of all orders of Sigma-Delta modulation with "leaky" integration is completely characterized by some interesting groups of polynomials with "sign" coefficients. The results are naturally generalized to Sigma-Delta modulations with multiple delays, Delta-modulations in the "downlink", unbalanced Delta-modulations and systems with two-level quantized feedback. Further extensions relate to the existence of periodic points arising from Delta-modulated feedback control of a stable linear system in an arbitrary direction, for which some necessary and sufficient conditions are given.

  16. Entendiendo Delta desde las Humanidades

    OpenAIRE

    José Calvo Tello

    2016-01-01

    Stylometry is one of the research areas in greater development within Digital Humanities. However, few studies have worked until recently with texts in Spanish and even less so from Spanish-speaking countries. The aim of this paper is to present in Spanish, and without prior statistical knowledge from the reader, one of the main methods used in stylometry, the measure of textual distance Burrows’ Delta. This paper explains this measure using a very small corpus of proverbs and then checks the...

  17. Low Cost Network Emulator with Ethernet and E1 Interfaces

    Directory of Open Access Journals (Sweden)

    Zbynek Kocur

    2010-01-01

    Full Text Available Contemporary Next Generation Networks (NGN are mainly built on the Internet Protocol (IP and Ethernet. Major challenge for emerging types of wired and wireless IP-based networks is to provide an adequate Quality of Service (QoS for different services. The quality of evaluation requires a detailed knowledge of the performance requirements for particular services and applications. The paper is primarily oriented to the end-to-end testing for the Ethernet-based terminal equipment. The low cost Ethernet network emulator was developed on the Department of Telecommunication Technology of the Faculty of Electrical Engineering of the Czech Technical University in Prague. The extension for emulation network with the E1 interfaces and TDM over IP transmission can be used with external converters.

  18. Subcellular Localization of Rat CYP2E1 Impacts Metabolic Efficiency toward Common Substrates

    OpenAIRE

    2015-01-01

    Cytochrome P450 2E1 (CYP2E1) detoxifies or bioactivates many low molecular-weight compounds. Most knowledge about CYP2E1 activity relies on studies of the enzyme localized to endoplasmic reticulum (erCYP2E1); however, CYP2E1 undergoes transport to mitochondria (mtCYP2E1) and becomes metabolically active. We report the first comparison of in vitro steady-state kinetic profiles for erCYP2E1 and mtCYP2E1 oxidation of probe substrate 4-nitrophenol and pollutants styrene and aniline using subcellu...

  19. Data of evolutionary structure change: 1E1QA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QA-2HLDT 1E1Q 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bID> T 2HLDT ALKQVAGS

  20. Data of evolutionary structure change: 1E1RC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDT 1E1R 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI... 2HLD T 2HLDT AAFAQ--

  1. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  2. Challenges, Approaches and Experiences from Asian Deltas and the Rhine-Meuse Delta : Regional Training Workshop on Delta Planning and Management

    NARCIS (Netherlands)

    Wosten, J.H.M.; Douven, W.; Long Phi, H.; Fida Abdullah Khan, M.

    2013-01-01

    River delta's, like the Mekong Delta (Vietnam), Ganges-Brahmaputra Delta (Bangladesh), Ayeyarwady Delta (Myanmar), Nile (Egypt) and Ciliwung Delta (Indonesia) are developing rapidly and are characterised by large-scale urbanisation and industrialization processes. They are facing serious planning ch

  3. Deformation characteristics of {delta} phase in the delta-processed Inconel 718 alloy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y., E-mail: haiyanzhang@imr.ac.cn [Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Zhang, S.H., E-mail: shzhang@imr.ac.cn [Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Cheng, M. [Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Li, Z.X. [Beijing Institute of Aeronautica1 Materials, Beijing 100095 (China)

    2010-01-15

    The hot working characteristics of {delta} phase in the delta-processed Inconel 718 alloy during isothermal compression deformation at temperature of 950 deg. C and strain rate of 0.005 s{sup -1}, were studied by using optical microscope, scanning electron microscope and quantitative X-ray diffraction technique. The results showed that the dissolution of plate-like {delta} phase and the precipitation of spherical {delta} phase particles coexisted during the deformation, and the content of {delta} phase decreased from 7.05 wt.% to 5.14 wt.%. As a result of deformation breakage and dissolution breakage, the plate-like {delta} phase was spheroidized and transferred to spherical {delta} phase particles. In the center with largest strain, the plate-like {delta} phase disappeared and spherical {delta} phase appeared in the interior of grains and grain boundaries.

  4. Migration in Deltas: An Integrated Analysis

    Science.gov (United States)

    Nicholls, Robert J.; Hutton, Craig W.; Lazar, Attila; Adger, W. Neil; Allan, Andrew; Arto, Inaki; Vincent, Katharine; Rahman, Munsur; Salehin, Mashfiqus; Sugata, Hazra; Ghosh, Tuhin; Codjoe, Sam; Appeaning-Addo, Kwasi

    2017-04-01

    Deltas and low-lying coastal regions have long been perceived as vulnerable to global sea-level rise, with the potential for mass displacement of exposed populations. The assumption of mass displacement of populations in deltas requires a comprehensive reassessment in the light of present and future migration in deltas, including the potential role of adaptation to influence these decisions. At present, deltas are subject to multiple drivers of environmental change and often have high population densities as they are accessible and productive ecosystems. Climate change, catchment management, subsidence and land cover change drive environmental change across all deltas. Populations in deltas are also highly mobile, with significant urbanization trends and the growth of large cities and mega-cities within or adjacent to deltas across Asia and Africa. Such migration is driven primarily by economic opportunity, yet environmental change in general, and climate change in particular, are likely to play an increasing direct and indirect role in future migration trends. The policy challenges centre on the role of migration within regional adaptation strategies to climate change; the protection of vulnerable populations; and the future of urban settlements within deltas. This paper reviews current knowledge on migration and adaptation to environmental change to discern specific issues pertinent to delta regions. It develops a new integrated methodology to assess present and future migration in deltas using the Volta delta in Ghana, Mahanadi delta in India and Ganges-Brahmaputra-Meghna delta across India and Bangladesh. The integrated method focuses on: biophysical changes and spatial distribution of vulnerability; demographic changes and migration decision-making using multiple methods and data; macro-economic trends and scenarios in the deltas; and the policies and governance structures that constrain and enable adaptation. The analysis is facilitated by a range of

  5. Casimir force between $\\delta-\\delta^{\\prime}$ mirrors transparent at high frequencies

    CERN Document Server

    Braga, Alessandra N; Alves, Danilo T

    2016-01-01

    We investigate, in the context of a real massless scalar field in $1+1$ dimensions, models of partially reflecting mirrors simulated by Dirac $\\delta-\\delta^{\\prime}$ point interactions. In the literature, these models do not exhibit full transparency at high frequencies. In order to provide a more realistic feature for these models, we propose a modified $\\delta-\\delta^{\\prime}$ point interaction that enables to achieve full transparency in the limit of high frequencies. Taking this modified $\\delta-\\delta^{\\prime}$ model into account, we investigate the Casimir force, comparing our results with those found in the literature.

  6. Estrogen sulfotransferase/SULT1E1 promotes human adipogenesis.

    Science.gov (United States)

    Ihunnah, Chibueze A; Wada, Taira; Philips, Brian J; Ravuri, Sudheer K; Gibbs, Robert B; Kirisci, Levent; Rubin, J Peter; Marra, Kacey G; Xie, Wen

    2014-05-01

    Estrogen sulfotransferase (EST/SULT1E1) is known to catalyze the sulfoconjugation and deactivation of estrogens. The goal of this study is to determine whether and how EST plays a role in human adipogenesis. By using human primary adipose-derived stem cells (ASCs) and whole-fat tissues from the abdominal subcutaneous fat of obese and nonobese subjects, we showed that the expression of EST was low in preadipocytes but increased upon differentiation. Overexpression and knockdown of EST in ASCs promoted and inhibited differentiation, respectively. The proadipogenic activity of EST in humans was opposite to the antiadipogenic effect of the same enzyme in rodents. Mechanistically, EST promoted adipogenesis by deactivating estrogens. The proadipogenic effect of EST can be recapitulated by using an estrogen receptor (ER) antagonist or ERα knockdown. In contrast, activation of ER in ASCs inhibited adipogenesis by decreasing the recruitment of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ) onto its target gene promoters, whereas ER antagonism increased the recruitment of PPARγ to its target gene promoters. Linear regression analysis revealed a positive correlation between the expression of EST and body mass index (BMI), as well as a negative correlation between ERα expression and BMI. We conclude that EST is a proadipogenic factor which may serve as a druggable target to inhibit the turnover and accumulation of adipocytes in obese patients.

  7. E1 and M1 strength functions at low energy

    Directory of Open Access Journals (Sweden)

    Schwengner Ronald

    2017-01-01

    Full Text Available We report photon-scattering experiments using bremsstrahlung at the γELBE facility of Helmholtz-Zentrum Dresden-Rossendorf and using quasi-monoenergetic, polarized γ beams at the HIγS facility of the Triangle Universities Nuclear Laboratory in Durham. To deduce the photoabsorption cross sections at high excitation energy and high level density, unresolved strength in the quasicontinuum of nuclear states has been taken into account. In the analysis of the spectra measured by using bremsstrahlung at γELBE, we perform simulations of statistical γ-ray cascades using the code γDEX to estimate intensities of inelastic transitions to low-lying excited states. Simulated average branching ratios are compared with model-independent branching ratios obtained from spectra measured by using monoenergetic γ beams at HIγS. E1 strength in the energy region of the pygmy dipole resonance is discussed in nuclei around mass 90 and in xenon isotopes. M1 strength in the region of the spin-flip resonance is also considered for xenon isotopes. The dipole strength function of 74Ge deduced from γELBE experiments is compared with the one obtained from experiments at the Oslo Cyclotron Laboratory. The low-energy upbend seen in the Oslo data is interpreted as M1 strength on the basis of shell-model calculations.

  8. Evolving deltas: Conceptualising coevolution with engineered interventions

    Science.gov (United States)

    Welch, Amy; Nicholls, Robert; Lazar, Attila

    2017-04-01

    Mid to low latitude deltas have been populated for thousands of years due to their fertile soil and coastal location. This has led to an alteration in the land cover of deltas to primary agriculture and dense rural settlements and more recently, major cities and megacities have developed on or adjacent to many deltas. Deltas may be prosperous in terms of their outputs and services; however, they are also susceptible to many hazards due to their location and low-lying nature. Hazards include storm surges, fluvial flooding and erosion of both coastal and riverine areas, as well as subsidence, relative sea-level rise and pollution. This can have severe impacts on the delta, its population and its services. Therefore engineered interventions have been used for some time to protect the population and the valuable land from the consequences of hazards. Coevolution can be described as a feedback loop between nature and humans: each has an effect on how the other behaves and hence this inter-dependence interaction continues. Therefore the natural evolution of the delta interacts with engineered interventions, such as promoting accelerated subsidence over time, necessitating further adaptation. The deltaic landscape and associated livelihoods are thus the result of this co-evolution process between natural delta processes and engineered interventions. This presentation will identify and discuss various drivers and consequences of large scale engineered interventions, comparing and contrasting the management approaches taken in five populated deltas (Ganges-Brahmaputra-Meghna, Yangtze, Rhine-Meuse-Scheldt, Mekong and Nile). The type of engineered intervention and management approaches had a direct effect on the coevolution of deltas, with each of the deltas being at different stages in terms of extent of coevolution. A qualitative timeline of the typical steps of coevolution between the human system and the delta system of the studied deltas was produced. The major

  9. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  10. Delta hepatitis agent: structural and antigenic properties of the delta-associated particle.

    Science.gov (United States)

    Bonino, F; Hoyer, B; Shih, J W; Rizzetto, M; Purcell, R H; Gerin, J L

    1984-01-01

    Delta agent (delta) was serially passaged to a second and third hepatitis B surface antigen (HBsAg) carrier chimpanzee, using as inoculum the peak delta antigen (delta Ag) serum of an animal previously infected with human serum. The characteristics of serially transmitted delta Ag were similar to those described in first-passage animals. It was consistently detected before the development of anti-delta, in association with a 35- to 37-nm subpopulation of HBsAg particles and a unique low-molecular-weight (5.5 X 10(5)) RNA. RNase susceptibility of the delta-associated RNA and release of delta Ag activity upon treatment of delta-associated particles with detergent revealed that this particle is organized into a virion-like form with the RNA and delta Ag as internal components within a coat of HBsAg. Surface determinants of the delta-associated particle other than HBsAg were not detected by radioimmunoprecipitation experiments, using sera of humans and chimpanzees convalescent from delta hepatitis. The HBsAg-associated particle is the "candidate agent" of delta hepatitis. Images PMID:6698598

  11. The Niger Delta Amnesty Program

    Directory of Open Access Journals (Sweden)

    Benjamin A. Okonofua

    2016-06-01

    Full Text Available The armed conflict between militias and government forces in Nigeria’s Niger Delta region has spanned for more than two decades, defying all solutions. A disarmament, demobilization, and reintegration (DDR program was established in August 2015 in effort to end the violence and has remained in place. It is a radically different approach from past approaches that displayed zero tolerance to all political challenges to oil production or the allocation of oil profits. The approach appeared to be immediately successful in that it forced a ceasefire, engaged militants in planned programs to rehabilitate and reintegrate them into civilian society, and opened up the oil wells (many of which had been shut due to the crisis with the effect of increasing government revenue, which depends 85% on oil exports. Yet, few studies have attempted to understand the dynamics within the country that are responsible for the design and implementation of this broad policy shift or to understand whether and how the current initiative is able to end the conflict and institute peace beyond the short term. This study, therefore, is important because it provides a critical perspective that anticipates and explains emerging issues with the Niger Delta Amnesty Program, which have implications for DDR adaptation and implementation all over the world. Ultimately, the research demonstrates how the DDR program both transforms the Niger Delta conflict and becomes embroiled in intense contestations not only about the mechanism for transforming the targeted population but also whether and how the program incorporates women who are being deprioritized by the program.

  12. Analysis and Synthesis of Delta Operator Systems

    CERN Document Server

    Yang, Hongjiu; Shi, Peng; Zhao, Ling

    2012-01-01

    This book is devoted to analysis and design on delta operator systems. When sampling is fast, a dynamical system will become difficult to control, which can be seen in wide real world applications. Delta operator approach is very effective to deal with fast sampling systems. Moreover, it is easy to observe and analyze the control effect with different sampling periods in delta operator systems. The framework of this book has been carefully constructed for delta operator systems to handle sliding mode control, time delays, filter design, finite frequency and networked control. These problems indeed are especially important and significant in automation and control systems design. Through the clear framework of the book, readers can easily go through the learning process on delta operator systems via a precise and comfortable learning sequence. Following this enjoyable trail, readers will come out knowing how to use delta operator approach to deal with control problems under fast sampling case. This book should...

  13. Delta Clipper - Design for supportability

    Science.gov (United States)

    Smiljanic, Ray R.; Conrad, Charles; Spaulding, Ed; Gisburne, Don

    1993-07-01

    The 'Delta Clipper' Single Stage Rocket Technology (SSRT) currently under development in the DC-X program will implement reliability-centered maintenance and support, involving on-equipment/off-equipment two-level maintenance, a logistics and spares pipeline, and a minimization of 'blue suit' skill-level personnel. Attention is given to the range of SSRT features that are to be validated via the DC-X test program; these prominently involve LRUs replaceability and accessibility, standardization and interchangeability, and 'aircraft-like' automated data collection.

  14. Climate change and the Delta

    Science.gov (United States)

    Dettinger, Michael; Anderson, Jamie; Anderson, Michael L.; Brown, Larry R.; Cayan, Daniel; Maurer, Edwin P.

    2016-01-01

    Anthropogenic climate change amounts to a rapidly approaching, “new” stressor in the Sacramento–San Joaquin Delta system. In response to California’s extreme natural hydroclimatic variability, complex water-management systems have been developed, even as the Delta’s natural ecosystems have been largely devastated. Climate change is projected to challenge these management and ecological systems in different ways that are characterized by different levels of uncertainty. For example, there is high certainty that climate will warm by about 2°C more (than late-20th-century averages) by mid-century and about 4°C by end of century, if greenhouse-gas emissions continue their current rates of acceleration. Future precipitation changes are much less certain, with as many climate models projecting wetter conditions as drier. However, the same projections agree that precipitation will be more intense when storms do arrive, even as more dry days will separate storms. Warmer temperatures will likely enhance evaporative demands and raise water temperatures. Consequently, climate change is projected to yield both more extreme flood risks and greater drought risks. Sea level rise (SLR) during the 20th century was about 22cm, and is projected to increase by at least 3-fold this century. SLR together with land subsidence threatens the Delta with greater vulnerabilities to inundation and salinity intrusion. Effects on the Delta ecosystem that are traceable to warming include SLR, reduced snowpack, earlier snowmelt and larger storm-driven streamflows, warmer and longer summers, warmer summer water temperatures, and water-quality changes. These changes and their uncertainties will challenge the operations of water projects and uses throughout the Delta’s watershed and delivery areas. Although the effects of climate change on Delta ecosystems may be profound, the end results are difficult to predict, except that native species will fare worse than invaders. Successful

  15. From Natural to Design River Deltas

    Science.gov (United States)

    Giosan, Liviu

    2016-04-01

    Productive and biologically diverse, deltaic lowlands attracted humans since prehistory and may have spurred the emergence of the first urban civilizations. Deltas continued to be an important nexus for economic development across the world and are currently home for over half a billion people. But recently, under the double whammy of sea level rise and inland sediment capture behind dams, they have become the most threatened coastal landscape. Here I will address several deceptively simple questions to sketch some unexpected answers using example deltas from across the world from the Arctic to the Tropics, from the Danube to the Indus, Mississippi to Godavari and Krishna, Mackenzie to Yukon. What is a river delta? What is natural and what is not in a river delta? Are the geological and human histories of a delta important for its current management? Is maintaining a delta the same to building a new one? Can we design better deltas than Nature? These answers help us see clearly that survival of deltas in the next century depends on human intervention and is neither assured nor simple to address or universally applicable. Empirical observations on the hydrology, geology, biology and biochemistry of deltas are significantly lagging behind modeling capabilities endangering the applicability of numerical-based reconstruction solutions and need to be ramped up significantly and rapidly across the world.

  16. Charged current weak electroproduction of $\\Delta$ resonance

    CERN Document Server

    Alvarez-Ruso, L; Vacas, M J V

    1998-01-01

    We study the weak production of $\\Delta$ (i.e. $e^{-} + p \\to \\Delta^{0}+ energy range corresponding to the Mainz and TJNAF electron accelerators. The differential cross sections $\\sigma(\\theta)$ are found to be of the order of $ 10^{-39}$ cm$^2$/sr, over a range of angles which increases with energy. The possibility of observing these reactions with the high luminosities available at these accelerators, and studying the weak N-$\\Delta$ transition form factors through these reactions is discussed. The production cross section of N$^*(1440)$ in the kinematic region of $\\Delta$ production is also estimated and found to be small.

  17. Delta Semantics Defined By Petri Nets

    DEFF Research Database (Denmark)

    Jensen, Kurt; Kyng, Morten; Madsen, Ole Lehrmann

    This report is identical to an earlier version of May 1978 except that Chapter 5 has been revised. A new paper: "A Petri Net Definition of a System Description Language", DAIMI, April 1979, 20 pages, extends the Petri net model to include a data state representing the program variables. Delta...... and the possibility of using predicates to specify state changes. In this paper a formal semantics for Delta is defined and analysed using Petri nets. Petri nets was chosen because the ideas behind Petri nets and Delta concide on several points. A number of proposals for changes in Delta, which resulted from...

  18. SNC 80 and related delta opioid agonists.

    Science.gov (United States)

    Calderon, S N; Coop, A

    2004-01-01

    The discovery of the selective delta (delta) opioid agonists SNC 80 and BW373U86, which possess a diarylmethylpiperazine structure unique among opioids, was a major advance in the field of delta-opioid ligands. Much research has been performed to uncover the structure-activity relationships (SAR) of this class of ligands and also to compare the diarylmethylpiperazines with the traditional morphinan-based delta opioids. This review focuses on the development of the SAR of this unique series of ligands, and discusses questions which remain unanswered.

  19. $\\Delta$ decay in nuclear medium

    CERN Document Server

    Jain, B K; Kundu, Bijoy

    1996-01-01

    Proton-nucleus collisions, where the beam proton gets excited to the delta resonance and then decays to p\\pi ^+, either inside or outside the nuclear medium, are studied. Cross-sections for various kinematics for the (p,p' \\pi ^+) reaction between 500 MeV and 1 GeV beam energy are calculated to see the effects of the nuclear medium on the propagation and decay of the resonance. The cross-sections studied include proton energy spectra in coincidence with the pion, four momentum transfer distributions, and the invariant p\\pi^+ mass distributions. We find that the effect of the nuclear medium on these cross-sections mainly reduces their magnitudes. Comparing these cross-sections with those considering the decay of the delta outside the nucleus only, we further find that at 500 MeV the two sets of cross-sections have large differences, while by 1 GeV the differences between them become much smaller.

  20. Comparative assessment of the vulnerability and resilience of deltas : extended version with 14 deltas : synthesis report

    NARCIS (Netherlands)

    Bucx, T.; Driel, van W.F.; Boer, de H.; Graas, S.; Langenberg, V.; Marchand, M.; Guchte, van de C.

    2014-01-01

    Worldwide, deltas host dense populations and are important centres of agricultural and industrial production, and economic activity. Many deltas are areas of great ecological importance as well, featuring wetlands of high and unique biodiversity. Deltas are vulnerable to changes by natural forces an

  1. $\\Delta I=4$ and $\\Delta I=8$ bifurcations in rotational bands of diatomic molecules

    CERN Document Server

    Bonatsos, Dennis; Lalazissis, G A; Drenska, S B; Minkov, N; Raychev, P P; Roussev, R P; Bonatsos, Dennis

    1996-01-01

    It is shown that the recently observed $\\Delta I=4$ bifurcation seen in superdeformed nuclear bands is also occurring in rotational bands of diatomic molecules. In addition, signs of a $\\Delta I=8$ bifurcation, of the same order of magnitude as the $\\Delta I=4$ one, are observed both in superdeformed nuclear bands and rotational bands of diatomic molecules.

  2. INFLUENCE OF THE DELTA-DELTA-MESON COUPLING ON NUCLEON AND DELTA PROPERTIES IN NUCLEAR-MATTER

    NARCIS (Netherlands)

    DEJONG, F; MALFLIET, R

    1994-01-01

    We introduce a scalar and a vector DELTADELTA-meson vertex in the relativistic Dirac-Brueckner model for nuclear matter and investigate the consequences. We find small effects on the effective nucleon properties. The effects in the DELTA sector are more profound, although the DELTA is still effectiv

  3. Electromagnetic excitation of the Delta(1232) resonance

    Energy Technology Data Exchange (ETDEWEB)

    V. Pascalutsa; M. Vanderhaeghen; Shin Nan Yang

    2006-09-05

    We review the description of the lowest-energy nucleon excitation--the Delta(1232)-resonance. Much of the recent effort has been focused on the precision measurements of the nucleon to Delta transition by means of electromagnetic probes. We review the results of those measurements and confront them with the state-of-the-art calculations based on chiral effective-field theories (EFT), lattice QCD, and QCD-inspired models. Some of the theoretical approaches are reviewed in detail. In particular, we describe the chiral EFT of QCD in the energy domain of the Delta-resonance, and its applications to the electromagnetic nucleon-to-Delta transition (gamma N Delta). We also describe the recent dynamical and unitary-isobar models of pion electroproduction which are extensively used in the extraction of the gamma* N Delta form factors from experiment. Furthermore, we discuss the link of the gamma* N Delta form factors to generalized parton distributions (GPDs), as well as the predictions of perturbative QCD for these transition form factors. The present status of understanding the Delta-resonance properties and the nature of its excitation is summarized.

  4. Structure and replication of hepatitis delta virus

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-29

    Dec 29, 2008 ... Unidade de Biologia Molecular, Centro de Malária e outras Doenças Tropicais, Instituto de Higiene e Medicina Tropical, ... molecules of both delta antigens (Ryu et al., 1993). This ..... Glenn JS, Watson JA, Havel CM, White JO (1992). ... HDV RNA encoding the large delta antigen cannot replicate. J. Gen.

  5. Generalised CP and $\\Delta (96)$ Family Symmetry

    CERN Document Server

    Ding, Gui-Jun

    2014-01-01

    We perform a comprehensive study of the $\\Delta (96)$ family symmetry combined with the generalised CP symmetry $H_{\\rm{CP}}$. We investigate the lepton mixing parameters which can be obtained from the original symmetry $\\Delta (96)\\rtimes H_{\\rm{CP}}$ breaking to different remnant symmetries in the neutrino and charged lepton sectors, namely $G_{\

  6. Delta Blues Scholarship and Imperialist Nostalgia.

    Science.gov (United States)

    Nye, William P.

    When Delta blues are considered to be "folk music," the genre is inextricably tied to the neocolonial, sharecropping system of cotton production characteristic of the Mississippi Delta region between the Civil War and World War II. "Imperialist nostalgia," then, arises in accounts which pay primary and positive tribute to blues…

  7. The delta opioid receptor tool box.

    Science.gov (United States)

    Vicente-Sanchez, Ana; Segura, Laura; Pradhan, Amynah A

    2016-12-03

    In recent years, the delta opioid receptor has attracted increasing interest as a target for the treatment of chronic pain and emotional disorders. Due to their therapeutic potential, numerous tools have been developed to study the delta opioid receptor from both a molecular and a functional perspective. This review summarizes the most commonly available tools, with an emphasis on their use and limitations. Here, we describe (1) the cell-based assays used to study the delta opioid receptor. (2) The features of several delta opioid receptor ligands, including peptide and non-peptide drugs. (3) The existing approaches to detect delta opioid receptors in fixed tissue, and debates that surround these techniques. (4) Behavioral assays used to study the in vivo effects of delta opioid receptor agonists; including locomotor stimulation and convulsions that are induced by some ligands, but not others. (5) The characterization of genetically modified mice used specifically to study the delta opioid receptor. Overall, this review aims to provide a guideline for the use of these tools with the final goal of increasing our understanding of delta opioid receptor physiology.

  8. Entendiendo Delta desde las Humanidades

    Directory of Open Access Journals (Sweden)

    José Calvo Tello

    2016-05-01

    Full Text Available Stylometry is one of the research areas in greater development within Digital Humanities. However, few studies have worked until recently with texts in Spanish and even less so from Spanish-speaking countries. The aim of this paper is to present in Spanish, and without prior statistical knowledge from the reader, one of the main methods used in stylometry, the measure of textual distance Burrows’ Delta. This paper explains this measure using a very small corpus of proverbs and then checks the results in a corpus of Spanish novels. Both data and Python scripts are available to the community through GitHub, commented step by step so that you can play and visualize each step.

  9. Jiaxing: Delicacy of the Yangtze River Delta

    Institute of Scientific and Technical Information of China (English)

    WUXINYI; WANGNAN

    2004-01-01

    THE yangtze River Delta,where the Yangtzc River crosses China's east coast,has one of the country's most dynamic economies.In 1976Jcan Gottmann.a french geographer,called shanghai and its neighboring Yangtze River Delta the world's "sixth largest megalopolis." The Yangtze River Delta has 15 cities. Its territory accounts for one percent of China's total, 5.8 percent of hthe population, and 19.5 percent of the national GDP.In terms of both aggregate economy and growth speed, the Delta currently leads China and could likely be the "enginc" of the world's future economic growth. Located at the juncition of Shanghai Jiangsu and Zhejiang, Jiaxing City holds a central economic belt. It is within 100 kilometers of Shanghai, Hangzhou and Suzhou. In 200 and 2003, Jiaxing's GDP growth rate was first in Zhejiang Province and second among the 1.5 Delta cities.

  10. Metabolic inactivation of resolvin E1 and stabilization of its anti-inflammatory actions.

    Science.gov (United States)

    Arita, Makoto; Oh, Sungwhan F; Chonan, Tomomichi; Hong, Song; Elangovan, Siva; Sun, Yee-Ping; Uddin, Jasim; Petasis, Nicos A; Serhan, Charles N

    2006-08-11

    The resolvins (Rv) are lipid mediators derived from omega-3 polyunsaturated fatty acids that act within a local inflammatory milieu to stop leukocyte recruitment and promote resolution. Resolvin E1 (RvE1; (5S,12R,18R)-trihydroxy-6Z,8E,10E,14Z,16E-eicosapentaenoic acid) is an oxygenase product derived from omega-3 eicosapentaenoic acid that displays potent anti-inflammation/pro-resolution actions in vivo. Here, we determined whether oxidoreductase enzymes catalyze the conversion of RvE1 and assessed the biological activity of the RvE1 metabolite. With NAD+ as a cofactor, recombinant 15-hydroxyprostaglandin dehydrogenase acted as an 18-hydroxyl dehydrogenase to form 18-oxo-RvE1. In the murine lung, dehydrogenation of the hydroxyl group at carbon 18 position to form 18-oxo-RvE1 represented the major initial metabolic route for RvE1. At a concentration where RvE1 potently reduced polymorphonuclear leukocyte (PMN) recruitment in zymosan-induced peritonitis, 18-oxo-RvE1 was devoid of activity. In human neutrophils, carbon 20 hydroxylation of RvE1 was the main route of conversion. An RvE1 analog, i.e. 19-(p-fluorophenoxy)-RvE1, was synthesized that resisted rapid metabolic inactivation and proved to retain biological activity reducing PMN infiltration and pro-inflammatory cytokine/chemokine production in vivo. These results established the structure of a novel RvE1 initial metabolite, indicating that conversion of RvE1 to the oxo product represents a mode of RvE1 inactivation. Moreover, the designed RvE1 analog, which resisted further metabolism/inactivation, could be a useful tool to evaluate the actions of RvE1 in complex disease models.

  11. Data of evolutionary structure change: 1E1QC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDT 1E1Q 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI...yChain> 2HLD T 2HLDT VAAFA---QDLD

  12. Data of evolutionary structure change: 1E1QB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QB-2HLDT 1E1Q 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...dbChain> 2HLDT ALKQVAGSLKLFL 2HLD T 2HLDT VAAFAQDLDAST

  13. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  14. A note on inextensible flows of partially and pseudo null curves in E_1^4

    OpenAIRE

    Yuzbasi, Zuhal Kucukarslan; Bektas, Mehmet

    2013-01-01

    In this paper, we study inextensible flows of partially null and pseudo null curves in E_1^4. We give neccessary and sufficent conditions for inextensible flows of partially null and pseudo null curves in E_1^4

  15. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  16. Cell-based analysis of Chikungunya virus E1 protein in membrane fusion

    Directory of Open Access Journals (Sweden)

    Kuo Szu-Cheng

    2012-04-01

    Full Text Available Abstract Background Chikungunya fever is a pandemic disease caused by the mosquito-borne Chikungunya virus (CHIKV. E1 glycoprotein mediation of viral membrane fusion during CHIKV infection is a crucial step in the release of viral genome into the host cytoplasm for replication. How the E1 structure determines membrane fusion and whether other CHIKV structural proteins participate in E1 fusion activity remain largely unexplored. Methods A bicistronic baculovirus expression system to produce recombinant baculoviruses for cell-based assay was used. Sf21 insect cells infected by recombinant baculoviruses bearing wild type or single-amino-acid substitution of CHIKV E1 and EGFP (enhanced green fluorescence protein were employed to investigate the roles of four E1 amino acid residues (G91, V178, A226, and H230 in membrane fusion activity. Results Western blot analysis revealed that the E1 expression level and surface features in wild type and mutant substituted cells were similar. However, cell fusion assay found that those cells infected by CHIKV E1-H230A mutant baculovirus showed little fusion activity, and those bearing CHIKV E1-G91D mutant completely lost the ability to induce cell-cell fusion. Cells infected by recombinant baculoviruses of CHIKV E1-A226V and E1-V178A mutants exhibited the same membrane fusion capability as wild type. Although the E1 expression level of cells bearing monomeric-E1-based constructs (expressing E1 only was greater than that of cells bearing 26S-based constructs (expressing all structural proteins, the sizes of syncytial cells induced by infection of baculoviruses containing 26S-based constructs were larger than those from infections having monomeric-E1 constructs, suggesting that other viral structure proteins participate or regulate E1 fusion activity. Furthermore, membrane fusion in cells infected by baculovirus bearing the A226V mutation constructs exhibited increased cholesterol-dependences and lower pH thresholds

  17. Differentiation of Boc-protected alpha,delta-/delta,alpha- and beta,delta-/delta,beta-hybrid peptide positional isomers by electrospray ionization tandem mass spectrometry.

    Science.gov (United States)

    Raju, G; Ramesh, V; Srinivas, R; Sharma, G V M; Shoban Babu, B

    2010-06-01

    Two new series of Boc-N-alpha,delta-/delta,alpha- and beta,delta-/delta,beta-hybrid peptides containing repeats of L-Ala-delta(5)-Caa/delta(5)-Caa-L-Ala and beta(3)-Caa-delta(5)-Caa/delta(5)-Caa-beta(3)-Caa (L-Ala = L-alanine, Caa = C-linked carbo amino acid derived from D-xylose) have been differentiated by both positive and negative ion electrospray ionization (ESI) ion trap tandem mass spectrometry (MS/MS). MS(n) spectra of protonated isomeric peptides produce characteristic fragmentation involving the peptide backbone, the Boc-group, and the side chain. The dipeptide positional isomers are differentiated by the collision-induced dissociation (CID) of the protonated peptides. The loss of 2-methylprop-1-ene is more pronounced for Boc-NH-L-Ala-delta-Caa-OCH(3) (1), whereas it is totally absent for its positional isomer Boc-NH-delta-Caa-L-Ala-OCH(3) (7), instead it shows significant loss of t-butanol. On the other hand, second isomeric pair shows significant loss of t-butanol and loss of acetone for Boc-NH-delta-Caa-beta-Caa-OCH(3) (18), whereas these are insignificant for its positional isomer Boc-NH-beta-Caa-delta-Caa-OCH(3) (13). The tetra- and hexapeptide positional isomers also show significant differences in MS(2) and MS(3) CID spectra. It is observed that 'b' ions are abundant when oxazolone structures are formed through five-membered cyclic transition state and cyclization process for larger 'b' ions led to its insignificant abundance. However, b(1)(+) ion is formed in case of delta,alpha-dipeptide that may have a six-membered substituted piperidone ion structure. Furthermore, ESI negative ion MS/MS has also been found to be useful for differentiating these isomeric peptide acids. Thus, the results of MS/MS of pairs of di-, tetra-, and hexapeptide positional isomers provide peptide sequencing information and distinguish the positional isomers.

  18. Influence of different organic fertilizers on quality parameters and the delta(15)N, delta(13)C, delta(2)H, delta(34)S, and delta(18)O values of orange fruit (Citrus sinensis L. Osbeck).

    Science.gov (United States)

    Rapisarda, Paolo; Camin, Federica; Fabroni, Simona; Perini, Matteo; Torrisi, Biagio; Intrigliolo, Francesco

    2010-03-24

    To investigate the influence of different types of fertilizers on quality parameters, N-containing compounds, and the delta(15)N, delta(13)C, delta(2)H, delta (34)S, and delta(18)O values of citrus fruit, a study was performed on the orange fruit cv. 'Valencia late' (Citrus sinensis L. Osbeck), which was harvested in four plots (three organic and one conventional) located on the same farm. The results demonstrated that different types of organic fertilizers containing the same amount of nitrogen did not effect important changes in orange fruit quality parameters. The levels of total N and N-containing compounds such as synephrine in fruit juice were not statistically different among the different treatments. The delta(15)N values of orange fruit grown under fertilizer derived from animal origin as well as from vegetable compost were statistically higher than those grown with mineral fertilizer. Therefore, delta(15)N values can be used as an indicator of citrus fertilization management (organic or conventional), because even when applied organic fertilizers are of different origins, the natural abundance of (15)N in organic citrus fruit remains higher than in conventional ones. These treatments also did not effect differences in the delta(13)C, delta(2)H, delta(34)S, and delta(18)O values of fruit.

  19. Absence of NR2E1 mutations in patients with aniridia

    DEFF Research Database (Denmark)

    Corso-Díaz, Ximena; Borrie, Adrienne E; Bonaguro, Russell;

    2012-01-01

    Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other congen...

  20. Identifying hazards associated with lava deltas

    Science.gov (United States)

    Poland, Michael P.; Orr, Tim R.

    2014-01-01

    Lava deltas, formed where lava enters the ocean and builds a shelf of new land extending from the coastline, represent a significant local hazard, especially on populated ocean island volcanoes. Such structures are unstable and prone to collapse—events that are often accompanied by small explosions that can deposit boulders and cobbles hundreds of meters inland. Explosions that coincide with collapses of the East Lae ‘Apuki lava delta at Kīlauea Volcano, Hawai‘i, during 2005–2007 followed an evolutionary progression mirroring that of the delta itself. A collapse that occurred when the lava–ocean entry was active was associated with a blast of lithic blocks and dispersal of spatter and fine, glassy tephra. Shortly after delta growth ceased, a collapse exposed hot rock to cold ocean water, resulting in an explosion composed entirely of lithic blocks and lapilli. Further collapse of the delta after several months of inactivity, by which time it had cooled significantly, resulted in no recognizable explosion deposit. Seaward displacement and subsidence of the coastline immediately inland of the delta was measured by both satellite and ground-based sensors and occurred at rates of several centimeters per month even after the lava–ocean entry had ceased. The anomalous deformation ended only after complete collapse of the delta. Monitoring of ground deformation may therefore provide an indication of the potential for delta collapse, while the hazard associated with collapse can be inferred from the level of activity, or the time since the last activity, on the delta.

  1. Infection with E1B-mutant adenovirus stabilizes p53 but blocks p53 acetylation and activity through E1A

    DEFF Research Database (Denmark)

    Savelyeva, I.; Dobbelstein, M.

    2011-01-01

    Wild-type adenovirus type 5 eliminates p53 through the E1B-55 kDa and E4-34 kDa gene products. Deletion or mutation of E1B-55 kDa has long been thought to confer p53-selective replication of oncolytic viruses. We show here that infection with E1B-defective adenovirus mutants induces massive...... accumulation of p53, without obvious defects in p53 localization, phosphorylation, conformation and oligomerization. Nonetheless, p53 completely failed to induce its target genes in this scenario, for example, p21/CDKN1A, Mdm2 and PUMA. Two regions of the E1A gene products independently contributed...... acetylation in infected cells. Mutating either of these E1A regions, in addition to E1B, partially restored p21 mRNA levels. Our findings argue that adenovirus attenuates p53-mediated p21 induction, through at least two E1B-independent mechanisms. Other virus species and cancer cells may employ analogous...

  2. Delta Electroproduction in 12-C

    Energy Technology Data Exchange (ETDEWEB)

    McLauchlan, Steven [Univ. of Glasgow, Scotland (United Kingdom)

    2003-01-01

    The Δ-nucleus potential is a crucial element in the understanding of the nuclear system. Previous electroexcitation measurements in the delta region reported a Q2 dependence of the Δ mass indicating that this potential is dependent on the momentum of the Δ. Such a dependence is not observed for protons and neutrons in the nuclear medium. This thesis presents the experimental study of the electroexcitation of the Δ resonance in 12C, performed using the high energy electron beam at the Thomas Jefferson National Accelerator Facility, and the near 4π acceptance detector CLAS that enables the detection of the full reaction final state. Inclusive, semi inclusive, and exclusive cross sections were measured with an incident electron beam energy of 1.162GeV over the Q2 range 0.175-0.475 (GeV/c)2. A Q2 dependence of the Δ mass was only observed in the exclusive measurements indicating that the Δ-nucleus potential is affected by the momentum of the Δ.

  3. Novel diazabicycloalkane delta opioid agonists.

    Science.gov (United States)

    Loriga, Giovanni; Lazzari, Paolo; Manca, Ilaria; Ruiu, Stefania; Falzoi, Matteo; Murineddu, Gabriele; Bottazzi, Mirko Emilio Heiner; Pinna, Giovanni; Pinna, Gérard Aimè

    2015-09-01

    Here we report the investigation of diazabicycloalkane cores as potential new scaffolds for the development of novel analogues of the previously reported diazatricyclodecane selective delta (δ) opioid agonists, as conformationally constrained homologues of the reference δ agonist (+)-4-[(αR)-α((2S,5R)-4-allyl-2,5-dimethyl-1-piperazinyl)-3-methoxybenzyl]-N,N-diethylbenzamide (SNC80). In particular, we have simplified the diazatricyclodecane motif of δ opioid agonist prototype 1a with bridged bicyclic cores. 3,6-diazabicyclo[3.1.1]heptane, 3,8-diazabicyclo[3.2.1]octane, 3,9-diazabicyclo[3.3.1]nonane, 3,9-diazabicyclo[4.2.1]nonane, and 3,10-diazabicyclo[4.3.1]decane were adopted as core motifs of the novel derivatives. The compounds were synthesized and biologically assayed as racemic (3-5) or diastereoisomeric (6,7) mixtures. All the novel compounds 3-7 showed δ agonism behaviour and remarkable affinity to δ receptors. Amongst the novel derivatives, 3,8-diazabicyclo[3.2.1]octane based compound 4 evidenced improved δ affinity and selectivity relative to SNC80. Published by Elsevier Ltd.

  4. Damped Oscillator with Delta-Kicked Frequency

    Science.gov (United States)

    Manko, O. V.

    1996-01-01

    Exact solutions of the Schrodinger equation for quantum damped oscillator subject to frequency delta-kick describing squeezed states are obtained. The cases of strong, intermediate, and weak damping are investigated.

  5. Delta-nucleus dynamics: proceedings of symposium

    Energy Technology Data Exchange (ETDEWEB)

    Lee, T.S.H.; Geesaman, D.F.; Schiffer, J.P. (eds.)

    1983-10-01

    The appreciation of the role in nuclear physics of the first excited state of the nucleon, the delta ..delta..(1232), has grown rapidly in the past decade. The delta resonance dominates nuclear reactions induced by intermediate energy pions, nucleons, and electromagnetic probes. It is also the most important non-nucleonic degree of freedom needed to resolve many fundamental problems encountered in the study of low-energy nuclear phenomena. Clearly, a new phase of nuclear physics has emerged and conventional thinking must be extended to account for this new dimension of nuclear dynamics. The most challenging problem we are facing is how a unified theory can be developed to describe ..delta..-nucleus dynamics at all energies. In exploring this new direction, it is important to have direct discussions among researchers with different viewpoints. Separate entries were prepared for the 49 papers presented. (WHK)

  6. in the Niger Delta of Nigeria

    African Journals Online (AJOL)

    suggestions as policy options for the resolution of the armed conflict in the. Niger Delta ... indiscriminate use of lethal weapons by local militias, the cumulative effect of which is the ... of many 'child' soldiers in local conflicts or wars nowadays.

  7. Contemporary depositional environments of the Omo delta.

    Science.gov (United States)

    Butzer, K W

    1970-05-02

    Geomorphological and sedimentological studies of depositional environments of the modern Omo River delta and floodplain are essential to an understanding of the Pliocene to Pleistocene Mursi, Nkalabong and Kibish Formations of the Lower Omo Basin (southwestern Ethiopia).

  8. Legal Delta Boundary, 2001, DWR [ds586

    Data.gov (United States)

    California Department of Resources — The original topographic maps containing the drawn delta border were scanned from the Department of Water Resources. Images were registered to 1:24,000 USGS DRG's in...

  9. Cackling Canada goose nesting populations, Yukon Delta

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Number of potential territories, number of cackling Canada Goose nests, and percent occupancy of available territories from CCG plots on the Yukon Delta National...

  10. Water quality in the Okavango Delta

    African Journals Online (AJOL)

    2010-03-12

    Mar 12, 2010 ... water and sediments in the Okavango Delta published between 2000 and 2010. Despite the shortage ... Their interactions with light, water, dissolved nutrients and suspended solids ...... temporal remote sensing. Int. J. Remote ...

  11. California Black Rail - Central Delta [ds17

    Data.gov (United States)

    California Department of Resources — Results of taped-call black rail surveys of in-stream habitat within certain waterways in the central Sacramento / San Joaquin Delta during 1992 and 1993. TIME...

  12. Propagator for the double delta potential

    Energy Technology Data Exchange (ETDEWEB)

    Cacciari, Ilaria [Istituto di Fisica Applicata ' Nello Carrara' , CNR, via Madonna del Piano 10, 50019 Sesto Fiorentino, Florence (Italy); Moretti, Paolo [Istituto dei Sistemi Complessi, CNR, Sezione di Firenze, via Madonna del Piano 10, 50019 Sesto Fiorentino, Florence (Italy)]. E-mail: paolo.moretti@isc.cnr.it

    2006-12-04

    The propagator for the double delta potential is calculated starting from the integral form of the Schroedinger equation. A compact expression of its Laplace transform is found, that can be explicitly inverted in some limiting cases.

  13. The Atchafalaya River Delta. Report 4. Generic Analysis of Delta Development.

    Science.gov (United States)

    1984-01-01

    contemporaneously with delta growth (Donaldson, Martin , and Kanes 1970). The average rate of contour advancement has been ap- proximately 12 m/yr. Assuming the...Donaldson, Martin , ’, and Kanes 1970) shows that the delta has transgressed over 60 m. Average rates of deterioration are reported to be 2.75 m/yr...after 1965 ( Keown , Dardeau, and Causey 1980). Coarse sediment not reaching the delta is precisely the material needed for subaerial land. Third, the

  14. Optimized $\\delta$ expansion for relativistic nuclear models

    CERN Document Server

    Krein, G I; Peres-Menezes, D; Nielsen, M; Pinto, M B

    1998-01-01

    The optimized $\\delta$-expansion is a nonperturbative approach for field theoretic models which combines the techniques of perturbation theory and the variational principle. This technique is discussed in the $\\lambda \\phi^4$ model and then implemented in the Walecka model for the equation of state of nuclear matter. The results obtained with the $\\delta$ expansion are compared with those obtained with the traditional mean field, relativistic Hartree and Hartree-Fock approximations.

  15. Migration in Vulnerable Deltas: A Research Strategy

    Science.gov (United States)

    Hutton, C.; Nicholls, R. J.; Allan, A.

    2015-12-01

    C. Hutton1, & R. J. Nicholls1, , 1 University of Southampton, University Road, Southampton, Hampshire, United Kingdom, SO17 1BJ. cwh@geodata. soton.ac.ukAbstractGlobally, deltas contain 500 million people and with rising sea levels often linked to large number of forced migrants are expected in the coming century. However, migration is already a major process in deltas, such as the growth of major cities such as Dhaka and Kolkata. Climate and environmental change interacts with a range of catchment and delta level drivers, which encompass a nexus of sea-level rise, storms, freshwater and sediment supply from the catchment, land degradation, subsidence, agricultural loss and socio-economic stresses. DECCMA (Deltas, Vulnerability and Climate Change: Migration and Adaptation/CARRIA) is investigating migration in the Ganges-Brahmaputra-Meghna (GBM), Mahanadi and Volta Deltas, including the influence of climate change. The research will explore migration from a range of perspectives including governance and stakeholder analysis, demographic analysis, household surveys of sending and receiving areas, macro-economic analysis, and hazards and hotspot analysis both historically and into the future. Migration under climate change will depend on other adaptation in the deltas and this will be examined. Collectively, integrated analysis will be developed to examine migration, other adaptation and development pathways with a particular focus on the implications for the poorest. This will require the development of input scenarios, including expert-derived exogenous scenarios (e.g., climate change) and endogenous scenarios of the delta developed in a participatory manner. This applied research will facilitate decision support methods for the development of deltas under climate change, with a focus on migration and other adaptation strategies.

  16. Stellar delta matter with delta-meson coupling constants constrained by QCD sum rule

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Antonio Ferreira da [Secretaria de Educacao, Cultura e Desportos do Estado de Roraima (SECD/RR), Boa Vista, RR (Brazil); Oliveira, Jose Carlos Teixeira de [Universidade Federal de Roraima (UFRR), Boa Vista, RR (Brazil); Rodrigues, Hilario [Centro Federal de Educacao Tecnologica (CEFET-RJ), Rio de Janeiro, RJ (Brazil); Duarte, Sergio Barbosa [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Chiapparini, Marcelo [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil)

    2010-07-01

    The considerable presence of delta-resonances (30% of baryonic population) in the dense phase of relativistic heavy ion collisions leads to a great interest in the study of the delta matter formation in the deep interior of compact stars. In the present work we determine the equation of state and the population of baryons and leptons and discuss the effects of the baryon-meson coupling constants to the formation of delta matter in the stellar medium. We use the non-linear Walecka model consisting of the octet of baryons of spin 1=2 (n, p, {Lambda}{sup 0}, {Sigma}{sup -}, {Sigma}{sup 0}, {Sigma}{sup +}, {Xi}{sup -}, {Xi}{sup 0}) and baryonic resonances of spin 3=2, represented by the delta resonances ({Delta}{sup -}, ({Delta}{sup 0}, ({Delta}{sup +}, ({Delta}{sup ++}) and {Omega}{sup -}, in the baryonic sector. In the leptonic sector we consider the electrons and muons. The coupling constants between the hyperons {Lambda}, {Sigma}, and {Xi} and the mesons {omega} and {rho} are fixed by using SU(6) symmetry, while the hyperons-{sigma} coupling constants are constrained by the consistence of the hypernuclear potential in the nuclear matter with hypernuclear data. In addition, we use the finite density QCD sum rule to determine the possible values of delta-meson coupling constants. (author)

  17. delta(13)C and delta(2)H isotope ratios in amphetamine synthesized from benzaldehyde and nitroethane.

    Science.gov (United States)

    Collins, Michael; Salouros, Helen; Cawley, Adam T; Robertson, James; Heagney, Aaron C; Arenas-Queralt, Andrea

    2010-06-15

    Previous work in these laboratories and by Butzenlechner et al. and Culp et al. has demonstrated that the delta(2)H isotope value of industrial benzaldehyde produced by the catalytic oxidation of toluene is profoundly positive, usually in the range +300 per thousand to +500 per thousand. Synthetic routes leading to amphetamine, methylamphetamine or their precursors and commencing with such benzaldehyde may be expected to exhibit unusually positive delta(2)H values. Results are presented for delta(13)C and delta(2)H isotope values of 1-phenyl-2-nitropropene synthesized from an industrial source of benzaldehyde, having a positive delta(2)H isotope value, by a Knoevenagel condensation with nitroethane. Results are also presented for delta(13)C and delta(2)H isotope values for amphetamine prepared from the resulting 1-phenyl-2-nitropropene. The values obtained were compared with delta(13)C and delta(2)H isotope values obtained for an amphetamine sample prepared using a synthetic route that did not involve benzaldehyde. Finally, results are presented for samples of benzaldehyde, 1-phenyl-2-nitropropene and amphetamine that had been seized at a clandestine amphetamine laboratory.

  18. Structural models of the membrane anchors of envelope glycoproteins E1 and E2 from pestiviruses

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jimin, E-mail: jimin.wang@yale.edu; Li, Yue; Modis, Yorgo, E-mail: yorgo.modis@yale.edu

    2014-04-15

    The membrane anchors of viral envelope proteins play essential roles in cell entry. Recent crystal structures of the ectodomain of envelope protein E2 from a pestivirus suggest that E2 belongs to a novel structural class of membrane fusion machinery. Based on geometric constraints from the E2 structures, we generated atomic models of the E1 and E2 membrane anchors using computational approaches. The E1 anchor contains two amphipathic perimembrane helices and one transmembrane helix; the E2 anchor contains a short helical hairpin stabilized in the membrane by an arginine residue, similar to flaviviruses. A pair of histidine residues in the E2 ectodomain may participate in pH sensing. The proposed atomic models point to Cys987 in E2 as the site of disulfide bond linkage with E1 to form E1–E2 heterodimers. The membrane anchor models provide structural constraints for the disulfide bonding pattern and overall backbone conformation of the E1 ectodomain. - Highlights: • Structures of pestivirus E2 proteins impose constraints on E1, E2 membrane anchors. • Atomic models of the E1 and E2 membrane anchors were generated in silico. • A “snorkeling” arginine completes the short helical hairpin in the E2 membrane anchor. • Roles in pH sensing and E1–E2 disulfide bond formation are proposed for E1 residues. • Implications for E1 ectodomain structure and disulfide bonding pattern are discussed.

  19. [Induction of rat hepatic CYP2E1 expression by arecoline in vivo].

    Science.gov (United States)

    Huang, Xiang-tao; Xiao, Run-mei; Wang, Ming-feng; Wang, Jun-jun; Chen, Yong

    2016-01-01

    The regulation mechanism of arecoline on rat hepatic CYP2E1 was studied in vivo. After oral administration of arecoline hydrobromide (AH; 4, 20 and 100 mg x kg(-1) x d(-1)) to rats for one week, the hepatic CYP2E1 mRNA level remained unchanged, but the hepatic CYP2E1 protein content was dose-dependently increased. Additionally, although the hepatic CYP2E1 activity was induced by AH treatment, the induction was attenuated with the increase in dosage. The results indicate that the effect of arecoline on rat hepaticdoes not involve transcriptional activation of the gene, but largely involves the stabilization of CYP2E1 protein against degradation or increased efficiency of CYP2E1 mRNA translation, and additionally involve the post- ranslational modification of CYP2E1 protein. Furthermore, the CYP2E1 response is fairly equal among the different species, the induction of rat hepatic CYP2E1 by arecoline suggests that there is a risk of metabolic interaction among the substrate drugs of CYP2E1 in betel-quid use human.

  20. Improved Plant-based Production of E1 endoglucanase Using Potato: Expression Optimization and Tissue Targeting

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Ziyu [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hooker, Brian S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Daniel B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Thomas, Steven R. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2000-06-01

    Optimization of Acidothermus cellulolyticus endoglucanase (E1) gene expression in transgenic potato (Solanum tuberosum L.) was examined in this study, where the E1 coding sequence was transcribed under control of a leaf specific promoter (tomato RbcS-3C) or the Mac promoter (a hybrid promoter of mannopine synthase promoter and cauliflower mosaic virus 35S promoter enhancer region). Average E1 activity in leaf extracts of potato transformants, in which E1 protein was targeted by a chloroplast signal peptide and an apoplast signal peptide were much higher than those by an E1 native signal peptide and a vacuole signal peptide. E1 protein accumulated up to 2.6% of total leaf soluble protein, where E1 gene was under control of the RbcS-3C promoter, alfalfa mosaic virus 5-untranslated leader, and RbcS-2A signal peptide. E1 protein production, based on average E1 activity and E1 protein accumulation in leaf extracts, is higher in potato than those measured previously in transgenic tobacco bearing the same transgene constructs. Comparisons of E1 activity, protein accumulation, and relative mRNA levels showed that E1 expression under control of tomato RbcS-3C promoter was specifically localized in leaf tissues, while E1 gene was expressed in both leaf and tuber tissues under control of Mac promoter. This suggests dual-crop applications in which potato vines serve as enzyme production `bioreactors' while tubers are preserved for culinary applications.

  1. Determination of the Michel Parameters $\\rho$, $\\xi$, and $\\delta$ in $\\tau$-Lepton Decays with $\\tau \\to \\rho \

    CERN Document Server

    Albrecht, H

    1998-01-01

    Using the ARGUS detector at the $e^+ e^-$ storage ring DORIS II, we have measured the Michel parameters $\\rho$, $\\xi$, and $\\xi\\delta$ for center of mass energies in the region of the $\\Upsilon$ resonances. Using 0.04 \\pm 0.08$, $\\xi_{e}= 1.12 \\pm 0.20 \\pm 0.09$, $\\xi\\delta_{e}= 0.57 \\pm 0.14 \\pm 0.07$, $\\rho_{\\mu}= 0.69 \\pm 0.06 \\pm 0.08$, $\\xi_{\\mu}= 1.25 \\pm 0.27 the combined ARGUS results on $\\rho$, $\\xi$, and $\\xi\\delta$ using this work und previous measurements.

  2. The Okavango: Whose Delta is it?

    Science.gov (United States)

    Magole, Lapologang; Magole, Lefatshe Innocent

    The Okavango Delta is amongst the largest Ramsar sites ( http://www.ramsar.org/sitelist.pdf) in the world and an important wetland for community livelihoods, conservation and tourism in Botswana. Over the years, the utilization of the delta has shifted from communal use to state control, with an increased use for conservation and tourism. This increased use for conservation and tourism has manifested in the physical expansion of the conservation area - Moremi Game Reserve and the formation of Wildlife Management Areas (WMAs) around the reserve, whose primary land use is wildlife utilization. The expansion of the conservation area has translated into several practical matters, including expansion of the area for non-hunting activities or photographic areas. The livelihoods of local communities of the Okavango delta who depended on fishing, hunter-gathering, livestock rearing, rain-fed agriculture and flood recession farming have been negatively affected by the expansion of conservation and tourism in the delta. The livelihoods alternatives in the form of Community Based Natural Resource Management (CBNRM) and tourism have not provided substitutes for the people as the communities are still reliant on the same old livelihood sources as in the past, albeit within smaller and restricted areas. This paper explores the ownership of the natural resources within the Okavango Delta. It asks and attempts to answer the following questions: Who owns and controls the use of the land? Who has access to other resources there in? Who makes the decisions on how the delta resources should be managed and used? Who benefits from the delta resources? We argue firstly that ownership of the delta as defined by legal parameters and demonstrated in natural resource management practice is vested on government. Secondly, government, after assuming ownership of the delta continues to sell its stake to the international community, at the expense of local ownership and access to resources. We

  3. The Role of CYP2E1 in the Drug Metabolism or Bioactivation in the Brain

    Science.gov (United States)

    García-Suástegui, W. A.; Ramos-Chávez, L. A.; Rubio-Osornio, M.; Calvillo-Velasco, M.; Atzin-Méndez, J. A.; Guevara, J.

    2017-01-01

    Organisms have metabolic pathways that are responsible for removing toxic agents. We always associate the liver as the major organ responsible for detoxification of the body; however this process occurs in many tissues. In the same way, as in the liver, the brain expresses metabolic pathways associated with the elimination of xenobiotics. Besides the detoxifying role of CYP2E1 for compounds such as electrophilic agents, reactive oxygen species, free radical products, and the bioactivation of xenobiotics, CYP2E1 is also related in several diseases and pathophysiological conditions. In this review, we describe the presence of phase I monooxygenase CYP2E1 in regions of the brain. We also explore the conditions where protein, mRNA, and the activity of CYP2E1 are induced. Finally, we describe the relation of CYP2E1 in brain disorders, including the behavioral relations for alcohol consumption via CYP2E1 metabolism. PMID:28163821

  4. The Role of CYP2E1 in the Drug Metabolism or Bioactivation in the Brain

    Directory of Open Access Journals (Sweden)

    W. A. García-Suástegui

    2017-01-01

    Full Text Available Organisms have metabolic pathways that are responsible for removing toxic agents. We always associate the liver as the major organ responsible for detoxification of the body; however this process occurs in many tissues. In the same way, as in the liver, the brain expresses metabolic pathways associated with the elimination of xenobiotics. Besides the detoxifying role of CYP2E1 for compounds such as electrophilic agents, reactive oxygen species, free radical products, and the bioactivation of xenobiotics, CYP2E1 is also related in several diseases and pathophysiological conditions. In this review, we describe the presence of phase I monooxygenase CYP2E1 in regions of the brain. We also explore the conditions where protein, mRNA, and the activity of CYP2E1 are induced. Finally, we describe the relation of CYP2E1 in brain disorders, including the behavioral relations for alcohol consumption via CYP2E1 metabolism.

  5. Inhibitory Potency of 4-Carbon Alkanes and Alkenes toward CYP2E1 Activity

    OpenAIRE

    2014-01-01

    CYP2E1 has been implicated in the bioactivation of many small molecules into reactive metabolites which form adducts with proteins and DNA, and thus a better understanding of the molecular determinants of its selectivity are critical for accurate toxicological predictions. In this study, we determined the potency of inhibition of human CYP2E1 for various 4-carbon alkanes, alkenes and alcohols. In addition, known CYP2E1 substrates and inhibitors including 4-methylpyrazole, aniline, and dimethy...

  6. CYP2E1 mediated isoniazid-induced hepatotoxicity in rats

    Institute of Scientific and Technical Information of China (English)

    Jiang YUE; Ren-xiu PENG; Jing YANG; Rui KONG; Juan LIU

    2004-01-01

    AIM: To investigate the role of CYP2E1 in isoniazid (INH)-induced hepatotoxicity and the influence of rifampicin (RFP) on INH-induced liver injury. METHODS: Rats were treated with INH alone (100 mg/kg, ip) or co-administered with RFP (100 mg/kg, ig) for 10 d and 21 d. Hepatotoxicity was assayed by plasma enzymes (sALT, sAST) and histopathological examinations. Hepatic CYP2E1 activity was measured by aniline hydroxylase (ANH), and CYP2E1 mRNA expression was determined by RT-PCR. Plasma hydrazine concentration was determined by RP-HPLC.RESULTS: For a 10 d INH-treatment, hepatic CYP2E1 level was increased to 3.7-fold over the control; liver impairment appeared after 21 d treatment, while CYP2E1 and plasma hydrazine were, respectively, increased to 4.6-fold and 1.7-fold. However, in INH-RFP group for 10 d, CYP2E1 and plasma hydrazine were, respectively,decreased by 13 % and 18 % over INH group; similarly, hepatic injury is equal to INH group appeared after 21 d,and CYP2E1 was further decreased by 26 %. Correlation analysis showed that sALT had a positive correlation with plasma hydrazine and with CYP2E1 activity; CYP2E1 activity was also markedly correlated with plasma hydrazine.And compared with control, there is no difference in changes of CYP2E1 mRNA expression in INH and INH-RFP treatment for 21 d. CONCLUSION: The metabolite of INH, hydrazine, plays an important role in INH-induced hepatotoxicity in rats. The induction of CYP2E1 by hydrazine is involved in the hepatotoxicity of INH. RFP does not exacerbate INH-induced hepatotoxicity in short term, which relates to down-regulation of CYP2E1.

  7. 26 CFR 1.1059(e)-1 - Non-pro rata redemptions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Non-pro rata redemptions. 1.1059(e)-1 Section 1... (CONTINUED) INCOME TAXES Special Rules § 1.1059(e)-1 Non-pro rata redemptions. (a) In general. Section 1059(d... 1059(e)(1). For example, if a redemption of stock is not pro rata as to all shareholders, any...

  8. Absence of NR2E1 mutations in patients with aniridia

    DEFF Research Database (Denmark)

    Corso-Díaz, Ximena; Borrie, Adrienne E; Bonaguro, Russell;

    2012-01-01

    Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other congen...... congenital ocular malformations (anterior segment dysgenesis, congenital optic nerve malformation, and microphthalmia)....

  9. CYP2E1-dependent hepatotoxicity and oxidative damage after ethanol administration in human primary hepatocytes

    Institute of Scientific and Technical Information of China (English)

    Lie-Gang Liu; Hong Yan; Ping Yao; Wen Zhang; Li-Jun Zou; Fang-Fang Song; Ke Li; Xiu-Fa Sun

    2005-01-01

    AIM: To observe the relationship between ethanol-induced oxidative damage in human primary cultured hepatocytes and cytochrome P450 2E1 (CYP2E1) activity, in order to address if inhibition of CYP2E1 could attenuate ethanol-induced cellular damage.METHODS: The dose-dependent (25-100 mmol/L) and time-dependent (0-24 h) exposures of primary human cultured hepatocytes to ethanol were carried out. CYP2E1 activity and protein expression were detected by spectrophotometer and Western blot analysis respectively.Hepatotoxicity was investigated by determination of lactate dehydrogenase (LDH) and aspartate transaminase (AST) level in hepatocyte culture supernatants, as well as the intracellular formation of malondialdehyde (MDA).RESULTS: A dose-and time-dependent response between ethanol exposure and CYP2E1 activity in human hepatocytes was demonstrated. Moreover, there was a time-dependent increase of CYP2E1 protein after 100 mmol/L ethanol exposure. Meanwhile, ethanol exposure of hepatocytes caused a time-dependent increase of ceilular MDA level, LDH, and AST activities in supernatants.Furthermore, the inhibitor of CYP2E1, diallyl sulfide (DAS) could partly attenuate the increases of MDA, LDH, and AST in human hepatocytes.CONCLUSION: A positive relationship between ethanol-induced oxidative aamage in human primary cultured hepatocytes and CYP2E1 activity was exhibited, and the inhibition of CYP2E1 could partly attenuate ethanol-induced oxidative damage.

  10. Requirements for E1A dependent transcription in the yeast Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Mymryk Joe S

    2009-04-01

    Full Text Available Abstract Background The human adenovirus type 5 early region 1A (E1A gene encodes proteins that are potent regulators of transcription. E1A does not bind DNA directly, but is recruited to target promoters by the interaction with sequence specific DNA binding proteins. In mammalian systems, E1A has been shown to contain two regions that can independently induce transcription when fused to a heterologous DNA binding domain. When expressed in Saccharomyces cerevisiae, each of these regions of E1A also acts as a strong transcriptional activator. This allows yeast to be used as a model system to study mechanisms by which E1A stimulates transcription. Results Using 81 mutant yeast strains, we have evaluated the effect of deleting components of the ADA, COMPASS, CSR, INO80, ISW1, NuA3, NuA4, Mediator, PAF, RSC, SAGA, SAS, SLIK, SWI/SNF and SWR1 transcriptional regulatory complexes on E1A dependent transcription. In addition, we examined the role of histone H2B ubiquitylation by Rad6/Bre1 on transcriptional activation. Conclusion Our analysis indicates that the two activation domains of E1A function via distinct mechanisms, identify new factors regulating E1A dependent transcription and suggest that yeast can serve as a valid model system for at least some aspects of E1A function.

  11. Human CYP2E1 mediates the formation of glycidamide from acrylamide.

    Science.gov (United States)

    Settels, Eva; Bernauer, Ulrike; Palavinskas, Richard; Klaffke, Horst S; Gundert-Remy, Ursula; Appel, Klaus E

    2008-10-01

    Regarding the cancer risk assessment of acrylamide (AA) it is of basic interest to know, as to what amount of the absorbed AA is metabolized to glycidamide (GA) in humans, compared to what has been observed in laboratory animals. GA is suspected of being the ultimate carcinogenic metabolite of AA. From experiments with CYP2E1-deficient mice it can be concluded that AA is metabolized to GA primarily by CYP2E1. We therefore examined whether CYP2E1 is involved in GA formation in non-rodent species with the focus on humans by using human CYP2E1 supersomes, marmoset and human liver microsomes and in addition, genetically engineered V79 cells expressing human CYP2E1 (V79h2E1 cells). Special emphasis was placed on the analytical detection of GA, which was performed by gas chromatography/mass spectrometry. The results show that AA is metabolized to GA in human CYP2E1 supersomes, in marmoset and human liver microsomes as well as in V79h2E1 cells. The activity of GA formation is highest in supersomes; in human liver it is somewhat higher than in marmoset liver. A monoclonal CYP2E1 human selective antibody (MAB-2E1) and diethyldithiocarbamate (DDC) were used as specific inhibitors of CYP2E1. The generation of GA could be inhibited by MAB-2E1 to about 80% in V79h2E1 cells and to about 90% in human and marmoset liver microsomes. Also DDC led to an inhibition of about 95%. In conclusion, AA is metabolized to GA by human CYP2E1. Overall, the present work describes (1) the application and refinement of a sensitive methodology in order to determine low amounts of GA, (2) the applicability of genetically modified V79 cell lines in order to investigate specific questions concerning metabolism and (3) the involvement, for the first time, of human CYP2E1 in the formation of GA from AA. Further studies will compare the activities of GA formation in genetically engineered V79 cells expressing CYP2E1 from different species.

  12. Identification and characterization of multiple conserved nuclear localization signals within adenovirus E1A

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, Kris S.; Cohen, Michael J.; Fonseca, Greg J.; Todorovic, Biljana; King, Cason R. [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Yousef, Ahmed F. [Department of Chemical and Environmental Engineering, Masdar Institute, Abu Dhabi (United Arab Emirates); Zhang, Zhiying [College of Animal Science and Technologies, Northwest A and F University, Yangling, Shaanxi 712100 (China); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Department of Oncology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada)

    2014-04-15

    The human adenovirus 5 (HAdV-5) E1A protein has a well defined canonical nuclear localization signal (NLS) located at its C-terminus. We used a genetic assay in the yeast Saccharomyces cerevisiae to demonstrate that the canonical NLS is present and functional in the E1A proteins of each of the six HAdV species. This assay also detects a previously described non-canonical NLS within conserved region 3 and a novel active NLS within the N-terminal/conserved region 1 portion of HAdV-5 E1A. These activities were also present in the E1A proteins of each of the other five HAdV species. These results demonstrate that, despite substantial differences in primary sequence, HAdV E1A proteins are remarkably consistent in that they contain one canonical and two non-canonical NLSs. By utilizing independent mechanisms, these multiple NLSs ensure nuclear localization of E1A in the infected cell. - Highlights: • HAdV E1A uses multiple mechanisms for nuclear import. • We identified an additional non-canonical NLS in the N-terminal/CR1 portion of E1A. • The new NLS does not contact importin-alpha directly. • All NLSs are functionally conserved in the E1A proteins of all 6 HAdV species.

  13. Human CYP2E1 mediates the formation of glycidamide from acrylamide

    Energy Technology Data Exchange (ETDEWEB)

    Settels, Eva; Appel, Klaus E. [Federal Institute for Risk Assessment, Center for Experimental Toxicology, Berlin (Germany); Bernauer, Ulrike; Gundert-Remy, Ursula [Federal Institute for Risk Assessment, Department of Safety of Substances and Preparations, Berlin (Germany); Palavinskas, Richard; Klaffke, Horst S. [Federal Institute for Risk Assessment, Center for Analytical Chemistry, Berlin (Germany)

    2008-10-15

    Regarding the cancer risk assessment of acrylamide (AA) it is of basic interest to know, as to what amount of the absorbed AA is metabolized to glycidamide (GA) in humans, compared to what has been observed in laboratory animals. GA is suspected of being the ultimate carcinogenic metabolite of AA. From experiments with CYP2E1-deficient mice it can be concluded that AA is metabolized to GA primarily by CYP2E1. We therefore examined whether CYP2E1 is involved in GA formation in non-rodent species with the focus on humans by using human CYP2E1 supersomes trademark, marmoset and human liver microsomes and in addition, genetically engineered V79 cells expressing human CYP2E1 (V79h2E1 cells). Special emphasis was placed on the analytical detection of GA, which was performed by gas chromatography/mass spectrometry. The results show that AA is metabolized to GA in human CYP2E1 supersomes trademark, in marmoset and human liver microsomes as well as in V79h2E1 cells. The activity of GA formation is highest in supersomes trademark; in human liver it is somewhat higher than in marmoset liver. A monoclonal CYP2E1 human selective antibody (MAB-2E1) and diethyldithiocarbamate (DDC) were used as specific inhibitors of CYP2E1. The generation of GA could be inhibited by MAB-2E1 to about 80% in V79h2E1 cells and to about 90% in human and marmoset liver microsomes. Also DDC led to an inhibition of about 95%. In conclusion, AA is metabolized to GA by human CYP2E1. Overall, the present work describes (1) the application and refinement of a sensitive methodology in order to determine low amounts of GA, (2) the applicability of genetically modified V79 cell lines in order to investigate specific questions concerning metabolism and (3) the involvement, for the first time, of human CYP2E1 in the formation of GA from AA. Further studies will compare the activities of GA formation in genetically engineered V79 cells expressing CYP2E1 from different species. (orig.)

  14. Methodology to assay CYP2E1 mixed function oxidase catalytic activity and its induction

    Directory of Open Access Journals (Sweden)

    Arthur I. Cederbaum

    2014-01-01

    Full Text Available The cytochrome P450 mixed function oxidase enzymes are the major catalysts involved in drug metabolism. There are many forms of P450. CYP2E1 metabolizes many toxicologically important compounds including ethanol and is active in generating reactive oxygen species. Since several of the contributions in the common theme series “Role of CYP2E1 and Oxidative/Nitrosative Stress in the Hepatotoxic Actions of Alcohol” discuss CYP2E1, this methodology review describes assays on how CYP2E1 catalytic activity and its induction by ethanol and other inducers can be measured using substrate probes such as the oxidation of para-nitrophenol to para-nitrocatechol and the oxidation of ethanol to acetaldehyde. Approaches to validate that a particular reaction e.g. oxidation of a drug or toxin is catalyzed by CYP2E1 or that induction of that reaction is due to induction of CYP2E1 are important and specific examples using inhibitors of CYP2E1, anti-CYP2E1 IgG or CYP2E1 knockout and knockin mice will be discussed.

  15. Impact of sea-level rise in a Mediteranean delta: The Ebro delta cast

    NARCIS (Netherlands)

    Sánchez-Arcilla, A.; Stive, M.D.F.; Jiménez, J.A.; García, M.A.

    1993-01-01

    In anticipation of a comprehensive, multidisciplinary study on the impact of climatic change on the Ebro Delta preliminary results are here presented of the response of the outer delta coast to present and future relative sea-level rise. Due to the absence of observations and predictions of regional

  16. Final State Interactions and Delta S=-1, Delta C=\\pm 1 B--decays

    CERN Document Server

    Fayyazuddin, A

    2002-01-01

    The final state interactions (FSI) in Delta S=-1, Delta C=\\pm 1, decays of B-meson are discussed. The rescattering corrections are found to be of order of 15-20%. The strong interaction phase shifts are estimated and their effects on CP-asymmetry are discussed.

  17. A model for the Delta(1600) resonance and gamma N -> Delta(1600) transition

    CERN Document Server

    Ramalho, G

    2010-01-01

    A covariant spectator constituent quark model is applied to study the gamma N -> Delta(1600) transition. Two processes are important in the transition: a photon couples to the individual quarks of the Delta(1600) core (quark core), and a photon couples to the intermediate pion-baryon states (pion cloud). While the quark core contributions are estimated assuming Delta(1600) as the first radial excitation of Delta(1232), the pion cloud contributions are estimated based on an analogy with the gamma N -> Delta(1232) transition. To estimate the pion cloud contributions in the gamma N -> Delta(1600) transition, we include the relevant intermediate states, pi-N, pi-Delta, pi-N(1440) and pi-Delta(1600). Dependence on the four-momentum transfer squared, Q2, is predicted for the magnetic dipole transition form factor, GM*(Q2), as well as the helicity amplitudes, A_1/2(Q2) and A_3/2(Q2). The results at Q2=0 are compared with the existing data.

  18. A model for the Delta(1600) resonance and gamma N -> Delta(1600) transition

    Energy Technology Data Exchange (ETDEWEB)

    G. Ramalho, K. Tsushima

    2010-10-01

    A covariant spectator constituent quark model is applied to study the gamma N -> Delta(1600) transition. Two processes are important in the transition: a photon couples to the individual quarks of the Delta(1600) core (quark core), and a photon couples to the intermediate pion-baryon states (pion cloud). While the quark core contributions are estimated assuming Delta(1600) as the first radial excitation of Delta(1232), the pion cloud contributions are estimated based on an analogy with the gamma N -> Delta(1232) transition. To estimate the pion cloud contributions in the gamma N -> Delta(1600) transition, we include the relevant intermediate states, pi-N, pi-Delta, pi-N(1440) and pi-Delta(1600). Dependence on the four-momentum transfer squared, Q2, is predicted for the magnetic dipole transition form factor, GM*(Q2), as well as the helicity amplitudes, A_1/2(Q2) and A_3/2(Q2). The results at Q2=0 are compared with the existing data.

  19. Impact of sea-level rise in a Mediteranean delta: The Ebro delta cast

    NARCIS (Netherlands)

    Sánchez-Arcilla, A.; Stive, M.D.F.; Jiménez, J.A.; García, M.A.

    1993-01-01

    In anticipation of a comprehensive, multidisciplinary study on the impact of climatic change on the Ebro Delta preliminary results are here presented of the response of the outer delta coast to present and future relative sea-level rise. Due to the absence of observations and predictions of regional

  20. The Enabling Delta Life Initiative - Global Programme of Action on Deltas - Programme description

    NARCIS (Netherlands)

    Driel, van W.F.; Skyllerstedt, S.; Wosten, J.H.M.

    2014-01-01

    Being ‘hotspots’ of human activity with generally high population densities, deltas are vulnerable to changes induced by a range of driving forces, both natural and anthropogenic. In addition to already existing challenges, uncertainty of the possible impacts of climate change, low lying deltas arou

  1. Houtman Abrolhos Isotope (delta 18O, delta 13C) Data for 1795 to 1994

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — DESCRIPTION: VARIABLES AND UNITS: Column #1: core depth in mm Column #2: delta C-13 vs V-PDB Column #3: delta O-18 vs V-PDB Column #4: assigned date in years A.D....

  2. \\Delta Y/ \\Delta Z from the analysis of local K dwarfs

    CERN Document Server

    Gennaro, Mario; Degl'Innocenti, Scilla

    2010-01-01

    The stellar helium-to-metal enrichment ratio, \\Delta Y/\\Delta Z, is a widely studied astrophysical quantity. However, its value is still not precisely constrained. This paper is focused on the study of the main sources of uncertainty which affect the \\Delta Y/\\Delta Z derived from the analysis of the low-main sequence (MS) stars in the solar neighborhood. The possibility to infer the value of \\Delta Y/\\Delta Z from the study of low-MS stars relies on the dependence of the stellar luminosity and effective temperature on the initial Y and Z. The \\Delta Y/\\Delta Z ratio is obtained by comparing the magnitude difference between the observed stars and a reference theoretical zero age main sequence (ZAMS) with the related theoretical magnitude differences computed from a new set of stellar models with up-to-date input physics and a fine grid of chemical compositions. A Monte Carlo approach has been used to evaluate the impact on the result of different sources of uncertainty, i.e. observational errors, evolutionary...

  3. Holocene delta plain development in the Song Hong (Red River) delta, Vietnam

    Science.gov (United States)

    Funabiki, Ayako; Haruyama, Shigeko; Quy, Nguyen Van; Hai, Pham Van; Thai, Dinh Hung

    2007-05-01

    Holocene delta plain development was investigated based on three sediment cores analyzed in detail from the Song Hong (Red River) delta plain in Vietnam. Two cores (DA and PD) from the western delta plain showed both the landward limit of the transgressive estuarine system in the valley incised during the last glacial maximum and floodplain evolution since the middle Holocene. On the other hand, a core (TL) from the eastern delta plain revealed a Pleistocene terrace buried under the deltaic sediments and a slow accumulation rate compared with that in the west. At 8 cal ky BP, the shoreline migrated very close to the present Hanoi city area, and the sedimentary environment changed to tidal flat or salt marsh. Hanoi city marks the northern limit of shoreline transgression. The mangrove swamp expanded from 8 to 5 cal ky BP to the landward limit of the delta plain. Subsequently, the shoreline migrated seaward as a result of delta progradation and sea-level lowering. From 5 cal ky BP, the emerged area evolved into a floodplain and natural levees formed along the abandoned river channels on the western delta plain, but at 2 cal ky, archeological sites indicate that the Holocene terrace in the eastern delta plain was still inundated.

  4. Microarray-based analysis and clinical validation identify ubiquitin-conjugating enzyme E2E1 (UBE2E1 as a prognostic factor in acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Hongmei Luo

    2016-11-01

    Full Text Available Abstract Background Previous research suggested that single gene expression might be correlated with acute myeloid leukemia (AML survival. Therefore, we conducted a systematical analysis for AML prognostic gene expressions. Methods We performed a microarray-based analysis for correlations between gene expression and adult AML overall survival (OS using datasets GSE12417 and GSE8970. Positive findings were validated in an independent cohort of 50 newly diagnosed, non-acute promyelocytic leukemia (APL AML patients by quantitative RT-PCR and survival analysis. Results Microarray-based analysis suggested that expression of eight genes was each associated with 1-year and 3-year AML OS in both GSE12417 and GSE8970 datasets (p < 0.05. Next, we validated our findings in an independent cohort of AML samples collected in our hospital. We found that ubiquitin-conjugating enzyme E2E1 (UBE2E1 expression was adversely correlated with AML survival (p = 0.04. Multivariable analysis showed that UBE2E1 high patients had a significant shorter OS and shorter progression-free survival after adjusting other known prognostic factors (p = 0.03. At last, we found that UBE2E1 expression was negatively correlated with patients’ response to induction chemotherapy (p < 0.05. Conclusions In summary, we demonstrated that UBE2E1 expression was a novel prognostic factor in adult, non-APL AML patients.

  5. MODIFICATION OF DELTA FOR CHOOSER OPTIONS

    Directory of Open Access Journals (Sweden)

    Marek Ďurica

    2015-09-01

    Full Text Available Correctly used financial derivatives can help investors increase their expected returns and minimize their exposure to risk. To ensure the specific needs of investors, a large number of different types of non-standard exotic options is used. Chooser option is one of them. It is an option that gives its holder the right to choose at some predetermined future time whether the option will be a standard call or put with predetermined strike price and maturity time. Although the chooser options are more expensive than standard European-style options, in many cases they are a more suitable instrument for investors in hedging their portfolio value. For an effective use of the chooser option as a hedging instrument, it is necessary to check the values of the Greek parameters delta and gamma for the options. Especially, if the value of the parameter gamma is too large, hedging of the portfolio value using only parameter delta is insufficient and brings high transaction costs because the portfolio has to be reviewed relatively often. Therefore, in this article, a modification of delta-hedging as well as using the value of parameter gamma is suggested. Error of the delta modification is analyzed and compared with the error of widely used parameter delta. Typical patterns for the modified hedging parameter variation with various time to choose time for chooser options are also presented in this article.

  6. Notched delta, phenotype, and Angelman syndrome.

    Science.gov (United States)

    Korff, Christian M; Kelley, Kent R; Nordli, Douglas R

    2005-08-01

    The notched delta pattern is one of the characteristic EEG features found in Angelman syndrome patients. The purpose of this study was to evaluate the possibility of using the notched delta pattern as a detection tool for Angelman syndrome patients by analyzing its frequency in a tertiary care pediatric center, its specificity for Angelman syndrome, and the age at which it was observed. The authors performed a retrospective review of the video-EEG recordings of all the patients who had either the notched delta pattern or a phenotype consistent with Angelman syndrome. The notched delta was observed in 1.1% of all the EEGs performed. Its specificity for Angelman syndrome was evaluated at 38%. The youngest age at which it was noted was 14 months. The results indicate that the notched delta pattern is relatively rare, but more frequent than expected, and is easily recognizable. The pattern was observed not only in Angelman syndrome patients, but also in children with a spectrum of conditions wider than reported. It is a powerful detection tool for Angelman syndrome when correlated to a suggestive phenotype, and the association of these features should raise suspicion for Angelman syndrome in both infants and adults.

  7. Tracking Nile Delta vulnerability to Holocene change.

    Directory of Open Access Journals (Sweden)

    Nick Marriner

    Full Text Available Understanding deltaic resilience in the face of Holocene climate change and human impacts is an important challenge for the earth sciences in characterizing the full range of present and future wetland responses to global warming. Here, we report an 8000-year mass balance record from the Nile Delta to reconstruct when and how this sedimentary basin has responded to past hydrological shifts. In a global Holocene context, the long-term decrease in Nile Delta accretion rates is consistent with insolation-driven changes in the 'monsoon pacemaker', attested throughout the mid-latitude tropics. Following the early to mid-Holocene growth of the Nile's deltaic plain, sediment losses and pronounced erosion are first recorded after ~4000 years ago, the corollaries of falling sediment supply and an intensification of anthropogenic impacts from the Pharaonic period onwards. Against the backcloth of the Saharan 'depeopling', reduced river flow underpinned by a weakening of monsoonal precipitation appears to have been particularly conducive to the expansion of human activities on the delta by exposing productive floodplain lands for occupation and irrigation agriculture. The reconstruction suggests that the Nile Delta has a particularly long history of vulnerability to extreme events (e.g. floods and storms and sea-level rise, although the present sediment-starved system does not have a direct Holocene analogue. This study highlights the importance of the world's deltas as sensitive archives to investigate Holocene geosystem responses to climate change, risks and hazards, and societal interaction.

  8. QCD in the {delta}-regime

    Energy Technology Data Exchange (ETDEWEB)

    Bietenholz, W. [Universidad Nacional Autonoma de Mexico, Mexico City (Mexico). Inst. de Ciencias Nucleares; Cundy, N. [Seoul National Univ. (Korea, Republic of). Lattice Gauge Theory Research Center; Goeckeler, M. [Regensburg Univ. (Germany). Inst. fuer Theoretische Physik; Horsley, R.; Zanotti, J.M. [Edinburgh Univ. (United Kingdom). School of Physics; Nakamura, Y. [Tsukuba Univ., Ibaraki (Japan). Center for Computational Sciences; Pleiter, D. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Rakow, P.E.L. [Liverpool Univ. (United Kingdom). Theoretical Physics Div.; Schierholz, G. [Regensburg Univ. (Germany). Inst. fuer Theoretische Physik; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2011-03-15

    The {delta}-regime of QCD is characterised by light quarks in a small spatial box, but a large extent in (Euclidean) time. In this setting a specific variant of chiral perturbation theory - the {delta}-expansion - applies, based on a quantum mechanical treatment of the quasi onedimensional system. In particular, for vanishing quark masses one obtains a residual pion mass M{sup R}{sub {pi}}, which has been computed to the third order in the {delta}-expansion. A comparison with numerical measurements of this residual mass allows for a new determination of some Low Energy Constants, which appear in the chiral Lagrangian. We first review the attempts to simulate 2-flavour QCD directly in the {delta}-regime. This is very tedious, but results compatible with the predictions for M{sup R}{sub {pi}} have been obtained. Then we show that an extrapolation of pion masses measured in a larger volume towards the {delta}-regime leads to good agreement with the theoretical predictions. From those results, we also extract a value for the (controversial) sub-leading Low Energy Constant anti l{sub 3}. (orig.)

  9. Reduction of benzene metabolism and toxicity in mice that lack CYP2E1 expression.

    Science.gov (United States)

    Valentine, J L; Lee, S S; Seaton, M J; Asgharian, B; Farris, G; Corton, J C; Gonzalez, F J; Medinsky, M A

    1996-11-01

    Transgenic CYP2E1 knockout mice (cyp2e1-/-) were used to investigate the involvement of CYP2E1 in the in vivo metabolism of benzene and in the development of benzene-induced toxicity. After benzene exposure, absence of CYP2E1 protein was confirmed by Western blot analysis of mouse liver samples. For the metabolism studies, male cyp2e1-/- and wild-type control mice were exposed to 200 ppm benzene, along with a radiolabeled tracer dose of [14C]benzene (1.0 Ci/mol) by nose-only inhalation for 6 hr. Total urinary radioactivity and all radiolabeled individual metabolites were reduced in urine of cyp2e1-/- mice compared to wild-type controls during the 48-hr period after benzene exposure. In addition, a significantly greater percentage of total urinary radioactivity could be accounted for as phenylsulfate conjugates in cyp2e1-/- mice compared to wild-type mice, indicating the importance of CYP2E1 in oxidation of phenol following benzene exposure in normal mice. For the toxicity studies, male cyp2e1-/-, wild-type, and B6C3F1 mice were exposed by whole-body inhalation to 0 ppm (control) or 200 ppm benzene, 6 hr/day for 5 days. On Day 5, blood, bone marrow, thymus, and spleen were removed for evaluation of micronuclei frequencies and tissue cellularities. No benzene-induced cytotoxicity or genotoxicity was observed in cyp2e1-/- mice. In contrast, benzene exposure resulted in severe genotoxicity and cytotoxicity in both wild-type and B6C3F1 mice. These studies conclusively demonstrate that CYP2E1 is the major determinant of in vivo benzene metabolism and benzene-induced myelotoxicity in mice.

  10. Characteristics and Soft-Demodulation of Galileo E1 Signal%Galileo E1信号特征及其软件解调

    Institute of Scientific and Technical Information of China (English)

    易翔

    2009-01-01

    Galileo E1民用信号采用新的BOC(1,1)扩频调制方式.针对E1信号进行信号建模,并对其信号特征进行了详细研究,最后设计了Galileo软件解调器中的信号处理模块.通过仿真验证表明,软件解调器成功实现了对Galileo E1信号的捕获、跟踪、解扩、解调全过程处理,克服了BOC解调的错锁问题.

  11. Interactions among mu- and delta-opioid receptors, especially putative delta1- and delta2-opioid receptors, promote dopamine release in the nucleus accumbens.

    NARCIS (Netherlands)

    Hirose, N.; Murakawa, K.; Takada, K.; Oi, Y.; Suzuki, T.; Nagase, H.; Cools, A.R.; Koshikawa, N.

    2005-01-01

    The effect of interactions among mu- and delta-opioid receptors, especially the putative delta(1)- and delta(2)-opioid receptors, in the nucleus accumbens on accumbal dopamine release was investigated in awake rats by in vivo brain microdialysis. In agreement with previous studies, perfusion of the

  12. Hydraulic engineering in the social-ecological delta: understanding the interplay between social, ecological, and technological systems in the Dutch delta by means of “delta trajectories”

    NARCIS (Netherlands)

    Staveren, van M.F.; Tatenhove, van J.P.M.

    2016-01-01

    Several of the world's largest deltas have recently been conceptualized as social-ecological delta systems. Although such conceptualizations are valuable in emphasizing complex interaction between social actors and ecological processes in deltas, they do not go into specific dynamics that surround t

  13. Interactions among mu- and delta-opioid receptors, especially putative delta1- and delta2-opioid receptors, promote dopamine release in the nucleus accumbens.

    NARCIS (Netherlands)

    Hirose, N.; Murakawa, K.; Takada, K.; Oi, Y.; Suzuki, T.; Nagase, H.; Cools, A.R.; Koshikawa, N.

    2005-01-01

    The effect of interactions among mu- and delta-opioid receptors, especially the putative delta(1)- and delta(2)-opioid receptors, in the nucleus accumbens on accumbal dopamine release was investigated in awake rats by in vivo brain microdialysis. In agreement with previous studies, perfusion of the

  14. El plan del delta - Holanda

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1963-09-01

    Full Text Available Holland is very poor in land resources. Hence its development has been directed towards intensive industrialization and maximum agricultural exploitation. The western part of the country is below sea level and is occupied by 65 percent of the population. Originally the coast consisted of a number of islands, estuaries and slight elevations. Man has transformed this coastline, first making a number of artificial lakes, or polders, and then converting these into fertile districts. These projects protect the soil by means of dykes, which require careful conservation, but even so violent floods are not infrequent. One of the difficult problems involved in this vast enterprise is the complex system of water supply, lines of communication and flow of the rivers into the sea along the estuary zone. This zone is on the south west, and to protect it a National Commission has been set up. After careful study, it was decided that the best defense against the violence of the sea would consist in closing off the inroads of the sea into the continental coastline. The set of hydraulic projects which constitutes this plan for the improvement of the sea defences will take 25 years to fulfil. The general project is highly ambitious and includes both maritime, road and structural works, in which there is a variety of stonework constructions. This paper describes, in brief outline, the main contents of the 11 headings into which the general construction project has been subdivided. In addition, this is supplemented with information on the projects which are already initiated and on the constructional procedure that is being adopted. Of these latter projects, the Nabla bridge is of particular interest. It is situated on the delta. It is made in prestressed concrete, and consists of 17 spans, of 60 length each. This enormous structure, in addition to its great length, and supporting a 22.8 ms wide roadway, is subjected to the tremendous forces 11» of the sea on one

  15. 26 CFR 1.669(e)-1A - Pro rata portion of taxes deemed distributed.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Pro rata portion of taxes deemed distributed. 1.669(e)-1A Section 1.669(e)-1A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning Before January...

  16. Expression of cytochrome P4502E1 gene in hepatocellular carcinoma

    Institute of Scientific and Technical Information of China (English)

    Xiao-Bo Man; Liang Tang; Xiu-Hua Qiu; Li-Qun Yang; Hui-Fang Cao; Meng-Chao Wu; Hong-Yang Wang

    2004-01-01

    AIM: To investigate cytpchrome P4502E1 ( CYP2E1) gene expression in occurrence and progression of hepatocellular carcinoma (HCC).METHODS: The human liver arrayed library was spotted onto the nylon membranes to make cDNA array. Hybridization of cDNA array was performed with labeled probes synthesized from RNA isolated from HCC and adjacent liver tissues.Sprague-Dawley rats were administrated diethylnitrosamine (DENA) to induce HCC. CYP2E1 expression was detected by the method of RT-PCR and Northern blot analysis.RESULTS: CYP2E1 was found by cDNA array hybridization to express differently between HCC and liver tissues. CYP2E1only expressed in liver, but did not express in HCC tissues and expressed lowly in cirrhotic tissues. In the progression of cirrhosis and HCC, the expression level of CYP2E1 was gradually decreased and hardly detected until the late stage of HCC.CONCLUSION: Using arrayed library to make cDNA arrays is an effective method to find differential expression genes.CYP2E1 is a unique gene expressing in liver but did not express in HCC. CYP2E1 expression descended along with the initiation and progression of HCC, which is noteworthy further investigations in its significance in the development of HCC.

  17. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen

    NARCIS (Netherlands)

    A. van Rongen (Anne); P.A.J. Välitalo (Pyry A. J.); M.Y. Peeters (Mariska); D. Boerma (Djamila); F.W. Huisman (Fokko W.); B. van Ramshorst (Bert); E.H.P.A. van Dongen (Eric); J.N. van den Anker (John); C.A.J. Knibbe (Catherijne)

    2016-01-01

    textabstractIntroduction: Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially worsenin

  18. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen.

    NARCIS (Netherlands)

    Rongen, van A.; Välitalo, P.A.J.; Peeters, M.Y.; Boerma, D.; Huisman, F.W.; Ramshorst, van B.; Dongen, van E.P.; Anker, van den J.N.; Knibbe, C.A.J.

    2016-01-01

    INTRODUCTION Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially worsening the safety

  19. CK2 phosphorylation inactivates DNA binding by the papillomavirus E1 and E2 proteins.

    Science.gov (United States)

    Schuck, Stephen; Ruse, Cristian; Stenlund, Arne

    2013-07-01

    Papillomaviruses have complex life cycles that are understood only superficially. Although it is well established that the viral E1 and E2 proteins play key roles in controlling viral transcription and DNA replication, how these factors are regulated is not well understood. Here, we demonstrate that phosphorylation by the protein kinase CK2 controls the biochemical activities of the bovine papillomavirus E1 and E2 proteins by modifying their DNA binding activity. Phosphorylation at multiple sites in the N-terminal domain in E1 results in the loss of sequence-specific DNA binding activity, a feature that is also conserved in human papillomavirus (HPV) E1 proteins. The bovine papillomavirus (BPV) E2 protein, when phosphorylated by CK2 on two specific sites in the hinge, also loses its site-specific DNA binding activity. Mutation of these sites in E2 results in greatly increased levels of latent viral DNA replication, indicating that CK2 phosphorylation of E2 is a negative regulator of viral DNA replication during latent viral replication. In contrast, mutation of the N-terminal phosphorylation sites in E1 has no effect on latent viral DNA replication. We propose that the phosphorylation of the N terminus of E1 plays a role only in vegetative viral DNA replication, and consistent with such a role, caspase 3 cleavage of E1, which has been shown to be necessary for vegetative viral DNA replication, restores the DNA binding activity to phosphorylated E1.

  20. 26 CFR 1.665(e)-1A - Preceding taxable year.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Preceding taxable year. 1.665(e)-1A Section 1... (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning on Or After January 1, 1969 § 1.665(e)-1A Preceding taxable year. (a) Definition—(1) Domestic trusts—(i...

  1. 26 CFR 31.3121(e)-1 - State, United States, and citizen.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false State, United States, and citizen. 31.3121(e)-1... § 31.3121(e)-1 State, United States, and citizen. (a) When used in the regulations in this subpart, the... is used in a geographical sense. The term “citizen of the United States” includes a citizen of the...

  2. NATO-3C/Delta launch

    Science.gov (United States)

    1978-01-01

    NATO-3C, the third in a series of NATO defense-related communication satellites, is scheduled to be launched on a delta vehicle from the Eastern Test Range no earlier than November 15, 1978. NATO-3A and -3B were successfully launched by Delta vehicles in April 1976 and January 1977, respectively. The NATO-3C spacecraft will be capable of transmitting voice, data, facsimile, and telex messages among military ground stations. The launch vehicle for the NATO-3C mission will be the Delta 2914 configuration. The launch vehicle is to place the spacecraft in a synchronous transfer orbit. The spacecraft Apogee Kick motor is to be fired at fifth transfer orbit apogee to circularize its orbit at geosynchronous altitude of 35,900 km(22,260 miles) above the equator over the Atlantic Ocean somewhere between 45 and 50 degrees W longitude.

  3. New Protein Vector ApE1 for Targeted Delivery of Anticancer Drugs

    Directory of Open Access Journals (Sweden)

    N. V. Pozdniakova

    2012-01-01

    Full Text Available A new chimeric gene ApE1 encoding the receptor-binding domain of the human alpha-fetoprotein fused to a sequence of 22 glutamic acid residues was constructed. A new bacterial producer strain E. coli SHExT7 ApE1 was selected for ApE1 production in a soluble state. A simplified method was developed to purify ApE1 from bacterial biomass. It was shown that the new vector protein selectively interacts with AFP receptors on the tumor cell surface and can be efficiently accumulated in tumor cells. In addition, ApE1 was shown to be stable in storage and during its chemical modification. An increased number of carboxyl groups in the molecule allows the production of cytotoxic compound conjugates with higher drug-loading capacity and enhanced tumor targeting potential.

  4. Liquefaction potential of Nile delta, Egypt

    Science.gov (United States)

    Fergany, Elsayed; Omar, Khaled

    2017-06-01

    Understanding how sedimentary basins respond to seismic-wave energy generated by earthquake events is a significant concern for seismic-hazard estimation and risk analysis. The main goal of this study is assessing the vulnerability index, Kg, as an indicator for liquefaction potential sites in the Nile delta basin based on the microtremor measurements. Horizontal to Vertical spectral ratio analyses (HVSR) of ambient noise data, which was conducted in 2006 at 120 sites covering the Nile delta from south to north were reprocessed using Geopsy software. HVSR factors of amplification, A, and fundamental frequency, F, were calculated and Kg was estimated for each measurement. The Kg value varies widely from south toward north delta and the potential liquefaction places were estimated. The higher vulnerability indices are associated with sites located in southern part of the Nile delta and close to the branches of Nile River. The HVSR factors were correlated with geologic setting of the Nile delta and show good correlations with the sediment thickness and subsurface stratigraphic boundaries. However, we note that sites located in areas that have greatest percentage of sand also yielded relatively high Kg values with respect to sites in areas where clay is abundant. We concluded that any earthquake with ground acceleration more than 50 gal at hard rock can cause a perceived deformation of sandy sediments and liquefaction can take place in the weak zones of Kg ≥ 20. The worst potential liquefaction zones (Kg > 30) are frequently joined to the Damietta and Rosetta Nile River branches and south Delta where relatively coarser sand exists. The HVSR technique is a very sensitive tool for lithological stratigraphy variations in two dimensions and varying liquefaction susceptibility.

  5. All optical binary delta-sigma modulator

    Science.gov (United States)

    Sayeh, Mohammad R.; Siahmakoun, Azad

    2005-09-01

    This paper describes a novel A/D converter called "Binary Delta-Sigma Modulator" (BDSM) which operates only with nonnegative signal with positive feedback and binary threshold. This important modification to the conventional delta-sigma modulator makes the high-speed (>100GHz) all-optical implementation possible. It has also the capability to modify its own sampling frequency as well as its input dynamic range. This adaptive feature helps designers to optimize the system performance under highly noisy environment and also manage the power consumption of the A/D converters.

  6. Measurement of the Muon Decay Parameter delta

    CERN Document Server

    Gaponenko, A N; Davydov, Yu I; Depommier, P; Doornbos, J; Faszer, W; Fujiwara, M C; Gagliardi, C A; Gill, D R; Green, P; Gumplinger, P; Hasinoff, M D; Henderson, R S; Hu, J; Jamieson, B; Kitching, P; Koetke, D D; Krushinsky, A A; Lachin, Yu Yu; MacDonald, J A; MacDonald, R P; Marshall, G M; Mathie, E L; Miasoedov, L V; Mischke, R E; Musser, J R; Nord, P M; Nozar, M; Olchanski, K; Olin, A; Openshaw, R; Porcelli, T A; Poutissou, J M; Poutissou, R; Quraan, M A; Rodning, N L; Selivanov, V; Sheffer, G; Shin, B; Sobratee, F; Stanislaus, T D S; Tacik, R; Torokhov, V D; Tribble, R E; Vasilev, M A; Wright, D H

    2004-01-01

    The muon decay parameter delta has been measured by the TWIST collaboration. We find delta = 0.74964 +- 0.00066(stat.) +- 0.00112(syst.), consistent with the Standard Model value of 3/4. This result implies that the product Pmuxi of the muon polarization in pion decay, Pmu, and the muon decay parameter xi falls within the 90% confidence interval 0.9960 < Pmuxi < xi < 1.0040. It also has implications for left-right-symmetric and other extensions of the Standard Model.

  7. Flood Inundation Modelling in Data Sparse Deltas

    Science.gov (United States)

    Hawker, Laurence; Bates, Paul; Neal, Jeffrey

    2017-04-01

    An estimated 7% of global population currently live in deltas, and this number is increasing over time. This has resulted in numerous human induced impacts on deltas ranging from subsidence, upstream sediment trapping and coastal erosion amongst others. These threats have already impacted on flood dynamics in deltas and could intensify in line with human activities. However, the myriad of threats creates a large number of potential scenarios that need to be evaluated. Therefore, to assess the impacts of these scenarios, a pre-requisite is a flood inundation model that is both computationally efficient and flexible in its setup so it can be applied in data-sparse settings. An intermediate scale, which compromises between the computational speed of a global model and the detail of a case specific bespoke model, was chosen to achieve this. To this end, we have developed an intermediate scale flood inundation model at a resolution of 540m of the Mekong Delta, built with freely available data, using the LISFLOOD-FP hydrodynamic model. The purpose of this is to answer the following questions: 1) How much detail is required to accurately simulate flooding in the Mekong Delta? , 2) What characteristics of deltas are most important to include in flood inundation models? Models were run using a vegetation removed SRTM DEM and a hind-casting of tidal heights as a downstream boundary. Results indicate the importance of vegetation removal in the DEM for inundation extent and the sensitivity of water level to roughness coefficients. The propagation of the tidal signal was found to be sensitive to bathymetry, both within the river channel and offshore, yet data availability for this is poor, meaning the modeller has to be careful in his or her choice of bathymetry interpolation Supplementing global river channel data with more localised data demonstrated minor improvements in results suggesting detailed channel information is not always needed to produce good results. It is

  8. DNA polymerase III accessory proteins. I. holA and holB encoding delta and delta'.

    Science.gov (United States)

    Dong, Z; Onrust, R; Skangalis, M; O'Donnell, M

    1993-06-05

    The genes encoding the delta and delta' subunits of the 10-subunit Escherichia coli replicase, DNA polymerase III holoenzyme, have been identified and sequenced. The holA gene encoding delta is located downstream of rlpB at 15.2 min and predicts a 38.7 kda protein. The holB gene encoding delta' is located at 24.3 min and predicts a 36.9-kDa protein. Hence the delta and delta' subunits are unrelated proteins encoded by separate genes. The genes have been used to express and purify delta and delta' in quantity. The predicted amino acid sequence of delta' is homologous to the sequences of the tau and gamma subunits revealing a large amount of structural redundancy within the holoenzyme.

  9. Measurement of the N to Delta(1232) Transition at High Momentum Transfer by pi0 Electroproduction

    CERN Document Server

    Ungaro, M; Aznauryan, I; Burkert, V D; Joo, K; Smith, L C; Adams, G; Amarian, M; Ambrozewicz, P; Anghinolfi, M; Asryan, G; Audit, G; Avakian, H; Bagdasaryan, H; Ball, J P; Baltzell, N A; Barrow, S; Batourine, V; Battaglieri, M; Bedliski, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Biselli, A S; Bonner, B E; Bouchigny, S; Boiarinov, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Bültmann, S; Butuceanu, C; Calarco, J R; Careccia, S L; Carman, D S; Cazes, A; Chen, S; Cole, P L; Coltharp, P; Cords, D; Corvisiero, P; Crabb, D; Cummings, J P; De Sanctis, E; De Vita, R; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Djalali, C; Dodge, G E; Donnelly, J; Doughty, D; Dugger, M; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; Elouadrhiri, L; Eugenio, P; Fatemi, R; Fedotov, G; Feldman, G; Feuerbach, R J; Funsten, H; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J; Gordon, C I O; Gothe, R W; Griffioen, K A; Guidal, M; Guillo, M; Guler, N; Guo, L; Gyurjyan, V; Hadjidakis, C; Hakobyan, R S; Hardie, J; Heddle, D; Hersman, F W; Hleiqawi, I; Holtrop, M; Hicks, K; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Ito, M M; Jenkins, D; Jo, H S; Jüngst, H G; Kellie, J D; Khandaker, M; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Kossov, M; Kramer, L H; Kubarovski, V; Kühn, J; Kuhn, S E; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Lee, T; Ji Li; Livingston, K; Marchand, C; Markov, N; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mehrabyan, S S; Melone, J J; Mestayer, M D; Meyer, C A; Mikhailov, K; Minehart, R C; Mirazita, M; Miskimen, R; Mokeev, V; Morand, L; Morrow, S A; Müller, J; Mutchler, G S; Napolitano, J; Nasseripour, R; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niroula, M; Niyazov, R A; Nozar, M; O'Rielly, G V; Osipenko, M; Ostrovidov, A I; Park, K; Pasyuk, E; Philips, S A; Pivnyuk, N; Pocanic, D; Pogorelko, O I; Polli, E; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rosner, G; Rossi, P; Rubin, P D; Sabatie, F; Salgado, C; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Sharabyan, Yu G; Skabelin, A V; Smith, E S; Sober, D I; Stavinsky, A V; Stepanyan, S S; Stepanyan, S; Stokes, B E; Strakovsky, I I; Strauch, S; Taiuti, M; Tedeschi, D J; Thoma, U; Tkabladze, A; Todor, L; Tkachenko, S I; Tur, C; Vineyard, M F; Vlassov, A V; Weinstein, L B; Weygand, D P; Williams, M; Wolin, E; Wood, M H; Yegneswaran, A; Zana, L; Zhang, B; Zhang, J; Zhao, B

    2006-01-01

    We report a new measurement of the exclusive electroproduction reaction gamma* p -> pi0 p to explore the evolution from soft non-perturbative physics to hard processes via the Q2 dependence of the magnetic (M1+), electric (E1+) and scalar (S1+) multipoles in the N to Delta transition. 9000 differential cross section data points cover W from threshold to 1.4 eV/c2, 4pi center-of-mass solid angle, and Q2 from 3 to 6 GeV2/c2, the highest yet achieved. It is found that the magnetic form factor G*M decreases with Q2 more steeply than the proton magnetic form factor, the ratio E1+/M1+ is small and negative, indicating strong helicity non-conservation, and the ratio S1+/M1+ is negative, while its magnitude increases with Q2.

  10. Measurement of the N --> Delta^+ (1232) Transition at High-Momentum Transfer by pi^0 Electroproduction

    Energy Technology Data Exchange (ETDEWEB)

    M. Ungaro; P. Stoler; I. Aznauryan; V. D. Burkert; K. Joo; L. C. Smith; G. Adams; M. Amarian; P. Ambrozewicz; M. Anghinolfi; G. Asryan; G. Audit; H. Avakian; H. Bagdasaryan; J. P. Ball; N. A. Baltzell; S. Barrow; V. Batourine; M. Battaglieri; I. Bedliski; M. Bektasoglu; M. Bellis; N. Benmouna; B. L. Berman; A. S. Biselli; B. E. Bonner; S. Bouchigny; S. Boiarinov; R. Bradford; D. Branford; W. J. Briscoe; W. K. Brooks; S. Bültmann; C. Butuceanu; J. R. Calarco; S. L. Careccia; D. S. Carman; A. Cazes; S. Chen; P. L. Cole; P. Coltharp; D. Cords; P. Corvisiero; D. Crabb; J. P. Cummings; E. De Sanctis; R. DeVita; P. V. Degtyarenko; H. Denizli; L. Dennis; A. Deur; K. V. Dharmawardane; C. Djalali; G. E. Dodge; J. Donnelly; D. Doughty; M. Dugger; S. Dytman; O. P. Dzyubak; H. Egiyan; K. S. Egiyan; L. Elouadrhiri; P. Eugenio; R. Fatemi; G. Fedotov; G. Feldman; R. J. Feuerbach; H. Funsten; M. Garçon; G. Gavalian; G. P. Gilfoyle; K. L. Giovanetti; F. X. Girod; J. Goetz; C. I. O. Gordon; R. W. Gothe; K. A. Griffioen; M. Guidal; M. Guillo; N. Guler; L. Guo; V. Gyurjyan; C. Hadjidakis; R. S. Hakobyan; J. Hardie; D. Heddle; F. W. Hersman; I. Hleiqawi; M. Holtrop; K. Hicks; C. E. Hyde-Wright; Y. Ilieva; D. G. Ireland; B. S. Ishkhanov; M. M. Ito; D. Jenkins; H. S. Jo; H. G. Juengst; J. D. Kellie; M. Khandaker; W. Kim; A. Klein; F. J. Klein; A. V. Klimenko; M. Kossov; L. H. Kramer; V. Kubarovsky; J. Kuhn; S. E. Kuhn; J. Lachniet; J. M. Laget; J. Langheinrich; D. Lawrence; T. Lee; Ji Li; K. Livingston; C. Marchand; N. Markov; S. McAleer; B. McKinnon; J. W. C. McNabb; B. A. Mecking; S. Mehrabyan; J. J. Melone; M. D. Mestayer; C. A. Meyer; K. Mikhailov; R. Minehart; M. Mirazita; R. Miskimen; V. Mokeev; L. Morand; S. A. Morrow; J. Mueller; G. S. Mutchler; J. Napolitano; R. Nasseripour; S. Niccolai; G. Niculescu; I. Niculescu; B. B. Niczyporuk; M. Niroula; R. A. Niyazov; M. Nozar; G. V. O' Rielly; M. Osipenko; A. I. Ostrovidov; K. Park; E. Pasyuk; S. A. Philips; N. Pivnyuk; D. Pocanic; O. Pogorelko; E. Polli; S. Pozdniakov; B. M. Preedom; J. W. Price; Y. Prok; D. Protopopescu; L. M. Qin; B. A. Raue; G. Riccardi; G. Ricco; M. Ripani; B. G. Ritchie; F. Ronchetti; G. Rosner; P. Rossi; P. D. Rubin; F. Sabatié; C. Salgado; J. P. Santoro; V. Sapunenko; R. A. Schumacher; V. S. Serov; Y. G. Sharabian; A. V. Skabelin; E. S. Smith; D. I. Sober; A. Stavinsky; S. S. Stepanyan; S. Stepanyan; B. E. Stokes; I. I. Strakovsky; S. Strauch; M. Taiuti; D. J. Tedeschi; U. Thoma; A. Tkabladze; L. Todor; S. Tkachenko; C. Tur; M. F. Vineyard; A. V. Vlassov; L. B. Weinstein; D. P. Weygand; M. Williams; E. Wolin; M. H. Wood; A. Yegneswaran; L. Zana; B. Zhang; J. Zhang; and B. Zhao

    2006-09-01

    We report a new measurement of the exclusive electroproduction reaction gamma*_p --> pi0_p to explore the evolution from soft nonperturbative physics to hard processes via the Q2 dependence of the magnetic (M1+), electric (E1+), and scalar (S1+) multipoles in the N --> Delta transition. 9000 differential cross section data points cover W from threshold to 1.4 GeV/c2, 4pi center-of-mass solid angle, and Q2 from 3 to 6 GeV2/c2, the highest yet achieved. It is found that the magnetic form factor G^*M decreases with Q2 more steeply than the proton magnetic form factor, the ratio E1+/M1+ is small and negative, indicating strong helicity nonconservation, and the ratio S1+/M1+ is negative, while its magnitude increases with Q2.

  11. gamma* N --> Delta at JLab: Exploring the High Q2 Regime

    Energy Technology Data Exchange (ETDEWEB)

    Maurizio Ungaro; Kyungseon Jo; Paul Stoler

    2007-04-01

    We report a new measurement of the exclusive electroproduction reaction gamma* p --> pi0 p to explore the evolution from soft non-perturbative physics to hard processes via the Q2 dependence of the magnetic (M1+), electric (E1+) and scalar (S1+) multipoles in the N --> Delta transition. 9000 differential cross section data points cover W from threshold to 1.4 GeV/c2, 4pi center-of-mass solid angle, and Q2 from 3 to 6 GeV2/c2, the highest yet achieved. It is found that the magnetic form factor GM* decreases with Q2 more steeply than the proton magnetic form factor, the ratio E1+/M1+ is small and negative, indicating strong helicity non-conservation, and the ratio S1+/M1+ is negative, while its magnitude increases with Q2.

  12. Heat Kernel Estimate for $\\Delta+\\Delta^{\\alpha/2}$ in $C^{1,1}$ open sets

    CERN Document Server

    Chen, Zhen-Qing; Song, Renming

    2010-01-01

    We consider a family of pseudo differential operators $\\{\\Delta+ a^\\alpha \\Delta^{\\alpha/2}; a\\in (0, 1]\\}$ on $\\bR^d$ for every $d\\geq 1$ that evolves continuously from $\\Delta$ to $\\Delta + \\Delta^{\\alpha/2}$, where $\\alpha \\in (0, 2)$. It gives rise to a family of L\\'evy processes $\\{X^a, a\\in (0, 1]\\}$ in $\\bR^d$, where $X^a$ is the sum of a Brownian motion and an independent symmetric $\\alpha$-stable process with weight $a$. We establish sharp two-sided estimates for the heat kernel of $\\Delta + a^{\\alpha} \\Delta^{\\alpha/2}$ with zero exterior condition in a family of open subsets, including bounded $C^{1, 1}$ (possibly disconnected) open sets. This heat kernel is also the transition density of the sum of a Brownian motion and an independent symmetric $\\alpha$-stable process with weight $a$ in such open sets. Our result is the first sharp two-sided estimates for the transition density of a Markov process with both diffusion and jump components in open sets. Moreover, our result is uniform in $a$ in the s...

  13. Comparison of osteogenic potentials of human rat BMP4 and BMP6 gene therapy using [E1-] and [E1-,E2b-] adenoviral vectors

    Directory of Open Access Journals (Sweden)

    Hongwei Li, Jin Zhong Li, Debra D. Pittman, Andy Amalfitano, Gerald R. Hankins, Gregory A. Helm

    2006-01-01

    Full Text Available Osteogenic potentials of some recombinant human bone morphogenetic protein (BMP first-generation adenoviral vectors (ADhBMPs are significantly limited in immunocompetent animals. It is unclear what role expression of viral proteins and foreign proteins transduced by adenoviral vectors play in the host immune response and in ectopic bone formation. In this study two sets of experiments were designed and performed. First, rat BMP6 cDNA were amplified, sequenced, and recombined in first-generation adenoviral vector (ADrBMP6. A comparison of human and rat BMP6 adenoviral vectors demonstrated identical osteogenic activities in both immunodeficient and immunocompetent rats. Second, the activities of recombinant human BMP6 in E1- (ADhBMP6 and [E1-,E2b-] ( [E1-,E2b-]ADGFP&hBMP6, and [E1-,E2b-]ADhBMP6 adenoviral vectors were compared in both in vitro and in vivo models. Similar activities of these two generations of BMP adenoviral vectors were found in all models. These results indicate that the amount of viral gene expression and the source of the BMP cDNA are not major factors in the interruption of osteogenic potentials of recombinant BMP6 adenoviral vectors in immunocompetent animals.

  14. Abraham Reef Stable Isotope Data (delta 13C, delta 18O, delta 14C) for 1635-1957

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Site: Abraham Reef, 22ó 06'S, 153ó 00'E, Porites australiensus, Radiocarbon (delta 14C) and Stable Isotope (del 18O and del 13C) results from bi-annual samples from...

  15. A design for clock data recovery circuit of E1%一种E1时钟数据恢复电路的设计

    Institute of Scientific and Technical Information of China (English)

    李鑫; 黄海生; 张斌; 惠楠

    2012-01-01

    针对E1数据的时钟数据恢复问题,设计一种基于小数分频且有环路滤波功能的数控振荡器(DigitallyControlled Oscillator,DCO),给出一种新的全数字锁相环(All Digital Phase-Locked Loop,ADPLL)实现方案,将数字环路滤波器(Digital Loop Filter,DLF)和DCO集成到一个模块,从而实现一种E1时钟数据恢复(Clock Data Re-covery,CDR)电路。经过对比可知,新方案比传统ADPLL实现方案的电路集成度更高。理论分析显示,新方案电路性能可靠。%For the problem of E1 clock data recovery, a kind of Digitally Controlled Oscillator (DCO), which has loop filtering function based on fractional frequency dividing, is presented. Then it gives a new kind of All Digital Phase-Locked Loop(ADPLL) implemention scheme. On the basis of this scheme, a kind of E1 Clock Data Reeovery(CDR) circuit is implemented. Com- pared with traditional ADPLL implemention scheme, the scheme presented integrates Digital Loop Filter (DLF) and DCO together, thus the integration of the circuit becomes higher. The mathematical analysis to the circuit performance proves that the design can reliably recover the data and clock from E1 data received.

  16. The microscopic structure of $\\pi NN$, $\\pi N\\Delta$ and $\\pi\\Delta\\Delta$ vertices in a hybrid constituent quark model

    CERN Document Server

    Jung, Ju-Hyun

    2016-01-01

    We present a microscopic description of the strong $\\pi NN$, $\\pi N\\Delta$ and $\\pi\\Delta\\Delta$ vertices. Our starting point is a constituent-quark model supplemented by an additional $3q\\pi$ non-valence component. In the spirit of chiral constituent-quark models, quarks are allowed to emit and reabsorb a pion. This multichannel system is treated in a relativistically invariant way within the framework of point-form quantum mechanics. Starting with a common $SU(6)$ spin-flavor-symmetric wave function for $N$ and $\\Delta$, we calculate the strength of the $\\pi NN$, $\\pi N\\Delta$ and $\\pi\\Delta\\Delta$ couplings and the corresponding vertex form factors. Our results are in accordance with phenomenological fits of these quantities that have been obtained within purely hadronic multichannel models for baryon resonances.

  17. Long-Term Prostaglandin E1 Infusion for Newborns with Critical Congenital Heart Disease.

    Science.gov (United States)

    Aykanat, Alper; Yavuz, Taner; Özalkaya, Elif; Topçuoğlu, Sevilay; Ovalı, Fahri; Karatekin, Güner

    2016-01-01

    Prostaglandin E1 is crucial for keeping the patent ductus arteriosus in critical congenital heart disease for the survival and palliation of particularly prematurely born babies until a cardiosurgical intervention is available. In this study, the side effects of prostaglandin E1 in newborns with critical congenital heart disease and clinical outcomes were evaluated. Thirty-five newborns diagnosed with critical congenital heart disease were treated with prostaglandin E1 between January 2012 and September 2014 at our hospital. Patient charts were examined for prostaglandin E1 side effects (metabolic, gastric outlet obstruction, apnea), clinical status, and prognosis. Acquired data were analyzed in the SPSS 20.0 program. Patients with birth weight under 2500 g needed more days of prostaglandin E1 infusion than ones with birthweight over 2500 g (P = 0.016). The ratio of patients with birth weight under 2500 g who received prostaglandin E1 longer than 7 days was higher than the patients with birth weight over 2500 g (P = 0.02). Eighteen side effects were encountered in 11 of 35 patients (31%). Of these side effects, 1 patient had 4, 4 patients had 2, and 6 patients had only 1 side effect. Discontinuation of the therapy was never needed. Prostaglandin E1 is an accepted therapy modality for survival and outcome in critical congenital heart disease in particularly low-birth-weight babies until a surgical intervention is available. Side effects are not less encountered but are almost always manageable, and discontinuation is not needed.

  18. Candida albicans modulates host defense by biosynthesizing the pro-resolving mediator resolvin E1.

    Directory of Open Access Journals (Sweden)

    Eric J Haas-Stapleton

    Full Text Available Candida albicans is an opportunistic fungal pathogen of humans that resides commensally on epithelial surfaces, but can cause inflammation when pathogenic. Resolvins are a class of anti-inflammatory lipids derived from omega-3 polyunsaturated fatty acids (PUFA that attenuate neutrophil migration during the resolution phase of inflammation. In this report we demonstrate that C. albicans biosynthesizes resolvins that are chemically identical to those produced by human cells. In contrast to the trans-cellular biosynthesis of human Resolvin E1 (RvE1, RvE1 biosynthesis in C. albicans occurs in the absence of other cellular partners. C. albicans biosynthesis of RvE1 is sensitive to lipoxygenase and cytochrome P450 monoxygenase inhibitors. We show that 10nM RvE1 reduces neutrophil chemotaxis in response to IL-8; 1nM RvE1 enhanced phagocytosis of Candida by human neutrophils, as well as intracellular ROS generation and killing, while having no direct affect on neutrophil motility. In a mouse model of systemic candidiasis, RvE1 stimulated clearance of the fungus from circulating blood. These results reveal an inter-species chemical signaling system that modulates host immune functions and may play a role in balancing host carriage of commensal and pathogenic C. albicans.

  19. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation.

    Science.gov (United States)

    Chien, Ting-Ying; Chang, Darby Tien-Hao; Chen, Chien-Yu; Weng, Yi-Zhong; Hsu, Chen-Ming

    2008-07-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least three sequential blocks that are concurrently conserved, i.e. frequently observed together in sequences. In other words, a sequence signature is consisted of residues from multiple regions of the protein sequence, which echoes the observation that an enzyme catalytic site is usually constituted of residues that are largely separated in the sequence. E1DS currently contains 5421 sequence signatures that in total cover 932 4-digital EC numbers. E1DS is evaluated based on a collection of enzymes with catalytic sites annotated in Catalytic Site Atlas. When compared to the famous pattern database PROSITE, predictions based on E1DS signatures are considered more sensitive in identifying catalytic sites and the involved residues. E1DS is available at http://e1ds.ee.ncku.edu.tw/ and a mirror site can be found at http://e1ds.csbb.ntu.edu.tw/.

  20. Enterasys Networks delivers 10-Gigabit ethernet for the enterprise with new matrix E1 switching family

    CERN Multimedia

    2001-01-01

    Enterasys Networks Inc., today announced its new Matrix E1 family of 10-Gigabit and Gigabit Ethernet switches. The Matrix E1 Optical Access Switch (OAS) enables organizations to deliver applications at 10-Gb speeds across a single fibre optic pair. Jacques Altaber, deputy leader of IT at CERN said "High-bandwith solutions are essential to leveraging more computing power, so 10-Gb Ethernet is the next logical step for us...The Matrix E1 allows us to provide the networking support that our scientists need and gives us a certain future for bandwidth and computing expansion".

  1. Inactivation of cyclin E1 inhibits chemically induced hepatocarcinogenesis in mice

    OpenAIRE

    Moro, Nives

    2011-01-01

    E-type cyclins (CcnE) control the transition of quiescent cells into the cell cycle. Two E-type cyclins, CcnE1 and CcnE2 have been described. A variety of human cancers, including hepatocellular carcinoma (HCC), overexpress CcnE and this is frequently associated with reduced patient survival. The aim of the present study was to dissect the role of CcnE1 and CcnE2 for hepatocarcinogenesis induced by the carcinogen diethylnitrosamine (DEN) using CcnE1 and CcnE2 knockout mice. The central questi...

  2. Reduced complexity MASH delta-sigma modulator

    OpenAIRE

    Ye, Zhipeng; Kennedy, Michael Peter

    2007-01-01

    A reduced complexity digital multi-stage noise shaping (MASH) delta-sigma modulator for fractional-N frequency synthesizer applications is proposed. A long word is used for the first modulator in a MASH structure; the sequence length is maximized by setting the least significant bit of the input to 1; shorter words are used in subsequent stages. Experimental results confirm simulations

  3. Strong decays of nucleon and $\\Delta$ resonances

    CERN Document Server

    Bijker, R

    1996-01-01

    We study the strong couplings of the nucleon and delta resonances in a collective model. In the ensuing algebraic treatment we derive closed expressions for decay widths which are used to analyze the experimental data for strong decays into the pion and eta channels.

  4. How stable is the Mississippi Delta?

    NARCIS (Netherlands)

    Törnqvist, T.E.; Bick, S.J.; van der Borg, K.; de Jong, A.F.M.

    2006-01-01

    Large deltas are commonly believed to exhibit rapid rates of tectonic subsidence, largely due to sediment loading of the lithosphere. As a result, deltaic plains are prone to accelerated relative sea-level rise, coastal erosion, and wetland loss. Hurricane Katrina's devastation testifies to the seve

  5. Design of Low Power Sigma Delta ADC

    Directory of Open Access Journals (Sweden)

    Mohammed Arifuddin Sohel

    2012-08-01

    Full Text Available A Low power discrete time sigma delta ADC consisting of a second order sigma delta modulator and third order Cascaded Integrated Comb (CIC filter is proposed. The second order modulator is designed to work at a signal band of 20 K Hz at an oversampling ratio of 64 with a sampling frequency of 2.56 MHz. It achieves a signal to noise ratio of 85.2dB and a resolution of 14 bits. The CIC digital filter is designed to implement a decimation factor of 64, operating at a maximum sampling frequency of 2.56 MHz. A second order sigma delta modulator is implemented in 0.18 micron CMOS technology using full custom design and the third order digital CIC decimation filter is implemented in verilog HDL. The complete Sigma Delta ADC, consisting of analog block of second order modulator and digital block of decimator consumes a total power 1.96mW.

  6. Design of Low Power Sigma Delta ADC

    Directory of Open Access Journals (Sweden)

    Mohammed Arifuddin Sohel

    2012-09-01

    Full Text Available A Low power discrete time sigma delta ADC consisting of a second order sigma delta modulator and third order Cascaded Integrated Comb (CIC filter is proposed. The second order modulator is designed to work at a signal band of 20K Hz at an oversampling ratio of 64 with a sampling frequency of 2.56 MHz. It achieves a signal to noise ratio of 85.2dB and a resolution of 14 bits. The CIC digital filter is designed to implement a decimation factor of 64, operating at a maximum sampling frequency of 2.56 MHz. A second order sigma delta modulator is implemented in 0.18micron CMOS technology using full custom design and the third order digital CIC decimation filter is implemented in verilog HDL. The complete Sigma Delta ADC, consisting of analog block of second order modulator and digital block of decimator consumes a total power 1.96mW.

  7. Two-Photon-Exchange Effects and $\\Delta(1232)$ Deformation

    CERN Document Server

    Zhou, Hai-Qing

    2016-01-01

    The two-photon-exchange (TPE) contribution in $ep\\rightarrow ep\\pi ^0$ with $W=M_{\\Delta}$ and small $Q^2$ is calculated and its corrections to the ratios of electromagnetic transition form factors $R_{EM} = E_{1+}^{(3/2)}/M_{1+}^{(3/2)} $ and $R_{SM} = S_{1+}^{(3/2)}/M_{1+}^{(3/2)}$, are analysed. A simple hadronic model is used to estimate the TPE amplitude. Two phenomenological models, MAID2007 and SAID, are used to approximate the full $ep\\rightarrow ep\\pi ^0$ cross sections which contain both the TPE and the one-photon-exchange (OPE) contributions. The genuine the OPE amplitude is then extracted from an integral equation by iteration. We find that the TPE contribution is not sensitive to whether MAID or SAID is used as input in the region with $Q^2<2$ GeV$^2$. It gives small correction to $R_{EM}$ while for $R_{SM}$, the correction is about -10\\% at small $\\epsilon$ and about $1\\%$ at large $\\epsilon$ for $Q^2\\approx2.5$ GeV$^2$. The large correction from TPE at small $\\epsilon$ must be included in th...

  8. The Niger Delta Avengers, Autonomous Ethnic Clans and Common ...

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    The situation in Niger Delta region has remained an unanswered research question. When oil was discovered .... From the foregone analysis, the greed factor is sufficient to explain the crisis in Niger. Delta given the ..... homeless. The sizeable ...

  9. Habitat Management Plan for Delta and Breton National Wildlife Refuges

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Delta and Breton NWRs Habitat Management Plan provides a long-term vision and specific guidance on managing habitats for the resources of concern at Delta and...

  10. $\\delta-\\delta^\\prime$ generalized Robin boundary conditions and quantum vacuum fluctuations

    CERN Document Server

    Munoz-Castaneda, J M

    2014-01-01

    The effects induced by the quantum vacuum fluctuations of one massless real scalar field on a configuration of two partially transparent plates are investigated. The physical properties of the infinitely thin plates are simulated by means of Dirac-$\\delta-\\delta^\\prime$ point interactions. It is shown that the distortion caused on the fluctuations by this external background gives rise to a generalization of Robin boundary conditions. The $T$-operator for potentials concentrated on points with non defined parity is computed with total generality. The quantum vacuum interaction energy between the two plates is computed using the $TGTG$ formula to find positive, negative, and zero Casimir energies. The parity properties of the $\\delta-\\delta^\\prime$ potential allow repulsive quantum vacuum force between identical plates.

  11. Delta-Bar-Delta and directed random search algorithms to study capacitor banks switching overvoltages

    Directory of Open Access Journals (Sweden)

    Sadeghkhani Iman

    2012-01-01

    Full Text Available This paper introduces an approach to analyse transient overvoltages during capacitor banks switching based on artificial neural networks (ANN. Three learning algorithms, delta-bar-delta (DBD, extended delta-bar-delta (EDBD and directed random search (DRS were used to train the ANNs. The ANN training is based on equivalent parameters of the network and therefore, a trained ANN is applicable to every studied system. The developed ANN is trained with extensive simulated results and tested for typical cases. The new algorithms are presented and demonstrated for a partial 39-bus New England test system. The simulated results show the proposed technique can accurately estimate the peak values of switching overvoltages.

  12. Delta Delta Excitation in Proton-Proton Induced pi0pi0 Production

    CERN Document Server

    Skorodko, T; Bogoslawsky, D; Calen, H; Clement, H; Doroshkevich, E; Demiroers, L; Ekstroem, C; Fransson, K; Gustafsson, L; Hoistad, B; Ivanov, G; Jacewicz, M; Jiganov, E; Johansson, T; Khakimova, O; Keleta, S; Koch, I; Kren, F; Kullander, S; Kupsc, A; Marciniewski, P; Meier, R; Morosov, B; Pauly, C; Petren, H; Petukhov, Y; Povtorejko, A; Ruber, R J M Y; Schoenning, K; Scobel, W; Shwartz, B; Stepaniak, J; Thoerngren-Engblom, P; Tikhomirov, V; Wagner, G J; Wolke, M; Yamamoto, A; Zabierowski, J; Zlomanczuk, J

    2010-01-01

    Exclusive measurements of the $pp \\to pp\\pi^0\\pi^0$ reaction have been performed at CELSIUS/WASA at energies from threshold up to $T_p$ = 1.3 GeV. Total and differential cross sections have been obtained. Here we concentrate on energies $T_p \\ge$ 1 GeV, where the $\\Delta\\Delta$ excitation becomes the leading process. No evidence is found for a significant ABC effect beyond that given by the conventional $t$-channel $\\Delta\\Delta$ excitation. This holds also for the double-pionic fusion to the quasibound $^2$He. The data are compared to model predictions, which are based on both pion and $\\rho$ exchange. Total and differential cross sections are at variance with these predictions and call for a profound modification of the $\\rho$-exchange. A phenomenological modification allowing only a small $\\rho$ exchange contribution leads to a quantitative description of the data.

  13. {Delta}{Delta} excitation in proton-proton induced {pi}{sup 0{pi}0} production

    Energy Technology Data Exchange (ETDEWEB)

    Skorodko, T.; Bashkanov, M. [Physikalisches Institut der Universitaet Tuebingen, D-72076 Tuebingen (Germany); Bogoslawsky, D. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Calen, H. [The Svedberg Laboratory, Uppsala (Sweden); Clement, H., E-mail: Clement@pit.physik.uni-tuebingen.d [Physikalisches Institut der Universitaet Tuebingen, D-72076 Tuebingen (Germany); Doroshkevich, E. [Physikalisches Institut der Universitaet Tuebingen, D-72076 Tuebingen (Germany); Demiroers, L. [Hamburg University, Hamburg (Germany); Ekstroem, C.; Fransson, K. [The Svedberg Laboratory, Uppsala (Sweden); Gustafsson, L.; Hoeistad, B. [Uppsala University, Uppsala (Sweden); Ivanov, G. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Jacewicz, M. [Uppsala University, Uppsala (Sweden); Jiganov, E. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Johansson, T. [Uppsala University, Uppsala (Sweden); Khakimova, O. [Physikalisches Institut der Universitaet Tuebingen, D-72076 Tuebingen (Germany); Keleta, S.; Koch, I. [Uppsala University, Uppsala (Sweden); Kren, F. [Physikalisches Institut der Universitaet Tuebingen, D-72076 Tuebingen (Germany); Kullander, S. [Uppsala University, Uppsala (Sweden)

    2011-01-10

    Exclusive measurements of the pp{yields}pp{pi}{sup 0{pi}0} reaction have been performed at CELSIUS/WASA at energies from threshold up to T{sub p}=1.3 GeV. Total and differential cross sections have been obtained. Here we concentrate on energies T{sub p{>=}}1 GeV, where the {Delta}{Delta} excitation becomes the leading process. No evidence is found for a significant ABC effect beyond that given by the conventional t-channel {Delta}{Delta} excitation. This holds also for the double-pionic fusion to the quasibound {sup 2}He. The data are compared to model predictions, which are based on both {pi}- and {rho}-exchange. Total and differential cross sections are at variance with these predictions and call for a profound modification of the {rho}-exchange. A phenomenological modification allowing only a small {rho}-exchange contribution leads to a quantitative description of the data.

  14. Acetato(N-[(E-1-(6-methyl-2-pyridylmethylidene]-2-{2-[(E-1-(6-methyl-2-pyridylmethylideneamino]phenethyl}anilinenickel(II perchlorate

    Directory of Open Access Journals (Sweden)

    Hong-In Lee

    2010-10-01

    Full Text Available In the title complex, [Ni(CH3COO(C28H26N4]ClO4, the NiII atom is coordinated by two imine N atoms and two pyridine N atoms of the N-[(E-1-(6-methyl-2-pyridylmethylidene]-2-(2-[(E-1-(6-methyl-2-pyridylmethylideneamino]phenethylaniline donor ligand and two O atoms of the acetate ion in a distorted octahedral coordination. The average Ni—N and Ni—O bond lengths are 2.131 (13 and 2.098 (11 Å, respectively. An intramolecular N—H...O interaction occurs. Relatively weak intermolecular C—H...O interactions between the ligands and the ClO4− ions result in a chain extending along the b axis.

  15. E1, M1, E2 transition energies and probabilities of W$^{54+}$ ions

    CERN Document Server

    Ding, Xiao-bin; Liu, Jia-xin; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A; Nakamura, Nobuyuki; Dong, Chen-zhong

    2016-01-01

    A comprehensive theoretical study of the E1, M1, E2 transitions of Ca-like tungsten ions is presented. Using multi-configuration Dirac-Fock (MCDF) method with a restricted active space treatment, the wavelengths and probabilities of the M1 and E2 transitions between the multiplets of the ground state configuration ([Ne]3s$^{2}$3p$^{6}$3d$^{2}$) and of the E1 transitions between [Ne]3s$^{2}$3p$^{5}$3d$^{3}$ and [Ne]3s$^{2}$3p$^{6}$3d$^{2}$ have been calculated. The results are in reasonable agreement with available experimental data. The present E1 and M1 calculations are compared with previous theoretical values. For E2 transitions, the importance of electron correlation from 3s and 3p orbitals is pointed out. Several strong E1 transitions are predicted, which have potential advantage for plasma diagnostics.

  16. 26 CFR 1.1397E-1 - Qualified zone academy bonds.

    Science.gov (United States)

    2010-04-01

    ... TAX (CONTINUED) INCOME TAXES Empowerment Zone Employment Credit § 1.1397E-1 Qualified zone academy...), (iii), (iv) or (v). Services of employees of the eligible local education agency do not constitute...

  17. 78 FR 15597 - Special Conditions: GE Aviation CT7-2E1 Turboshaft Engine Model

    Science.gov (United States)

    2013-03-12

    ... conditions are issued for the General Electric Aviation (GE) CT7-2E1 engine model. This engine model will... ensure the test will run for a 2.5 minute duration with no interruption. Type Certification Basis Under...

  18. Effects of E2 and E1-E2 Interference on Coulomb Dissociation of 19C

    Institute of Scientific and Technical Information of China (English)

    Rajesh Kharab; Pardeep Singh; Ravinder Kumar

    2007-01-01

    We investigate the effects of higher order multipole transitions, in particular electric quadrupole (E2) and E1-E2interference, on the Coulomb dissociation of 19 C within the framework of the first order eikonal approximation.The sensitivity of the total Coulomb breakup cross section and the longitudinal momentum distribution of the core fragment to these effects are checked. The breakup occurs predominately through the dipole transition and the contribution of E2 transition to the total cross section is found to be within the range from 1 to 3% of that of E1. It is further observed that the E1-E2 interference term contributes nothing to the integrated cross section.On the other hand, the longitudinal momentum distribution is observed to be insensitive to the E2 transition while the E1-E2 interference introduces a small asymmetry in its shape.

  19. The C-terminal region of E1A: a molecular tool for cellular cartography.

    Science.gov (United States)

    Yousef, Ahmed F; Fonseca, Gregory J; Cohen, Michael J; Mymryk, Joe S

    2012-04-01

    The adenovirus E1A proteins function via protein-protein interactions. By making many connections with the cellular protein network, individual modules of this virally encoded hub reprogram numerous aspects of cell function and behavior. Although many of these interactions have been thoroughly studied, those mediated by the C-terminal region of E1A are less well understood. This review focuses on how this region of E1A affects cell cycle progression, apoptosis, senescence, transformation, and conversion of cells to an epithelial state through interactions with CTBP1/2, DYRK1A/B, FOXK1/2, and importin-α. Furthermore, novel potential pathways that the C-terminus of E1A influences through these connections with the cellular interaction network are discussed.

  20. CYP2E1-catalyzed oxidation contributes to the sperm toxicity of 1-bromopropane in mice.

    Science.gov (United States)

    Garner, C Edwin; Sloan, C; Sumner, S C J; Burgess, J; Davis, J; Etheridge, A; Parham, A; Ghanayem, B I

    2007-03-01

    1-bromopropane (1-BrP) induces dose- and time-dependent reproductive organ toxicity and reduced sperm motility in rodents. The contribution of cytochrome P4502E1 (CYP2E1) to both 1-BrP metabolism and the induction of male reproductive toxicity was investigated using wild-type (WT) and Cyp2e1-/- mice. In gas uptake inhalation studies, the elimination half-life of [1,2,3-(13)C]-1-BrP was longer in Cyp2e1-/- mice relative to WT (3.2 vs. 1.3 h). Urinary metabolites were identified by 13C nuclear magnetic resonance. The mercapturic acid of 1-bromo-2-hydroxypropane (2OHBrP) was the major urinary metabolite in WT mice, and products of conjugation of 1-BrP with glutathione (GSH) were insignificant. The ratio of GSH conjugation to 2-hydroxylation increased 5-fold in Cyp2e1-/- mice relative to WT. After 1-BrP exposure, hepatic GSH was decreased by 76% in WT mice vs. 47% in Cyp2e1-/- mice. Despite a 170% increase in 1-BrP exposure in Cyp2e1-/- vs. WT mice, sperm motility in exposed Cyp2e1-/- mice did not change relative to unexposed matched controls. This suggests that metabolites produced through CYP2E1-mediated oxidation may be responsible for 1-BrP-induced sperm toxicity. Both 1-BrP and 2OHBrP inhibited the motility of sperm obtained from WT mice in vitro. However, only 2OHBrP reduced the motility of sperm obtained from Cyp2e1-/- mice in vitro, suggesting that conversion of parent compound to 2OHBrP within the spermatozoa may contribute, at least in part, to reduced motility. Overall, these data suggest that metabolism of 1-BrP is mediated in part by CYP2E1, and activation of 1BrP via this enzyme may contribute to the male reproductive toxicity of this chemical.

  1. A delta-catenin signaling pathway leading to dendritic protrusions.

    Science.gov (United States)

    Abu-Elneel, Kawther; Ochiishi, Tomoyo; Medina, Miguel; Remedi, Monica; Gastaldi, Laura; Caceres, Alfredo; Kosik, Kenneth S

    2008-11-21

    Delta-catenin is a synaptic adherens junction protein pivotally positioned to serve as a signaling sensor and integrator. Expression of delta-catenin induces filopodia-like protrusions in neurons. Here we show that the small GTPases of the Rho family act coordinately as downstream effectors of delta-catenin. A dominant negative Rac prevented delta-catenin-induced protrusions, and Cdc42 activity was dramatically increased by delta-catenin expression. A kinase dead LIMK (LIM kinase) and a mutant Cofilin also prevented delta-catenin-induced protrusions. To link the effects of delta-catenin to a physiological pathway, we noted that (S)-3,5-dihydroxyphenylglycine (DHPG) activation of metabotropic glutamate receptors induced dendritic protrusions that are very similar to those induced by delta-catenin. Furthermore, delta-catenin RNA-mediated interference can block the induction of dendritic protrusions by DHPG. Interestingly, DHPG dissociated PSD-95 and N-cadherin from the delta-catenin complex, increased the association of delta-catenin with Cortactin, and induced the phosphorylation of delta-catenin within the sites that bind to these protein partners.

  2. Morphodynamics of a cyclic prograding delta: the Red River, Vietnam

    NARCIS (Netherlands)

    Maren, D.S. van

    2004-01-01

    River deltas are inhabited by over 60% of the world population, and are, consequently, of paramount agricultural and economical importance. They constitute unique wetland envi ronments which gives river deltas ecological importance as well. Additionally, many deltas contain large accumulations of oi

  3. 78 FR 45592 - DeltaPoint Capital IV, LP;

    Science.gov (United States)

    2013-07-29

    ... ADMINISTRATION DeltaPoint Capital IV, LP; Notice Seeking Exemption Under Section 312 of the Small Business Investment Act, Conflicts of Interest Notice is hereby given that DeltaPoint Capital IV, L.P., 45 East Avenue... Business Administration (``SBA'') Rules and Regulations (13 CFR 107.730). DeltaPoint Capital IV,...

  4. Role of CYP2E1 gene polymorphisms association with hepatitis risk in Northeast India

    Institute of Scientific and Technical Information of China (English)

    Manab; Deka; Moumita; Bose; Bharati; Baruah; Purabi; Deka; Bose; Subhash; Medhi; Sujoy; Bose; Anjan; Saikia; Premashish; Kar

    2010-01-01

    AIM:To investigate hepatitis virus, genetic and environmental factors, and their interactions in predisposing patients to liver diseases in Northeast India. METHODS:A total of 104 jaundice patients and 124 community controls were included. Serological analysis was performed by routine enzyme-linked immunosorbent assay, and nucleic acid testing for hepatitis viruses was done by polymerase chain reaction (PCR), followed by PCR direct sequencing for viral genotyping. Cytochrome P450 2E1 (CYP2E1) polymorphism w...

  5. Cooperative effects for CYP2E1 differ between styrene and its metabolites

    OpenAIRE

    2013-01-01

    Cooperative interactions are frequently observed in the metabolism of drugs and pollutants by cytochrome P450s; nevertheless, the molecular determinants for cooperativity remain elusive. Previously, we demonstrated that steady-state styrene metabolism by CYP2E1 exhibits positive cooperativity.We hypothesized that styrene metabolites have lower affinity than styrene toward CYP2E1 and limited ability to induce cooperative effects during metabolism. To test the hypothesis, we determined the pote...

  6. Phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains identified in China

    Institute of Scientific and Technical Information of China (English)

    赵璇

    2014-01-01

    Objective To understand the phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from different provinces in China during the last 50 years.Methods Traditional biotyping testings including susceptibility to polymyxin B,sensitivity to groupⅣphage,Voges-Proskauer test and haemolysis of sheep erythrocytes were conducted.Results Data from Biotype-specific phenotype analysis revealed that only 133 isolates carried the typical E1 Tor phenotypes while the other 251

  7. Evolution of the ubiquitin-activating enzyme Uba1 (E1)

    Science.gov (United States)

    Allan, Douglas C.; Phillips, J. C.

    2017-10-01

    Ubiquitin tags diseased proteins and initiates an enzyme conjugation cascade, which has three stages. The first-stage enzyme Uba1 (E1) has evolved only modestly from slime mold to humans, and is > 14 times larger than Ub. Here we use critical point thermodynamic scaling theory to connect Uba1 (E1) evolution from yeast and slime mold to fruit flies and humans to subtle changes in its amino acid sequences.

  8. The effect of prostaglandin E_1 on recovery of early renal graft functions after transplantation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Objective To investigate the effect of prostaglandin E1 (PGE1) on recovery of early renal graft functions after transplantation. Methods One hundred and seven patients after renal transplantation were allocated in the treated group, and treated by conventional treatment with injection of 10 μg prostaglandin E1 additionally twice a day for 14 days. And eighty-eight patients who received conventional treatment alone after renal transplantation at the corresponding period were allocated in the control group. I...

  9. Comparative assessment of the vulnerability and resilience of 10 deltas : work document

    NARCIS (Netherlands)

    Bucx, T.; Marchand, M.; Makaske, B.; Guchte, van de C.

    2010-01-01

    Background information about: Nile delta (Egypt), Incomati delta (Mozambique), Ganges-Brahmaputra-Meghna (Bangladesh), Yangtze (China), Ciliwung (Indonesia), Mekong (Vietnam), Rhine-Meuse (The Netherlands), Danube (Romania), California Bay-Delta, Mississippi River Delta (USA)

  10. The Frequency of Cytochrome P450 2E1 Polymorphisms in Black South Africans

    Directory of Open Access Journals (Sweden)

    Paul K. Chelule

    2006-01-01

    Full Text Available Polymorphisms in the promoter region of the Cytochrome P4502E1 (CYP2E1 gene reportedly modify the metabolic activity of CYP2E1 enzyme, and have been associated with increased susceptibility to squamous cell carcinoma (SCC of the oesophagus in high prevalence areas such as China. To assess the frequency of these polymorphisms in Black South Africans, a population with a high incidence of oesophageal SCC, this study examined genomic DNA from 331 subjects for restriction fragment length polymorphisms in the CYP2E1 (RsaI and PstI digestion. The frequency of the CYP2E1 c1/c1 and c1/c3 genotypes was 95% and 5% respectively. The frequency of the CYP2E1 allele distribution was found to be markedly different between Chinese and South African populations; hence it is important to place racial differences into consideration when proposing allelic variants as genetic markers for cancer.

  11. In vitro characterization of the NAD+ synthetase NadE1 from Herbaspirillum seropedicae.

    Science.gov (United States)

    Laskoski, Kerly; Santos, Adrian R S; Bonatto, Ana C; Pedrosa, Fábio O; Souza, Emanuel M; Huergo, Luciano F

    2016-05-01

    Nicotinamide adenine dinucleotide synthetase enzyme (NadE) catalyzes the amination of nicotinic acid adenine dinucleotide (NaAD) to form NAD(+). This reaction represents the last step in the majority of the NAD(+) biosynthetic routes described to date. NadE enzymes typically use either glutamine or ammonium as amine nitrogen donor, and the reaction is energetically driven by ATP hydrolysis. Given the key role of NAD(+) in bacterial metabolism, NadE has attracted considerable interest as a potential target for the development of novel antibiotics. The plant-associative nitrogen-fixing bacteria Herbaspirillum seropedicae encodes two putative NadE, namely nadE1 and nadE2. The nadE1 gene is linked to glnB encoding the signal transduction protein GlnB. Here we report the purification and in vitro characterization of H. seropedicae NadE1. Gel filtration chromatography analysis suggests that NadE1 is an octamer. The NadE1 activity was assayed in vitro, and the Michaelis-Menten constants for substrates NaAD, ATP, glutamine and ammonium were determined. Enzyme kinetic and in vitro substrate competition assays indicate that H. seropedicae NadE1 uses glutamine as a preferential nitrogen donor.

  12. Structural analysis and evolution of specificity of the SUMO UFD E1-E2 interactions

    Science.gov (United States)

    Liu, Bing; Lois, L. Maria; Reverter, David

    2017-01-01

    SUMO belongs to the ubiquitin-like family (UbL) of protein modifiers. SUMO is conserved among eukaryotes and is essential for the regulation of processes such as DNA damage repair, transcription, DNA replication and mitosis. UbL modification of proteins occurs via a specific enzymatic cascade formed by the crosstalk between the E1-activating enzyme, the E2-conjugating enzyme and the E3-ligase. An essential discrimination step in all UbL modifiers corresponds to the interaction between E1 and E2 enzymes, which is mediated by the recruitment of the E2 to the UFD domain (Ubiquitin-Fold Domain) of the E1 enzyme. To gain insights in the properties of this interface, we have compared the structures of the complexes between E1 UFD domain and E2 in human and yeast, revealing two alternative UFD platforms that interact with a conserved E2. Comparative sequence analysis of the E1 UFD domain indicates that the E2 binding region has been conserved across phylogenetic closely related species, in which higher sequence conservation can be found in the E2 binding region than in the entire UFD domain. These distinctive strategies for E1-E2 interactions through the UFD domain might be the consequence of a high selective pressure to ensure specificity of each modifier conjugation system. PMID:28165030

  13. Evidence for a parity doublet Delta(1920)P33 and Delta(1940)D33 from gammap-->ppi;{0}eta.

    Science.gov (United States)

    Horn, I; Anisovich, A V; Anton, G; Bantes, R; Bartholomy, O; Beck, R; Beloglazov, Yu; Bogendörfer, R; Castelijns, R; Crede, V; Ehmanns, A; Ernst, J; Fabry, I; Flemming, H; Fösel, A; Fuchs, M; Funke, Chr; Gothe, R; Gridnev, A; Gutz, E; Höffgen, St; Hössl, J; Junkersfeld, J; Kalinowsky, H; Klein, F; Klempt, E; Koch, H; Konrad, M; Kopf, B; Krusche, B; Langheinrich, J; Löhner, H; Lopatin, I; Lotz, J; Matthäy, H; Menze, D; Messchendorp, J; Metag, V; Nikonov, V A; Novinski, D; Ostrick, M; van Pee, H; Sarantsev, A V; Schmidt, C; Schmieden, H; Schoch, B; Suft, G; Sumachev, V; Szczepanek, T; Thoma, U; Walther, D; Weinheimer, Chr

    2008-11-14

    Evidence is reported for the existence of a parity doublet of Delta resonances with total angular momentum J=3/2 from photoproduction of the ppi;{0}eta final state. The two parity partners Delta(1920)P33 and Delta(1940)D33 make significant contributions to the reaction. Cascades of resonances into Delta(1232)eta, N(1535)pi, and Na0(980) are clearly observed.

  14. 78 FR 22911 - Delta Air Lines, Inc., Reservation Sales and Customer Care Call Center, Seatac, WA; Delta Air...

    Science.gov (United States)

    2013-04-17

    ... Employment and Training Administration Delta Air Lines, Inc., Reservation Sales and Customer Care Call Center, Seatac, WA; Delta Air Lines, Inc., Reservation Sales and Customer Care Call Center, Sioux City, IA... workers and former workers of Delta Air Lines, Inc., Reservation Sales and Customer Care Call...

  15. Autophagy Protects against CYP2E1/Chronic Ethanol-Induced Hepatotoxicity

    Directory of Open Access Journals (Sweden)

    Yongke Lu

    2015-10-01

    Full Text Available Autophagy is an intracellular pathway by which lysosomes degrade and recycle long-lived proteins and cellular organelles. The effects of ethanol on autophagy are complex but recent studies have shown that autophagy serves a protective function against ethanol-induced liver injury. Autophagy was found to also be protective against CYP2E1-dependent toxicity in vitro in HepG2 cells which express CYP2E1 and in vivo in an acute alcohol/CYPE1-dependent liver injury model. The goal of the current report was to extend the previous in vitro and acute in vivo experiments to a chronic ethanol model to evaluate whether autophagy is also protective against CYP2E1-dependent liver injury in a chronic ethanol-fed mouse model. Wild type (WT, CYP2E1 knockout (KO or CYP2E1 humanized transgenic knockin (KI, mice were fed an ethanol liquid diet or control dextrose diet for four weeks. In the last week, some mice received either saline or 3-methyladenine (3-MA, an inhibitor of autophagy, or rapamycin, which stimulates autophagy. Inhibition of autophagy by 3-MA potentiated the ethanol-induced increases in serum transaminase and triglyceride levels in the WT and KI mice but not KO mice, while rapamycin prevented the ethanol liver injury. Treatment with 3-MA enhanced the ethanol-induced fat accumulation in WT mice and caused necrosis in the KI mice; little or no effect was found in the ethanol-fed KO mice or any of the dextrose-fed mice. 3-MA treatment further lowered the ethanol-decrease in hepatic GSH levels and further increased formation of TBARS in WT and KI mice, whereas rapamycin blunted these effects of ethanol. Neither 3-MA nor rapamycin treatment affected CYP2E1 catalytic activity or content or the induction CYP2E1 by ethanol. The 3-MA treatment decreased levels of Beclin-1 and Atg 7 but increased levels of p62 in the ethanol-fed WT and KI mice whereas rapamycin had the opposite effects, validating inhibition and stimulation of autophagy, respectively. These

  16. Cytochrome p450 2E1 polymorphisms and the risk of gastric cardia cancer

    Institute of Scientific and Technical Information of China (English)

    Lin Cai; Zong-Li Zheng; Zuo-Feng Zhang

    2005-01-01

    AIM: Genetic polymorphisms of drug-metabolizing enzymes have recently been shown to affect susceptibility to chemical carcinogenesis. Cytochrome P450 2E1 (CYP2E1)enzyme catalyzes the metabolism of many procarcinogens,such as N-nitrosamines and related compounds. The gene coding for this enzyme is polymorphic and thus may play a role in gastric cardia cancer (GCC) etiology. In this hospital-based case-control study, we evaluate the relationship between genetic polymorphisms of CYP2E1and the risk of GCC.METHODS: The study subjects comprised 159 histologically confirmed GCC cases identified via hospital cancer registry and surgical records at five hospitals in Fuzhou, Fujian Province, China, between April and November 2001.Controls were 192 patients admitted to the same hospitals for nonmalignant conditions. The genotypes of CYP2E1were detected by a PCR-based RFLP assay. The odds ratios were estimated by logistic regression analyses and were adjusted for potential confounding factors.RESULTS: The distribution of three genotypes of CYP2E1in GCC cases and controls was significantly different (X2 = 16.04, P<0.01). The frequency of the CYP2E1 (c1/c1)genotype in GCC cases and controls was 60.4% and 40.1%,respectively. The CYP2E1 (c1/c1) genotype was associated with an increased risk for GCC (the adjusted (OR) was 2.37, 95% confidence interval (CI): 1.52-3.70). Subjects who carried the CYP2E 1 (c1/c1) genotype and were habitual smokers were at a significantly higher risk of developing GCC (OR = 4.68, 95%CI: 2.19-10.04) compared with those who had the CYP2E1 (c1/c2or c2/c2') genotype and did not smoke.CONCLUSION: These results suggest that the CYP2E 1genotype may influence individual susceptibility to development of GCC, and that the risk increases significantly in smokers.

  17. Expression of Estrogen Sulfotransferase 1E1 and Steroid Sulfatase in Breast Cancer: A Immunohistochemical Study

    Directory of Open Access Journals (Sweden)

    D. Poisson Paré

    2009-01-01

    Full Text Available It is known that the steroid sulfatase (STS and the estrogen sulfotransferase (EST1E1 are commonly expressed in human breast carcinomas. STS and EST1E1 combined action could maintain the equilibrium between sulfated (inactive and unconjugated (active estrogens, which might have effects on development of hormone dependent breast cancer. We studied the expression of the STS and EST1E1 in 88 breast carcinomas and 57 adjacent non-malignant tissues by immunohistochemistry. The results were correlated with the tumor expression of estrogen receptor α (ER-α and β (ER-β, progesterone receptor A (PR-A and B (PR-B and the proliferation marker CDC47, the tumoral type and stage and the age at surgery. STS expression was higher in carcinoma specimens than in adjacent normal tissues, although not to a significant level (p = 0.064 and it was positively associated with CDC47 expression (p 0.05. These observations support the hypothesis that STS is overexpressed in breast cancer and associated with a worse prognosis. EST1E1 was observed for the first time in the nuclei of epithelial and tumoral cells. Tumor expression of EST1E1 was positively correlated with ER-β (p 0.01 and PR-B (p 0.05, two steroid receptors already associated with an improve prognosis for breast cancer. Controlling the STS overexpression in carcinomas could be a way to inhibit cancer growth. The significance of the association between EST1E1 and ER-β or PR-B should be further studied since these two receptors are transcription activators and may regulate the expression of protective enzymes like EST1E1.

  18. Mutation in E1, the ubiquitin activating enzyme, reduces Drosophila lifespan and results in motor impairment.

    Science.gov (United States)

    Liu, Hsiu-Yu; Pfleger, Cathie M

    2013-01-01

    Neurodegenerative diseases cause tremendous suffering for those afflicted and their families. Many of these diseases involve accumulation of mis-folded or aggregated proteins thought to play a causal role in disease pathology. Ubiquitinated proteins are often found in these protein aggregates, and the aggregates themselves have been shown to inhibit the activity of the proteasome. These and other alterations in the Ubiquitin Pathway observed in neurodegenerative diseases have led to the question of whether impairment of the Ubiquitin Pathway on its own can increase mortality or if ongoing neurodegeneration alters Ubiquitin Pathway function as a side-effect. To address the role of the Ubiquitin Pathway in vivo, we studied loss-of-function mutations in the Drosophila Ubiquitin Activating Enzyme, Uba1 or E1, the most upstream enzyme in the Ubiquitin Pathway. Loss of only one functional copy of E1 caused a significant reduction in adult lifespan. Rare homozygous hypomorphic E1 mutants reached adulthood. These mutants exhibited further reduced lifespan and showed inappropriate Ras activation in the brain. Removing just one functional copy of Ras restored the lifespan of heterozygous E1 mutants to that of wild-type flies and increased the survival of homozygous E1 mutants. E1 homozygous mutants also showed severe motor impairment. Our findings suggest that processes that impair the Ubiquitin Pathway are sufficient to cause early mortality. Reduced lifespan and motor impairment are seen in the human disease X-linked Infantile Spinal Muscular Atrophy, which is associated with mutation in human E1 warranting further analysis of these mutants as a potential animal model for study of this disease.

  19. Cytochrome P450-2E1 promotes fast food-mediated hepatic fibrosis

    Science.gov (United States)

    Abdelmegeed, Mohamed A.; Choi, Youngshim; Godlewski, Grzegorz; Ha, Seung-Kwon; Banerjee, Atrayee; Jang, Sehwan; Song, Byoung-Joon

    2017-01-01

    Cytochrome P450-2E1 (CYP2E1) increases oxidative stress. High hepatic cholesterol causes non-alcoholic steatohepatitis (NASH) and fibrosis. Thus, we aimed to study the role of CYP2E1 in promoting liver fibrosis by high cholesterol-containing fast-food (FF). Male wild-type (WT) and Cyp2e1-null mice were fed standard chow or FF for 2, 12, and 24 weeks. Various parameters of liver fibrosis and potential mechanisms such as oxidative and endoplasmic reticulum (ER) stress, inflammation, and insulin resistance (IR) were studied. Indirect calorimetry was also used to determine metabolic parameters. Liver histology showed that only WT fed FF (WT-FF) developed NASH and fibrosis. Hepatic levels of fibrosis protein markers were significantly increased in WT-FF. The nitroxidative stress marker iNOS, but not CYP2E1, was significantly elevated only in FF-fed WT. Serum endotoxin, TLR-4 levels, and inflammatory markers were highest in WT-FF. FAS, PPAR-α, PPAR-γ, and CB1-R were markedly altered in WT-FF. Electron microscopy and immunoblot analyses showed significantly higher levels of ER stress in FF-fed WT. Indirect calorimetry showed that Cyp2e1-null-mice fed FF exhibited consistently higher total energy expenditure (TEE) than their corresponding WT. These results demonstrate that CYP2E1 is important in fast food-mediated liver fibrosis by promoting nitroxidative and ER stress, endotoxemia, inflammation, IR, and low TEE. PMID:28051126

  20. CYP2E1-dependent elevation of serum cholesterol, triglycerides, and hepatic bile acids by isoniazid.

    Science.gov (United States)

    Cheng, Jie; Krausz, Kristopher W; Li, Feng; Ma, Xiaochao; Gonzalez, Frank J

    2013-01-15

    Isoniazid is the first-line medication in the prevention and treatment of tuberculosis. Isoniazid is known to have a biphasic effect on the inhibition-induction of CYP2E1 and is also considered to be involved in isoniazid-induced hepatotoxicity. However, the full extent and mechanism of involvement of CYP2E1 in isoniazid-induced hepatotoxicity remain to be thoroughly investigated. In the current study, isoniazid was administered to wild-type and Cyp2e1-null mice to investigate the potential toxicity of isoniazid in vivo. The results revealed that isoniazid caused no hepatotoxicity in wild-type and Cyp2e1-null mice, but produced elevated serum cholesterol and triglycerides, and hepatic bile acids in wild-type mice, as well as decreased abundance of free fatty acids in wild-type mice and not in Cyp2e1-null mice. Metabolomic analysis demonstrated that production of isoniazid metabolites was elevated in wild-type mice along with a higher abundance of bile acids, bile acid metabolites, carnitine and carnitine derivatives; these were not observed in Cyp2e1-null mice. In addition, the enzymes responsible for bile acid synthesis were decreased and proteins involved in bile acid transport were significantly increased in wild-type mice. Lastly, treatment of targeted isoniazid metabolites to wild-type mice led to similar changes in cholesterol, triglycerides and free fatty acids. These findings suggest that while CYP2E1 is not involved in isoniazid-induced hepatotoxicity, while an isoniazid metabolite might play a role in isoniazid-induced cholestasis through enhancement of bile acid accumulation and mitochondria β-oxidation. Published by Elsevier Inc.

  1. Neutrophil Resolvin E1 Receptor Expression and Function in Type 2 Diabetes.

    Science.gov (United States)

    Freire, Marcelo O; Dalli, Jesmond; Serhan, Charles N; Van Dyke, Thomas E

    2017-01-15

    Unresolved inflammation is key in linking metabolic dysregulation and the immune system in type 2 diabetes. Successful regulation of acute inflammation requires biosynthesis of specialized proresolving lipid mediators, such as E-series resolvin (RvE) 1, and activation of cognate G protein-coupled receptors. RvE1 binds to leukotriene B4 (BLT-1) on neutrophils and to ERV-1/ChemR23 on monocyte/macrophages. We show novel actions of RvE1 and expression patterns of neutrophil receptors in type 2 diabetes. Neutrophils from healthy subjects express functional BLT-1, low levels of minimally functional ERV-1, and inversed coexpression when compared to neutrophils from type 2 diabetes subjects. Stimulation with TNF-α or LPS increased the expression of ERV-1 by healthy and diabetic neutrophils. RvE1 counteracted LPS and TNF-α induction of ERV-1 overexpression and endogenous diabetic overexpression, activating phagocytosis and resolution signals. Functional ERV-1 was determined by phosphorylation of the signaling protein ribosomal S6. Receptor-antagonism experiments revealed that the increase in phosphorylation of ribosomal S6 was mediated by BLT-1 in healthy subject neutrophils and by ERV-1 in diabetes. Metabololipidomics reveal a proinflammatory profile in diabetic serum. Cell phagocytosis is impaired in type 2 diabetes and requires RvE1 for activation. The dose of RvE1 required to activate resolution signals in type 2 diabetic neutrophils was significantly higher than in healthy controls. RvE1 rescues the dysregulation seen on neutrophil receptor profile and, following a therapeutic dosage, activates phagocytosis and resolution signals in type 2 diabetes. These findings reveal the importance of resolution receptors in health, disease, and dysregulation of inflammation in type 2 diabetes.

  2. Spectral factorization using the delta operator

    DEFF Research Database (Denmark)

    Rostgaard, Morten; Poulsen, Niels Kjølstad; Ravn, Ole

    1994-01-01

    In recent years many papers have been published abouth the gamma-operator, mostly caused by the better numerical properties and the rapprochement between continuous and discrete time. A major problem within the LQG-design of a delta-based input-output relation has been how to spectral-factorize i......In recent years many papers have been published abouth the gamma-operator, mostly caused by the better numerical properties and the rapprochement between continuous and discrete time. A major problem within the LQG-design of a delta-based input-output relation has been how to spectral......-factorize in an efficient way. The discrete-time method of Kuccera will not be applied since numerical word-length characteristics will be poor for fast sampling rates. In this paper a new approach is considered. A new gamma-operator (Tustin operator) is introduced, in order to make an iterative and numerical stable...

  3. Nucleon and Delta structure in continuum QCD

    Science.gov (United States)

    Cloet, Ian

    2014-03-01

    Quantum Chromodynamics (QCD) is the only known example in nature of a fundamental quantum field theory that is innately non-perturbative. Solving QCD will have profound implications for our understanding of the natural world, for example, it will explain how light quarks and massless gluons bind together to form the observed mesons and baryons; hence explaining the origin of more than 98% of the mass in the visible universe. Given the challenges posed by QCD, it is insufficient to study hadron ground-states alone if one seeks a solution; in this regard the delta plays a special role as the lightest baryon resonance. I will discuss recent progress using continuum QCD approaches to the study of nucleon and delta properties, with a focus on insights gained by the calculation (and measurement) of their electromagnetic form factors.

  4. Pluviometric anomaly in the Llobregat Delta

    Directory of Open Access Journals (Sweden)

    J. Mazón

    2009-01-01

    Full Text Available The data from surface automatic weather stations show that in the area of the Llobregat delta (northeast of the Iberian Peninsula we can observe greater precipitation than in nearby inland areas (Ordal, Collserola, Garraf, than on the other side of a massif located on the coast (Garraf and than on the northern coast. This distribution of the precipitation could be explained by the formation of a nocturnal surface cold front in the Llobregat delta. In order to analyze in-depth the physical mechanisms that can influence the formation of this front (topography, sea and drainage winds, two rain episodes in the area were simulated with the MM5 mesoscale model, reproducing satisfactorily the physical mechanisms that favor the appearance of the front.

  5. On regularizations of the Dirac delta distribution

    Science.gov (United States)

    Hosseini, Bamdad; Nigam, Nilima; Stockie, John M.

    2016-01-01

    In this article we consider regularizations of the Dirac delta distribution with applications to prototypical elliptic and hyperbolic partial differential equations (PDEs). We study the convergence of a sequence of distributions SH to a singular term S as a parameter H (associated with the support size of SH) shrinks to zero. We characterize this convergence in both the weak-* topology of distributions and a weighted Sobolev norm. These notions motivate a framework for constructing regularizations of the delta distribution that includes a large class of existing methods in the literature. This framework allows different regularizations to be compared. The convergence of solutions of PDEs with these regularized source terms is then studied in various topologies such as pointwise convergence on a deleted neighborhood and weighted Sobolev norms. We also examine the lack of symmetry in tensor product regularizations and effects of dissipative error in hyperbolic problems.

  6. Matrix multiplication on the Intel Touchstone Delta

    Energy Technology Data Exchange (ETDEWEB)

    Huss-Lederman, S.; Jacobson, E.M.; Tsao, A. [Supercomputing Research Center, Bowie, MD (United States); Zhang, G. [CONVEX Computer Corp., Richardson, TX (United States)

    1993-12-31

    Matrix multiplication is a key primitive in block matrix algorithms such as those found in LAPACK. We present results from our study of matrix multiplication algorithms on the Intel Touchstone Delta, a distributed memory message-passing architecture with a two-dimensional mesh topology. We obtain an implementation that uses communication primitives highly suited to the Delta and exploits the single node assembly-coded matrix multiplication. Our algorithm is completely general, able to deal with arbitrary mesh aspect ratios and matrix dimensions, and has achieved parallel efficiency of 86% with overall peak performance in excess of 8 Gflops on 256 nodes for an 8800 {times} 8800 matrix. We describe our algorithm design and implementation, and present performance results that demonstrate scalability and robust behavior over varying mesh topologies.

  7. Clostridium perfringens Delta-Toxin Induces Rapid Cell Necrosis.

    Directory of Open Access Journals (Sweden)

    Soshi Seike

    Full Text Available Clostridium perfringens delta-toxin is a β-pore-forming toxin and a putative pathogenic agent of C. perfringens types B and C. However, the mechanism of cytotoxicity of delta-toxin remains unclear. Here, we investigated the mechanisms of cell death induced by delta-toxin in five cell lines (A549, A431, MDCK, Vero, and Caco-2. All cell lines were susceptible to delta-toxin. The toxin caused rapid ATP depletion and swelling of the cells. Delta-toxin bound and formed oligomers predominantly in plasma membrane lipid rafts. Destruction of the lipid rafts with methyl β-cyclodextrin inhibited delta-toxin-induced cytotoxicity and ATP depletion. Delta-toxin caused the release of carboxyfluorescein from sphingomyelin-cholesterol liposomes and formed oligomers; toxin binding to the liposomes declined with decreasing cholesterol content in the liposomes. Flow cytometric assays with annexin V and propidium iodide revealed that delta-toxin treatment induced an elevation in the population of annexin V-negative and propidium iodide-positive cells. Delta-toxin did not cause the fragmentation of DNA or caspase-3 activation. Furthermore, delta-toxin caused damage to mitochondrial membrane permeability and cytochrome c release. In the present study, we demonstrate that delta-toxin produces cytotoxic activity through necrosis.

  8. Elastic and transition form factors of the \\Delta(1232)

    CERN Document Server

    Segovia, Jorge; Cloët, Ian C; Roberts, Craig D; Schmidt, Sebastian M; Wan, Shaolong

    2013-01-01

    Predictions obtained with a confining, symmetry-preserving treatment of a vector-vector contact interaction at leading-order in a widely used truncation of QCD's Dyson-Schwinger equations are presented for \\Delta and \\Omega baryon elastic form factors and the \\gamma N -> \\Delta transition form factors. This simple framework produces results that are practically indistinguishable from the best otherwise available, an outcome which highlights that the key to describing many features of baryons and unifying them with the properties of mesons is a veracious expression of dynamical chiral symmetry breaking in the hadron bound-state problem. The following specific results are of particular interest. The \\Delta elastic form factors are very sensitive to m_\\Delta. Hence, given that the parameters which define extant simulations of lattice-regularised QCD produce \\Delta-resonance masses that are very large, the form factors obtained therewith are a poor guide to properties of the \\Delta(1232). Considering the \\Delta-b...

  9. [Quantitative relationship between molecular structure of polychlorinated biphenyls (PCBs) and enthalpy change (deltaH), entropy change (deltaS') in chromatographic process].

    Science.gov (United States)

    Zhang, Qing; Dai, Chaozheng

    2005-09-01

    The relationship between the rule of chromatographic retention value and molecular structure is an important part in the research of chromatographic thermodynamics. The topological index structural parameter JG and the topological index adjoining parameter LJ are put forward. Parameter J(G) describes the correlation of quantity and position of chlorine atoms in polychlorinated biphenyl (PCB) molecules. Parameter L(J) describes the ortho-position correlation of chlorine atoms in PCB molecules. The relational expression between the PCB molecular structures and their enthalpy change (deltaH), entropy change (deltaS') in chromatographic process was discovered. The values of enthalpy change and entropy change for about 140 kinds of polychlorinated biphenyls in chromatographic process on three stationary phases, DB-1, DB-5 and DB-1701, were determined. In comparison with deltaH and deltaS' of the experimental data those calculated from the relational expression had the average relative deviations for deltaH and deltaS' are 0.56% -0.97% and 0.55% - 1.06%, respectively.

  10. Performance evaluation of photonic Sigma Delta ADCS

    OpenAIRE

    Tan, Yean Wee

    2010-01-01

    Approved for public release; distribution is unlimited The integration of photonic and electronic components to realize a photonic sigma delta ADC is considered in this thesis. The integration process was broken up into steps. First, the performance of a pair of dual-port Mach-Zehnder interferometers (MZI) modulating a train of narrow high-speed laser pulses from a mode-locked laser was investigated. Various parameters like the half-wave voltage (V) and insertion loss were verified. Nex...

  11. Delta Greenbriar - Atlanta – (EE. UU.

    Directory of Open Access Journals (Sweden)

    Heery, George

    1975-05-01

    Full Text Available «Delta Greenbriar» is a corporate centre for the Delta air line company. The complex comprises four buildings containing: 1 the installations for flight simulation; 2 the air training base; 3 the control centre for flights and communications; 4 the department for tickets and reservations. They consist of one of two storeys. The lower ones can be extended both horizontally as well as vertically, whereas the other ones can only be enlarged in horizontal direction. The unit has been designed like a university campus, with patios, inner gardens and exterior corridors which apart from connecting the various buildings with each other also provide a close contact between the office premises and the park.El «Delta Greenbriar» es un centro corporativo para la compañía de líneas aéreas Delta. El complejo está constituido por cuatro edificios, que alojan: 1 las instalaciones para la simulación de vuelo; 2 la base de entrenamiento aéreo; 3 el centro de control de vuelo y comunicaciones; 4 el departamento de reservas y venta de billetes. Constan de una o dos plantas, pudiéndose ampliar los más bajos tanto horizontal como verticalmente, mientras que los otros sólo pueden aumentarse en sentido horizontal. El conjunto se ha diseñado como un campus universitario, con patios, ajardinamiento interior y corredores exteriores que, además de enlazar los distintos edificios entre sí, ponen en estrecha relación los espacios de oficinas con el parque.

  12. Evolution of Modern Yellow River Delta Coast

    Institute of Scientific and Technical Information of China (English)

    尹延鸿; 周永青; 丁东

    2004-01-01

    This paper deals with the development and evolution of modem Yellow River delta and the erosion or deposition rates of its different sections. In June, 1996,Yellow Rivers terminal course was artificially turned eastwards to empty into the sea and then the 11th lobe of the modern Yellow River delta began to form. This course change may mark the beginning of the 3rd subdelta formation. As a result of that, the Yellow River delta advances towards east by north with the 1st, 2nd and 3rd subdeltas arranged in succession. Coast zone in the deltaic area is divided into 7 different sections according to their different erosion or deposition rates: the relatively stable section from Dakou River to Shunjiang Stream, the weakly retreating section from Shun jiang Stream to the Tiaohe River mouth, the strongly retreating section from the Tiaohe River mouth to the station 106, the artificially stable section due to stone dam protection from the station 106 to Gudong Oilfield, the strong deposition section from Gudong Oilfield to Dawenliu Haipu, the weakly deposition section from Dawenliu Haipu to the Zimai Stream mouth, and the stable section from the Zimai Stream mouth to the Jiaolai River mouth. It is predicted that the erosion and deposition situations of the sections will nearly remain the same in 10 years, but the retreating and silting-up rates will tend to become slower gradually. Human activities have an evident influence on the changes of the coastline.

  13. GLOBAL CHARM OF THE CHANGJIANG RIVER DELTA

    Institute of Scientific and Technical Information of China (English)

    CHEN Shu-peng; ZHOU Cheng-hu; CHEN Qiu-xiao

    2003-01-01

    Based on the theory of geo-economy, under the new situation of global economy, information network and China's entry into WTO, also with the holding of APEC (in 2001) and the International Exposition in the near future, the Changjiang (Yangtze) River Delta is striding toward the spectacular international multi-polar situation and becomes one of core regions with high-speed development. Facing the ocean and world all along, leading the progressive tides of the age and scintillating the splendor of the nation, she does advance with time. Through a long period of irrigation projects construction and intensive operation of lands in previous agricultural society, the artificial wetland ecosystem with a positive cycle had ever been formed in this region. At present, environmental pollution and urban expansion resulted from post-industrialization are being rectified. The delta will be the paradigm of industrial and agricultural modernization along the sustainable development road. With the rapid development of urbanization,she has been one of the regions with the highest density population and high urbanization level. Taking the Changjiang River estuary and the Hangzhou Bay as two parts, she is continuously strengthening and adjusting her interiorstructure, expanding mothball space and constructing the oriental modern "logistics center" to link the whole world. The butterfly-style urban system of the Changjiang River Delta is flying, probably engendering earthshaking "butterfly effect".

  14. Delta: Data Reduction for Integrated Application Workflows.

    Energy Technology Data Exchange (ETDEWEB)

    Lofstead, Gerald Fredrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jean-Baptiste, Gregory [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Oldfield, Ron A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-06-01

    Integrated Application Workflows (IAWs) run multiple simulation workflow components con- currently on an HPC resource connecting these components using compute area resources and compensating for any performance or data processing rate mismatches. These IAWs require high frequency and high volume data transfers between compute nodes and staging area nodes during the lifetime of a large parallel computation. The available network band- width between the two areas may not be enough to efficiently support the data movement. As the processing power available to compute resources increases, the requirements for this data transfer will become more difficult to satisfy and perhaps will not be satisfiable at all since network capabilities are not expanding at a comparable rate. Furthermore, energy consumption in HPC environments is expected to grow by an order of magnitude as exas- cale systems become a reality. The energy cost of moving large amounts of data frequently will contribute to this issue. It is necessary to reduce the volume of data without reducing the quality of data when it is being processed and analyzed. Delta resolves the issue by addressing the lifetime data transfer operations. Delta removes subsequent identical copies of already transmitted data during transfers and restores those copies once the data has reached the destination. Delta is able to identify duplicated information and determine the most space efficient way to represent it. Initial tests show about 50% reduction in data movement while maintaining the same data quality and transmission frequency.

  15. Modelling repeatedly flaring delta-sunspots

    CERN Document Server

    Chatterjee, Piyali; Carlsson, Mats

    2016-01-01

    Active regions (AR) appearing on the surface of the Sun are classified into $\\alpha$, $\\beta$, $\\gamma$, and $\\delta$ by the rules of the Mount Wilson Observatory, California on the basis of their topological complexity. Amongst these, the $\\delta$-sunspots are known to be super-active and produce the most X-ray flares. Here, we present results from a simulation of the Sun by mimicking the upper layers and the corona, but starting at a more primitive stage than any earlier treatment. We find that this initial state consisting of only a thin sub-photospheric magnetic sheet breaks into multiple flux-tubes which evolve into a colliding-merging system of spots of opposite polarity upon surface emergence, similar to those often seen on the Sun. The simulation goes on to produce many exotic $\\delta$-sunspot associated phenomena: repeated flaring in the range of typical solar flare energy release and ejective helical flux ropes with embedded cool-dense plasma filaments resembling solar coronal mass ejections.

  16. Understanding delta-sigma data converters

    CERN Document Server

    Pavan, Shanti; Temes, Gabor C

    2017-01-01

    This new edition introduces novel analysis and design techniques for delta-sigma (ΔΣ) converters in physical and conceptual terms, and includes new chapters that explore developments in the field over the last decade. This book explains the principles and operation of delta-sigma analog-to-digital converters (ADCs) in physical and conceptual terms in accordance with the most recent developments in the field. The interest of ΔΣ converter designers has shifted significantly over the past decade, due to many new applications for data converters at the far ends of the frequency spectrum. Continuous-time delta-sigma A/D converters with GHz clocks, of both lowpass and bandpass types, are required for wireless applications. At the other extreme, multiplexed ADCs with very narrow (sometimes 10 Hz wide) signal bandwidths, but very high accuracy are needed in the interfaces of biomedical and environmental sensors. To reflect the changing eeds of designers, the second edition includes significant new material on bo...

  17. DDX3 regulates cell growth through translational control of cyclin E1.

    Science.gov (United States)

    Lai, Ming-Chih; Chang, Wen-Cheng; Shieh, Sheau-Yann; Tarn, Woan-Yuh

    2010-11-01

    DDX3 belongs to the DEAD box family of RNA helicases, but the details of its biological function remain largely unclear. Here we show that knockdown of DDX3 expression impedes G(1)/S-phase transition of the cell cycle. To know how DDX3 may act in cell cycle control, we screened for cellular mRNA targets of DDX3. Many of the identified DDX3 targets encoded cell cycle regulators, including G(1)/S-specific cyclin E1. DDX3 depletion specifically downregulates translation of cyclin E1 mRNA. Moreover, our data suggest that DDX3 participates in translation initiation of targeted mRNAs as well as in cell growth control via its RNA helicase activity. Consistent with these findings, we show that in the temperature-sensitive DDX3 mutant hamster cell line tsET24, cyclin E1 expression is downregulated at a nonpermissive temperature that inactivates mutant DDX3. Taken together, our results indicate that DDX3 is critical for translation of cyclin E1 mRNA, which provides an alternative mechanism for regulating cyclin E1 expression during the cell cycle.

  18. Cooperative effects for CYP2E1 differ between styrene and its metabolites

    Science.gov (United States)

    Hartman, Jessica H.; Boysen, Gunnar; Miller, Grover P.

    2014-01-01

    Cooperative interactions are frequently observed in the metabolism of drugs and pollutants by cytochrome P450s; nevertheless, the molecular determinants for cooperativity remain elusive. Previously, we demonstrated that steady-state styrene metabolism by CYP2E1 exhibits positive cooperativity.We hypothesized that styrene metabolites have lower affinity than styrene toward CYP2E1 and limited ability to induce cooperative effects during metabolism. To test the hypothesis, we determined the potency and mechanism of inhibition for styrene and its metabolites toward oxidation of 4-nitrophenol using CYP2E1 Supersomes® and human liver microsomes.Styrene inhibited the reaction through a mixed cooperative mechanism with high affinity for the catalytic site (67 μM) and lower affinity for the cooperative site (1100 μM), while increasing substrate turnover at high concentrations. Styrene oxide and 4-vinylphenol possessed similar affinity for CYP2E1. Styrene oxide behaved cooperatively like styrene, but 4-vinylphenol decreased turnover at high concentrations. Styrene glycol was a very poor competitive inhibitor. Among all compounds, there was a positive correlation with binding and hydrophobicity.Taken together, these findings for CYP2E1 further validate contributions of cooperative mechanisms to metabolic processes, demonstrate the role of molecular structure on those mechanisms and underscore the potential for heterotropic cooperative effects between different compounds. PMID:23327532

  19. Silencing E1A mRNA by RNA interference inhibits adenovirus replication.

    Science.gov (United States)

    Chung, Y-S; Kim, M-K; Lee, W-J; Kang, C

    2007-01-01

    The adenovirus family contains 51 human serotypes, and most human adenoviruses cause widespread respiratory tract infections. Adenovirus infections can result in severe complications in some cases, such as in adenovirus type 11 infection in immunocompromised patients. However, effective treatment methods for adenovirus infections are currently unavailable. This prompted the search for antiviral agents effective against adenovirus infections. In the present study, adenovirus E1A was targeted by RNA interference (RNAi) using synthetic small interfering RNAs (siRNAs) in an attempt to inhibit viral replication, since adenovirus E1A proteins are known to be involved in the transcriptional activation of the viral and cellular genes necessary for controlling the cell cycle and viral replication. The results indicated that the siRNAs effectively reduced the amount of adenovirus E1A mRNA and the levels of replicative intermediates. Additionally, siRNA-mediated gene silencing inhibited adenovirus replication by suppressing the E1A mRNA. These results suggest that the RNAi-mediated targeting of adenovirus E1A may have a potentially therapeutic effect in controlling adenovirus infections.

  20. 2-Carboxyquinoxalines kill mycobacterium tuberculosis through noncovalent inhibition of DprE1.

    Science.gov (United States)

    Neres, João; Hartkoorn, Ruben C; Chiarelli, Laurent R; Gadupudi, Ramakrishna; Pasca, Maria Rosalia; Mori, Giorgia; Venturelli, Alberto; Savina, Svetlana; Makarov, Vadim; Kolly, Gaelle S; Molteni, Elisabetta; Binda, Claudia; Dhar, Neeraj; Ferrari, Stefania; Brodin, Priscille; Delorme, Vincent; Landry, Valérie; de Jesus Lopes Ribeiro, Ana Luisa; Farina, Davide; Saxena, Puneet; Pojer, Florence; Carta, Antonio; Luciani, Rosaria; Porta, Alessio; Zanoni, Giuseppe; De Rossi, Edda; Costi, Maria Paola; Riccardi, Giovanna; Cole, Stewart T

    2015-03-20

    Phenotypic screening of a quinoxaline library against replicating Mycobacterium tuberculosis led to the identification of lead compound Ty38c (3-((4-methoxybenzyl)amino)-6-(trifluoromethyl)quinoxaline-2-carboxylic acid). With an MIC99 and MBC of 3.1 μM, Ty38c is bactericidal and active against intracellular bacteria. To investigate its mechanism of action, we isolated mutants resistant to Ty38c and sequenced their genomes. Mutations were found in rv3405c, coding for the transcriptional repressor of the divergently expressed rv3406 gene. Biochemical studies clearly showed that Rv3406 decarboxylates Ty38c into its inactive keto metabolite. The actual target was then identified by isolating Ty38c-resistant mutants of an M. tuberculosis strain lacking rv3406. Here, mutations were found in dprE1, encoding the decaprenylphosphoryl-d-ribose oxidase DprE1, essential for biogenesis of the mycobacterial cell wall. Genetics, biochemical validation, and X-ray crystallography revealed Ty38c to be a noncovalent, noncompetitive DprE1 inhibitor. Structure-activity relationship studies generated a family of DprE1 inhibitors with a range of IC50's and bactericidal activity. Co-crystal structures of DprE1 in complex with eight different quinoxaline analogs provided a high-resolution interaction map of the active site of this extremely vulnerable target in M. tuberculosis.

  1. Activation of the human beta interferon gene by the adenovirus type 12 E1B gene

    Energy Technology Data Exchange (ETDEWEB)

    Shiroki, K.; Toth, M.

    1988-01-01

    The transcription of endogenous beta interferon mRNA was activated in human embryo kidney (HEK) cells infected with adenovirus 12 (Ad12) but was activated only inefficiently or not at all in HEK cells infected with Ad5 and rc-1 (Ad5 dl312 containing the Ad12 E1A region). The analysis with Ad12 mutants showed that Ad12 E1B products, especially the 19K protein, were important for the expression of the endogenous beta interferon gene and Ad12 E1A products were not involved in the expression. The expression of exogeneously transfected pIFN-CAT (a hybrid plasmid having the human beta interferon promoter fused with the CAT gene) was activated in HEK and chicken embryo fibroblast (CEF) cells infected with either Ad12 or Ad5. The analysis of cotransfection of CEF cells with pIFN-CAT and plasmids containing fragments of Ad12 or Ad5 DNA showed that Ad12 or Ad5 E1B (possibly the 19K protein) was and E1A was not involved in the expression of the exogenous pIFN-CAT.

  2. E1B and E4 oncoproteins of adenovirus antagonize the effect of apoptosis inducing factor

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Roberta L. [Department of Microbiology and Immunology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Wilkinson, John C., E-mail: john.wilkinson@ndsu.edu [Department of Biochemistry, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Ornelles, David A., E-mail: ornelles@wakehealth.edu [Department of Microbiology and Immunology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States)

    2014-05-15

    Adenovirus inundates the productively infected cell with linear, double-stranded DNA and an abundance of single-stranded DNA. The cellular response to this stimulus is antagonized by the adenoviral E1B and E4 early genes. A mutant group C adenovirus that fails to express the E1B-55K and E4ORF3 genes is unable to suppress the DNA-damage response. Cells infected with this double-mutant virus display significant morphological heterogeneity at late times of infection and frequently contain fragmented nuclei. Nuclear fragmentation was due to the translocation of apoptosis inducing factor (AIF) from the mitochondria into the nucleus. The release of AIF was dependent on active poly(ADP-ribose) polymerase-1 (PARP-1), which appeared to be activated by viral DNA replication. Nuclear fragmentation did not occur in AIF-deficient cells or in cells treated with a PARP-1 inhibitor. The E1B-55K or E4ORF3 proteins independently prevented nuclear fragmentation subsequent to PARP-1 activation, possibly by altering the intracellular distribution of PAR-modified proteins. - Highlights: • E1B-55K or E4orf3 prevents nuclear fragmentation. • Nuclear fragmentation requires AIF and PARP-1 activity. • Adenovirus DNA replication activates PARP-1. • E1B-55K or E4orf3 proteins alter the distribution of PAR.

  3. Purification and application of C-terminally truncated hepatitis C virus E1 proteins expressed in Escherichia coli

    Institute of Scientific and Technical Information of China (English)

    Jing Liu; Li-Xin Zhu; Yu-Ying Kong; Guang-Di Li; Yuan Wang

    2005-01-01

    AIM: To explore the possibility of expressing hepatitis C virus (HCV) envelope protein 1 (E1) in Escherichia coli(E.coli)and to test the purified recombinant E1 proteins for clinical and research applications. METHODS: C-terminally trunczated E1 fragments were expressed in E. coli as hexa-histidine-tagged fusion proteins. The expression products were purified under denaturing conditions using immobilized-metal affinity chromatography. Purified E1 proteins were used to immunize rabbits. Rabbit anti-sera thus obtained were reacted with both E. coli- and mammalian cell-expressed E1 glycoproteins as detected by Western blot.RESULTS: Full-length E1 protein proved difficult to express in E. coli. C-terminally truncated E1 was successfully expressed in E. coli as hexa-histidine-tagged recombinant fusion protein and was purified under denaturing conditions on Ni2+-NTA agarose. Rabbit anti-sera raised against purified recombinant E1 specifically reacted with mammalian cell-expressed E1 giycoproteins in Western blot. Furthermore, E. coli-derived E1 protein was able to detect animal antibodies elicited by E1-based DNA immunization.CONCLUSION: These results demonstrate that the prokaryotically expressed E1 proteins share identical epitopes with eukaryotically expressed E1 glycoprotein. The E. coli-derived E1 proteins and corresponding antisera can become useful tools in anti-HCV vaccine research.

  4. Adaptive Delta Management: cultural aspects of dealing with uncertainty

    Science.gov (United States)

    Timmermans, Jos; Haasnoot, Marjolijn; Hermans, Leon; Kwakkel, Jan

    2016-04-01

    Deltas are generally recognized as vulnerable to climate change and therefore a salient topic in adaptation science. Deltas are also highly dynamic systems viewed from physical (erosion, sedimentation, subsidence), social (demographic), economic (trade), infrastructures (transport, energy, metropolization) and cultural (multi-ethnic) perspectives. This multi-faceted dynamic character of delta areas warrants the emergence of a branch of applied adaptation science, Adaptive Delta Management, which explicitly focuses on climate adaptation of such highly dynamic and deeply uncertain systems. The application of Adaptive Delta Management in the Dutch Delta Program and its active international dissemination by Dutch professionals results in the rapid dissemination of Adaptive Delta Management to deltas worldwide. This global dissemination raises concerns among professionals in delta management on its applicability in deltas with cultural conditions and historical developments quite different from those found in the Netherlands and the United Kingdom where the practices now labelled as Adaptive Delta Management first emerged. This research develops an approach and gives a first analysis of the interaction between the characteristics of different approaches in Adaptive Delta Management and their alignment with the cultural conditions encountered in various delta's globally. In this analysis, first different management theories underlying approaches to Adaptive Delta Management as encountered in both scientific and professional publications are identified and characterized on three dimensions: The characteristics dimensions used are: orientation on today, orientation on the future, and decision making (Timmermans, 2015). The different underlying management theories encountered are policy analysis, strategic management, transition management, and adaptive management. These four management theories underlying different approaches in Adaptive Delta Management are connected to

  5. On the determination of low-energy constants for {delta}S=1 transitions

    Energy Technology Data Exchange (ETDEWEB)

    Giusti, L.; Pena, C. [European Organization for Nuclear Research, Geneva (Switzerland); Hernandez, P. [Dpto. Fisica Teorica and IFIC, Edificio Institutos Investigacion, Valencia (Spain); Laine, M. [Bielefeld Univ. (Germany). Fakultaet fuer Physik; Wennekers, J.; Wittig, H. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2005-10-01

    We present our preliminary results for three-point correlation functions involving the operators entering the {delta}S=1 effective Hamiltonian with an active charm quark, obtained using overlap fermions in the quenched approximation. This is the first computation carried out for valence quark masses small enough so as to permit a matching to Quenched Chiral Perturbation Theory in the {epsilon}-regime. The commonly observed large statistical fluctuations are tamed by means of low-mode averaging techniques, combined with restrictions to individual topological sectors. We also discuss the matching of the resulting hadronic matrix elements to the effective low-energy constants for {delta}S=1 transitions. This involves (a) finite-volume corrections which can be evaluated at NLO in Quenched Chiral Perturbation Theory, and (b) the short-distance renormalization of the relevant four-quark operators in discretizations based on the overlap operator. We discuss perturbative estimates for the renormalization factors and possible strategies for their non-perturbative evaluation. Our results can be used to isolate the long-distance contributions to the {delta}I=1/2 rule, coming from physics effects around the intrinsic QCD scale. (orig.)

  6. Calcification of MC3T3-E1 cells on titanium and zirconium.

    Science.gov (United States)

    Umezawa, Takayuki; Chen, Peng; Tsutsumi, Yusuke; Doi, Hisashi; Ashida, Maki; Suzuki, Shoichi; Moriyama, Keiji; Hanawa, Takao

    2015-01-01

    To confirm similarity of hard tissue compatibility between titanium and zirconium, calcification of MC3T3-E1 cells on titanium and zirconium was evaluated in this study. Mirror-polished titanium (Ti) and zirconium (Zr) disks and zirconium-sputter deposited titanium (Zr/Ti) were employed in this study. The surface of specimens were characterized using scanning electron microscopy and X-ray diffraction. Then, the cellular proliferation, differentiation and calcification of MC3T3-E1 cells on specimens were investigated. The surface of Zr/Ti was much smoother and cleaner than those of Ti and Zr. The proliferation of the cell was the same among three specimens, while the differentiation and calcification on Zr/Ti were faster than those on Ti and Zr. Therefore, Ti and Zr showed the identical hard tissue compatibility according to the evaluation with MC3T3-E1 cells. Sputter deposition may improve cytocompatibility.

  7. Double ion beams and accelerated ions observed by SWIDs on Chang'E-1

    Science.gov (United States)

    Kong, Linggao; Zhang, Aibing; Wang, Shijin

    2012-07-01

    Chang'E-1 is the first Chinese lunar exploration spacecraft launced in 2007. Solar Wind Ion Detectors(SWIDs) are two scientific instruments on Chang'E-1 to measure the solar wind and the plasma environment around the Moon. Some cases of double ion beams in solar wind were observed by SWIDs. These double ion beams present double proton beams with a single alpha beam. Another insteresting phenomenon observed by SWIDs is the accelerated ions when the spacecraft was over the magnetic anomalies. The magnetic anomaly may induce mini-magnetosphere, which was confirmed both by simulation and measurement of some other lunar exploration spacecrafts. The accelerated ions observed by Chang'E-1 may be the result of the interaction of the solar wind and the mini-magnetosphere of the Moon.

  8. Influence of Lactobacillus E1 on the Storage Stability in Emulsion Immobilization

    Institute of Scientific and Technical Information of China (English)

    SUN Xin; CHEN Xiguang; LIU Chengsheng; CHA Dongsu; PENG Hongni

    2009-01-01

    A coacervation method with double emulsion strategy (w/o/w) was used to prepare immobilized Lactobacillus E1. Diatomite was chosen as the carrier for bacteria. Sodium alginate,dextrin and gelatin were used as protective solutes for the preservation of Lactobacillus E1 and their effects on the storage viability during storage were discussed. The influence of storage temperature on the storage viability was also examined. The results show that high bacteria viable count over 109 cfu/g for an extended shelf life of 37 d can be achieved with 2% sodium alginate, 5% dextrin and 4% gelatin as protective solutes, at 10 ℃ of the storage temperature. This immobilized Lactobacillus E1 has potential use as functional food ingredient for both human dairy food and animal feedstuff.

  9. Inhibitory Potency of 4-Carbon Alkanes and Alkenes toward CYP2E1 Activity

    Science.gov (United States)

    Hartman, Jessica H.; Miller, Grover P.; Boysen, Gunnar

    2016-01-01

    CYP2E1 has been implicated in the bioactivation of many small molecules into reactive metabolites which form adducts with proteins and DNA, and thus a better understanding of the molecular determinants of its selectivity are critical for accurate toxicological predictions. In this study, we determined the potency of inhibition of human CYP2E1 for various 4-carbon alkanes, alkenes and alcohols. In addition, known CYP2E1 substrates and inhibitors including 4-methylpyrazole, aniline, and dimethylnitrosamine were included to determine their relative potencies. Of the 1,3-butadiene-derived metabolites studied, 3,4-epoxy-1-butene was the strongest inhibitor with an IC50 of 110 μM compared to 1700 μM and 6600 μM for 1,2-butenediol and 1,2:3,4-diepoxybutane, respectively. Compared to known inhibitors, inhibitory potency of 3,4-epoxy-1-butene is between 4-methylpyrazole (IC50 = 1.8 μM) and dimethylnitrosamine (IC50 = 230 μM). All three butadiene metabolites inhibit CYP2E1 activity through a simple competitive mechanism. Among the 4-carbon compounds studied, the presence and location of polar groups seems to influence inhibitory potency. To further examine this notion, the investigation was extended to include structurally and chemically similar analogs, including propylene oxide and various butane alcohols. Those results demonstrated preferential recognition of CYP2E1 toward the type and location of polar and hydrophobic structural elements. Taken together, CYP2E1 metabolism may be modified in vivo by exposure to 4-carbon compounds, such as drugs, and nutritional constituents, a finding that highlights the complexity of exposure to mixtures. PMID:24561005

  10. Propolis protects CYP 2E1 enzymatic activity and oxidative stress induced by carbon tetrachloride.

    Science.gov (United States)

    Bhadauria, Monika; Nirala, Satendra Kumar; Shukla, Sangeeta

    2007-08-01

    Induction of CYP 2E1 by carbon tetrachloride (CCl(4)) is one of the central pathways by which CCl(4) generates oxidative stress in hepatocytes. Experimental liver injury was induced in rats by CCl(4) to determine toxicological actions on CYP 2E1 by microsomal drug metabolizing enzymes. In this report, ethanolic extract of propolis at a dose of 200 mg/kg (po) was used after 24 h of toxicant administration to validate its protective potential. Intraperitoneal injection of CCl(4) (1.5 ml/kg) induced hepatotoxicity after 24 h of its administration that was associated with elevated malonyldialdehyde (index of lipid peroxidation), lactate dehydrogenase and gamma-glutamyl transpeptidase release (index of a cytotoxic effect). Hepatic microsomal drug metabolizing enzymes of CYP 2E1 showed sharp depletion as assessed by estimating aniline hydroxylase and amidopyrine N-demethylase activity after CCl(4) exposure. Toxic effect of CCl(4) was evident on CYP 2E1 activity by increased hexobarbitone induced sleep time and bromosulphalein retention. Propolis extract showed significant improvement in the activity of both enzymes and suppressed toxicant induced increase in sleep time and bromosulphalein retention. Choleretic activity of liver did not show any sign of toxicity after propolis treatment at a dose of 200 mg/kg (id). Histopathological evaluation of the liver revealed that propolis reduced the incidence of liver lesions including hepatocyte swelling and lymphocytic infiltrations induced by CCl(4). Electron microscopic observations also showed improvement in ultrastructure of liver and substantiated recovery in biochemical parameters. Protective activity of propolis at 200 mg/kg dose was statistically compared with positive control silymarin (50 mg/kg, po), a known hepatoprotective drug seems to be better in preventing hepatic CYP 2E1 activity deviated by CCl(4). These results lead us to speculate that propolis may play hepatoprotective role via improved CYP 2E1 activity and

  11. p53/E1b58kDa complex regulates adenovirus replication.

    Science.gov (United States)

    Ridgway, P J; Hall, A R; Myers, C J; Braithwaite, A W

    1997-10-27

    We have explored a role for the adenovirus (Ad5) E1b58kDa/p53 protein complex in adenovirus replication. This was done by using virus mutants containing different defects in the E1b58kDa gene and cell lines that express either a wild-type p53 protein or a mutant p53 protein. We find that infection of wild-type p53-containing cells with wild-type Ad5 causes a shutoff of p53 and alpha-actin protein synthesis by distinct mechanisms, but neither occurs in mutant p53 cells. Our data also indicate that the shutoff is dependent on formation of the p53/E1b complex and may also involve another virus protein, E4ORF6. Following from these observations we asked whether failure to form the complex resulted in impaired adenovirus replication. Our experiments showed that neither wild-type Ad5 nor the E1b mutant dl338 could replicate in cells expressing a mutant p53 protein, but that wild-type adenovirus replicated well in wild-type p53-expressing cells. Collectively, our data suggest that the interaction between p53 and the E1b58kDa protein is necessary for efficient adenovirus replication. This is the first time such a direct link between the complex and virus replication has been demonstrated. These data raise serious questions about the usefulness of E1b-defective viruses in tumor therapy.

  12. Functional characterisation of an engineered multidomain human P450 2E1 by molecular Lego.

    Science.gov (United States)

    Fairhead, Michael; Giannini, Silva; Gillam, Elizabeth M J; Gilardi, Gianfranco

    2005-12-01

    The human cytochrome P450s constitute an important family of monooxygenase enzymes that carry out essential roles in the metabolism of endogenous compounds and foreign chemicals. We present here results of a fusion between a human P450 enzyme and a bacterial reductase that for the first time is shown does not require the addition of lipids or detergents to achieve wild-type-like activities. The fusion enzyme, P450 2E1-BMR, contains the N-terminally modified residues 22-493 of the human P450 2E1 fused at the C-terminus to residues 473-1049 of the P450 BM3 reductase (BMR). The P450 2E1-BMR enzyme is active, self-sufficient and presents the typical marker activities of the native human P450 2E1: the hydroxylation of p-nitrophenol (KM=1.84+/-0.09 mM and kcat of 2.98+/-0.04 nmol of p-nitrocatechol formed per minute per nanomole of P450) and chlorzoxazone (KM=0.65+/-0.08 mM and kcat of 0.95+/-0.10 nmol of 6-hydroxychlorzoxazone formed per minute per nanomole of P450). A 3D model of human P450 2E1 was generated to rationalise the functional data and to allow an analysis of the surface potentials. The distribution of charges on the model of P450 2E1 compared with that of the FMN domain of BMR provides the ground for the understanding of the interaction between the fused domains. The results point the way to successfully engineer a variety of catalytically self-sufficient human P450 enzymes for drug metabolism studies in solution.

  13. DDX3 Regulates Cell Growth through Translational Control of Cyclin E1▿ †

    OpenAIRE

    2010-01-01

    DDX3 belongs to the DEAD box family of RNA helicases, but the details of its biological function remain largely unclear. Here we show that knockdown of DDX3 expression impedes G1/S-phase transition of the cell cycle. To know how DDX3 may act in cell cycle control, we screened for cellular mRNA targets of DDX3. Many of the identified DDX3 targets encoded cell cycle regulators, including G1/S-specific cyclin E1. DDX3 depletion specifically downregulates translation of cyclin E1 mRNA. Moreover, ...

  14. Thionin-D4E1 chimeric protein protects plants against bacterial infections

    Energy Technology Data Exchange (ETDEWEB)

    Stover, Eddie W; Gupta, Goutam; Hao, Guixia

    2017-08-08

    The generation of a chimeric protein containing a first domain encoding either a pro-thionon or thionin, a second domain encoding D4E1 or pro-D4E1, and a third domain encoding a peptide linker located between the first domain and second domain is described. Either the first domain or the second domain is located at the amino terminal of the chimeric protein and the other domain (second domain or first domain, respectively) is located at the carboxyl terminal. The chimeric protein has antibacterial activity. Genetically altered plants and their progeny expressing a polynucleotide encoding the chimeric protein resist diseases caused by bacteria.

  15. Improvements and Testing Practical Expressions for Photon Strength Functions of E1 Gamma-Transitions

    CERN Document Server

    Plujko, Vladimir; Kadenko, Igor; Solodovnyk, Kateryna

    2016-01-01

    Analytical expression for the E1 photon strength functions (PSF) is modified to account for the low-energy enhancement due to nuclear structure effects (presence of low-energy state (LES)). A closed-form expression of the E1 PSF function includes response of two nuclear states: LES and giant diplole resonance (GDR). Expression for the nuclear response function on electromagnetic field is based on a model of excitation of two coupled damped states. These approach is tested for different data sets for spherical nuclei. Impact on PSF shape of coupling between LES and GDR excitations is considered.

  16. E1A genes of adenovirus type 2 and type 5 are expressed at different levels

    DEFF Research Database (Denmark)

    Moritz, Constanze; Dobbelstein, Matthias

    2006-01-01

    Adenoviruses are an extensively studied system for modeling oncogenesis and for experimental cancer therapy. The most commonly analyzed virus types are 2 and 5, and little distinction has been made between them in past studies. Adenoviruses used for therapeutic purposes are frequently hybrids...... region. We found that the hybrid viruses replicated with considerably lower efficiency than their type 5 counterparts in H1299 cells (dl309:WtD = 3-4, dl338:dl1520 > 10). Moreover, adenovirus type 2 E1A expression from the hybrid viruses was strongly reduced in comparison to adenovirus type 5 E1A...

  17. CYP2E1-dependent elevation of serum cholesterol, triglycerides, and hepatic bile acids by isoniazid

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Jie; Krausz, Kristopher W. [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Li, Feng; Ma, Xiaochao [Department of Pharmacology, Toxicology and Therapeutics, The University of Kansas Medical Center, 4089 KLSIC, MS 1018, 3901 Rainbow Boulevard, Kansas City, KS 66160 (United States); Gonzalez, Frank J., E-mail: fjgonz@helix.nih.gov [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)

    2013-01-15

    Isoniazid is the first-line medication in the prevention and treatment of tuberculosis. Isoniazid is known to have a biphasic effect on the inhibition–induction of CYP2E1 and is also considered to be involved in isoniazid-induced hepatotoxicity. However, the full extent and mechanism of involvement of CYP2E1 in isoniazid-induced hepatotoxicity remain to be thoroughly investigated. In the current study, isoniazid was administered to wild-type and Cyp2e1-null mice to investigate the potential toxicity of isoniazid in vivo. The results revealed that isoniazid caused no hepatotoxicity in wild-type and Cyp2e1-null mice, but produced elevated serum cholesterol and triglycerides, and hepatic bile acids in wild-type mice, as well as decreased abundance of free fatty acids in wild-type mice and not in Cyp2e1-null mice. Metabolomic analysis demonstrated that production of isoniazid metabolites was elevated in wild-type mice along with a higher abundance of bile acids, bile acid metabolites, carnitine and carnitine derivatives; these were not observed in Cyp2e1-null mice. In addition, the enzymes responsible for bile acid synthesis were decreased and proteins involved in bile acid transport were significantly increased in wild-type mice. Lastly, treatment of targeted isoniazid metabolites to wild-type mice led to similar changes in cholesterol, triglycerides and free fatty acids. These findings suggest that while CYP2E1 is not involved in isoniazid-induced hepatotoxicity, while an isoniazid metabolite might play a role in isoniazid-induced cholestasis through enhancement of bile acid accumulation and mitochondria β-oxidation. -- Highlights: ► Isoniazid metabolites were elevated only in wild-type mice. ► Isoniazid caused no hepatotoxicity in wild-type and Cyp2e1-null mice. ► Isoniazid elevated serum cholesterol and triglycerides, and hepatic bile acids. ► Bile acid transporters were significantly decreased in isoniazid-treated mice.

  18. A regulatory variant in CYP2E1 affects the risk of lung squamous cell carcinoma.

    Science.gov (United States)

    Cao, Lei; Lin, Jia; He, Bing; Wang, Hongge; Rao, Juan; Liu, Yingwen; Zhang, Xuemei

    2014-01-01

    Cytochrome P450 2E1 (CYP2E1), an ethanol-inducible enzyme, has been shown to metabolically activate various carcinogens, which is critical for the development of cancers. It has been demonstrated that CYP2E1 polymorphisms alter the transcriptional activity. However, studies on the association between CYP2E1 -1239G>C polymorphism and non-small cell lung cancer have reported conflicting results. Thus, the gain of the present study was to investigate whether CYP2E1 -1239G>C polymorphism is associated with the development of non-small cell lung cancer in Chinese population. A case-control study was conducted in which CYP2E1 -1239G>C polymorphism was analyzed in 526 Chinese patients with non-small cell lung cancer and 526 age-matched healthy controls by polymerase chain reaction-restriction fragment length polymorphism. Odds ratios were estimated by multivariate logistic regression. A meta-analysis was conducted to evaluate the association of CYP2E1 -1239G>C polymorphism with the risk of lung cancer in Chinese population by calculating pooled odds ratio (OR). For CYP2E1 -1239G>C polymorphism, -1239C allele carriers (OR = 0.67; 95% confidence interval (CI) = 0.51-0.87; P = 0.002) were associated with a decreased risk of non-small cell lung cancer when compared with -1239GG homozygotes. In the group analyses by pathological types, for lung squamous cell carcinoma and other types, the ORs of the C allele carriers were 0.60 (95% CI = 0.41-0.88; P = 0.009) and 0.54 (95% CI = 0.30-0.99; P = 0.045). In the group analysis of smoking status, the OR for the -1239C allele-containing genotype was higher than that for -1239GG genotype (OR = 0.57; 95% CI = 0.40-0.81; P = 0.002) among smokers, but not among nonsmokers. Moreover, when the risk associated with CYP2E1 polymorphism was further evaluated within strata of C polymorphism and the risk of non-small cell lung cancer. Meta-analysis data also showed that the carriers of CYP2E1 -1239C allele

  19. Analysis, testing, and evaluation of faulted and unfaulted Wye, Delta, and open Delta connected electromechanical actuators

    Science.gov (United States)

    Nehl, T. W.; Demerdash, N. A.

    1983-07-01

    Mathematical models capable of simulating the transient, steady state, and faulted performance characteristics of various brushless dc machine-PSA (power switching assembly) configurations were developed. These systems are intended for possible future use as primemovers in EMAs (electromechanical actuators) for flight control applications. These machine-PSA configurations include wye, delta, and open-delta connected systems. The research performed under this contract was initially broken down into the following six tasks: development of mathematical models for various machine-PSA configurations; experimental validation of the model for failure modes; experimental validation of the mathematical model for shorted turn-failure modes; tradeoff study; and documentation of results and methodology.

  20. PDH-E1alpha dephosphorylation and activation in human skeletal muscle during exercise

    DEFF Research Database (Denmark)

    Pilegaard, Henriette; Birk, Jesper Bratz; Sacchetti, Massimo;

    2006-01-01

    extensor exercise at moderate intensity. During the 4-h resting period, activity of PDH in the active form (PDHa) did not change in either trial, yet phosphorylation of PDH-E1a site 1 (PDH-P1) and site 2 (PDH-P2) was elevated in the intralipid compared with the control trial. PDHa activity increased during...

  1. US NDC Modernization Iteration E1 Prototyping Report: User Interface Framework

    Energy Technology Data Exchange (ETDEWEB)

    Lober, Randall R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team completed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the User Interface Framework (UIF) in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  2. Methylglyoxal induces oxidative stress and mitochondrial dysfunction in osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Suh, K S; Choi, E M; Rhee, S Y; Kim, Y S

    2014-02-01

    Methylglyoxal is a reactive dicarbonyl compound produced by glycolytic processing and identified as a precursor of advanced glycation end products. The elevated methylglyoxal levels in patients with diabetes are believed to contribute to diabetic complications, including bone defects. The objective of this study was to evaluate the effect of methylglyoxal on the function of osteoblastic MC3T3-E1 cells. The data indicated that methylglyoxal decreased osteoblast differentiation and induced osteoblast cytotoxicity. Pretreatment of MC3T3-E1 cells with aminoguanidine (a carbonyl scavenger), Trolox (an antioxidant), and cyclosporin A (a blocker of the mitochondrial permeability transition pore) prevented methylglyoxal-induced cytotoxicity in MC3T3-E1 cells. However, BAPTA/AM (an intracellular Ca(2+) chelator) and dantrolene (an inhibitor of endoplasmic reticulum Ca(2+) release) did not reverse the cytotoxic effect of methylglyoxal. Methylglyoxal increased the formation of intracellular reactive oxygen species, mitochondrial superoxide, and cardiolipin peroxidation in osteoblastic MC3T3-E1 cells. Methylglyoxal also decreased the mitochondrial membrane potential and intracellular ATP and nitric oxide levels, suggesting that carbonyl stress-induced loss of mitochondrial integrity contributes to the cytotoxicity of methylglyoxal. Furthermore, the results demonstrated that methylglyoxal induced protein adduct formation, inactivation of glyoxalase I, and activation of glyoxalase II. Aminoguanidine reversed all aforementioned effects of methylglyoxal. Taken together, these data support the notion that high methylglyoxal concentrations have detrimental effects on osteoblasts through a mechanism involving oxidative stress and mitochondrial dysfunction.

  3. 26 CFR 301.6511(e)-1 - Special rules applicable to manufactured sugar.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Special rules applicable to manufactured sugar... Assessment and Collection § 301.6511(e)-1 Special rules applicable to manufactured sugar. (a) Use as... the person entitled thereto. Such right accrues as of the date the manufactured sugar, or article...

  4. US NDC Modernization Iteration E1 Prototyping Report: Processing Control Framework

    Energy Technology Data Exchange (ETDEWEB)

    Prescott, Ryan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hamlet, Benjamin R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team developed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the processing control framework in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  5. US NDC Modernization Iteration E1 Prototyping Report: Common Object Interface

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Jennifer E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hess, Michael M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team completed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the Common Object Interface (COI) in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  6. Transcriptional activation by the E1A regions of adenovirus types 40 and 41

    NARCIS (Netherlands)

    Loon, A.E. van; Gilardi, P.; Perricaudet, M.; Rozijn, Th. H.; Sussenbach, J.S.

    1987-01-01

    In order to establish whether the poor growth of the two fastidious adenoviruses types 40 and 41 (Ad40 and Ad41) in HeLa cells is due to a reduced trans-activation by the early region to (E1A), we have determined the trans-activating effect of this region on the expression of the chloramphenicol ace

  7. Two-step method for curing Escherichia coli of ColE1-derived plasmids

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne

    2008-01-01

    To cure Escherichia coli for plasmids derived from the ColE1 replicon advantage is taken of the fact that maintenance of this replicon requires a wild-type allele of polA, encoding DNA polymerase I. Curing is achieved by cotransduction of a mutant polA allele with metE::Tn10, fadAB::Tn10 or other...

  8. Osteogenic gene expression of murine osteoblastic (MC3T3-E1) cells under cyclic tension

    Science.gov (United States)

    Kao, C. T.; Chen, C. C.; Cheong, U.-I.; Liu, S. L.; Huang, T. H.

    2014-08-01

    Low-level laser therapy (LLLT) can promote cell proliferation. The remodeling ability of the tension side of orthodontic teeth affects post-orthodontic stability. The purpose of the present study was to investigate the osteogenic effects of LLLT on osteoblast-like cells treated with a simulated tension system that provides a mechanical tension regimen. Murine osteoblastic (MC3T3-E1) cells were cultured in a Flexcell strain unit with programmed loads of 12% elongation at a frequency of 0.5 Hz for 24 and 48 h. The cultured cells were treated with a low-level diode laser using powers of 5 J and 10 J. The proliferation of MC3T3-E1 cells was determined using the Alamar Blue assay. The expression of osteogenic genes (type I collagen (Col-1), osteopontin (OPN), osteocalcin (OC), osteoprotegerin (OPG), receptor activator of nuclear factor kappa B ligand (RANKL), bone morphologic protein (BMP-2), and bone morphologic protein (BMP-4)) in MC3T3-E1 cells was analyzed using reverse transcription polymerase chain reaction (RT-PCR). The data were analyzed using one-way analysis of variance. The proliferation rate of tension-cultured MC3T3-E1 cells under 5 J and 10 J LLLT increased compared with that of the control group (p < 0.05). Prominent mineralization of the MC3T3-E1 cells was visible using a von Kossa stain in the 5 J LLLT group. Osteogenic genes (Col-1, OC, OPG and BMP-2) were significantly expressed in the MC3T3-E1 cells treated with 5 J and 10 J LLLT (p < 0.05). LLLT in tension-cultured MC3T3-E1 cells showed synergistic osteogenic effects, including increases in cell proliferation and Col-1, OPN, OC, OPG and BMP-2 gene expression. LLLT might be beneficial for bone remodeling on the tension side of orthodontics.

  9. E1A,E1B double-restricted adenovirus enhances the cytotoxicity and antitumor activity of gemcitabine to renal cell carcinoma

    Institute of Scientific and Technical Information of China (English)

    WANG Hua; Makoto Satoh; CHEN Gui-ping; LI De-chuan; Hirofumi Hamada; Yoichi Arai

    2011-01-01

    Background Our previous studies have demonstrated potent oncolysis efficacy of the E1A,E1B double-restricted replication-competent oncolytic adenovirus AxdAdB-3 for treatment of bladder cancer. Here,we reported the feasibility and efficacy of AxdAdB-3 alone,or in combination with gemcitabine for treating renal cell carcinoma.Methods Cytopathic effects of AxdAdB-3 were evaluated in human renal cell carcinoma cell lines TOS-1,TOS-2,TOS-3,TOS-3LN,SMKT-R3,SMKT-R4 and ACHN,and in normal human renal proximal tubule epithelial cells (RPTEC).AxdAdB-3 induced down-regulation of the cell cycle was determined by flow cytometry. Combination therapies of AxdAdB-3 with gemcitabine were evaluated in vitro and in vivo on subcutaneous TOS-3LN tumors in a severe combined immunodeficiency disease (SCID) mouse model.Results AxdAdB-3 was potently cytopathic against the tested most renal cell carcinoma cell lines including TOS-2,TOS-3,TOS-3LN,SMKT-R3 and SMKT-R4,while normal human RPTEC were not destroyed. AxdAdB-3 effectively induced cell cycle S-phase entry. Combined therapy of AxdAdB-3 with gemcitabine demonstrated stronger antitumor effects in vitro and in vivo compared with either AxdAdB-3 or gemcitabine alone.Conclusion AxdAdB-3 alone,or in combination with gemcitabine may be a promising strategy against renal cell carcinoma.

  10. Tidal river dynamics: Implications for deltas

    Science.gov (United States)

    Hoitink, A. J. F.; Jay, D. A.

    2016-03-01

    Tidal rivers are a vital and little studied nexus between physical oceanography and hydrology. It is only in the last few decades that substantial research efforts have been focused on the interactions of river discharge with tidal waves and storm surges into regions beyond the limit of salinity intrusion, a realm that can extend inland hundreds of kilometers. One key phenomenon resulting from this interaction is the emergence of large fortnightly tides, which are forced long waves with amplitudes that may increase beyond the point where astronomical tides have become extinct. These can be larger than the linear tide itself at more landward locations, and they greatly influence tidal river water levels and wetland inundation. Exploration of the spectral redistribution and attenuation of tidal energy in rivers has led to new appreciation of a wide range of consequences for fluvial and coastal sedimentology, delta evolution, wetland conservation, and salinity intrusion under the influence of sea level rise and delta subsidence. Modern research aims at unifying traditional harmonic tidal analysis, nonparametric regression techniques, and the existing understanding of tidal hydrodynamics to better predict and model tidal river dynamics both in single-thread channels and in branching channel networks. In this context, this review summarizes results from field observations and modeling studies set in tidal river environments as diverse as the Amazon in Brazil, the Columbia, Fraser and Saint Lawrence in North America, the Yangtze and Pearl in China, and the Berau and Mahakam in Indonesia. A description of state-of-the-art methods for a comprehensive analysis of water levels, wave propagation, discharges, and inundation extent in tidal rivers is provided. Implications for lowland river deltas are also discussed in terms of sedimentary deposits, channel bifurcation, avulsion, and salinity intrusion, addressing contemporary research challenges.

  11. THE RURAL TOURISM IN DANUBE DELTA

    Directory of Open Access Journals (Sweden)

    Ionica SOARE

    2014-06-01

    Full Text Available Purpose - the purpose of this paper is to evaluate the rural areas has market size and forecast its development as an economic activity. The present paper aims at analyzing the rural areas has in Danube Delta. In an enviable BAs which have responsibility for their particular isolated, such as the Danube Delta and the Danube that used, fishing and rural areas has the main activities that provide jobs and income sources for local populations. Design/methodology/approach - A survey was administered to customers’ rural hostel accommodation in Danube Delta. Descriptive statistics method was mainly adopted to calculate the mean with standard deviation of entry assumes variable, and to examine the different levels of consumers' awareness. The index values of product familiarity, the ratio between entries assumes product's familiarity value and the average value. Findings - the research results show hash has rural consumers have different perception and accomplished through behaviour. The information channels of brand hash mainly from friends, relatives and neighbours, so word of mouth spreading is very important for a brand. Women show a higher sensitivity in health and are currently operating the propensity than referred to follow the recommendations for nutrition. Research limitations/implications - This item is intended to synthesize developments and challenges," on June 13th rural market growth has. The results of this paper should be considered tentatively until has also features replicated by larger has rural consumers. Originality/value - members of rural areas has consumer's behavior would improve marketing and the development of rural areas has products, in order to reduce consumer confusion.

  12. Delta Shell: Integrated Modeling by Example

    Science.gov (United States)

    Donchyts, G.; Jagers, B.; Baart, F.; Geer, P. V.

    2011-12-01

    We present the integrated modeling environment Delta Shell. It supports the full workflow of integrated environmental modeling: setup, configuration, simulation, analysis and reporting of results. Many components of the environment can be reused independently, allowing development of scientific, geospatial and other applications focused on data analysis, editing, visualization and storage. One of the unique features is that the Delta Shell environment integrates models from many different fields, such as hydrodynamics, hydrology, morphology, ecology, water quality, geospatial and decision support systems. This integration is possible due to flexible general data types, lightweight model coupling framework, the plugin system and the inclusion of a number of high quality open source components. Here we will use the open source morphological model XBeach as an example showing how to integrate models into the Delta Shell environment. Integration of XBeach adds a graphical interface which can be used to make testing coastal safety for complicated coastal areas easier. By using this example, we give an overview of the modeling framework and its possibilities. To increase the usability, the model is integrated with a coastal profile data set covering the whole coast of the Netherlands. This gives the end user a system to easily use the model for scanning the safety of the Dutch coast. The reuse of the components of the environment individually or combined is encouraged. They are available as separate components and have minimal or no dependencies on other components. This includes libraries to work with scientific multidimensional data, geospatial data (in particular geospatial coverages: values of some quantities defined on a spatial domain), editors, visualisation of time-dependent data and the modeling framework (projects, data linking, workflow management, model integration). Most components and the XBeach example are available as open source.

  13. Upper-division student difficulties with the Dirac delta function

    CERN Document Server

    Wilcox, Bethany R

    2015-01-01

    The Dirac delta function is a standard mathematical tool that appears repeatedly in the undergraduate physics curriculum in multiple topical areas including electrostatics, and quantum mechanics. While Dirac delta functions are often introduced in order to simplify a problem mathematically, students still struggle to manipulate and interpret them. To characterize student difficulties with the delta function at the upper-division level, we examined students' responses to traditional exam questions and a standardized conceptual assessment, and conducted think-aloud interviews. Our analysis was guided by an analytical framework that focuses on how students activate, construct, execute, and reflect on the Dirac delta function in the context of problem solving in physics. Here, we focus on student difficulties using the delta function to express charge distributions in the context of junior-level electrostatics. Common challenges included: invoking the delta function spontaneously, translating a description of a c...

  14. Compositeness of the Delta(1232) resonance in pi N scattering

    CERN Document Server

    Sekihara, Takayasu; Yamagata-Sekihara, Junko; Yasui, Shigehiro

    2015-01-01

    We evaluate the $\\pi N$ compositeness of the $\\Delta (1232)$ resonance so as to clarify the internal structure of $\\Delta (1232)$ in terms of the $\\pi N$ component. Here the compositeness is defined as contributions from two-body wave functions to the normalization of the total wave function and is extracted from the $\\pi N$ scattering amplitude. In this study we employ the chiral unitary approach with the interaction up to the next-to-leading order plus a bare $\\Delta$ term in chiral perturbation theory and describe $\\Delta (1232)$ in an elastic $\\pi N$ scattering. Fitting the $\\pi N$ scattering amplitude to the solution of the partial wave analysis, we obtain a large real part of the $\\pi N$ compositeness for $\\Delta (1232)$ comparable to unity and non-negligible imaginary part as well, with which we reconfirm the result in the previous study on the $\\pi N$ compositeness for $\\Delta (1232)$.

  15. The development of the CHANG'`E-1 lunar explorer laser altimeter

    Science.gov (United States)

    Shu, R.; Wang, J. Y.; Hu, Y. H.; Jia, J. J.

    According to Chinese fable CHANG prime E is the name of a peri who lives in the moon with a white rabbit The CHANG prime E-1 lunar explorer will be launched in April 2007 The Lunar Explorer Laser Altimeter LELA is one of the 6 payloads in Chang prime E-1 which is developed by Shanghai Institute of Technical Physics Chinese Academy of Sciences The data of LELA will be used with the Optical Imager for acquiring the three dimension image of the moon surface The LELA transmits laser pulses determines their round trip times to the surface of the moon using a time interval counter and measures ranges between CHANG prime E-1 lunar explorer and the lunar surface in the nadir direction with 5m accuracy every 1 second for 1 year s mission period The acquired range data are transformed to the topography of the moon with the aid of position and attitude data of the CHANG prime E-1 lunar explorer obtained from the ground-based tracking and on board star sensor respectively The mean distances between Chang prime E-1 and the surface of moon is 200Km The LELA utilizes a laser diode LD pumped Q-switched Nd YAG laser that has a wavelength of 1064nm a pulse width of 10ns The output beam divergence is improved to 0 6mrad by Galileo refractor-type collimator which resulted in a moon surface spot size foot print of 120m The return pulses are captured by Cassegrain-type reflector and detected by Si-APD detector The prototype began from 2003 Until now the engineering model had been finished

  16. Monitoring the Polarimetric Variability of \\delta\\ Scorpii

    CERN Document Server

    Bednarski, Daniel

    2012-01-01

    The Be star \\delta\\ Scorpii is an interesting binary system, whose primary companion created a circumstellar disk after the periastron passage of the secondary in 2000, being since then classified as Be. This work presents the results of a long-term monitoring of this star in broad-band imaging polarimetry. The observational data collected since 2006 in the Pico dos Dias Observatory (Brazil) show a variable polarization that seems to correlate with the photometric light curve. From this data we see that the disk density varied since 2006; furthermore, the data suggests that there was some disturbance of the disk during the last periastron passage in July, 2011.

  17. Error Minimization of Polynomial Approximation of Delta

    Indian Academy of Sciences (India)

    Islam Sana; Sadiq Muhammad; Qureshi Muhammad Shahid

    2008-09-01

    The difference between Universal time (UT) and Dynamical time (TD), known as Delta ( ) is tabulated for the first day of each year in the Astronomical Almanac. During the last four centuries it is found that there are large differences between its values for two consecutive years. Polynomial approximations have been developed to obtain the values of for any time of a year for the period AD 1620 to AD 2000 (Meeu 2000) as no dynamical theories describe the variations in . In this work, a new set of polynomials for is obtained for the period AD 1620 to AD 2007 that is found to produce better results compared to previous attempts.

  18. International Financial Centers Delta in China

    Institute of Scientific and Technical Information of China (English)

    Emily Yu

    2009-01-01

    @@ It has called a lot of attention tnat China should build a pattern of International Financial Centers Delta:Make Beijing the centre of International Finance Management and Cooperation,working as the management and cooperation base and headquarter for China's participation in the iriternational Financial competition;Make Shanghai the centre of International Finance Market.working as the main battlefield of China's participation in international financial competition;Make Hong Kong the centre of Intemational Finance Open and Innovation,working as the frontier of China's participation in international financial competition.

  19. Hepatitis Delta Virus: A Peculiar Virus

    OpenAIRE

    Carolina Alves; Cristina Branco; Celso Cunha

    2013-01-01

    The hepatitis delta virus (HDV) is distributed worldwide and related to the most severe form of viral hepatitis. HDV is a satellite RNA virus dependent on hepatitis B surface antigens to assemble its envelope and thus form new virions and propagate infection. HDV has a small 1.7 Kb genome making it the smallest known human virus. This deceivingly simple virus has unique biological features and many aspects of its life cycle remain elusive. The present review endeavors to gather the available ...

  20. Stratigraphy and Evolution of Delta Channel Deposits, Jezero Crater, Mars

    Science.gov (United States)

    Goudge, T. A.; Mohrig, D.; Cardenas, B. T.; Hughes, C. M.; Fassett, C. I.

    2017-01-01

    The Jezero impact crater hosted an open-basin lake that was active during the valley network forming era on early Mars. This basin contains a well exposed delta deposit at the mouth of the western inlet valley. The fluvial stratigraphy of this deposit provides a record of the channels that built the delta over time. Here we describe observations of the stratigraphy of the channel deposits of the Jezero western delta to help reconstruct its evolution.

  1. Delta Doping High Purity CCDs and CMOS for LSST

    Science.gov (United States)

    Blacksberg, Jordana; Nikzad, Shouleh; Hoenk, Michael; Elliott, S. Tom; Bebek, Chris; Holland, Steve; Kolbe, Bill

    2006-01-01

    A viewgraph presentation describing delta doping high purity CCD's and CMOS for LSST is shown. The topics include: 1) Overview of JPL s versatile back-surface process for CCDs and CMOS; 2) Application to SNAP and ORION missions; 3) Delta doping as a back-surface electrode for fully depleted LBNL CCDs; 4) Delta doping high purity CCDs for SNAP and ORION; 5) JPL CMP thinning process development; and 6) Antireflection coating process development.

  2. Delta Plaza kohvik = The Delta Plaza Café / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Pärnu mnt. 141 asuva kohviku Delta Plaza sisekujundusest. Sisearhitektid Tiiu Truus ja Marja Viltrop (Stuudio Truus OÜ). Hoone arhitektid Jüri Okas ja Marika Lõoke (AB J. Okas & M. Lõoke). Žürii liikme Mait Summataveti arvamus kohvikust

  3. Global Heat Kernel Estimates for $\\Delta+\\Delta^{\\alpha/2}$ in Half-space-like domains

    CERN Document Server

    Chen, Zhen-Qing; Song, Renming

    2011-01-01

    Suppose that $d\\ge 1$ and $\\alpha\\in (0, 2)$. In this paper, by using probabilistic methods, we establish sharp two-sided pointwise estimates for the Dirichlet heat kernels of $\\{\\Delta+ a^\\alpha \\Delta^{\\alpha/2}; \\ a\\in (0, 1]\\}$ on half-space-like $C^{1, 1}$ domains in ${\\mathbb R}^d$ for all time $t>0$. The large time estimates for half-space-like domains are very different from those for bounded domains. Our estimates are uniform in $a \\in (0, 1]$ in the sense that the constants in the estimates are independent of $a\\in (0, 1]$. Thus it yields the Dirichlet heat kernel estimates for Brownian motion in half-space-like domains by taking $a\\to 0$. Integrating the heat kernel estimates in time $t$, we obtain uniform sharp two-sided estimates for the Green functions of $\\{\\Delta+ a^\\alpha \\Delta^{\\alpha/2}; \\ a\\in (0, 1]\\}$ in half-space-like $C^{1, 1}$ domains in ${\\mathbb R}^d$.

  4. Delta Plaza kohvik = The Delta Plaza Café / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Pärnu mnt. 141 asuva kohviku Delta Plaza sisekujundusest. Sisearhitektid Tiiu Truus ja Marja Viltrop (Stuudio Truus OÜ). Hoone arhitektid Jüri Okas ja Marika Lõoke (AB J. Okas & M. Lõoke). Žürii liikme Mait Summataveti arvamus kohvikust

  5. Hydraulic Geometry of a tidally influenced delta channel network: the Mahakam Delta, East Kalimantan, Indonesia

    Science.gov (United States)

    Sassi, M.; Hoitink, A.; de Brye, B.; Deleersnijder, E.

    2011-12-01

    Hydraulic Geometry (HG) refers to relations between the characteristics of channels in a network, including mean depth, width, and bed slope, and the discharge conveyed by the channel during bank-full conditions. HG relations are of fundamental importance to water management in channel networks, and they bear an interesting relation with geomorphology. River delta channel networks typically scale according to HG relations such as log(A) ~ p*log(Q), where A is channel cross sectional area, Q water discharge, and the exponent p is in between 0.8 and 1.2. In tidal networks, the tidal prism or tidal discharge can be used, instead of a discharge with a constant frequency of occurrence. In the tidal case, the exponent often shows the same range of variation. Tidal rivers are intrinsically complex, as tidal propagation is influenced by river discharge and vice-versa. Consequently, channel geometry in tidally influenced river deltas may show a mixed scaling behavior of river and tidal channel networks, as the channel forming discharges may both be of river and tidal origin. In tidal regions, the tidal dynamics may lead to a cyclic variation in water discharge distribution at bifurcations, readily affecting HG relations. We present results from the Mahakam delta channel network in Indonesia, a tide-river dominated delta which has been prograding for 60 km over the last 5000 years. Bathymetric surveys were conducted over the distributary network and connected tidal channels. Based on a geomorphic analysis of the present distributary network, we show that channel geometry of the fluvial distributary network scales with bifurcation order. The bifurcation order does not feature a clear relation with bifurcate branch length or bifurcate width ratio, as in the case of river deltas. HG relations of the area of selected cross-sections are well represented by the tidal prism or by the river discharge, when scaled with the bifurcation order. Numerical simulations show that river

  6. QCD corrections to inclusive $\\Delta S=1,2$ transitions

    OpenAIRE

    Jamin, Matthias

    1994-01-01

    The talk summarises a calculation of the two-point functions for $\\Delta S=1$ current-current and QCD-penguin operators, as well as for the $\\Delta S=2$ operator, at the next-to-leading order. The size of the gluonic corrections to current-current operators is large, providing a qualitative understanding of the observed enhancement in $\\Delta I=1/2$ transitions. In the $\\Delta S=2$ sector the QCD corrections are quite moderate ($\\approx -20\\%$). This work has been done in collaboration with A...

  7. [A study of 158 cases of acute delta hepatitis].

    Science.gov (United States)

    Castro, A; Buti, M; Esteban, R; Jardí, R; Allende, H; Roget, M; Rodríguez-Frías, F; Guardia, J

    1990-09-22

    We have prospectively studied 158 cases of acute hepatitis delta observed during the last 7 years in a general hospital. Among them 136 were male and 22 female. The mean age was 22.7 years with a range between 16 and 61 years. The epidemiologic factors were drug addiction by parenteral route in 145 cases (92%), sexual transmission in 5 (3%), post transfusional in 2 (1%) and unknown in 6 (4%). With respect to the delta type infection, 105 cases (66%) were coinfections with type B and delta, and 53 patients had a type delta superinfection (34%). The clinical course was a fulminant hepatitis in three cases (two cases of coinfection B and delta an one case of delta superinfection), and an acute benign hepatitis in 155 patients. The follow-up of 118 patients revealed that 96% of coinfections by type B and delta evolved to the chronicity showing findings of active chronic hepatitis or hepatic cirrhosis. It should be noted that in 4 cases of superinfection delta type (11%) the HBsAg was negative after several months of positivity. In these patients the level of transaminases normalized and the hepatic histology evidenced alterations of chronic active hepatitis (2 cases) and hepatic cirrhosis (2 cases) without identification of tissular delta antigen.

  8. A global analysis of human habitation on river deltas

    Science.gov (United States)

    Edmonds, Douglas; Caldwell, Rebecca; Baumgardner, Sarah; Paola, Chris; Roy, Samapriya; Nelson, Amelia; Nienhuis, Jaap

    2017-04-01

    River deltas are ideal sites for human habitation because of their fertile floodplains, easy access to the ocean, and abundant land. But anthropogenic and natural processes are causing deltas to sink, which increases the probability of coastal flooding and human exposure to risk. The full extent of the risk posed to humans is unclear because the number of people living on river deltas is unknown. Towards this end we mapped the locations and areas of all deltas in the world (n= 1813). Using Google Earth we identified all river mouths (≥ 50 m wide) on marine coastlines that are also connected to an upstream catchment. Rivers that split into two or more active or relict distributary channels, end in a depositional protrusion from the shoreline, or do both, are defined as deltas. The depositional protrusion and distributary channel network define the geomorphic area of each delta. We mark the position of the delta apex at the first bifurcation, or for a single channel delta at the intersection of the regional shoreline and the main channel. We mark three lateral extents, one on either side of the main channel at the maximum displacement of the depositional protrusion or the distributary network, and one on the most basinward position of the delta. We define delta area as the convex hull around these extent points and the delta apex. For each delta area polygon we extract elevation from the Shuttle Radar Topography Mission dataset and population count in years 2000, 2005, 2010, 2015, and 2020 from Gridded Population of the World, version 4. In total, deltas cover 0.56% of the total area of the world yet contain 4.1% of the world's population. The population on deltas has grown from 237 million in 2000 to projected values of 322 million in 2020. Deltaic population is growing at 1.59% per year, which outpaces the world growth rate of 1.11%. Additionally, population density is increasing with time from 322 people per km2 in year 2000 to projected values of 422 people per

  9. Superconducting bandpass delta-sigma modulator

    Science.gov (United States)

    Bulzacchelli, J. F.; Lee, H.-S.; Misewich, J. A.; Ketchen, M. B.

    1999-11-01

    Bandpass delta-sigma modulators digitize narrowband signals with high dynamic range and linearity. The required sampling rate is only a few times higher than the centre frequency of the input. This paper presents a superconducting bandpass delta-sigma modulator for direct analogue-to-digital conversion of RF signals in the GHz range. The input signal is capacitively coupled to one end of a microstrip transmission line, and a single flux quantum balanced comparator quantizes the current flowing out of the other end. Quantization noise is suppressed at the quarter-wave resonance of the transmission line (about 2 GHz in our design). Circuit performance at a 20 GHz sampling rate has been studied with several long JSIM simulations. Full-scale (FS) input sensitivity is 20 mV (rms), and in-band noise is -53 dBFS and -57 dBFS over bandwidths of 39 MHz and 19.5 MHz, respectively. In-band intermodulation distortion is better than -69 dBFS.

  10. Superconducting bandpass delta-sigma modulator

    Energy Technology Data Exchange (ETDEWEB)

    Bulzacchelli, J.F.; Lee, H.-S. [Department of Electrical Engineering and Computer Science, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Misewich, J.A.; Ketchen, M.B. [IBM Research Division, T. J. Watson Research Center, Yorktown Heights, NY 10598 (United States)

    1999-11-01

    Bandpass delta-sigma modulators digitize narrowband signals with high dynamic range and linearity. The required sampling rate is only a few times higher than the centre frequency of the input. This paper presents a superconducting bandpass delta-sigma modulator for direct analogue-to-digital conversion of RF signals in the GHz range. The input signal is capacitively coupled to one end of a microstrip transmission line, and a single flux quantum balanced comparator quantizes the current flowing out of the other end. Quantization noise is suppressed at the quarter-wave resonance of the transmission line (about 2 GHz in our design). Circuit performance at a 20 GHz sampling rate has been studied with several long JSIM simulations. Full-scale (FS) input sensitivity is 20 mV (rms), and in-band noise is -53 dBFS and -57 dBFS over bandwidths of 39 MHz and 19.5 MHz, respectively. In-band intermodulation distortion is better than -69 dBFS. (author)

  11. Catalyzing action towards the sustainability of deltas: deltas as integrated socio-ecological systems and sentinels of regional and global change

    Science.gov (United States)

    Foufoula-Georgiou, E.; Tessler, Z. D.; Brondizio, E.; Overeem, I.; Renaud, F.; Sebesvari, Z.; Nicholls, R. J.; Anthony, E.

    2016-12-01

    Deltas are highly dynamic and productive environments: they are food baskets of the world, home to biodiverse and rich ecosystems, and they play a central role in food and water security. However, they are becoming increasingly vulnerable to risks arising from human activities, land subsidence, regional water management, global sea-level rise, and climate extremes. Our Belmont Forum DELTAS project (BF-DELTAS: Catalyzing actions towards delta sustainability) encompasses an international network of interdisciplinary research collaborators with focal areas in the Mekong, Ganges Brahmaputra, and the Amazon deltas. The project is organized around five main modules: (1) developing an analytical framework for assessing delta vulnerability and scenarios of change (Delta-SRES), (2) developing an open-acess, science-based integrative modeling framework for risk assessment and decision support (Delta-RADS), (3) developing tools to support quantitative mapping of the bio-physical and socio-economic environments of deltas and consolidate bio-physical and social data within shared data repositories (Delta-DAT), (4) developing Global Delta Vulnerability Indices (Delta-GDVI) that capture current and projected scenarios for major deltas around the world , and (5) collaborating with regional stakeholders to put the science, modeling, and data into action (Delta-ACT). In this talk, a research summary will be presented on three research domains around which significant collaborative work was developed: advancing biophysical classification of deltas, understanding deltas as coupled socio-ecological systems, and analyzing and informing social and environmental vulnerabilities in delta regions.

  12. delta13C and delta18O trends across overstory environments in whole foliage and cellulose of three Pinus species.

    Science.gov (United States)

    Powers, Matthew D; Pregitzer, Kurt S; Palik, Brian J

    2008-09-01

    Stable isotope ratios of carbon (delta(13)C) and oxygen (delta(18)O) are increasingly used to investigate environmental influences on plant physiology. Cellulose is often isolated for isotopic studies, but some authors have questioned the value of this process. We studied trends in delta(13)C and delta(18)O of whole foliage and holocellulose from seedlings of three Pinus species across three overstory environments to evaluate the benefits of holocellulose extraction in the context of a traditional ecological experiment. Both tissue types showed increasing delta(13)C from closed-canopy controls to thinned plots to 0.3 ha canopy gaps, and no change in delta(18)O between overstory environments. delta(13)C of P. resinosa and P. strobus was greater than delta(13)C of P. banksiana in whole foliage and holocellulose samples, and there were no differences in delta(18)O associated with species in either tissue type. Our results suggest whole foliage and holocellulose provide similar information about isotopic trends across broad environmental gradients and between species, but holocellulose may be better suited for studying differences in stable isotope composition between multiple species across several treatments.

  13. Sonochemical synthesis of novel pyrano[3,4-e][1,3]oxazines: A green protocol.

    Science.gov (United States)

    Saleh, Tamer S; Al-Bogami, Abdullah S; Mekky, Ahmed E M; Alkhathlan, Hamad Z

    2017-05-01

    The atom-efficient and green protocol for formation of pyrano[3,4-e][1,3]oxazines utilizing dimethyl carbonate under ultrasound irradiation in a presence of KF/basic alumina was reported. We provide a novel series of pyrano[3,4-e][1,3]oxazine derivatives interesting for biological screening tests. In general, it was found that ultrasound irradiations enable the reactions to occur which could not be carried out under silent conditions. These remarkable effects appeared in sonicated reactions can be reasonably interpreted in terms of acoustic cavitation phenomenon. Structures of the products were established on analytical and spectral data. This protocol offers several advantages attain many principles of green chemistry including, save energy, atom economy, clean reactions, inexpensive green reagent and use catalysts rather than stoichiometric reagents.

  14. Introduction to the Payloads and the Initial Observation Results of Chang'E-1

    Institute of Scientific and Technical Information of China (English)

    SUN Huixian; CHEN Xiaomin; OUYANG Ziyuan; ZOU Yongliao; WU Ji; DAI Shuwu; ZHAO Baochang; SHU Rong; CHANG Jin; WANG Huanyu; ZHANG Xiaohui; REN Qiongying

    2008-01-01

    Chang'E-1, the orbiter circling the moon 200km above the moon surface, is the first Chinese Lunar exploration satellite. The satellite was successfully launched on 24th October 2007.There are 8 kinds of scientific payloads onboard, including the stereo camera, the laser altimeter, the Sagnac-based interferometer image spectrometer, the Gamma ray spectrometer, the X-ray spectrometer, the microwave radiometer, the high energy particle detector, the solar wind plasma detector and a supporting payload data management system. Chang'E-1 opened her eyes to look at the moon and took the first batch of lunar pictures after her stereo camera was switched on in 20th November 2007.Henceforth all the instruments are successfully switched on one by one. After a period of parameter adjustment and initial check out, all scientific instruments are now in their normal operating phase.In this paper, the payloads and the initial observation results are introduced.

  15. Influence of delta doping on intersubband transition and absorption in AlGaN/GaN step quantum wells for terahertz applications

    Science.gov (United States)

    Tang, Chenjie; Shi, Junxia

    2015-05-01

    Effects of delta doping location and density on intersubband transitions in AlGaN/GaN step quantum wells for terahertz (THz) applications have been investigated by solving Schrödinger and Poisson equations self-consistently. It shows that delta doping near the GaN well/AlGaN step well interface causes a blue-shift, while delta doping in the barrier or near barrier/GaN well and barrier/step well interfaces cause a red-shift first and then a blue-shift with increasing doping density. The shifts are attributed to the combination of many body effect and internal field modulation effect, and can be more than 200% or 70% of the e1-e2 transition energy, as for blue-shift or red-shift, respectively. In addition, the influences of delta-doping location and density on the absorption coefficient are also investigated in detail. Delta doping at the middle of a layer is found much more desirable over uniform-doping in order to improve the absorption coefficient, especially in the step well.

  16. Heterologous expression of human cytochrome P450 2E1 in HepG2 cell line

    Institute of Scientific and Technical Information of China (English)

    Jian Zhuge; Ye Luo; Ying-Nian Yu

    2003-01-01

    AIM: Human cytochrome P-450 2E1 (CYP2E1) takes part in the biotransformation of ethanol, acetone, many smallmolecule substrates and volatile anesthetics. CYP2E1 is involved in chemical activation of many carcinogens,procarcinogens, and toxicants. To assess the metabolic and toxicological characteristics of CYP2E1, we cloned CYP2E1 cDNA and established a HepG2 cell line stably expressing recombinant CYP 2E1.METHODS: Human CYP2E1 cDNA was amplified with reverse transcription-polymerase chain reaction (RT-PCR)from total RNAs extracted from human liver and cloned into pGEM-T vector. The cDNA segment was identified by DNA sequencing and subcloned into a mammalian expression vector pREP9. A transgenic cell line was established by transfecting the recombinant plasmid of pREP9-CYP2E1 to HepG2 cells. The expression of CYP2E1 mRNA was validated by RT-PCR. The enzyme activity of CYP2E1 catalyzing oxidation of 4-nitrophenol in postmitochondrial supernate (S9) fraction of the cells was determined by spectrophotometry. The metabolic activation of HepG2-CYP2E1 cells was assayed by N-nitrosodiethylamine (NDEA)cytotoxicity and micronucleus test.RESULTS: The cloned CYP2E1 cDNA segment was identical to that reported by Umeno et al(GenBank access No.J02843). HepG2-CYP2E1 cells expressed CYP2E1 mRNA and had 4-nitrophenol hydroxylase activity (0.162±0.025nmol.min-1.mg-1 S9 protein), which were undetectable in parent HepG2 cells. HepG2-CYP2E1 cells increased the cytotoxicity and micronucleus rate of NDEA in comparison with those of HepG2 cells.CONCLUSION: The cDNA of human CYP2E1 can be successfully cloned, and a cell line, HepG2-CYP2E1, which can efficiently express mRNA and has CYP2E1 activity, is established. The cell line is useful for testing the cytotoxicity,mutagenicity and metabolism of xenobiotics, which may possibly be activated or metabolized by CYP2E1.

  17. Multidecadal Fluvial Sediment Fluxes to Deltas under Environmental Change Scenarios

    Science.gov (United States)

    Dunn, Frances; Darby, Stephen; Nicholls, Robert

    2016-04-01

    Sediment delivery is vital to sustain delta environments on which over half a billion people live worldwide. Due to factors such as subsidence and sea level rise, deltas sink relative to sea level if sediment is not delivered to and retained on their surfaces. Deltas which sink relative to sea level experience flooding, land degradation and loss, which endangers anthropogenic activities and populations. The future of fluvial sediment fluxes, a key mechanism for sediment delivery to deltas, is uncertain due to complex environmental changes which are predicted to occur over the coming decades. This research investigates fluvial sediment fluxes under environmental changes in order to assess the sustainability of delta environments under potential future scenarios up to 2100. Global datasets of climate change, reservoir construction, and population and GDP as proxies for anthropogenic influence through land use changes are used to drive the catchment numerical model WBMsed, which is being used to investigate the effects of these environmental changes on fluvial sediment delivery. This process produces fluvial sediment fluxes under multiple future scenarios which will be used to assess the future sustainability of a selection of 8 vulnerable deltas, although the approach can be applied to deltas worldwide. By modelling potential future scenarios of fluvial sediment flux, this research contributes to the prognosis for delta environments. The future scenarios will inform management at multiple temporal scales, and indicate the potential consequences for deltas of various anthropogenic activities. This research will both forewarn managers of potentially unsustainable deltas and indicate those anthropogenic activities which encourage or hinder the creation of sustainable delta environments.

  18. Common Structure of Rare Replication-Deficient E1-Positive Particles in Adenoviral Vector Batches

    Science.gov (United States)

    Murakami, Pete; Havenga, Menzo; Fawaz, Farah; Vogels, Ronald; Marzio, Giuseppe; Pungor, Erno; Files, Jim; Do, Linh; Goudsmit, Jaap; McCaman, Michael

    2004-01-01

    The use of the PER.C6 adenovirus packaging cell line in combination with a designated vector plasmid system, whereby the cell line and vector with E1 deleted have no sequence overlap, eliminates the generation of replication-competent adenovirus during vector production. However, we have found cytopathic effect (CPE)-inducing particles in 2 out of more than 40 large-scale manufacturing lots produced in PER.C6 cells. The CPE inducer was detected at a frequency of 1 event in 7.5 × 1012 vector particles. Despite amplification, it was not readily purified, indicating that the agent itself is replication deficient and requires the parental recombinant adenovirus serotype 5 (rAd5) vector for replication and packaging. Therefore, we designated the agent as a helper-dependent E1-positive region containing viral particle (HDEP). Here, we report the molecular structure of the HDEP genome, revealing an Ad comprised of E1 sequences derived from PER.C6 cells flanked by inverted terminal repeat, packaging signal, and transgene sequences. These sequences form a palindromic structure devoid of E2, E3, E4, and late genes. Since only 5 bp were shared between E1 sequences in the PER.C6 genome and viral vector sequences, the data strongly suggested that insertion of genomic DNA into an adenoviral genome had occurred essentially via nonhomologous recombination. HDEPs have been found in unrelated virus batches and appear to share a common structure that may explain their mechanism of generation. This finding allowed development of an HDEP assay to screen batches of rAd5 produced on the PER.C6 cell line and resulted in detection of seven HDEP agents from four different transgene-virus vector constructs in separate batches of Ad. PMID:15163713

  19. Mouse Spermatocytes Express CYP2E1 and Respond to Acrylamide Exposure

    Science.gov (United States)

    Nixon, Belinda J.; Katen, Aimee L.; Stanger, Simone J.; Schjenken, John E.; Nixon, Brett; Roman, Shaun D.

    2014-01-01

    Metabolism of xenobiotics by cytochrome P450s (encoded by the CYP genes) often leads to bio-activation, producing reactive metabolites that interfere with cellular processes and cause DNA damage. In the testes, DNA damage induced by xenobiotics has been associated with impaired spermatogenesis and adverse effects on reproductive health. We previously reported that chronic exposure to the reproductive toxicant, acrylamide, produced high levels of DNA damage in spermatocytes of Swiss mice. CYP2E1 metabolises acrylamide to glycidamide, which, unlike acrylamide, readily forms adducts with DNA. Thus, to investigate the mechanisms of acrylamide toxicity in mouse male germ cells, we examined the expression of the CYP, CYP2E1, which metabolises acrylamide. Using Q-PCR and immunohistochemistry, we establish that CYP2E1 is expressed in germ cells, in particular in spermatocytes. Additionally, CYP2E1 gene expression was upregulated in these cells following in vitro acrylamide exposure (1 µM, 18 h). Spermatocytes were isolated and treated with 1 µM acrylamide or 0.5 µM glycidamide for 18 hours and the presence of DNA-adducts was investigated using the comet assay, modified to detect DNA-adducts. Both compounds produced significant levels of DNA damage in spermatocytes, with a greater response observed following glycidamide exposure. A modified comet assay indicated that direct adduction of DNA by glycidamide was a major source of DNA damage. Oxidative stress played a small role in eliciting this damage, as a relatively modest effect was found in a comet assay modified to detect oxidative adducts following glycidamide exposure, and glutathione levels remained unchanged following treatment with either compound. Our results indicate that the male germ line has the capacity to respond to xenobiotic exposure by inducing detoxifying enzymes, and the DNA damage elicited by acrylamide in male germ cells is likely due to the formation of glycidamide adducts. PMID:24788432

  20. Repression of insulin gene expression by adenovirus type 5 E1a proteins.

    OpenAIRE

    1987-01-01

    Insulin gene transcription relies on enhancer and promoter elements which are active in pancreatic beta cells. We showed that adenovirus type 5 infection of HIT T-15 cells, a transformed hamster beta cell line, represses insulin gene transcription and mRNA levels. Using expression plasmids transiently introduced into HIT T-15 cells, we showed that adenovirus type 5 E1a transcription regulatory proteins repress insulin enhancer-promoter element activity as assayed with a surrogate xanthine-gua...

  1. Ultrasound associated uptake of chitosan nanoparticles in MC3T3-E1 cells

    Science.gov (United States)

    Wu, Junyi

    Chitosan is a natural linear polysaccharide that has been well known for its applications in drug delivery system due to its unique physicochemical and biological properties. However, challenges still remain for it to become a fully realized therapeutic agent. In this study, we investigated the uptake of chitosan nanoparticles (CNP) under the ultrasound stimulation, using a model cell culture system (MC3T3-E1 mouse pre-osteoblasts). The CNP were fabricated by an ionic gelation method and were lyophilized prior to characterization and delivery to cells. Particle size and zeta potential were measured using Dynamic Light Scattering (DLS); the efficiency of chitosan complexation was measured using the ninhydrin assay. Cytotoxicity was examined by neutral red assay within 48 hours after delivery. The effect of ultrasound (US) on the efficiency of nanoparticle delivery to the MC3T3-E1 cells was examined at 1MHz and at either 1 or 2 W/cm2. Fluorescein isothiocyanate (FITC)-conjugated-CNP were used to visualize the internalized particles within the cytosol. The uptake of FITC-CNP exhibits a dose and time dependent effect, a strong FITC fluorescence was detected at the concentration of 500microg/mL under fluorescence microscope. Ultrasound assisted uptake of FITC-CNP performed a significant positive effect at 2W/cm2 with 60s of ultrasound exposure time. CNP displayed a slightly decrease in cell viability from 25microg/mL to 100microg/mL, while higher concentration of CNP facilitates the proliferation of MC3T3-E1 cells. Less than 10% of reduction in cell viability was observed for US at 1W/cm2 and 2W/cm2 with 30s and 60s of exposure time, which suggest a mild effect of US to MC3T3-E1 cell line.

  2. Calculation of Radiative Corrections to E1 matrix elements in the Neutral Alkalis

    Energy Technology Data Exchange (ETDEWEB)

    Sapirstein, J; Cheng, K T

    2004-09-28

    Radiative corrections to E1 matrix elements for ns-np transitions in the alkali metal atoms lithium through francium are evaluated. They are found to be small for the lighter alkalis but significantly larger for the heavier alkalis, and in the case of cesium much larger than the experimental accuracy. The relation of the matrix element calculation to a recent decay rate calculation for hydrogenic ions is discussed, and application of the method to parity nonconservation in cesium is described.

  3. Migraine: possible role of platelet insensitivity to prostaglandin E1 (PGE1).

    Science.gov (United States)

    Cerneca, F; de Luyk, S; Radillo, O; Simeone, R; Mangiarotti, M

    1993-01-01

    Platelet aggregation inhibition, induced by prostaglandin E1 (PGE1), was evaluated in 38 patients affected by migraine. Our data indicate a complete insensitivity to PGE1 in these subjects. The insensitivity to PGE1 leads to decreased cyclic-AMP (cAMP) levels, determining an imbalance in the inhibitory mechanism. From this observation we can suppose that the decreased affinity of PGE1-receptors, causing decreased cAMP levels, may be involved in pathogenesis of migraine.

  4. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation

    OpenAIRE

    2008-01-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least thre...

  5. Definition of a major p53 binding site on Ad2E1B58K protein and a possible nuclear localization signal on the Ad12E1B54K protein.

    Science.gov (United States)

    Grand, R J; Parkhill, J; Szestak, T; Rookes, S M; Roberts, S; Gallimore, P H

    1999-01-28

    Previous studies have established that adenovirus 2/5 early region 1B (Ad E1B) 58K protein binds p53 strongly and co-localizes with it to cytoplasmic dense bodies whilst the homologous Ad12E1B54K protein binds only weakly and co-localizes primarily to the nucleus in Ad12E1 transformed cells. We have used these properties of the E1B proteins from different viral serotypes to map the p53 binding site on the Ad2/5 protein. A set of chimaeric genes was constructed containing different proportions of the Ad12 and Ad2E1B DNA. These, together with Ad12E1A and E1B19K DNA, were transfected into baby rat kidney cells and transformed lines isolated. From an examination of the properties of these Ad12/Ad2E1B fusion proteins in co-immunoprecipitation and subcellular localization experiments it has been concluded that the p53 binding site on Ad2E1B58K protein lies between amino acids 216 and 235 and that the homologous region on Ad12E1B54K protein also binds p53. In addition, a unique nuclear localization signal is located on Ad12E1B54K between residues 228 and 239. We suggest that primary structure differences in these regions of the Ad2 and Ad12E1B proteins are responsible for the different subcellular localizations in AdE1 transformants.

  6. Q2 Dependence of quadrupole strength in the gamma*p --> Delta(+)(1232) --> p pi(0) transition.

    Science.gov (United States)

    Joo, K; Smith, L C; Burkert, V D; Minehart, R; Aznauryan, I G; Elouadrhiri, L; Stepanyan, S; Adams, G S; Amaryan, M J; Anciant, E; Anghinolfi, M; Armstrong, D S; Asavapibhop, B; Audit, G; Auger, T; Avakian, H; Barrow, S; Bagdasaryan, H; Battaglieri, M; Beard, K; Bektasoglu, M; Bertozzi, W; Bianchi, N; Biselli, A S; Boiarinov, S; Bonner, B E; Brooks, W K; Calarco, J R; Capitani, G P; Carman, D S; Carnahan, B; Cole, P L; Coleman, A; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Cummings, J; De Sanctis, E; De Vita, R; Degtyarenko, P V; Demirchyan, R A; Denizli, H; Dennis, L C; Deppman, A; Dharmawardane, K V; Dhuga, K S; Djalali, C; Dodge, G E; Doughty, D; Dragovitsch, P; Dugger, M; Dytman, S; Eckhause, M; Efremenko, Y V; Egiyan, H; Egiyan, K S; Farhi, L; Feuerbach, R J; Ficenec, J; Fissum, K; Forest, T A; Funsten, H; Gai, M; Gavrilov, V B; Gilad, S; Gilfoyle, G P; Giovanetti, K L; Girard, P; Griffioen, K A; Guidal, M; Guillo, M; Gyurjyan, V; Hancock, D; Hardie, J; Heddle, D; Heisenberg, J; Hersman, F W; Hicks, K; Hicks, R S; Holtrop, M; Hyde-Wright, C E; Ito, M M; Jenkins, D; Kelley, J H; Khandaker, M; Kim, K Y; Kim, W; Klein, A; Klein, F J; Klusman, M; Kossov, M; Kuang, Y; Kuhn, S E; Laget, J M; Lawrence, D; Longhi, A; Loukachine, K; Lucas, M; Major, R W; Manak, J J; Marchand, C; Matthews, S K; McAleer, S; McNabb, J W C; Mecking, B A; Mestayer, M D; Meyer, C A; Mirazita, M; Miskimen, R; Muccifora, V; Mueller, J; Mutchler, G S; Napolitano, J; Niculescu, G; Niczyporuk, B; Niyazov, R A; Ohandjanyan, M S; Opper, A; Patois, Y; Peterson, G A; Philips, S; Pivnyuk, N; Pocanic, D; Pogorelko, O; Polli, E; Preedom, B M; Price, J W; Qin, L M; Raue, B A; Reolon, A R; Riccardi, G; Ricco, G; Ripani, M; Ritchie, B G; Ronchetti, F; Rossi, P; Rowntree, D; Rubin, P D; Salgado, C W; Sanzone, M; Sapunenko, V; Sargsyan, M; Schumacher, R A; Sharabian, Y G; Shaw, J; Shuvalov, S M; Skabelin, A; Smith, E S; Smith, T; Sober, D I; Spraker, M; Stoler, P; Taiuti, M; Taylor, S; Tedeschi, D; Thompson, R; Todor, L; Tung, T Y; Vineyard, M F; Vlassov, A; Weller, H; Weinstein, L B; Welsh, R; Weygand, D P; Whisnant, S; Witkowski, M; Wolin, E; Yegneswaran, A; Yun, J; Zhou, Z; Zhao, J

    2002-03-25

    Models of baryon structure predict a small quadrupole deformation of the nucleon due to residual tensor forces between quarks or distortions from the pion cloud. Sensitivity to quark versus pion degrees of freedom occurs through the Q2 dependence of the magnetic (M1+), electric (E1+), and scalar (S1+) multipoles in the gamma*p-->Delta(+)-->p pi(0) transition. We report new experimental values for the ratios E(1+)/M(1+) and S(1+)/M(1+) over the range Q2 = 0.4-1.8 GeV2, extracted from precision p(e,e(')p)pi(0) data using a truncated multipole expansion. Results are best described by recent unitary models in which the pion cloud plays a dominant role.

  7. CYP1A1 and CYP2E1 polymorphism frequencies in a large Brazilian population

    Directory of Open Access Journals (Sweden)

    Renata dos Santos Coura

    2007-01-01

    Full Text Available The enzymes encoded by the polymorphic genes CYP1A1 and CYP2E1 play an important role in the activation and inactivation of xenobiotics. These enzymes have been associated with xenobiotic-induced diseases, such as cancer, therapeutic failure and adverse effects of drugs. The aim of the present study was to determine the allelic and genotypic frequencies of these polymorphisms in a large, ethnically mixed Brazilian population sample from Rio de Janeiro. Polymorphisms CYP1A1 and CYP2E1 were determined in 870 unrelated individuals by PCR-RFLP analysis in peripheral blood DNA. The observed allelic frequencies were 0.90 for CYP1A1*1A and 0.95 for CYP2E1*1A, in the total sample. The allelic frequency of CYP1A1*2C in "pardos" (0.13 and Brazilian whites (0.11 was higher than in Caucasians (0.05, which may be a result of the Amerindian genetic component, that presents the highest frequency of this allele observed up to now. The genotype distributions for both polymorphisms were in Hardy-Weinberg equilibrium and were statistically different between males and females, and among ethnic groups.

  8. Construction and in vitro Study of an E1B-Defective Adenovirus

    Institute of Scientific and Technical Information of China (English)

    Xue Feng; Joshua Mallam Nock; Zhu Hua-bin; Dong Chang-yuan; Qi Yi-peng

    2004-01-01

    An E1B-defective adenovirus named r1/Ad was constructed by homologous recombination. The construction, selection and propagation of recombinant virus was done in the human embryonic kidney 293 cells (HEK293). The in vitro study demonstrated that the recombinant virus has the ability to replicate in and lyse some p53-deficient human tumor cells such as the human glioblastoma tumor cells (U251) and human bladder tumer cells (EJ) but not in the normal cells with functional p53 such as the human fibroblast cells (MRC-5). Also, based on the cytopathic effect (CPE), it was demonstrated that the U251 cells were more sensitive to the infection of r1/Ad than that of EJ cells under identical conditions. In this paper, it was found that r1/Ad could be very useful in studying the in vitro selective replication of E1B-defective adenovirus. This may help to determine the safety of using any E1B-defective adenoviruses in cancer gene therapy.

  9. Ubiquitination independent of E1 and E2 enzymes by bacterial effectors

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, Jiazhang; Sheedlo, Michael J.; Yu, Kaiwen; Tan, Yunhao; Nakayasu, Ernesto S.; Das, Chittaranjan; Liu, Xiaoyun; Luo, Zhao-Qing

    2016-04-06

    Signaling by ubiquitination regulates virtually every cellular process in eukaryotes. Covalent attachment of ubiquitin to a substrate is catalyzed by the E1, E2 and E3 three-enzyme cascade 1, which links the C terminus of ubiquitin via an isopeptide bond mostly to the ε-amino group of a lysine of the substrate. Given the essential roles of ubiquitination in the regulation of the immune system, it is not surprising that the ubiquitination network is a common target for diverse infectious agents 2. For example, many bacterial pathogens exploit ubiquitin signaling using virulence factors that function as E3 ligases, deubiquitinases 3 or as enzymes that directly attack ubiquitin 4. The bacterial pathogen Legionella pneumophila utilizes approximately 300 effectors that modulate diverse host processes to create a niche permissive for its replication in phagocytes 5. Here we demonstrate that members of the SidE effector family (SidEs) of L. pneumophila ubiquitinate multiple Rab small GTPases associated with the endoplasmic reticulum (ER). Moreover, we show that these proteins are capable of catalyzing ubiquitination without the need for the E1 and E2 enzymes. The E1/E2-independent ubiquitination catalyzed by these enzymes requires NAD but not ATP and Mg2+. A putative mono ADP-ribosyltransferase (mART) motif critical for the ubiquitination activity is also essential for the role of SidEs in intracellular bacterial replication in a protozoan host. These results establish that ubiquitination can be catalyzed by a single enzyme.

  10. The E1 protein is mandatory for pore formation by Semliki Forest virus spikes.

    Science.gov (United States)

    Dick, M; Barth, B U; Kempf, C

    1996-06-01

    Insect cells (Aedes albopictus, clone C6/36) were infected with various variants of Semliki Forest virus including the wild type using the SFV replicon system. The variants included deletion mutants lacking one of the structural proteins and a mutant with a point mutation in p62 (SQL). The latter mutation results in a failure to process p62 to E2 and E3. After infection of the cells with different variant viruses and subsequent expression of viral proteins in the host cell plasma membrane low pH-induced pore formation was detected by measuring the efflux of a radiolabeled compound. The results of these experiments clearly showed that the E1 protein is mandatory for the acid-induced pore formation. A participation of the 6K or C-protein could be excluded. Furthermore, results obtained with the SQL mutant suggest that dissociation of the E1/E2 heterodimer and subsequent homooligomerization of E1 are required for pore formation.

  11. Effects of 6-Hydroxyflavone on Osteoblast Differentiation in MC3T3-E1 Cells

    Directory of Open Access Journals (Sweden)

    Chien-Hung Lai

    2014-01-01

    Full Text Available Osteoblast differentiation plays an essential role in bone integrity. Isoflavones and some flavonoids are reported to have osteogenic activity and potentially possess the ability to treat osteoporosis. However, limited information concerning the osteogenic characteristics of hydroxyflavones is available. This study investigates the effects of various hydroxyflavones on osteoblast differentiation in MC3T3-E1 cells. The results showed that 6-hydroxyflavone (6-OH-F and 7-hydroxyflavone (7-OH-F stimulated ALP activity. However, baicalein and luteolin inhibited ALP activity and flavone showed no effect. Up to 50 μM of each compound was used for cytotoxic effects study; flavone, 6-OH-F, and 7-OH-F had no cytotoxicity on MC3T3-E1 cells. Moreover, 6-OH-F activated AKT and serine/threonine kinases (also known as protein kinase B or PKB, extracellular signal-regulated kinases (ERK 1/2, and the c-Jun N-terminal kinase (JNK signaling pathways. On the other hand, 7-OH-F promoted osteoblast differentiation mainly by activating ERK 1/ 2 signaling pathways. Finally, after 5 weeks of 6-OH-F induction, MC3T3-E1 cells showed a significant increase in the calcein staining intensity relative to merely visible mineralization observed in cells cultured in the osteogenic medium only. These results suggested that 6-OH-F could activate AKT, ERK 1/2, and JNK signaling pathways to effectively promote osteoblastic differentiation.

  12. In vivo and in vitro characterization of CYP2E1 activity in Japanese and Caucasians.

    Science.gov (United States)

    Kim, R B; Yamazaki, H; Chiba, K; O'Shea, D; Mimura, M; Guengerich, F P; Ishizaki, T; Shimada, T; Wilkinson, G R

    1996-10-01

    Chlorzoxazone's disposition after oral administration was determined in 20 young healthy Caucasian men and a similar group of Japanese men. The drug's plasma concentrations were significantly higher and its rate of elimination slower in Japanese compared to Caucasian men. Accordingly, chlorzoxazone's oral clearance was smaller (40%) in Japanese men and a similar difference (30%) was still apparent after normalizing for body weight (3.74 +/- 1.23 versus 5.05 +/- 1.41 ml.min-1.kg-1, P relationships were found between measures of CYP2E1 activity, both in vivo and in vitro, and genomic polymorphisms in the CYP2E1 gene identified by Rsal/Pstl and Dral restriction fragment length polymorphisms. Collectively, these data show an interracial difference in CYP2E1 activity. Because this enzyme is importantly involved in the activation of environmental procarcinogens, such a difference may account, in part, for the lower rate of some cancers, e.g., lung cancer, in Japanese compared to Caucasians men.

  13. Electric dipole strength distribution below the E1 giant resonance in N = 82 nuclei

    Science.gov (United States)

    Guliyev, Ekber; Kuliev, Ali; Guner, Mehmet

    2010-12-01

    In this study quasiparticle random-phase approximation with the translational invariant Hamiltonian using deformed mean field potential has been conducted to describe electric dipole excitations in 136Xe, 138Ba, 140Ce, 142Nd, 144Sm and 146Gd isotones. The distribution of the calculated E1 strength shows a resonance like structure at energies between 6-8 MeV exhausting up to 1% of the isovector electric dipole Energy Weighted Sum Rule and in some aspects nicely confirms the experimental data. It has been shown that the main part of E1 strength, observed below the threshold in these nuclei may be interpreted as main fragments of the Pygmy Dipole resonance. The agreement between calculated mean excitation energies as well as summed B(E1) value of the 1- excitations and the available experimental data is quite good. The calculations indicate the presence of a few prominent positive parity 1+ States in heavy N = 82 isotones in the energy interval 6-8 MeV which shows not all dipole excitations were of electric character in this energy range.

  14. Instanton induced Yukawa couplings from distant E3 and E(-1) instantons

    Energy Technology Data Exchange (ETDEWEB)

    Goodsell, Mark D. [Sorbonne Universités, UPMC Univ Paris 06, UMR 7589, LPTHE,F-75005, Paris (France); CNRS, UMR 7589, LPTHE,F-75005, Paris (France); Witkowski, Lukas T. [Institute for Theoretical Physics, University of Heidelberg,Philosophenweg 19, 69120 Heidelberg (Germany)

    2016-01-07

    We calculate non-perturbative contributions to Yukawa couplings on D3-branes at orbifold singularities due to E3 and fractional E(-1) instantons which do not intersect the visible sector branes. While distant E3 instantons on bulk cycles typically contribute to Yukawa couplings, we find that distant fractional E(-1) can also give rise to new Yukawa couplings. However, fractional E(-1) instantons only induce Yukawa couplings if they are located at a singularity which shares a collapsed homologous two-cycle with the singularity supporting the visible sector. The non-perturbative contributions to Yukawa couplings exhibit a different flavour structure than the tree-level Yukawa couplings and, as a result, they can be sources of flavour violation. This is particularly relevant for schemes of moduli stabilisation which rely on superpotential contributions from E3 instantons, such as KKLT or the Large Volume Scenario. As a byproduct of our analysis, we shed some new light on the properties of annulus diagrams with matter field insertions in stringy instanton calculus.

  15. Evidence for selective regulation of the phosphorylation of myocyte proteins by isoproterenol and prostaglandin E1.

    Science.gov (United States)

    Hayes, J S; Bowling, N; King, K L; Boder, G B

    1982-01-12

    Both isoproterenol and prostaglandin E1 increased the activation state of cyclic AMP-dependent protein kinase in cultured myocytes; however, only isoproterenol enhanced phosphorylase activity and contractile state. Following the incubation of intact myocytes with 32PO3-(4), 32 phosphoproteins were resolved from total cellular proteins by electrophoresis in sodium dodecyl sulfate polyacrylamide gels followed by autoradiography. Isoproterenol stimulated 32PO3-(4) incorporation into 16 proteins, including 2 phosphoproteins not observed under control conditions. By contrast, prostaglandin E1 neither caused a measurable change in the protein phosphorylation pattern nor interfered with isoproterenol's capacity to do so. Isoproterenol stimulated myocyte protein phosphorylation in either the presence or absence of extracellular Ca2+. The results suggest that the regulation of protein phosphorylation following adenylate cyclase stimulation is: (1) an agonist-specific process and not due solely to a random accumulation of intracellular cycle AMP and activation of protein kinase; (2) the Ca2+ mobilization component of beta-receptor activation does not account for the paradoxical effects of isoproterenol and prostaglandin E1; (3) activation of cyclic AMP-dependent protein kinase does not always result in an enhancement of protein phosphorylation.

  16. Ovarian Hormone Estrone Glucuronide (E1G) quantification-impedimetric electrochemical spectroscopy approach

    KAUST Repository

    Zia, Asif I.

    2013-12-01

    A study was conducted on detection and concentration measurement of estrone glucuronide (E1G), an important metabolite of the ovarian hormone estradiol, by using Electrochemical Impedance Spectroscopy (EIS) technique. A miniature planar Inter-digital (ID) capacitive sensor fabricated on single crystal silicon substrate with sputtered gold electrodes coupled with EIS was used to measure conductivity, permeability and dielectric properties of the said hormone metabolite. A thin film of Silicon Nitride (50 um) was coated on the sensor as passivation layer to avoid Faradic currents through the sensor. Impedance spectrums were obtained with various concentrations of E1G in buffer solution by exposing the samples to electrical perturbations at certain frequency range. Relationship of sample conductance with E1G concentration was studied on basis Randle\\'s equivalent circuit model and results were analyzed to deduce Constant Phase Equivalent (CPE) Circuit model in order to evaluate the double layer capacitance produced at the solution-electrode interface due to kinetic processes taking place in the electrochemical cell. The sensitivity of the sensor was evaluated against concentration. The result analysis confirmed that fabricated ID sensor together with EIS can provide a rapid and successful low cost sensing system which can help a lay user to determine peak time for feminine reproductive fertility at home without submitting samples for an expensive and time consuming laboratory test. © 2013 IEEE.

  17. Delta-doping in diffusion studies

    Science.gov (United States)

    Bénière, François; Chaplain, René; Gauneau, Marcel; Reddy, Viswanatha; Régrény, André

    1993-12-01

    The δ-doping where the dopant is confined on the length-scale of the lattice constant provides perfectly ideal conditions to study the atomic transport processes. We have studied MBE-grown GaAs samples δ-doped with Si and Al layers. Long time diffusion anneals have been performed in the temperature range 550 800 °C. The distribution profiles are examined by SIMS-profiling. We obtain Si diffusion coefficients in good agreement with the other recent studies using different techniques (rapid thermal annealing, capacitance-voltage profiling, sandwiched diffusion source). This contrasts with the earlier measurements based on diffusion of implanted dopants which were much more widely spread. We conclude that the more accurate data allowed with the δ-doping show that the diffusion coefficient is an intrinsic parameter provided that the amount of dopant and the dislocation density are kept sufficiently small. Le dopage-delta, où le dopant est confiné à l'échelle du paramètre du réseau, fournit les conditions parfaitement idéales pour étudier les processus de transport atomique. Nous avons étudié des échantillons de GaAs obtenus par épitaxie par jet moléculaire dopés par des couches-delta de Si et Al. Des traitements de diffusion de longue durée ont été réalisés dans l'intervalle de température 550 à 800°C. Les profils de distribution sont examinés par spectrométrie d'émission d'ions secondaires. Nous obtenons des coefficients de diffusion de Si en bon accord avec les autres études récentes utilisant des techniques différentes (traitement thermique ultrarapide, profil de distribution par la méthode capacité-voltage, diffusion d'une couche “ sandwich ”). Ceci diffère des mesures antérieures qui, basées sur la diffusion de dopants implantés, étaient beaucoup plus dispersées. Nous concluons que les données plus précises rendues possibles par le dopage-delta montrent que le coefficient de diffusion est un paramètre intrinsèque

  18. A NOTE ON DELTA-PERTURBATION EXPANSION METHOD

    Institute of Scientific and Technical Information of China (English)

    何吉欢

    2002-01-01

    The Delta-perturbation expansion method, a kind of new perturbation technique depending upon an artificial parameter Delta was studied. The study reveals that the method exits some advantages, but also exits some limitations. To overcome the limitations, the socalled linearized perturbation method proposed by HE Ji-huan can be powerfully applied.

  19. Automatisierte VHDL-Code-Generierung eines Delta-Sigma Modulators

    Science.gov (United States)

    Spilka, R.; Ostermann, T.

    2006-09-01

    Im vorliegenden Beitrag wird eine automatische Generierung des VHDL-Codes eines Delta-Sigma Modulators präsentiert. Die Koeffizientenmultiplikation wird hierbei durch Bit-Serielle-Addition durchgeführt. Mit Hilfe zweier neuer Matlab Funktionen wird der Systementwurf durch die bekannte Delta-Sigma Toolbox von R. Schreier erweitert und direkt synthesefähiger VHDL Code erzeugt.

  20. A BRITE view on delta Scuti and gamma Doradus stars

    CERN Document Server

    Zwintz, Konstanze

    2016-01-01

    BRITE-Constellation has obtained data for a few delta Scuti and gamma Doradus type stars. A short overview of the pulsational content found in five stars - beta Cassiopeiae, epsilon Cephei, M Velorum, beta Pictoris and QW Puppis - is given and the potential of BRITE-Constellation observations of delta Scuti and gamma Doradus pulsators is discussed.

  1. Terahertz radiation from delta-doped GaAs

    DEFF Research Database (Denmark)

    Birkedal, Dan; Hansen, Ole; Sørensen, Claus Birger;

    1994-01-01

    Terahertz pulse emission from four different delta-doped molecular beam epitaxially grown GaAs samples is studied. We observe a decrease of the emitted THz pulse amplitude as the distance of the delta-doped layer from the surface is increased, and a change in polarity of the THz pulses as compared...

  2. Women in Leadership Roles in Phi Delta Kappa.

    Science.gov (United States)

    Harder, Martha B.; And Others

    The professional and personal characteristics of the men and women in Phi Delta Kappa who hold the top elected positions in local chapters were compared, and the perceptions of these leaders of the impact of allowing women to be members of Phi Delta Kappa were assessed. A 43-item questionnaire was developed and mailed to 1,340 chapter presidents…

  3. Downstream hydraulic geometry of a tidally influenced river delta

    NARCIS (Netherlands)

    Sassi, M.G.; Hoitink, A.J.F.; Brye, de B.; Deleersnijder, E.

    2012-01-01

    Channel geometry in tidally influenced river deltas can show a mixed scaling behavior between that of river and tidal channel networks, as the channel forming discharge is both of river and tidal origin. We present a method of analysis to quantify the tidal signature on delta morphology, by extendin

  4. Towards a Comprehensive Framework for Adaptive Delta Management

    NARCIS (Netherlands)

    Marchand, M.; Ludwig, F.

    2014-01-01

    Deltas are dynamic landforms at the boundary of land and sea, involving intricate mazes of rivers and small waterways, wetlands, estuaries and coastal barrier islands. They are home to over half a billion people. Deltas are also home to rich ecosystems, such as mangroves and marshes. They are

  5. Delta's paradise: a challenge for lan[d]scape architects

    NARCIS (Netherlands)

    Boekhorst, te J.K.M.; Toorn, van den M.W.M.

    1996-01-01

    Paradise as a metaphor has always played an important role in art. This is definitely true for the art of garden design, but paradise is also a metaphor that can be used for the landscape. Some of the most interesting landscapes are found in deltas. Deltas are rich in natural and economic potential.

  6. Towards a Comprehensive Framework for Adaptive Delta Management

    NARCIS (Netherlands)

    Marchand, M.; Ludwig, F.

    2014-01-01

    Deltas are dynamic landforms at the boundary of land and sea, involving intricate mazes of rivers and small waterways, wetlands, estuaries and coastal barrier islands. They are home to over half a billion people. Deltas are also home to rich ecosystems, such as mangroves and marshes. They are econom

  7. An annotated list of Fishes from the Niger Delta

    NARCIS (Netherlands)

    Boeseman, M.

    1963-01-01

    At the end of November 1960, the Leiden Museum received an interesting collection of animals, mostly fishes, from the Niger delta. All specimens were collected by Mr. H. J. G. Beets, at the time employed by Shell B.P. — Delta Investigations, during the period May to August 1960, and in the region

  8. Delta's paradise: a challenge for lan[d]scape architects

    NARCIS (Netherlands)

    te Boekhorst, J.K.M.; Toorn, van den M.W.M.

    1996-01-01

    Paradise as a metaphor has always played an important role in art. This is definitely true for the art of garden design, but paradise is also a metaphor that can be used for the landscape. Some of the most interesting landscapes are found in deltas. Deltas are rich in natural and economic potential.

  9. Emerging leadership from communities in the Lower Mississippi Delta (LMD)

    Science.gov (United States)

    The Delta NIRI (Nutrition Intervention Research Initiative) team has conducted several research studies in the Lower Mississippi Delta (LMD) region employing the community-based participatory research (CBPR) model. Our collaborative work in the LMD focuses on interventions conducted in each of our c...

  10. Spatio-temporal distributions of delta18O, delta D and salinity in the Arabian Sea: Identifying processes and controls

    Digital Repository Service at National Institute of Oceanography (India)

    Deshpande, R.D.; Muraleedharan, P.M.; Singh, R.L.; Kumar, B.; Rao, M.S.; Dave, M.; Sivakumar, K.U.; Gupta, S.K.

    of these parameters. From the distributions of delta18O and salinity (S), and the relationships between delta18OdeltaD and delta18O–S, the following inferences have been drawn: (1) there is a broad correspondence between...

  11. 78 FR 21491 - DeltaPoint Capital IV, L.P., DeltaPoint Capital IV (New York), L.P.; Notice Seeking Exemption...

    Science.gov (United States)

    2013-04-10

    ... ADMINISTRATION DeltaPoint Capital IV, L.P., DeltaPoint Capital IV (New York), L.P.; Notice Seeking Exemption Under Section 312 of the Small Business Investment Act, Conflicts of Interest Notice is hereby given that DeltaPoint Capital IV, L.P. and DeltaPoint Capital IV (New York), L.P., 45 East Avenue, 6th...

  12. The Concentration Dependence of the (Delta)s Term in the Gibbs Free Energy Function: Application to Reversible Reactions in Biochemistry

    Science.gov (United States)

    Gary, Ronald K.

    2004-01-01

    The concentration dependence of (delta)S term in the Gibbs free energy function is described in relation to its application to reversible reactions in biochemistry. An intuitive and non-mathematical argument for the concentration dependence of the (delta)S term in the Gibbs free energy equation is derived and the applicability of the equation to…

  13. Identification of Interactions in the E1E2 Heterodimer of Hepatitis C Virus Important for Cell Entry*

    Science.gov (United States)

    Maurin, Guillemette; Fresquet, Judith; Granio, Ophélia; Wychowski, Czeslaw; Cosset, François-Loïc; Lavillette, Dimitri

    2011-01-01

    Several conserved domains critical for E1E2 assembly and hepatitis C virus entry have been identified in E1 and E2 envelope glycoproteins. However, the role of less conserved domains involved in cross-talk between either glycoprotein must be defined to fully understand how E1E2 undergoes conformational changes during cell entry. To characterize such domains and to identify their functional partners, we analyzed a set of intergenotypic E1E2 heterodimers derived from E1 and E2 of different genotypes. The infectivity of virions indicated that Con1 E1 did not form functional heterodimers when associated with E2 from H77. Biochemical analyses demonstrated that the reduced infectivity was not related to alteration of conformation and incorporation of Con1 E1/H77 E2 heterodimers but rather to cell entry defects. Thus, we generated chimeric E1E2 glycoproteins by exchanging different domains of each protein in order to restore functional heterodimers. We found that both the ectodomain and transmembrane domain of E1 influenced infectivity. Site-directed mutagenesis highlighted the role of amino acids 359, 373, and 375 in transmembrane domain in entry. In addition, we identified one domain involved in entry within the N-terminal part of E1, and we isolated a motif at position 219 that is critical for H77 function. Interestingly, using additional chimeric E1E2 complexes harboring substitutions in this motif, we found that the transmembrane domain of E1 acts as a partner of this motif. Therefore, we characterized domains of E1 and E2 that have co-evolved inside a given genotype to optimize their interactions and allow efficient entry. PMID:21555519

  14. Surface Delta Interaction and g factors

    CERN Document Server

    Yu, Xiaofei

    2015-01-01

    Using an attractive surface delta interaction we obtain wave functions for 2 neutrons (or neutron holes) in the model space of 2 orbits (l=4, j=7/2) and (l=2, j=5/2). If we take the single particle energies to be degenerate we find that the g factors for I=2, 4 and 6 are all the same -namely the orbital g factor of the single nucleon. For a free neutron this quantity zero all 2particle or 2 hole g factors are equal to zero as well.. Only the orbital part of the g -factors contribute - the spin part cancels out. We then consider the effects of introducing a single energy splititng between the 2 orbits.

  15. Historical floods in the Dutch Rhine Delta

    Directory of Open Access Journals (Sweden)

    R. Glaser

    2003-01-01

    Full Text Available Historical records provide direct information about the climatic impact on society. Especially great natural disasters such as river floods have been for long attracting the attention of humankind. Time series for flood development on the Rhine branches Waal, Nederrijn/Lek and IJssel in the Dutch Rhine Delta are presented in this paper. In the case of the Waal it is even possible to compare historical flood frequencies based on documentary data with the recent development reconstructed from standardized instrumental measurements. In brief, we will also discuss various parameters concerning the structure of the flood series and the "human dimension" of natural disaster, i.e. the vulnerability of society when facing natural disasters.

  16. Head orientation prediction: delta quaternions versus quaternions.

    Science.gov (United States)

    Himberg, Henry; Motai, Yuichi

    2009-12-01

    Display lag in simulation environments with helmet-mounted displays causes a loss of immersion that degrades the value of virtual/augmented reality training simulators. Simulators use predictive tracking to compensate for display lag, preparing display updates based on the anticipated head motion. This paper proposes a new method for predicting head orientation using a delta quaternion (DQ)-based extended Kalman filter (EKF) and compares the performance to a quaternion EKF. The proposed framework operates on the change in quaternion between consecutive data frames (the DQ), which avoids the heavy computational burden of the quaternion motion equation. Head velocity is estimated from the DQ by an EKF and then used to predict future head orientation. We have tested the new framework with captured head motion data and compared it with the computationally expensive quaternion filter. Experimental results indicate that the proposed DQ method provides the accuracy of the quaternion method without the heavy computational burden.

  17. Spectral factorization using the delta operator

    DEFF Research Database (Denmark)

    Rostgaard, Morten; Poulsen, Niels Kjølstad; Ravn, Ole

    1994-01-01

    In recent years many papers have been published abouth the gamma-operator, mostly caused by the better numerical properties and the rapprochement between continuous and discrete time. A major problem within the LQG-design of a delta-based input-output relation has been how to spectral......-factorize in an efficient way. The discrete-time method of Kuccera will not be applied since numerical word-length characteristics will be poor for fast sampling rates. In this paper a new approach is considered. A new gamma-operator (Tustin operator) is introduced, in order to make an iterative and numerical stable...... solution to the spectral factorization problem. The key idea is to use the gamma-operator resembled by its behavior to the differential operator....

  18. Delta-excitations and the three-nucleon force

    CERN Document Server

    Epelbaum, E; Meißner, Ulf-G

    2007-01-01

    We study the three-nucleon force in chiral effective field theory with explicit Delta-resonance degrees of freedom. We show that up to next-to-next-to-leading order, the only contribution to the isospin symmetric three-nucleon force involving the spin-3/2 degrees of freedom is given by the two-pion-exchange diagram with an intermediate delta, frequently called the Fujita-Miyazawa force. We also analyze the leading isospin-breaking corrections due to the delta. For that, we give the first analysis of the delta quartet mass splittings in chiral effective field theory. The charge-symmetry breaking three-nucleon force due to an intermediate delta excitation is small, of the order of a few keV.

  19. Automatic Detection of Magnetic delta in Sunspot Groups

    CERN Document Server

    Padinhatteeri, Sreejith; Bloomfield, D Shaun; Gallagher, Peter T

    2015-01-01

    Large and magnetically complex sunspot groups are known to be associated with flares. To date, the Mount Wilson scheme has been used to classify sunspot groups based on their morphological and magnetic properties. The most flare prolific class, the delta sunspot-group, is characterised by opposite polarity umbrae within a common penumbra, separated by less than 2 degrees. In this article, we present a new system, called the Solar Monitor Active Region Tracker - Delta Finder (SMART-DF), that can be used to automatically detect and classify magnetic deltas in near-realtime. Using continuum images and magnetograms from the Helioseismic and Magnetic Imager (HMI) onboard NASA's Solar Dynamics Observatory (SDO), we first estimate distances between opposite polarity umbrae. Opposite polarity pairs having distances of less that 2 degrees are then identified, and if these pairs are found to share a common penumbra, they are identified as a magnetic delta configuration. The algorithm was compared to manual delta detect...

  20. Effects of isovector scalar $\\delta$-meson on hypernuclei

    CERN Document Server

    Ikram, M; Biswal, S K; Patra, S K

    2014-01-01

    We analyze the effects of $\\delta-$ meson on hypernuclei within the frame-work of relativistic mean field theory. The $\\delta-$ meson is included into the Lagrangian for hypernuclei. The extra nucleon-meson coupling ($g_\\delta$) affects the every piece of physical observables, like binding energy, radii and single particle energy of hypernuclei. The lambda mean field potential is investigated which is consistent with other predictions. Flipping of single particle energy levels are observed with the strength of $g_\\delta$ in the considered hypernuclei as well as normal nuclei. The spin-orbit potentials are observed for considered hypernuclei and the effect of $g_\\delta$ on spin-orbit potentials is also analyzed. The calculated single-$\\Lambda$ binding energies ($B_\\Lambda$) are quite agreeable with the experimental data.

  1. Isolation of Delta9-THCA-A from hemp and analytical aspects concerning the determination of Delta9-THC in cannabis products.

    Science.gov (United States)

    Dussy, Franz E; Hamberg, Cornelia; Luginbühl, Marco; Schwerzmann, Thomas; Briellmann, Thomas A

    2005-04-20

    A simple procedure based on a common silica gel column chromatography for the isolation of Delta9-tetrahydrocannabinolic acid A (Delta9-THCA-A) from hemp in a multi-milligram scale is presented. Further, the decarboxylation reaction of Delta9-THCA-A to the toxicologically active Delta9-tetrahydrocannabinol (Delta9-THC) at different analytical and under-smoking conditions is investigated. Maximal conversion in an optimised analytical equipment yields about 70% Delta9-THC. In the simulation of the smoking process, only about 30 % of the spiked substance could be recovered as Delta9-THC.

  2. Multimode delta-E effect magnetic field sensors with adapted electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Zabel, Sebastian; Fichtner, Simon; Kirchhof, Christine; Quandt, Eckhard; Faupel, Franz, E-mail: ff@tf.uni-kiel.de [Faculty of Engineering, Institute for Materials Science, Kiel University, Kaiserstraße 2, 24143 Kiel (Germany); Reermann, Jens; Schmidt, Gerhard [Faculty of Engineering, Institute for Electrical Engineering, Kiel University, Kaiserstraße 2, 24143 Kiel (Germany); Wagner, Bernhard [Fraunhofer Institute for Silicon Technology ISIT, Fraunhoferstraße 1, 25524 Itzehoe (Germany)

    2016-05-30

    We present an analytical and experimental study on low-noise piezoelectric thin film resonators that utilize the delta-E effect of a magnetostrictive layer to measure magnetic fields at low frequencies. Calculations from a physical model of the electromechanical resonator enable electrode designs to efficiently operate in the first and second transversal bending modes. As predicted by our calculations, the adapted electrode design improves the sensitivity by a factor of 6 and reduces the dynamic range of the sensor output by 16 dB, which significantly eases the requirements on readout electronics. Magnetic measurements show a bandwidth of 100 Hz at a noise level of about 100 pTHz{sup −0.5}.

  3. Multimode delta-E effect magnetic field sensors with adapted electrodes

    Science.gov (United States)

    Zabel, Sebastian; Reermann, Jens; Fichtner, Simon; Kirchhof, Christine; Quandt, Eckhard; Wagner, Bernhard; Schmidt, Gerhard; Faupel, Franz

    2016-05-01

    We present an analytical and experimental study on low-noise piezoelectric thin film resonators that utilize the delta-E effect of a magnetostrictive layer to measure magnetic fields at low frequencies. Calculations from a physical model of the electromechanical resonator enable electrode designs to efficiently operate in the first and second transversal bending modes. As predicted by our calculations, the adapted electrode design improves the sensitivity by a factor of 6 and reduces the dynamic range of the sensor output by 16 dB, which significantly eases the requirements on readout electronics. Magnetic measurements show a bandwidth of 100 Hz at a noise level of about 100 pTHz-0.5.

  4. Dependence of {delta}E effect on internal stresses in nickel: Experimental results by laser interferometry

    Energy Technology Data Exchange (ETDEWEB)

    Chicharro, J.M. [Dept. de Mecanica Aplicada e Ingenieria de Proyectos, E.T.S.I. Industriales, Universidad de Castilla-La Mancha, Avd. Camilo Jose Cela s/n, 13071 Ciudad Real (Spain)]. E-mail: josemanuel.chicharro@uclm.es; Bayon, A. [Dept. de Fisica Aplicada a los Recursos Naturales, E.T.S.I. Minas, Universidad Politecnica de Madrid, c/Rios Rosas, 21, 28003 Madrid (Spain); Salazar, F. [Dept. de Fisica Aplicada a los Recursos Naturales, E.T.S.I. Minas, Universidad Politecnica de Madrid, c/Rios Rosas, 21, 28003 Madrid (Spain)

    2006-02-15

    The speckle heterodyne interferometry is applied to the study of the dependence of Young's modulus on both the magnetic field and the internal stresses in a soft ferromagnetic material. Young's modulus is determined from the first natural longitudinal frequency of a slender magnetic rod positioned within a solenoid. Vibration of the sample is detected by an optical heterodyne system with a wide bandwidth. The samples are heated to above the Curie point and then cooled at several rates in order to induce different internal stresses. The study refers to nickel rods 10mm in diameter and 110mm in length. The grain sizes of the samples are also determined and related to changes in {delta}E.

  5. Studies on the metabolism of the Delta9-tetrahydrocannabinol precursor Delta9-tetrahydrocannabinolic acid A (Delta9-THCA-A) in rat using LC-MS/MS, LC-QTOF MS and GC-MS techniques.

    Science.gov (United States)

    Jung, Julia; Meyer, Markus R; Maurer, Hans H; Neusüss, Christian; Weinmann, Wolfgang; Auwärter, Volker

    2009-10-01

    In Cannabis sativa, Delta9-Tetrahydrocannabinolic acid-A (Delta9-THCA-A) is the non-psychoactive precursor of Delta9-tetrahydrocannabinol (Delta9-THC). In fresh plant material, about 90% of the total Delta9-THC is available as Delta9-THCA-A. When heated (smoked or baked), Delta9-THCA-A is only partially converted to Delta9-THC and therefore, Delta9-THCA-A can be detected in serum and urine of cannabis consumers. The aim of the presented study was to identify the metabolites of Delta9-THCA-A and to examine particularly whether oral intake of Delta9-THCA-A leads to in vivo formation of Delta9-THC in a rat model. After oral application of pure Delta9-THCA-A to rats (15 mg/kg body mass), urine samples were collected and metabolites were isolated and identified by liquid chromatography-mass spectrometry (LC-MS), liquid chromatography-tandem mass spectrometry (LC-MS/MS) and high resolution LC-MS using time of flight-mass spectrometry (TOF-MS) for accurate mass measurement. For detection of Delta9-THC and its metabolites, urine extracts were analyzed by gas chromatography-mass spectrometry (GC-MS). The identified metabolites show that Delta9-THCA-A undergoes a hydroxylation in position 11 to 11-hydroxy-Delta9-tetrahydrocannabinolic acid-A (11-OH-Delta9-THCA-A), which is further oxidized via the intermediate aldehyde 11-oxo-Delta9-THCA-A to 11-nor-9-carboxy-Delta9-tetrahydrocannabinolic acid-A (Delta9-THCA-A-COOH). Glucuronides of the parent compound and both main metabolites were identified in the rat urine as well. Furthermore, Delta9-THCA-A undergoes hydroxylation in position 8 to 8-alpha- and 8-beta-hydroxy-Delta9-tetrahydrocannabinolic acid-A, respectively, (8alpha-Hydroxy-Delta9-THCA-A and 8beta-Hydroxy-Delta9-THCA-A, respectively) followed by dehydration. Both monohydroxylated metabolites were further oxidized to their bishydroxylated forms. Several glucuronidation conjugates of these metabolites were identified. In vivo conversion of Delta9-THCA-A to Delta9-THC was

  6. Extensive junctional diversity of rearranged human T cell receptor delta genes.

    Science.gov (United States)

    Hata, S; Satyanarayana, K; Devlin, P; Band, H; McLean, J; Strominger, J L; Brenner, M B; Krangel, M S

    1988-06-10

    The human T cell receptor delta (TCR delta) gene encodes one component of the TCR gamma delta-CD3 complex found on subsets of peripheral blood and thymic T cells. Human TCR delta diversity was estimated by characterizing rearrangements in TCR gamma delta cell lines and determining the structures of complementary DNA clones representing functional and nonfunctional transcripts in these cell lines. One V delta segment and one J delta segment were identified in all functional transcripts, although a distinct J delta segment was identified in a truncated transcript. Further, one D delta element was identified, and evidence for the use of an additional D delta element was obtained. Thus human TCR delta genes appear to use a limited number of germline elements. However, the apparent use of two D delta elements in tandem coupled with imprecise joining and extensive incorporation of N nucleotides generates unprecedented variability in the junctional region.

  7. Potency of Mahakam Delta in East Kalimantan, Indonesia

    Directory of Open Access Journals (Sweden)

    Zairin Zain

    2014-04-01

    Full Text Available Normal 0 false false false IN X-NONE X-NONE Mahakam Delta is not only utilized for fishery activities but also for several industrial purposes such as coal and oil mining, shipping and timber. The objective of this paper is to provide information in term of the potency of Mahakam Delta located in East Kalimantan province, Indonesia. The study was conducted in Mahakam Delta, East Kalimantan Province, Indonesia. Participatory rural appraisal is a group of methods to collect information in a participatory fashion from rural communities. The method employed in this research was descriptive analysis describing the environmental potency found in Mahakam Delta. Massive conversion of mangrove forest particularly Nypa (Nypa fruticans area into pond has driven conflict among related stakeholders on the utilization of natural resource and land which subsequently impacts on the fish and shrimp source regeneration, loss of ecological functions of mangrove forest for feeding, nursery and spawning ground of fish and other organisms. Besides of fisheries, oil and gas activity also exists in Mahakam Delta. Mahakam Delta is regarded as important area due to the largest producer of oil and gas mining. Thus, oil and gas industry is the most reliable sector that contributes to the economic development of Kutai Kartanegara district. As a resource provider, Mahakam Delta ecosystem provides various resources for livelihoods. As a life-support service provider, Mahakam Delta ecosystem provides habitat and ideal environment to support variety of living kinds. As a convenience provider, Mahakam Delta ecosystem provides unique and interesting recreation site. As a protector from natural disaster, Mahakam Delta ecosystem is able to protect human kinds from natural disaster threatening coastal area.

  8. Calculation of parity violating effects in the 6/sup 2/P/sub 1/2/-7/sup 2/P/sub 1/2/ forbidden M1 transition in thallium. [E1 amplitude, circular dichroism, parity violation, hyperfine structure

    Energy Technology Data Exchange (ETDEWEB)

    Neuffer, D.B.

    1977-05-01

    Calculations are presented of the E1 amplitude expected in forbidden M1 transitions of Tl and Cs if parity is violated in the neutral weak e-N interaction, as proposed in a number of gauge models, including that of Weinberg and Salam. Valence electron wave functions are generated as numerical solutions to the Dirac equation in a modified Tietz central potential. These wave functions are used to calculate allowed E1 transition rates, hfs splittings, and Stark E1 transition ampitudes. These results are compared with experiment and the agreement is generally good. The relativistic Tl 6/sup 2/P/sub 1/2/-7/sup 2/P/sub 1/2/ M1 transition amplitude M is also calculated, and corrections due to interconfiguration interaction, Breit interaction, and hfs mixing are included. The parity violating E1 amplitude E/sub PV/ is calculated and a value for the circular dichroism in the Weinberg model delta = -2.6 x 10/sup -3/ is obtained. Parity violating effects in other Tl transitions are discussed. Contributions to the M1 amplitude for the forbidden Cs 6/sup 2/S/sub 1/2/-7/sup 2/S/sub 1/2/ and 6/sup 2/S/sub 1/2/-8/sup 2/S/sub 1/2/ transitions and to the Cs 6/sup 2/S/sub 1/2/ g-factor anomaly from relativistic effects, Breit interaction, interconfiguration interaction, and hfs mixing are calculated, and it is found that this current theoretical description is not entirely adequate. The parity violating E1 amplitude E/sub PV/ for the 6S/sub 1/2/-7/sup 2/S/sub 1/2/ and 6S/sub 1/2/-8/sup 2/S/sub 1/2/ transitions is evaluated. With a measured value M/sub expt/ and the Weinberg value Q/sub W/ = -99, a circular dichroism delta = 1.64 x 10/sup -4/ for the 6/sup 2/S/sub 1/2/-7/sup 2/S/sub 1/2/ transition is found.

  9. Sustainable Growth in Urbanised Delta Areas: the Opportunities of a Geographical Approach to the Pearl River Delta

    NARCIS (Netherlands)

    Van Rens, G.; Nillisen, A.L.; Schamhart, C.; Lugt, N.

    2006-01-01

    The attractions of delta areas have boomed economies and founded major cities, but the threats of the adjacent water have persisted and natural resources have declined. The objective to facilitate sustainable urban growth in delta areas can only be met by a simultaneous approach of all the stakehold

  10. Preservation potential of the Last Interglacial lower Rhine delta relative to the Holocene Rhine-Meuse delta

    NARCIS (Netherlands)

    Peeters, J.; Martinius, A.W.; Cohen, K.M.; Middelkoop, H.; Stouthamer, E.

    2013-01-01

    In order to improve our insights in the sequence stratigraphic and architectural development of lower deltaic hydrocarbon reservoirs we study the Last Interglacial Rhine delta (MIS-5), and compare it to its well investigated counterpart, the Holocene (MIS-1) Rhine- Meuse delta (Berendsen & Stouthame

  11. Effects of ethanol on CYP2E1 levels and related oxidative stress using a standard balanced diet.

    Science.gov (United States)

    Azzalis, Ligia A; Fonseca, Fernando L A; Simon, Karin A; Schindler, Fernanda; Giavarotti, Leandro; Monteiro, Hugo P; Videla, Luis A; Junqueira, Virgínia B C

    2012-07-01

    Expression of cytochrome P4502E1 (CYP2E1) is very much influenced by nutritional factors, especially carbohydrate consumption, and various results concerning the expression of CYP2E1 were obtained with a low-carbohydrate diet. This study describes the effects of ethanol treatment on CYP2E1 levels and its relationship with oxidative stress using a balanced standard diet to avoid low or high carbohydrate consumption. Rats were fed for 1, 2, 3, or 4 weeks a commercial diet plus an ethanol-sucrose solution. The results have shown that ethanol administration was associated with CYP2E1 induction and stabilization without related oxidative stress. Our findings suggest that experimental models with a low-carbohydrate/high-fat diet produce some undesirable CYP2E1 changes that are not present when a balanced standard diet is given.

  12. Structure of Pyrazole Derivatives Impact their Affinity, Stoichiometry, and Cooperative Interactions for CYP2E1 Complexes

    OpenAIRE

    2013-01-01

    CYP2E1 plays a critical role in detoxication and carcinogenic activation of drugs, pollutants, and dietary compounds; however, these metabolic processes can involve poorly characterized cooperative interactions that compromise the ability to understand and predict CYP2E1 metabolism. Herein, we employed an array of ten azoles with an emphasis on pyrazoles to establish the selectivity of catalytic and cooperative CYP2E1 sites through binding and catalytic studies. Spectral binding studies for m...

  13. Evidence for the two-body nature of the E1 transition operator in the sdf-interacting boson model

    NARCIS (Netherlands)

    Barfield, A. F.; von Brentano, P.; Dewald, A.; Zell, K. O.; Zamfir, N. V.; Bucurescu, D.; Ivaşcu, M.; Scholten, O.

    1989-01-01

    Two new absolute transition rates are reported for the nucleus144Sm following an ( α, α') Coulomb excitation study. They are B(E3; 3-→ 0+)=(38±3) W.u. and B(E1;3- → 2+)=(2.8±0.4)×10-3 W.u. This large E1 matrix element, along with the previously known B(E1; 1- →+) value support the interpretation of

  14. Structure of Pyrazole Derivatives Impact their Affinity, Stoichiometry, and Cooperative Interactions for CYP2E1 Complexes

    OpenAIRE

    Hartman, Jessica H.; Bradley, Amber M.; Laddusaw, Ryan M.; Perry, Martin D.; Miller, Grover P.

    2013-01-01

    CYP2E1 plays a critical role in detoxication and carcinogenic activation of drugs, pollutants, and dietary compounds; however, these metabolic processes can involve poorly characterized cooperative interactions that compromise the ability to understand and predict CYP2E1 metabolism. Herein, we employed an array of ten azoles with an emphasis on pyrazoles to establish the selectivity of catalytic and cooperative CYP2E1 sites through binding and catalytic studies. Spectral binding studies for m...

  15. ON SPACELIKE BIHARMONIC SLANT HELICES ACCORDING TO BISHOP FRAME IN THE LORENTZIAN GROUP OF RIGID MOTIONS E(1,1

    Directory of Open Access Journals (Sweden)

    Talat Körpınar

    2012-01-01

    Full Text Available In this paper, we study spacelike biharmonic slant helices according to Bishop frame in the Lorentzian group of rigid motions E(1,1. We characterize the spacelike biharmonic slant helices in terms of their curvatures in the Lorentzian group of rigid motions E(1,1. Finally, we obtain parametric equations of spacelike biharmonic slant helices according to Bishop frame in the Lorentzian group of rigid motions E(1,1.

  16. Ubiquitination independent of E1 and E2 enzymes by bacterial effectors.

    Science.gov (United States)

    Qiu, Jiazhang; Sheedlo, Michael J; Yu, Kaiwen; Tan, Yunhao; Nakayasu, Ernesto S; Das, Chittaranjan; Liu, Xiaoyun; Luo, Zhao-Qing

    2016-05-01

    Signalling by ubiquitination regulates virtually every cellular process in eukaryotes. Covalent attachment of ubiquitin to a substrate is catalysed by the E1, E2 and E3 three-enzyme cascade, which links the carboxy terminus of ubiquitin to the ε-amino group of, in most cases, a lysine of the substrate via an isopeptide bond. Given the essential roles of ubiquitination in the regulation of the immune system, it is not surprising that the ubiquitination network is a common target for diverse infectious agents. For example, many bacterial pathogens exploit ubiquitin signalling using virulence factors that function as E3 ligases, deubiquitinases or as enzymes that directly attack ubiquitin. The bacterial pathogen Legionella pneumophila utilizes approximately 300 effectors that modulate diverse host processes to create a permissive niche for its replication in phagocytes. Here we demonstrate that members of the SidE effector family of L. pneumophila ubiquitinate multiple Rab small GTPases associated with the endoplasmic reticulum. Moreover, we show that these proteins are capable of catalysing ubiquitination without the need for the E1 and E2 enzymes. A putative mono-ADP-ribosyltransferase motif critical for the ubiquitination activity is also essential for the role of the SidE family in intracellular bacterial replication in a protozoan host. The E1/E2-independent ubiquitination catalysed by these enzymes is energized by nicotinamide adenine dinucleotide, which activates ubiquitin by the formation of ADP-ribosylated ubiquitin. These results establish that ubiquitination can be catalysed by a single enzyme, the activity of which does not require ATP.

  17. Cooperativity in CYP2E1 metabolism of acetaminophen and styrene mixtures.

    Science.gov (United States)

    Hartman, Jessica H; Letzig, Lynda G; Roberts, Dean W; James, Laura P; Fifer, E Kim; Miller, Grover P

    2015-10-01

    Risk assessment for exposure to mixtures of drugs and pollutants relies heavily on in vitro characterization of their bioactivation and/or metabolism individually and extrapolation to mixtures assuming no interaction. Herein, we demonstrated that in vitro CYP2E1 metabolic activation of acetaminophen and styrene mixtures could not be explained through the Michaelis-Menten mechanism or any models relying on that premise. As a baseline for mixture studies with styrene, steady-state analysis of acetaminophen oxidation revealed a biphasic kinetic profile that was best described by negative cooperativity (Hill coefficient=0.72). The best-fit mechanism for this relationship involved two binding sites with differing affinities (Ks=830μM and Kss=32mM). Introduction of styrene inhibited that reaction less than predicted by simple competition and thus provided evidence for a cooperative mechanism within the mixture. Likewise, acetaminophen acted through a mixed-type inhibition mechanism to impact styrene epoxidation. In this case, acetaminophen competed with styrene for CYP2E1 (Ki=830μM and Ksi=180μM for catalytic and effector sites, respectively) and resulted in cooperative impacts on binding and catalysis. Based on modeling of in vivo clearance, cooperative interactions between acetaminophen and styrene resulted in profoundly increased styrene activation at low styrene exposure levels and therapeutic acetaminophen levels. Current Michaelis-Menten based toxicological models for mixtures such as styrene and acetaminophen would fail to detect this concentration-dependent relationship. Hence, future studies must assess the role of alternate CYP2E1 mechanisms in bioactivation of compounds to improve the accuracy of interpretations and predictions of toxicity.

  18. Laser altimetry data of Chang’E-1 and the global lunar DEM model

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The Laser AltiMeter (LAM), as one of the main payloads of Chang’E-1 probe, is used to measure the topography of the lunar surface. It performed the first measurement at 02:22 on November 28th, 2007. Up to December 4th 2008, the total number of measurements was approximately 9.12 million, covering the whole surface of the Moon. Using the LAM data, we constructed a global lunar Digtal Elevation Model (DEM) with 3 km spatial resolution. The model shows pronounced morphological characteristics, legible and vivid details of the lunar surface. The plane positioning accuracy of the DEM is 445 m (1σ), and the vertical accuracy is 60 m (1σ). From this DEM model, we measured the full range of the altitude difference on the lunar sur-face, which is about 19.807 km. The highest point is 10.629 km high, on a peak between crater Korolev and crater Dirichlet-Jackson at (158.656°W, 5.441°N) and the lowest point is -9.178 km in height, inside crater Antoniadi (172.413°W, 70.368°S) in the South Pole-Aitken Basin. By comparison, the DEM model of Chang’E-1 is better than the USA ULCN2005 in accuracy and resolution and is probably identical to the DEM of Japan SELENE, but the DEM of Chang’E-1 reveals a new lowest point, clearly lower than that of SELENE.

  19. Lysophosphatidic acid induces chemotaxis in MC3T3-E1 osteoblastic cells

    Energy Technology Data Exchange (ETDEWEB)

    Masiello, Lisa M.; Fotos, Joseph S.; Galileo, Deni S.; Karin, Norm J.

    2006-07-01

    Lysophosphatidic acid (LPA) is a bioactive lipid that has pleiotropic effects on a variety of cell types and enhances the migration of endothelial and cancer cells, but it is not known if this lipid can alter osteoblast motility. We performed transwell migration assays using MC3T3-E1 osteoblastic cells and found LPA to be a potent chemotactic agent. Quantitative time-lapse video analysis of osteoblast migration after wounds were introduced into cell monolayers indicated that LPA stimulated both migration velocity and the average migration distance per cell. LPA also elicited substantial changes in cell shape and actin cytoskeletal structure; lipid-treated cells contained fewer stress fibers and displayed long membrane processes that were enriched in F-actin. Quantitative RT-PCR analysis showed that MC3T3-E1 cells express all four known LPA-specific G protein-coupled receptors (LPA1-LPA4) with a relative mRNA abundance of LPA1 > LPA4 > LPA2 >> LPA3. LPA-induced changes in osteoblast motility and morphology were antagonized by both pertussis toxin and Ki16425, a subtype-specific blocker of LPA1 and LPA3 receptor function. Cell migration in many cell types is linked to changes in intracellular Ca2+. Ki16425 also inhibited LPA-induced Ca2+ signaling in a dose-dependent manner, suggesting a link between LPA-induced Ca2+ transients and osteoblast chemotaxis. Our data show that LPA stimulates MC3T3-E1 osteoblast motility via a mechanism that is linked primarily to the G protein-coupled receptor LPA1.

  20. Occupational Survey Report. Ground Radio Communications, AFSC 2E1X3

    Science.gov (United States)

    2003-10-01

    analyzed the data, and wrote the final report. Mr. Tyrone Hill provided computer-programming support, and Ms. Dolores Navarro and Ms. Sherry Evans...AFSC 2E1X3 members selected military-related education and training opportunities and medical/ dental care for AD members as their second and third...TRAINING OPPORTUNITIES 52 2.52 55 2.49 50 2.34 MEDICAL/ DENTAL CARE FOR AD MEMBER 60 2.57 55 2.56 53 2.48 MEDICAL/ DENTAL CARE FOR FAMILY MEMBERS 48

  1. Cytochrome P450 2E1 genetic polymorphism and gastric cancer in Changle, Fujian Province

    Institute of Scientific and Technical Information of China (English)

    Lin Cai; Shun-Zhang Yu; Zuo-Feng Zhang

    2001-01-01

    AIM: Genetic polymorphism in enzymes of carcinogen metabolism has been found to have the influence on the susceptibility to cancer. Cytochrome P450 2E1 ( CYP2 E1) is considered to play an important role in the metabolic activation of procarcinogens such as N-nitroscoamines and Iow molecular weight organic compounds. The purpose of this study is to determine whether CYP450 2Elpolymorphisms are associated with risk s of gastric cancer. METHODS: We conducted a population based case-control study in Changle county, Fujian Province, a high-risk region of gastric cancer in China. Ninety-one incident gastric cancer patients and ninety-four healthy controls were included in our study. Datas including dsmographic characteristcs, diet intake, and alcohol and tobacco consumption of indivduals in our study were completed by a standardized questionnaire. PCR-RFLP revealed three genotypes: heterozygote (C1/C2) and two homozygotes (C1/C1 and C2/C2) in CYP2E1. RESULTS: The frequency of variant genotypes (C1/C2 and C2/C2) in gastric cancer cases and controls was 36.3% and 24.5%, respectively. The rare homozygous C2/C2 genotype was found in 6 indivduals in gastric cancer group(6.6%),whereas there was only one in the control group (1.1%).However, there was no statistically significan difference between the two groups (two-tailed Fisher′s exact test, P =0.066). Indivduals in gastric cancer group were more likely to carry genotype C1/C2 (odds ratio, OR = 1.50) and C2/C2(OR = 7.34) than indivduals in control group (X2 = 4.597, for trend P=0.032). The frequencies of genofypes with the C2allele ( C1/C2 and C2/C2 genotypes) were compared with those of genotypes without C2 allele ( C1/C1 genotype )among indivduals in gastric cancer group and control group according to the pattern of gastric cancer risk factors. The results show that indivduals who exposed to these gastric cancer risk factors and carry the C2 allele seemed to have a higher risk of developing gastric cancer. CONCLUSION

  2. Analysen zur Funktion des E1B-55K-Proteins von Adenovirus Typ 5 im lytischen Replikationszyklus

    OpenAIRE

    Kindsmüller, Kathrin

    2007-01-01

    Das E1B-55K-Protein von Adenovirus Typ 5 ist ein multifunktionelles Phosphoprotein, das eine zentrale Rolle im produktiven Replikationszyklus von Ad5 einnimmt. Die lytischen Aktivitäten des E1B-Proteins werden zumindest teilweise im Komplex mit dem viralen Protein E4orf6 vermittelt. Soweit bekannt fördert der E1B-55K/E4orf6-Komplex (E1B/E4-Komplex) den nukleozytoplasmatischen Transport viraler mRNAs und fördert somit die Synthese viraler Kapsidproteine bzw. die Produktion von Nachkommenviren....

  3. De-repression of RaRF-mediated RAR repression by adenovirus E1A in the nucleolus.

    Science.gov (United States)

    Um, Soo-Jong; Youn, Hye Sook; Kim, Eun-Joo

    2014-02-21

    Transcriptional activity of the retinoic acid receptor (RAR) is regulated by diverse binding partners, including classical corepressors and coactivators, in response to its ligand retinoic acid (RA). Recently, we identified a novel corepressor of RAR called the retinoic acid resistance factor (RaRF) (manuscript submitted). Here, we report how adenovirus E1A stimulates RAR activity by associating with RaRF. Based on immunoprecipitation (IP) assays, E1A interacts with RaRF through the conserved region 2 (CR2), which is also responsible for pRb binding. The first coiled-coil domain of RaRF was sufficient for this interaction. An in vitro glutathione-S-transferase (GST) pull-down assay was used to confirm the direct interaction between E1A and RaRF. Further fluorescence microscopy indicated that E1A and RaRF were located in the nucleoplasm and nucleolus, respectively. However, RaRF overexpression promoted nucleolar translocation of E1A from the nucleoplasm. Both the RA-dependent interaction of RAR with RaRF and RAR translocation to the nucleolus were disrupted by E1A. RaRF-mediated RAR repression was impaired by wild-type E1A, but not by the RaRF binding-defective E1A mutant. Taken together, our data suggest that E1A is sequestered to the nucleolus by RaRF through a specific interaction, thereby leaving RAR in the nucleoplasm for transcriptional activation.

  4. Interaction of Adenovirus E1A with the HHV8 Promoter of Latent Genes: E1A Proteins are Able to Activate the HHV-8 LANAp in MV3 Reporter Cells.

    Science.gov (United States)

    Koehler-Hansner, Karin; Flore, Ornella; Opalka, Bertram; Hengge, Ulrich R

    2008-01-01

    Human herpesvirus 8 (HHV-8) is associated with Kaposi's sarcoma, body cavity-based lymphoma, and Castleman's disease. Adenoviral (Ad) E1A proteins regulate the activity of cellular and viral promoters/enhancers and transcription factors and can suppress tumorigenicity of human cancers. As (i) HHV-8 and Ad may co-exist in immunocompromised patients and (ii) E1A might be considered as therapeutic transgene for HHV-8-associated neoplasms we investigated whether the promoter of the latency-associated nuclear antigen (LANAp) controlling expression of vCyclin, vFLIP, and LANA proteins required for latent type infection is regulated by E1A. Transfection experiments in MV3 melanoma cells revealed activation of the LANAp by Ad5 E1A constructs containing an intact N terminus (aa 1-119). In particular, an Ad12 E1A mutant, Spm2, lacking six consecutive alanine residues in the "spacer" region activated the HHV-8 promoter about 15-fold compared to vector controls. In summary, we report the activation of the LANAp by E1A as a novel interaction of E1A with a viral promoter. These data may have relevance for the management of viral infections in immunocompromised patients. A role for E1A as a therapeutic in this context remains to be defined.

  5. The fluvial evolution of the Holocene Nile Delta

    Science.gov (United States)

    Pennington, B. T.; Sturt, F.; Wilson, P.; Rowland, J.; Brown, A. G.

    2017-08-01

    The evolution of the Nile Delta, the largest delta system in the Mediterranean Sea, has both high palaeoenvironmental and archaeological significance. A dynamic model of the landscape evolution of this delta system is presented for the period c.8000-4500 cal BP. Analysis of sedimentary data and chronostratigraphic information contained within 1640 borehole records has allowed for a redefinition of the internal stratigraphy of the Holocene delta, and the construction of a four-dimensional landscape model for the delta's evolution through time. The mid-Holocene environmental evolution is characterised by a transition from an earlier set of spatially varied landscapes dominated by swampy marshland, to better-drained, more uniform floodplain environments. Archaeologically important Pleistocene inliers in the form of sandy hills protruding above the delta plain surface (known as ;turtlebacks;), also became smaller as the delta plain continued to aggrade, while the shoreline and coastal zone prograded north. These changes were forced by a decrease in the rate of relative sea-level rise under high rates of sediment-supply. This dynamic environmental evolution needs to be integrated within any discussion of the contemporary developments in the social sphere, which culminated in the emergence of the Ancient Egyptian State c.5050 cal BP.

  6. Behavior of MC3T3-E1 Osteoblast Cultured on Chitosan Modified with Polyvinylpyrrolidone

    Institute of Scientific and Technical Information of China (English)

    XI Jing; GAO Yuan; KONG Lijun; GONG Yandao; ZHAO Nanming; ZHANG Xiufang

    2005-01-01

    The physical and chemical properties of four kinds of modified chitosan materials made by blending chitosan with polyvinylpyrrolidone (PVP) were investigated. All four of these modified chitosan materials were hydrophilic with water contact angles ranging from 59° to 69°. Fourier transform-infrared spectra of the modified materials showed a new band at 1288 cm-1, implying formation of a surface physical interpenetrating network structure. Enzyme linked immunosorbent assay results indicated that much less fibronectin was adsorbed on the modified materials than on only chitosan. The viability of MC3T3-E1 osteoblasts cultured on the materials was assessed by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl- 2H-tetrazolium bromide assay. The results show that adding PVP10000 into the chitosan promotes adhesion of MC3T3-E1 osteoblasts on the modified materials, but has no effect on cell growth and proliferation; while adding PVP40000 reduces cell adhesion, growth, and proliferation. The results suggest that the increased hydrophilicity of the material surface does not always improve its biocompatibility, which will influence the selection and design of biomaterials.

  7. Lunar topographic model CLTM-s01 from Chang'E-1 laser altimeter

    Institute of Scientific and Technical Information of China (English)

    PING JinSong; HUANG Qian; YAN JianGuo; CAO JianFeng; TANG GeShi; SHU Rong

    2009-01-01

    More than 3 million range measurements from the Chang'E-1 Laser Altimeter have been used to pro-duce a global topographic model of the Moon with improved accuracy. Our topographic model, a 360th degree and order spherical harmonic expansion of the lunar radii, is designated as Chang'E-1 Lunar Topography Model s01 (CLTM-s01). This topographic field, referenced to a mean radius of 1738 km, has an absolute vertical accuracy of approximately 31 m and a spatial resolution of 0.25° (~7.5 km). This new lunar topographic model has greatly improved previous models in spatial coverage, accuracy and spatial resolution, and also shows the polar regions with the altimeter results for the first time. From CLTM-s01, the mean, equatorial, and polar radii of the Moon are 1737103, 1737646, and 1735843 m, re-spectively. In the lunar-fixed coordinate system, this model shows a COM/COF offset to be (-1.777, -0.730, 0.237) km along the x, y, and z directions, respectively. All the basic lunar shape parameters derived from CLTM-s01 are in agreement with the results of Clementine GLTM2, but CLTM-s01 offers higher accuracy and reliability due to its better global samplings.

  8. Lunar topographic model CLTM-s01 from Chang’E-1 laser altimeter

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    More than 3 million range measurements from the Chang’E-1 Laser Altimeter have been used to produce a global topographic model of the Moon with improved accuracy. Our topographic model, a 360th degree and order spherical harmonic expansion of the lunar radii, is designated as Chang’E-1 Lunar Topography Model s01 (CLTM-s01). This topographic field, referenced to a mean radius of 1738 km, has an absolute vertical accuracy of approximately 31 m and a spatial resolution of 0.25o (~7.5 km). This new lunar topographic model has greatly improved previous models in spatial coverage, accuracy and spatial resolution, and also shows the polar regions with the altimeter results for the first time. From CLTM-s01, the mean, equatorial, and polar radii of the Moon are 1737103, 1737646, and 1735843 m, respectively. In the lunar-fixed coordinate system, this model shows a COM/COF offset to be (-1.777, -0.730, 0.237) km along the x, y, and z directions, respectively. All the basic lunar shape parameters derived from CLTM-s01 are in agreement with the results of Clementine GLTM2, but CLTM-s01 offers higher accuracy and reliability due to its better global samplings.

  9. Effects of salvia miltiorrhiza bunge (SMB) on MC3T3-E1 cells.

    Science.gov (United States)

    Ding, Y; Soma, S; Takano-Yamamoto, T; Matsumoto, S; Sakuda, M

    1995-12-01

    In previous research, we found that the Salvia Miltiorrhiza Bunge (SMB), a traditional Chinese medicinal herb, accelerates orthodontic tooth movement. In the present study, to characterize the actions of SMB on bone remodeling, we investigated the effect of SMB on DNA synthesis and alkaline phosphatase activity of murine osteoblast like cell-clone, MC3T3-E1 cells in vitro. Treatment of the cells with SMB for 72 hours caused significant increase in ALPase activity. It was found that SMB increased ALPase activity in a dose-dependent manner, and up to maximum at the concentration of 5.0 mg/ml. At that concentration, ALPase activity was about 135% greater than that of control. SMB at 5.0 mg/ml significantly stimulated ALPase activity of the cells in multilayer on day 8 or calcification stage on day 16, but inhibited it in the sparse stage on day 2 or subconfluency stage on day 4. SMB had no effect on DNA synthesis in any stage of culture. ALPase activity significantly increased at 48 hours and was up to 300% greater than that of control activity at 96 hours. These findings suggest that SMB directly stimulates ALPase activity of MC3T3-E1 cells in multilayer stage or calcification stage without any effect on proliferation. Locally administrated SMB may affect the differentiation of osteoblasts in vivo.

  10. The effect of prostaglandin E1 on recovery of early renal graft functions after transplantation

    Institute of Scientific and Technical Information of China (English)

    Song Huanjin; Xue Wujun; Tian Xiaohui; Li Yang; Ding Chenguang; Ding Xiaoming; Feng Xinshun; Jin Zhankui

    2008-01-01

    Objective To investigate the effect of prostaglandin E: (PGE1) on recovery of early renal graft functions after transplantation. Methods One hundred and seven patients after renal transplantation were allocated in the treated group, and treated by conventional treatment with injection of 10 μg prostaglandin E1 additionally twice a day for 14 days. And eighty-eight patients who received conventional treatment alone after renal transplantation at the corresponding period were allocated in the control group. Indexes of the two groups, including incidence of delayed graft function and acute rejection reaction, volume of urine, serum certaintie (SCr), endogenous certainties clearance rate (CCr), the blood flow resistance in graft as well as blood viscosity (BV), and platelet aggregation rate (PAR), were determined. Results The urinary volume and endogenous certainties clearance rate of the treated group were significantly higher, but the level of SCr, incidence of renal function recovery retardation, BV, PAR and blood flow resistance in graft were significantly lower than these of the control group (P0.05). Conclusion Prostaglandin E1 can improve blood microcirculation and decrease the incidence of renal function recovery retardation. These effects are helpful for recovery of renal function after renal transplantation.

  11. [Genetic polymorphism of cytochrome P450 2E1 and the risk of nasopharyngeal carcinoma].

    Science.gov (United States)

    Ben Chaaben, Arij; Abaza, Hajer; Douik, Hayet; Chaouch, Leila; Ayari, Fayza; Ouni, Nesrine; Mamoghli, Tasnim; Ben Guezella, Dorra; Mejri, Rachida; Harzallah, Latifa; Guemira, Fethi

    2015-12-01

    Cytochrome P450 2E1 (CYP2E1) is a detoxifying enzyme that belongs to the phase I metabolism of xenobiotics. This enzyme is encoded by a highly polymorphic gene whose common polymorphism corresponds to the substitution of cytosine (C) and thymine (T) at position -1019 (rs2031920). This polymorphism has been identified in several cancers including nasopharyngeal cancer (NPC). The study involved 124 patients with nasopharyngeal carcinoma, compared with 166 healthy controls. The presence or absence of the polymorphism is determined by PCR-RFLP. The frequency comparison between the two groups is determined by the χ(2) test. The analysis of our results showed a significant difference between the two groups regarding the mutant genotype (C2/C2) (5% vs. 0.5%, P=0.04) and has a risk factor for NPC in Tunisia (OR=8.39; CI 95% [0.99-388.1]). Also, the C2 allele was significantly associated with the group of patients than the control group (6% vs. 2%, P=0.016) and increased three times the risk of NPC in Tunisia (OR=2.99, CI 95% [1.12-8.79]). Our results confirm the results reported in other populations and emphasize the importance of the involvement of this gene in the development of detoxification of the NPC, which seems more and more strongly associated with environmental factors.

  12. E1 resonances in neutron-rich nuclei within the phonon damping model

    Indian Academy of Sciences (India)

    Nguyen Dinh Dang; Voung Kim Au; Toshio Suzuki; Akito Arima

    2001-08-01

    The quasiparticle representation of the phonon damping model (PDM) is developed to include the superfluid pairing correlations microscopically. The formalism is applied to calculate the photoabsorption and the electromagnetic (EM) differential cross sections of E1 excitations in neutron-rich oxygen and calcium isotopes. The calculated photoabsorption cross sections agree reasonably well with the available data for 16,18O and 40,48Ca. The results of calculations show that the change of the fraction of the E1 integrated strength in the region of pygmy dipole resonance (PDR) as a function of mass number with increasing neutron number is in agreement with the recent experimental data, and does not follow the prediction by the simple cluster model. The EM differential cross sections obtained within PDM in this work show prominent PDR peaks below 15 MeV for 20,22O in agreement with the recent experimental observation. It is also shown that, using low-energy RI beams at around 50-60 MeV/nucleon, one can observe clean and even enhanced PDR peaks without the admixture with the GDR in the EM differential cross sections of neutron-rich nuclei.

  13. Comparison of chlorzoxazone one-sample methods to estimate CYP2E1 activity in humans

    DEFF Research Database (Denmark)

    Kramer, Iza; Dalhoff, Kim; Clemmesen, Jens O

    2003-01-01

    OBJECTIVE: Comparison of a one-sample with a multi-sample method (the metabolic fractional clearance) to estimate CYP2E1 activity in humans. METHODS: Healthy, male Caucasians ( n=19) were included. The multi-sample fractional clearance (Cl(fe)) of chlorzoxazone was compared with one...... estimates, Cl(est) at 3 h or 6 h, and MR at 3 h, can serve as reliable markers of CYP2E1 activity. The one-sample clearance method is an accurate, renal function-independent measure of the intrinsic activity; it is simple to use and easily applicable to humans.......-time-point clearance estimation (Cl(est)) at 3, 4, 5 and 6 h. Furthermore, the metabolite/drug ratios (MRs) estimated from one-time-point samples at 1, 2, 3, 4, 5 and 6 h were compared with Cl(fe). RESULTS: The concordance between Cl(est) and Cl(fe) was highest at 6 h. The minimal mean prediction error (MPE) of Cl...

  14. B(E1) Strengths from Coulomb Excitation of 11Be

    CERN Document Server

    Summers, N C; Ashwood, N I; Bouchat, V; Catford, W N; Clarke, N M; Curtis, N; Freer, M; Fulton, B R; Hanappe, F; Labiche, M; Lecouey, J L; Lemmon, R C; Mahboub, D; Ninane, A; Normand, G; Nunes, F M; Orr, N A; Pain, S D; Soic, N; Stuttgé, L; Thompson, I J; Timis, C N; Winfield, J S; Ziman, V

    2007-01-01

    The $B$(E1;$1/2^+\\to1/2^-$) strength for $^{11}$Be has been extracted from intermediate energy Coulomb excitation measurements, over a range of beam energies using a new reaction model, the extended continuum discretized coupled channels (XCDCC) method. In addition, a measurement of the excitation cross section for $^{11}$Be+$^{208}$Pb at 38.6 MeV/nucleon is reported. The $B$(E1) strength of 0.105(12) e$^2$fm$^2$ derived from this measurement is consistent with those made previously at 60 and 64 MeV/nucleon, i n contrast to an anomalously low result obtained at 43 MeV/nucleon. By coupling a multi-configuration description of the projectile structure with realistic reaction theory, the XCDCC model provides for the first time a fully quantum mechanical description of Coulomb excitation. The XCDCC calculations reveal that the excitation process involves significant contributions from nuclear, continuum, and higher-order effects. An analysis of the present and two earlier intermediate energy measurements yields a...

  15. Hot deformation behavior of delta-processed superalloy 718

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y., E-mail: wangyanhit@yahoo.cn [State Key Laboratory of Powder Metallurgy, Central South University, Changsha 410083 (China); School of Aeronautics and Astronautics, Central South University, Changsha 410083 (China); Shao, W.Z.; Zhen, L.; Zhang, B.Y. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)

    2011-03-25

    Research highlights: {yields} The peak stress for hot deformation can be described by the Z parameter. {yields} The grain size of DRX was inversely proportional to the Z parameter. {yields} The dissolution of {delta} phases was greatly accelerated under hot deformation. {yields}The {delta} phase stimulated nucleation can serve as the main DRX mechanism. - Abstract: Flow stress behavior and microstructures during hot compression of delta-processed superalloy 718 at temperatures from 950 to 1100 deg. C with strain rates of 10{sup -3} to 1 s{sup -1} were investigated by optical microscopy (OM), electron backscatter diffraction (EBSD) technique and transmission electron microscopy (TEM). The relationship between the peak stress and the deformation conditions can be expressed by a hyperbolic-sine type equation. The activation energy for the delta-processed superalloy 718 is determined to be 467 kJ/mol. The change of the dominant deformation mechanisms leads to the decrease of stress exponent and the increase of activation energy with increasing temperature. The dynamically recrystallized grain size is inversely proportional to the Zener-Hollomon (Z) parameter. It is found that the dissolution rate of {delta} phases under hot deformation conditions is much faster than that under static conditions. Dislocation, vacancy and curvature play important roles in the dissolution of {delta} phases. The main nucleation mechanisms of dynamic recrystallization (DRX) for the delta-processed superalloy 718 include the bulging of original grain boundaries and the {delta} phase stimulated DRX nucleation, which is closely related to the dissolution behavior of {delta} phases under certain deformation conditions.

  16. Primary production in the Delta: Then and now

    Science.gov (United States)

    Cloern, James E.; Robinson, April; Richey, Amy; Grenier, Letitia; Grossinger, Robin; Boyer, Katharyn E.; Burau, Jon; Canuel, Elizabeth A.; DeGeorge, John F.; Drexler, Judith Z.; Enright, Chris; Howe, Emily R.; Kneib, Ronald; Mueller-Solger, Anke; Naiman, Robert J.; Pinckney, James L.; Safran, Samuel M.; Schoellhamer, David H.; Simenstad, Charles A.

    2016-01-01

    To evaluate the role of restoration in the recovery of the Delta ecosystem, we need to have clear targets and performance measures that directly assess ecosystem function. Primary production is a crucial ecosystem process, which directly limits the quality and quantity of food available for secondary consumers such as invertebrates and fish. The Delta has a low rate of primary production, but it is unclear whether this was always the case. Recent analyses from the Historical Ecology Team and Delta Landscapes Project provide quantitative comparisons of the areal extent of 14 habitat types in the modern Delta versus the historical Delta (pre-1850). Here we describe an approach for using these metrics of land use change to: (1) produce the first quantitative estimates of how Delta primary production and the relative contributions from five different producer groups have been altered by large-scale drainage and conversion to agriculture; (2) convert these production estimates into a common currency so the contributions of each producer group reflect their food quality and efficiency of transfer to consumers; and (3) use simple models to discover how tidal exchange between marshes and open water influences primary production and its consumption. Application of this approach could inform Delta management in two ways. First, it would provide a quantitative estimate of how large-scale conversion to agriculture has altered the Delta's capacity to produce food for native biota. Second, it would provide restoration practitioners with a new approach—based on ecosystem function—to evaluate the success of restoration projects and gauge the trajectory of ecological recovery in the Delta region.

  17. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  18. Cytotoxicity of acrylamide and its epoxide glycidamide in CHO cells expressing human cytochrome P450 2E1

    Institute of Scientific and Technical Information of China (English)

    Shoulin Wang; Xiaoyang He; Xinru Wang; Junyan Hong

    2006-01-01

    Objective: To investigate whether CYP2E1 is responsible for the acrylamide metabolic activation in Flp-In CHO cell system. Methods: CYP2E1 cDNA was subcloned from the human liver full-length cDNA library and subsequently transfected into the Flp-In CHO cells to generate the stable transfectant of CYP2E1. The CYP2E1 mRNA expression was determined by RT-PCR. Acrylamide and its epoxide glycidamide induced cytotoxicity and cell cycle arrest in G2/M were conducted using MTS assay and flow cytometry, respectively. Results: In the CHO cell stably expressing CYP2E1 (CHO-2E1), a ~1.5 kbsize of band was detected from the mRNA in the cells while no corresponding band in the CHO-vector cells, which indicated that CYP2E1 was successfully transfected in the CHO cells. Compared with the CHO-vector cells, acrylamide showed a concentrationdependent loss of viability in the CHO-2E1 cells but no significant change of G2/M arrest was found. As expected, glycidamide induced similar profile of cytotoxicity in both of the cells, and G2/M arrest presented a concentration-dependent increased in the CHO-2E1 cells. Conclusion: The result suggested that CYP2E1 might be responsible for the acrylamide metabolism, and its metabolite glycidamide was a direct cytotoxic and genotoxic agent. It should be further considered whether acrylamide-induced toxicity is through its epoxide glycidamide in the presence of CYP2E1.

  19. Crystal structure of hyperthermophilic esterase EstE1 and the relationship between its dimerization and thermostability properties

    Directory of Open Access Journals (Sweden)

    Koh Eunhee

    2007-07-01

    Full Text Available Abstract Background EstE1 is a hyperthermophilic esterase belonging to the hormone-sensitive lipase family and was originally isolated by functional screening of a metagenomic library constructed from a thermal environmental sample. Dimers and oligomers may have been evolutionally selected in thermophiles because intersubunit interactions can confer thermostability on the proteins. The molecular mechanisms of thermostabilization of this extremely thermostable esterase are not well understood due to the lack of structural information. Results Here we report for the first time the 2.1-Å resolution crystal structure of EstE1. The three-dimensional structure of EstE1 exhibits a classic α/β hydrolase fold with a central parallel-stranded beta sheet surrounded by alpha helices on both sides. The residues Ser154, Asp251, and His281 form the catalytic triad motif commonly found in other α/β hydrolases. EstE1 exists as a dimer that is formed by hydrophobic interactions and salt bridges. Circular dichroism spectroscopy and heat inactivation kinetic analysis of EstE1 mutants, which were generated by structure-based site-directed mutagenesis of amino acid residues participating in EstE1 dimerization, revealed that hydrophobic interactions through Val274 and Phe276 on the β8 strand of each monomer play a major role in the dimerization of EstE1. In contrast, the intermolecular salt bridges contribute less significantly to the dimerization and thermostability of EstE1. Conclusion Our results suggest that intermolecular hydrophobic interactions are essential for the hyperthermostability of EstE1. The molecular mechanism that allows EstE1 to endure high temperature will provide guideline for rational design of a thermostable esterase/lipase using the lipolytic enzymes showing structural similarity to EstE1.

  20. Holocene evolution of the western Orinoco Delta, Venezuela

    Science.gov (United States)

    Aslan, A.; White, W.A.; Warne, A.G.; Guevara, E.H.

    2003-01-01

    The pristine nature of the Orinoco Delta of eastern Venezuela provides unique opportunities to study the geologic processes and environments of a major tropical delta. Remote-sensing images, shallow cores, and radiocarbon-dating of organic remains form the basis for describing deltaic environments and interpreting the Holocene history of the delta. The Orinoco Delta can be subdivided into two major sectors. The southeast sector is dominated by the Rio Grande-the principal distributary-and complex networks of anastomosing fluvial and tidal channels. The abundance of siliciclastic deposits suggests that fluvial processes such as over-bank flooding strongly influence this part of the delta. In contrast, the northwest sector is represented by few major distributaries, and overbank sedimentation is less widespread relative to the southeast sector. Peat is abundant and occurs in herbaceous and forested swamps that are individually up to 200 km2 in area. Northwest-directed littoral currents transport large volumes of suspended sediment and produce prominent mudcapes along the northwest coast. Mapping of surface sediments, vegetation, and major landforms identified four principal geomorphic systems within the western delta plain: (1) distributary channels, (2) interdistributary flood basins, (3) fluvial-marine transitional environments, and (4) marine-influenced coastal environments. Coring and radiocarbon dating of deltaic deposits show that the northern delta shoreline has prograded 20-30 km during the late Holocene sea-level highstand. Progradation has been accomplished by a combination of distributary avulsion and mudcape progradation. This style of deltaic progradation differs markedly from other deltas such as the Mississippi where distributary avulsion leads to coastal land loss, rather than shoreline progradation. The key difference is that the Orinoco Delta coastal zone receives prodigious amounts of sediment from northwest-moving littoral currents that transport

  1. Regional pole assignment for uncertain delta-operator systems

    Institute of Scientific and Technical Information of China (English)

    Man LIU; Yuanwei JING; Siying ZHANG

    2004-01-01

    The pole assignment in a specified disk by state feedback for uncertain delta-operator systems is studied.By making use of algebra Riccati equations,a sufficient and necessary condition of pole assignment for a kind of parameter uncertain delta-operator system in a specified disk by state feedback is presented.And the design method of state feedback controller is also developed.The proposed method can unify some previous related results of continuous and discrete time systems into the delta framework.The efficiency of the design method is illustrated by a numerical example.

  2. Electromagnetic form factors of the Delta with D-waves

    CERN Document Server

    Ramalho, G; Gross, Franz

    2010-01-01

    The electromagnetic form factors of the Delta baryon are evaluated within the framework of a covariant spectator quark model, where S and D-states are included in the $\\Delta$ wave function. We predict all the four Delta multipole form factors: the electric charge GE0, the magnetic dipole GM1, the electric quadrupole GE2 and the magnetic octupole GM3. We compare our predictions with other theoretical calculations. Our results are compatible with the available experimental data and recent lattice QCD data.

  3. Late quaternary evolution of the Orinoco Delta, Venezuela

    Science.gov (United States)

    Warne, A.G.; Guevara, E.H.; Aslan, A.

    2002-01-01

    The modern Orinoco Delta is the latest of a series of stacked deltas that have infilled the Eastern Venezuelan Basin (EVB) since the Oligocene. During the late Pleistocene sea-level lowstand (20,000 to 16,000 yrs BP), bedrock control points at the position of the present delta apex prevented the river channel from incising as deeply as many other major river systems. Shallow seismic data indicate that the late Pleistocene Orinoco incised into the present continental shelf, where it formed a braided-river complex that transported sediment to a series of shelf-edge deltas. As sea level rose from 16,000 to 9,500 yrs BP, the Orinoco shoreline shifted rapidly landward, causing shallow-marine waves and currents to form a widespread transgressive sand unit. Decelerating sea-level rise and a warmer, wetter climate during the early Holocene (9,500 to 6,000 yrs BP) induced delta development within the relatively quiet-water environment of the EVB embayment. Sea level approached its present stand in the middle Holocene (6,000 to 3,000 yrs BP), and the Orinoco coast prograded, broadening the delta plain and infilling the EVB embayment. Significant quantities of Amazon sediment began to be transported to the Orinoco coast by littoral currents. Continued progradation in the late Holocene caused the constriction at Boca de Serpientes to alter nearshore and shelf hydrodynamics and subdivide the submarine delta into two distinct areas: the Atlantic shelf and the Gulf of Paria. The increased influence of littoral currents along the coast promoted mudcape development. Because most of the water and sediment were transported across the delta plain through the Rio Grande distributary in the southern delta, much of the central and northwestern delta plain became sediment starved, promoting widespread accumulation of peat deposits. Human impacts on the delta are mostly associated with the Volca??n Dam on Can??o Manamo. However, human activities have had relatively little effect on the

  4. On generalized {delta}-semiclosed sets in topological spaces

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin Han [Division of Mathematical Sciences, Pukyong National University, Pusan 608-737 (Korea, Republic of)]. E-mail: jihpark@pknu.ac.kr; Song, Dae Seob [Division of Mathematical Sciences, Pukyong National University, Pusan 608-737 (Korea, Republic of); Saadati, Reza [Department of Mathematics, and Computer Science, Amirkabir University of Technology, 424 Hafez Avenue, Tehran 15914 (Iran, Islamic Republic of) and Department of Mathematics, Amol Islamic Azad University, Amol 46176-54553 (Iran, Islamic Republic of)]. E-mail: rsaadati@eml.cc

    2007-08-15

    The aim of this paper is to introduce the class of g{delta}s-closed sets and obtain the characterizations of T {sub 3/4} space due to Dontchev and Ganster [Dontchev J, Ganster M. On {delta}-generalized closed set and T {sub 3/4}-spaces. Mem Fac Sci Kochi Univ Ser A (Math) 1996;17:15-31]. We also introduce the notion of g{delta}s-continuity and investigate the relationships between it and other types of continuity.

  5. Is there a self-organization principle of river deltas?

    Science.gov (United States)

    Tejedor, Alejandro; Longjas, Anthony; Foufoula-Georgiou, Efi

    2017-04-01

    River deltas are known to possess a complex topological and flux-partitioning structure which has recently been quantified using spectral graph theory [Tejedor et al., 2015a,b]. By analysis of real and simulated deltas it has also been shown that there is promise in formalizing relationships between this topo-dynamic delta structure and the underlying delta forming processes [e.g., Tejedor et al., 2016]. The question we pose here is whether there exists a first order organizational principle behind the self-organization of river deltas and whether this principle can be unraveled from the co-evolving topo-dynamic structure encoded in the delta planform. To answer this question, we introduce a new metric, the nonlocal Entropy Rate (nER) that captures the information content of a delta network in terms of the degree of uncertainty in delivering fluxes from any point of the network to the shoreline. We hypothesize that if the "guiding principle" of undisturbed deltas is to efficiently and robustly build land by increasing the diversity of their flux pathways over the delta plane, then they would exhibit maximum nonlocal Entropy Rate at states at which geometry and flux dynamics are at equilibrium. At the same time, their nER would be non-optimal at transient states, such as before and after major avulsions during which topology and dynamics adjust to each other to reach a new equilibrium state. We will present our results for field and simulated deltas, which confirm this hypothesis and open up new ways of thinking about self-organization, complexity and robustness in river deltas. One particular connection of interest might have important implications since entropy rate and resilience are related by the fluctuation theorem [Demetrius and Manke, 2005], and therefore our results suggest that deltas might in fact self-organize to maximize their resilience to structural and dynamic perturbations. References: Tejedor, A., A. Longjas, I. Zaliapin, and E. Foufoula

  6. Monte Carlo simulations of the stability of delta-Pu

    CERN Document Server

    Landa, A; Ruban, A

    2003-01-01

    The transition temperature (T sub c) for delta-Pu has been calculated for the first time. A Monte Carlo method is employed for this purpose and the effective cluster interactions are obtained from first-principles calculations incorporated with the Connolly-Williams and generalized perturbation methods. It is found that at T sub c approx 548 K, delta-Pu undergoes transformation from a disordered magnetic state to a structure with an antiferromagnetic spin alignment that is mechanically unstable with respect to tetragonal distortion. The calculated transition temperature is in good agreement with the temperature measured at the gamma -> delta transition (593 K). (letter to the editor)

  7. Genomic organization of the human T-cell antigen-receptor alpha/delta locus.

    Science.gov (United States)

    Satyanarayana, K; Hata, S; Devlin, P; Roncarolo, M G; De Vries, J E; Spits, H; Strominger, J L; Krangel, M S

    1988-11-01

    Two clusters of overlapping cosmid clones comprising about 100 kilobases (kb) at the human T-cell antigen-receptor alpha/delta locus were isolated from a genomic library. The structure of the germ-line V delta 1 variable gene segment was determined. V delta 1 is located 8.5 kb downstream of the V alpha 13.1 gene segment, and both V segments are arranged in the same transcriptional orientation. The V alpha 17.1 segment is located between V delta 1 and the D delta, J delta, C delta region (containing the diversity, joining, and constant gene segments). Thus, V delta and V alpha segments are interspersed along the chromosome. The germ-line organization of the D delta 2, J delta 1, and J delta 2 segments was determined. Linkage of C delta to the J alpha region was established by identification of J alpha segments within 20 kb downstream of C delta. The organization of the locus was also analyzed by field-inversion gel electrophoresis. The unrearranged V delta 1 and D delta, J delta, C delta regions are quite distant from each other, apparently separated by a minimum of 175-180 kb.

  8. Expression profiling of peroxisome proliferator-activated receptor-delta (PPAR-delta) in mouse tissues using tissue microarray.

    Science.gov (United States)

    Higashiyama, Hiroyuki; Billin, Andrew N; Okamoto, Yuji; Kinoshita, Mine; Asano, Satoshi

    2007-05-01

    Peroxisome proliferator-activated receptor-delta (PPAR-delta) is known as a transcription factor involved in the regulation of fatty acid oxidation and mitochondrial biogenesis in several tissues, such as skeletal muscle, liver and adipose tissues. In this study, to elucidate systemic physiological functions of PPAR-delta, we examined the tissue distribution and localization of PPAR-delta in adult mouse tissues using tissue microarray (TMA)-based immunohistochemistry. PPAR-delta positive signals were observed on variety of tissues/cells in multiple systems including cardiovascular, urinary, respiratory, digestive, endocrine, nervous, hematopoietic, immune, musculoskeletal, sensory and reproductive organ systems. In these organs, PPAR-delta immunoreactivity was generally localized on the nucleus, although cytoplasmic localization was observed on several cell types including neurons in the nervous system and cells of the islet of Langerhans. These expression profiling data implicate various physiological roles of PPAR-delta in multiple organ systems. TMA-based immunohistochemistry enables to profile comprehensive protein localization and distribution in a high-throughput manner.

  9. Hepatitis C Virus E1 and E2 Proteins Used as Separate Immunogens Induce Neutralizing Antibodies with Additive Properties.

    Science.gov (United States)

    Beaumont, Elodie; Roch, Emmanuelle; Chopin, Lucie; Roingeard, Philippe

    2016-01-01

    Various strategies involving the use of hepatitis C virus (HCV) E1 and E2 envelope glycoproteins as immunogens have been developed for prophylactic vaccination against HCV. However, the ideal mode of processing and presenting these immunogens for effective vaccination has yet to be determined. We used our recently described vaccine candidate based on full-length HCV E1 or E2 glycoproteins fused to the heterologous hepatitis B virus S envelope protein to compare the use of the E1 and E2 proteins as separate immunogens with their use as the E1E2 heterodimer, in terms of immunogenetic potential and the capacity to induce neutralizing antibodies. The specific anti-E1 and anti-E2 antibody responses induced in animals immunized with vaccine particles harboring the heterodimer were profoundly impaired with respect to those in animals immunized with particles harboring E1 and E2 separately. Moreover, the anti-E1 and anti-E2 antibodies had additive neutralizing properties that increase the cross-neutralization of heterologous strains of various HCV genotypes, highlighting the importance of including both E1 and E2 in the vaccine for an effective vaccination strategy. Our study has important implications for the optimization of HCV vaccination strategies based on HCV envelope proteins, regardless of the platform used to present these proteins to the immune system.

  10. Functional analysis of the C-terminal region of human adenovirus E1A reveals a misidentified nuclear localization signal

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, Michael J.; King, Cason R.; Dikeakos, Jimmy D. [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Department of Oncology, The University of Western Ontario, London Regional Cancer Centre, Ontario (Canada)

    2014-11-15

    The immortalizing function of the human adenovirus 5 E1A oncoprotein requires efficient localization to the nucleus. In 1987, a consensus monopartite nuclear localization sequence (NLS) was identified at the C-terminus of E1A. Since that time, various experiments have suggested that other regions of E1A influence nuclear import. In addition, a novel bipartite NLS was recently predicted at the C-terminal region of E1A in silico. In this study, we used immunofluorescence microscopy and co-immunoprecipitation analysis with importin-α to verify that full nuclear localization of E1A requires the well characterized NLS spanning residues 285–289, as well as a second basic patch situated between residues 258 and 263 ({sup 258}RVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP{sup 289}). Thus, the originally described NLS located at the C-terminus of E1A is actually a bipartite signal, which had been misidentified in the existing literature as a monopartite signal, altering our understanding of one of the oldest documented NLSs. - Highlights: • Human adenovirus E1A is localized to the nucleus. • The C-terminus of E1A contains a bipartite nuclear localization signal (NLS). • This signal was previously misidentified to be a monopartite NLS. • Key basic amino acid residues within this sequence are highly conserved.

  11. Hepatitis C Virus E1 and E2 Proteins Used as Separate Immunogens Induce Neutralizing Antibodies with Additive Properties

    Science.gov (United States)

    Beaumont, Elodie; Roch, Emmanuelle; Chopin, Lucie; Roingeard, Philippe

    2016-01-01

    Various strategies involving the use of hepatitis C virus (HCV) E1 and E2 envelope glycoproteins as immunogens have been developed for prophylactic vaccination against HCV. However, the ideal mode of processing and presenting these immunogens for effective vaccination has yet to be determined. We used our recently described vaccine candidate based on full-length HCV E1 or E2 glycoproteins fused to the heterologous hepatitis B virus S envelope protein to compare the use of the E1 and E2 proteins as separate immunogens with their use as the E1E2 heterodimer, in terms of immunogenetic potential and the capacity to induce neutralizing antibodies. The specific anti-E1 and anti-E2 antibody responses induced in animals immunized with vaccine particles harboring the heterodimer were profoundly impaired with respect to those in animals immunized with particles harboring E1 and E2 separately. Moreover, the anti-E1 and anti-E2 antibodies had additive neutralizing properties that increase the cross-neutralization of heterologous strains of various HCV genotypes, highlighting the importance of including both E1 and E2 in the vaccine for an effective vaccination strategy. Our study has important implications for the optimization of HCV vaccination strategies based on HCV envelope proteins, regardless of the platform used to present these proteins to the immune system. PMID:26966906

  12. 26 CFR 1.1033(e)-1 - Sale or exchange of livestock solely on account of drought.

    Science.gov (United States)

    2010-04-01

    ... of drought. 1.1033(e)-1 Section 1.1033(e)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF... Sale or exchange of livestock solely on account of drought. (a) The sale or exchange of livestock... if the sale or exchange of such livestock by the taxpayer is solely on account of drought....

  13. Hepatitis C Virus E1 and E2 Proteins Used as Separate Immunogens Induce Neutralizing Antibodies with Additive Properties.

    Directory of Open Access Journals (Sweden)

    Elodie Beaumont

    Full Text Available Various strategies involving the use of hepatitis C virus (HCV E1 and E2 envelope glycoproteins as immunogens have been developed for prophylactic vaccination against HCV. However, the ideal mode of processing and presenting these immunogens for effective vaccination has yet to be determined. We used our recently described vaccine candidate based on full-length HCV E1 or E2 glycoproteins fused to the heterologous hepatitis B virus S envelope protein to compare the use of the E1 and E2 proteins as separate immunogens with their use as the E1E2 heterodimer, in terms of immunogenetic potential and the capacity to induce neutralizing antibodies. The specific anti-E1 and anti-E2 antibody responses induced in animals immunized with vaccine particles harboring the heterodimer were profoundly impaired with respect to those in animals immunized with particles harboring E1 and E2 separately. Moreover, the anti-E1 and anti-E2 antibodies had additive neutralizing properties that increase the cross-neutralization of heterologous strains of various HCV genotypes, highlighting the importance of including both E1 and E2 in the vaccine for an effective vaccination strategy. Our study has important implications for the optimization of HCV vaccination strategies based on HCV envelope proteins, regardless of the platform used to present these proteins to the immune system.

  14. Sharecropping Contract Experience in Delta State, Nigeria

    Institute of Scientific and Technical Information of China (English)

    Albert Ukaro Ofuoku

    2015-01-01

    Sharecropping has been an age long practice from ancient times. Some scholars saw the practice as being exploitative of the tenants, yet it is still being practiced. The reasons behind it continual practice need to be unveiled. This study was therefore conducted to examine the sharecropping contract experience in Delta State, Nigeria. The landlords decided to practice sharecropping as a result of emigration of their household members, farm size and cost of labours, some of them gave age and their primary occupation as factors for their decisions to opt for sharecropping arrangement. The yields were shared on the basis of 60% for the landlord to 40% for the tenant. The landlords provided all the equipment and inputs, while the tenant's carried out all the farm operations. They faced the constraints of stress, but were able to cope with them, because of hospitals and health centres nearby. The result of the test of hypothesis confirmed the reasons given for deciding on sharecropping arrangement. It was concluded that sharecropping was not exploitative. It was recommended that the practice of sharecropping should be encouraged and not diversified into other sources of livelihood should do so.

  15. The DELTA 181 lithium thionyl chloride battery

    Science.gov (United States)

    Sullivan, Ralph M.; Brown, Lawrence E.; Leigh, A. P.

    In 1986, the Johns Hopkins University/Applied Physics Laboratory (JHU/APL) undertook the development of a sensor module for the DELTA 181 spacecraft, a low earth orbit (LEO) mission of less than two months duration. A large lithium thionyl chloride battery was developed as the spacecraft's primary power source, the first known such use for this technology. The exceptionally high energy density of the lithium thionyl chloride cell was the primary driver for its use, resulting in a completed battery with a specific energy density of 120 Wh/lb. Safety requirements became the primary driver shaping all aspects of the power system design and development due to concerns about the potential hazards of this relatively new, high-energy technology. However, the program was completed without incident. The spacecraft was launched on February 8, 1988, from Kennedy Space Center (KSC) with over 60,000 Wh of battery energy. It reentered on April 2, 1988, still operating after 55 days, providing a successful, practical, and visible demonstration of the use of this technology for spacecraft applications.

  16. Delta Haptic Device as a nanomanipulator

    Science.gov (United States)

    Grange, Sebastien; Conti, Francois; Helmer, Patrick; Rouiller, Patrice; Baur, Charles

    2001-10-01

    At the EPFL, we have developed a force-feedback device and control architecture for high-end research and industrial applications. The Delta Haptic Device (DHD) consists of a 6 degrees-of-freedom (DOF) mecatronic device driven by a PC. Several experiments have been carried out in the fields of manipulation and simulation to assess the dramatic improvement haptic information brings to manipulation. This system is particularly well suited for scaled manipulation such as micro-, nano- and biomanipulation. Not only can it perform geometric and force scaling, but it can also include fairly complex physical models into the control loop to assist manipulation and enhance human understanding of the environment. To demonstrate this ability, we are currently interfacing our DHD with an atomic force microscope (AFM). In a first stage, we will be able to feel in real-time the topology of a given sample while visualizing it in 3D. The aim of the project is to make manipulation of carbon nanotubes possible by including physical models of such nanotubes behavior into the control loop, thus allowing humans to control complex structures. In this paper, we give a brief description of our device and present preliminary results of its interfacing with the AFM.

  17. CYP2E1 impairs GLUT4 gene expression and function: NRF2 as a possible mediator.

    Science.gov (United States)

    Armoni, M; Harel, C; Ramdas, M; Karnieli, E

    2014-06-01

    Impaired GLUT4 function/expression in insulin target tissues is well-documented in diabetes and obesity. Cytochrome P450 isoform 2E1 (CYP2E1) induces oxidative stress, leading to impaired insulin action. CYP2E1 knockout mice are protected against high fat diet-induced insulin resistance and obesity; however the molecular mechanisms are still unclear. We examined whether CYP2E1 impairs GLUT4 gene expression and function in adipose and muscle cells. CYP2E1 overexpression in skeletal muscle-derived L6 cells inhibited insulin-stimulated Glut4 translocation and 2-deoxyglucose uptake, with the latter inhibition being blocked by vitamin E. CYP2E1 overexpression in L6 and primary rat adipose (PRA) cells suppressed GLUT4 gene expression at promoter and mRNA levels, whereas CYP2E1 silencing had opposite effects. In PRA, CYP2E1-induced suppression of GLUT4 expression was blocked by chlormethiazole (CYP2E1-specific inhibitor) and the antioxidants vitamin E and N-acetyl-l-cysteine. CYP2E1 effect was mediated by the transcription factor NF-E2-related factor 2 (NRF2), as evident from its complete reversal by a coexpressed dominant-negative, but not wild-type NRF2. GLUT4 transcription was suppressed by NRF2 overexpression, and enhanced by NRF2 silencing. Promoter and ChIP analysis showed a direct and specific binding of NRF2 to a 58-326 GLUT4 promoter region that was required to maintain CYP2E1 suppression; this binding was enhanced by CYP2E1 overexpression. We suggest a mechanism for CYP2E1 action that involves: a) suppression of GLUT4 gene expression that is mediated by NRF2; b) impairment of insulin-stimulated Glut4 translocation and function. CYP2E1 and NRF2 are introduced as negative regulators of GLUT4 expression and function in insulin-sensitive cells.

  18. The hazard of the counterfeit E 1' signal in quartz to the ESR dating of fault movements

    Science.gov (United States)

    Toyoda, Shin; Schwarcz, Henry P.

    We have previously found (Toyoda and Schwarcz, in press) that γ-ray irradiation of granitic quartz produces a distinct ESR signal which overlaps the E 1' centre signal; this signal is removed by a heat treatment at 170°C for 15 min. Here we report the presence of this 'counterfeit' E 1[' signal in irradiated samples from fault gouge taken from the Hayward fault California. The contribution of the counterfeit E 1' signal to the total apparent E 1' centre signal intensity is significant and appears to account for most of the growth of the combined signal with irradiation. The intensity of the 'real' E 1' centre signal rises abruptly between irradiation doses of 300 and 1000 Gy, after removing the contribution of the counterfeit signal by heating.

  19. Evidence for the two-body nature of the E1 transition operator in the sdf-interacting boson model

    Energy Technology Data Exchange (ETDEWEB)

    Barfield, A.F.; Brentano, P. von; Dewald, A.; Zell, K.O.; Zamfir, N.V.; Bucurescu, D.; Ivascu, M.; Scholten, O.

    1989-01-01

    Two new a absolute transition rates are reported for the nucleus /sup 144/Sm following an (..cap alpha.., ..cap alpha..') Coulomb excitation study. They are B(E3;3/sup -/ -> 0/sup +/)=(38+-3)W.u. and B(E1;3/sup -/ -> 2/sup +/)=2.8+-0.4)x10/sup -3/W.u. This large E1 matrix element, along with the previously known B(E1;1/sup -/ -> 0/sup +/) value support the interpretation of the 1/sup -/ state in this nucleus as 2-phonon 2/sup +/x3/sup -/ excitation. In the frame of the IBM-1+f-boson model we show the need for a two-body term in the E1 transition operator. Estimates for the strenghts of the one and two-body parts of the E1 transition operator are obtained from these experimental data.

  20. Delta Morphodynamics Matters! Ecosystem Services, Poverty and Morphodynamic Change in the Ganges-Brahmaputra Mega-Delta

    Science.gov (United States)

    Nicholls, R. J.; Adger, N.; Allan, A.; Darby, S. E.; Hutton, C.; Matthews, Z.; Rahman, M.; Whitehead, P. G.; Wolf, J.

    2013-12-01

    The world's deltas are probably the most vulnerable type of coastal environment, and they face multiple stresses in the coming decades. These stresses include, amongst others, local drivers due to land subsidence, population growth and urbanisation within the deltas, regional drivers due to changes in catchment management (e.g. upstream land use and dam construction), as well as global climate change impacts such as sea-level rise. At the same time, the ecosystem services of river deltas support high population densities, with around 14% of the global population inhabiting deltas. A large proportion of these people experience extremes of poverty and they are therefore severely exposed to vulnerability from environmental and ecological stress and degradation. In areas close to or below the poverty boundary, both subsistence and cash elements of the economy tend to rely disproportionately heavily on ecosystem services which underpin livelihoods. Therefore, to sustainably manage delta environments they must be viewed as complex social-environmental systems where change is only partially driven by physical drivers such as sea level rise and climate change, and human-induced development activities are also critical. Here we outline a new conceptual framework for the development of methods to understand and characterise the key drivers of change in ecosystem services that affect the environment and economic status of populous deltas, focusing specifically on the Ganges-Brahmaputra-Meghna (GBM) mega-delta. The GBM delta is characterised by densely populated coastal lowlands with significant poverty, with livelihoods supported to a large extent by natural ecosystems such as the Sunderbahns (the largest mangrove forest in the world). However, the GBM delta is under severe development pressure due to many growing cities. At present the importance of ecosystems services to poverty and livelihoods is poorly understood. This is due to due to the complexity of interactions

  1. Mammalian cytochrome CYP2E1 triggered differential gene regulation in response to trichloroethylene (TCE) in a transgenic poplar.

    Science.gov (United States)

    Kang, Jun Won; Wilkerson, Hui-Wen; Farin, Federico M; Bammler, Theo K; Beyer, Richard P; Strand, Stuart E; Doty, Sharon L

    2010-08-01

    Trichloroethylene (TCE) is an important environmental contaminant of soil, groundwater, and air. Studies of the metabolism of TCE by poplar trees suggest that cytochrome P450 enzymes are involved. Using poplar genome microarrays, we report a number of putative genes that are differentially expressed in response to TCE. In a previous study, transgenic hybrid poplar plants expressing mammalian cytochrome P450 2E1 (CYP2E1) had increased metabolism of TCE. In the vector control plants for this construct, 24 h following TCE exposure, 517 genes were upregulated and 650 genes were downregulated over 2-fold when compared with the non-exposed vector control plants. However, in the transgenic CYP2E1 plant, line 78, 1,601 genes were upregulated and 1,705 genes were downregulated over 2-fold when compared with the non-exposed transgenic CYP2E1 plant. It appeared that the CYP2E1 transgenic hybrid poplar plants overexpressing mammalian CYP2E1 showed a larger number of differentially expressed transcripts, suggesting a metabolic pathway for TCE to metabolites had been initiated by activity of CYP2E1 on TCE. These results suggest that either the over-expression of the CYP2E1 gene or the abundance of TCE metabolites from CYP450 2E1 activity triggered a strong genetic response to TCE. Particularly, cytochrome p450s, glutathione S-transferases, glucosyltransferases, and ABC transporters in the CYP2E1 transgenic hybrid poplar plants were highly expressed compared with in vector controls.

  2. MicroRNA-16 Modulates HuR Regulation of Cyclin E1 in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Xun Guo

    2015-03-01

    Full Text Available RNA binding protein (RBPs and microRNAs (miRNAs or miRs are post-transcriptional regulators of gene expression that are implicated in development of cancers. Although their individual roles have been studied, the crosstalk between RBPs and miRNAs is under intense investigation. Here, we show that in breast cancer cells, cyclin E1 upregulation by the RBP HuR is through specific binding to regions in the cyclin E1 mRNA 3' untranslated region (3'UTR containing U-rich elements. Similarly, miR-16 represses cyclin E1, dependent on its cognate binding sites in the cyclin E1 3'UTR. Evidence in the literature indicates that HuR can regulate miRNA expression and recruit or dissociate RNA-induced silencing complexes (RISC. Despite this, miR-16 and HuR do not affect the other’s expression level or binding to the cyclin E1 3'UTR. While HuR overexpression partially blocks miR-16 repression of a reporter mRNA containing the cyclin E1 3'UTR, it does not block miR-16 repression of endogenous cyclin E1 mRNA. In contrast, miR-16 blocks HuR-mediated upregulation of cyclin E1. Overall our results suggest that miR-16 can override HuR upregulation of cyclin E1 without affecting HuR expression or association with the cyclin E1 mRNA.

  3. Inhibition of human papillomavirus DNA replication by an E1-derived p80/UAF1-binding peptide.

    Science.gov (United States)

    Lehoux, Michaël; Fradet-Turcotte, Amélie; Lussier-Price, Mathieu; Omichinski, James G; Archambault, Jacques

    2012-04-01

    The papillomavirus E1 helicase is recruited by E2 to the viral origin, where it assembles into a double hexamer that orchestrates replication of the viral genome. We previously identified the cellular WD40 repeat-containing protein p80/UAF1 as a novel interaction partner of E1 from anogenital human papillomavirus (HPV) types. p80 was found to interact with the first 40 residues of HPV type 31 (HPV31) E1, and amino acid substitutions within this domain abrogated the maintenance of the viral episome in keratinocytes. In this study, we report that these p80-binding substitutions reduce by 70% the ability of E1 to support transient viral DNA replication without affecting its interaction with E2 and assembly at the origin in vivo. Microscopy studies revealed that p80 is relocalized from the cytoplasm to discrete subnuclear foci by E1 and E2. Chromatin immunoprecipitation assays further revealed that p80 is recruited to the viral origin in an E1- and E2-dependent manner. Interestingly, overexpression of a 40-amino-acid-long p80-binding peptide, derived from HPV31 E1, was found to inhibit viral DNA replication by preventing the recruitment of endogenous p80 to the origin. Mutant peptides defective for p80 interaction were not inhibitory, demonstrating the specificity of this effect. Characterization of this E1 peptide by nuclear magnetic resonance (NMR) showed that it is intrinsically disordered in solution, while mapping studies indicated that the WD repeats of p80 are required for E1 interaction. These results provide additional evidence for the requirement for p80 in anogenital HPV DNA replication and highlight the potential of E1-p80 interaction as a novel antiviral target.

  4. Energies and E1, M2 transition rates for Mo XXX

    CERN Document Server

    Hu, Feng; Mei, Maofei; Yang, Jiamin

    2016-01-01

    Based on relativistic wavefunctions from multiconfigurational Dirac-Hartree-Fock (MCDHF) and configuration interaction calculations, energy levels, radiative rates, and wavelengths are evaluated for all levels of 3s$^2$3p, 3s3p$^2$, 3s$^2$3d, 3p$^3$, 3s3p3d, 3p$^2$3d and 3s3d$^2$ configurations of Al-like Molybdenum ion (Mo XXX). Transition probabilities are reported for E1 and M2 transitions from the ground level. The valence-valence and core-valence correlation effects are accounted for in a systematic way. Breit interactions and quantum electrodynamics effects are estimated in subsequent relativistic configuration interaction calculations. Comparisons are made with the available data in the literature and good agreement has been found which confirms the reliability of our results.

  5. Bis[(E-1-(3,4-dichlorobenzylideneamino-4-methylpyridinium] bis(maleonitriledithiolatonickelate(II

    Directory of Open Access Journals (Sweden)

    Shao-Ming Zhang

    2009-02-01

    Full Text Available The asymmetric unit of the title compound, (C13H11Cl2N22[Ni(C4N2S22], contains one-half of a centrosymmetric [Ni(mnt2] anion (where mnt is maleonitriledithiolate or 1,2-dicyano-1,2-ethylenedithiolate and an (E-1-(3,4-dichlorobenzylideneamino-4-methylpyridinium cation. In the anion, the coordination around the Ni atom is a distorted square. In the cation, the aromatic rings are oriented at a dihedral angle of 7.81 (3°. In the crystal structure, intermolecular C—H...N hydrogen bonds link the cations and anions. π–π Contacts between the nickel dithiolene and pyridine rings and between the benzene and pyridine rings, [centroid–centroid distances = 3.682 (3 and 3.643 (3 Å, respectively] may further stabilize the structure.

  6. Chang'E-1 orbiter discovers a lunar nearside volcano: YUTU Mountain

    Institute of Scientific and Technical Information of China (English)

    PING dinSong; HUANG Qian; SU XiaoLi; TANG GeShi; SHU Rong; XIAO Long; HUANG Jun

    2009-01-01

    In the day time of the Moon surface, the strong illumination from high altitude and high albedo rate radical craters will introduce the illumination effect on observing the nearby low altitude, low albedo rate and shallow small slop rate area seriously, and even can "hide" the later area from the light. Based on the lunar global topography model obtained by Chang'E-1 mission, and by comparing with the lunar gravity model, a volcano named "YUTU Mountain" has been identified. It is a volcano with diameter of ~300 km and height of ~2 km located at (14°N, 308°E) in Oceanus Procellarum. Besides, the DEM of another volcano named "GUISHU Mountain" in the same area has been improved. This new discovery will benefit the study of lunar magmatism and volcanism evolution in the nearside of the Moon.

  7. The use of laser altimetry data in Chang'E-1 precision orbit determination

    Science.gov (United States)

    Chang, Sheng-Qi; Huang, Yong; Li, Pei-Jia; Hu, Xiao-Gong; Fan, Min

    2016-09-01

    Accurate altimetric measurement not only can be applied to the calculation of a topography model but also can be used to improve the quality of the orbit reconstruction in the form of crossovers. Altimetry data from the Chang'E-1 (CE-1) laser altimeter are analyzed in this paper. The differences between the crossover constraint equation in the form of height discrepancies and in the form of minimum distances are mainly discussed. The results demonstrate that the crossover constraint equation in the form of minimum distances improves the CE-1 orbit precision. The overlap orbit performance has increased ∼ 30% compared to the orbit using only tracking data. External assessment using the topography model also shows orbit improvement. The results will be helpful for recomputing ephemeris and improving the CE-1 topography model.

  8. Application of ozonation process in industrial wastewaters: textile, kraft E1 and whey effluents.

    Science.gov (United States)

    Assalin, M R; Almeida, E S; Rosa, M A; Moraes, S G; Duran, N

    2004-08-01

    A large variety of organic and inorganic compounds can be found in wastewater from industrial processes. In this work, Advanced Oxidative Processes (AOPs) have been applied for the control of water pollution and the ozonation of different effluents was investigated. Wastewater from textile, kraft E1 and cheese manufacturing processes were chosen as examples of industrial effluents. The efficiency of substrate mineralization has been comparatively analyzed by the decrease in total organic carbon (TOC), color, and toxicity. The results revealed that the ozonation process can be a method for decolorization of effluent, but it is not effective for TOC reduction. The whey effluent was the most recalcitrant wastewater for ozone treatment which produced no TOC removal.

  9. Crystal structure of (E-1-(4-chlorophenylethanone O-dehydroabietyloxime

    Directory of Open Access Journals (Sweden)

    Jian-Qiang Zheng

    2014-09-01

    Full Text Available The title compound, C28H34ClNO2 {systematic name: (E-1-(4-chlorophenylethanone O-[(1R,4aS,10aR-7-isopropyl-1,4a-dimethyl-1,2,3,4,4a,9,10,10a-octahydrophenanthrene-1-carbonyl]oxime}, was synthesized from dehydroabietic acid. In the dehydroabietyl moiety, the central and terminal cyclohexane rings display chair and half-chair conformations, respectively, and a trans-ring junction. The C=N bond is in an E conformation and the C—O—N=C torsion angle is 148.1 (5°. No directional interactions except van der Waals contacts occur in the crystal structure.

  10. Lunar digital elevation model and elevation distribution model based on Chang’E-1 LAM data

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    More than 8.2 million effective data samples were obtained by the Chang’E-1 Laser Altimeter (LAM).In order to produce a global topographic model of the moon with improved accuracy,a hierarchical many-knot spline method was proposed in this paper.This algorithm makes use of a hierarchy of control lattices to approximate or interpolate the LAM data.Based on the proposed algorithm,a 0.0625°×0.0625° grid of global lunar DEM was obtained and it was compared with ULCN2005,CLTMs01 and Kaguya models,respectively.At the same time,this paper explored the elevation distribution law and established the elevation distribution model.It is shown that the global lunar and nearside elevation distribution is positively skewed and leptokurtic normal distribution,and the farside elevation distribution is a positively skewed and platykurtic normal distribution.

  11. The use of laser altimetry data in Chang'E-1 precision orbit determination

    Science.gov (United States)

    Chang, Sheng-Qi; Huang, Yong; Li, Pei-Jia; Hu, Xiao-Gong; Fan, Min

    2016-09-01

    Accurate altimetric measurement not only can be applied to the calculation of a topography model but also can be used to improve the quality of the orbit reconstruction in the form of crossovers. Altimetry data from the Chang'E-1 (CE-1) laser altimeter are analyzed in this paper. The differences between the crossover constraint equation in the form of height discrepancies and in the form of minimum distances are mainly discussed. The results demonstrate that the crossover constraint equation in the form of minimum distances improves the CE-1 orbit precision. The overlap orbit performance has increased ˜ 30% compared to the orbit using only tracking data. External assessment using the topography model also shows orbit improvement. The results will be helpful for recomputing ephemeris and improving the CE-1 topography model.

  12. Melatonin Suppresses Autophagy Induced by Clinostat in Preosteoblast MC3T3-E1 Cells.

    Science.gov (United States)

    Yoo, Yeong-Min; Han, Tae-Young; Kim, Han Sung

    2016-04-08

    Microgravity exposure can cause cardiovascular and immune disorders, muscle atrophy, osteoporosis, and loss of blood and plasma volume. A clinostat device is an effective ground-based tool for simulating microgravity. This study investigated how melatonin suppresses autophagy caused by simulated microgravity in preosteoblast MC3T3-E1 cells. In preosteoblast MC3T3-E1 cells, clinostat rotation induced a significant time-dependent increase in the levels of the autophagosomal marker microtubule-associated protein light chain (LC3), suggesting that autophagy is induced by clinostat rotation in these cells. Melatonin treatment (100, 200 nM) significantly attenuated the clinostat-induced increases in LC3 II protein, and immunofluorescence staining revealed decreased levels of both LC3 and lysosomal-associated membrane protein 2 (Lamp2), indicating a decrease in autophagosomes. The levels of phosphorylation of mammalian target of rapamycin (p-mTOR) (Ser2448), phosphorylation of extracellular signal-regulated kinase (p-ERK), and phosphorylation of serine-threonine protein kinase (p-Akt) (Ser473) were significantly reduced by clinostat rotation. However, their expression levels were significantly recovered by melatonin treatment. Also, expression of the Bcl-2, truncated Bid, Cu/Zn- superoxide dismutase (SOD), and Mn-SOD proteins were significantly increased by melatonin treatment, whereas levels of Bax and catalase were decreased. The endoplasmic reticulum (ER) stress marker GRP78/BiP, IRE1α, and p-PERK proteins were significantly reduced by melatonin treatment. Treatment with the competitive melatonin receptor antagonist luzindole blocked melatonin-induced decreases in LC3 II levels. These results demonstrate that melatonin suppresses clinostat-induced autophagy through increasing the phosphorylation of the ERK/Akt/mTOR proteins. Consequently, melatonin appears to be a potential therapeutic agent for regulating microgravity-related bone loss or osteoporosis.

  13. Study of thermally excited nuclei through E1 and E2 decay from collective modes

    Energy Technology Data Exchange (ETDEWEB)

    Million, B.; Bracco, A.; Benzoni, G.; Leoni, S.; Camera, F.; Wieland, O. [Dipartimento di Fisica, Universita di Milano and INFN, via Celoria 16, 20133, Milano (Italy); Maj, A.; Kmiecik, M. [Niewodniczanski Institute of Nuclear Physics, 31-342, Krakow (Poland); Gadea, A. [Laboratori Nazionali di Legnaro, via Romea, Legnaro (Italy); Herskind, B. [The Niels Bohr Institute, Blegdamsvej 15-17, 2100, Copenhagen (Denmark)

    2004-04-01

    The nuclear system at the limit of excitation energy and angular momentum is here studied in the case of the superdeformed nucleus {sup 143}Eu using {gamma}-spectroscopy techniques. The data are based on a EUROBALL experiment using the reaction {sup 37}Cl+{sup 110}Pd{yields}{sup 143}Eu+4n. The influence of thermal energy on superdeformed configurations is investigated through the analysis of the quasi-continuum spectra formed by E2 transitions among states of excited rotational bands with energy extending up to 4-5 MeV above the yrast line. In particular, the effective lifetimes of the discrete rotational bands forming ridge structures in {gamma}-{gamma} coincidence matrices is measured by a Doppler Shift Attenuation Method. The deduced quadrupole deformation of Q{sub t} {approx}10 eb indicates that the nucleus maintains its collectivity with increasing excitation energy, supporting the superdeformed character of the excited nuclear rotation. The obtained number of superdeformed discrete bands forming the ridge structures is found in good agreement with microscopic cranked shell model calculations including the decay-out process into the lower deformation minimum. In addition, the nuclear properties at higher excitation energies are investigated through the E1 {gamma}-decay of the giant dipole resonance (GDR). It is found that the intensity of the superdeformed yrast and excited bands increases by a factor of approximately 1.6 when a coincidence with a high-energy {gamma}-ray is required, showing the importance of the E1 cooling in the feeding mechanism of the superdeformed states. (orig.)

  14. EAARL Coastal Topography--Pearl River Delta 2008: First Surface

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A first surface elevation map (also known as a Digital Elevation Model, or DEM) of the Pearl River Delta in Louisiana and Mississippi was produced from remotely...

  15. EAARL Coastal Topography--Pearl River Delta 2008: Bare Earth

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A bare earth elevation map (also known as a Digital Elevation Model, or DEM) of the Pearl River Delta in Louisiana and Mississippi was produced from remotely sensed,...

  16. GPC Using a Delta-Domain Emulator-Based Approach

    DEFF Research Database (Denmark)

    Lauritsen, Morten Bach; Jensen, Morten Rostgaard; Poulsen, Niels Kjølstad

    1997-01-01

    This paper describes new approaches to generalized predictive control formulated in the delta (delta) domain. A new delta-domain version of the continuous-time emulator-based predictor is presented. It is shown to contain the optimal discrete-time predictor based on incomplete information...... as a special case. Usually, a good estimate is obtained in a much longer range of samples than obtained by the optimal predictor of the same complexity. This is particularly advantageous at fast sampling rates where a `conventional' predictor is bound to become very computationally demanding. Two controllers...... are considered: one having a well-defined limit as the sampling period tends to zero, the other being a close approximation to the conventional discrete-time GPC. Both algorithms are discrete in nature and well-suited for adaptive control. The fact that delta-domain models are used does not introduce...

  17. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1990

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1990 calendar year. The report begins with a summary...

  18. Delta- Sigma Modulator with Signal Dependant Feedback Gain

    National Research Council Canada - National Science Library

    K.Diwakar; V.Vinoth Kumar

    2015-01-01

    Higher order Delta-Sigma Modulator (DSM) is basically an unstable system. The approximate conditions for stability cannot be used for the design of a DSM for industrial applications where risk is involved...

  19. A High Performance Delta-Sigma Modulator for Neurosensing

    National Research Council Canada - National Science Library

    Xu, Jian; Zhao, Menglian; Wu, Xiaobo; Islam, Md Kafiul; Yang, Zhi

    2015-01-01

    ... to achieve and would require excessive circuit area and power for implementation. In this paper, we present a high performance Delta-Sigma modulator along with several design techniques and enabling blocks to reduce circuit area and power...

  20. An integrated delta-sigma based IIR filter

    Science.gov (United States)

    Au, Dennis Kin-Wah

    Delta-sigma based infinite impulse response (IIR) filters are a recently developed circuit technique for efficiently realizing IIR filters operating directly on oversampled delta-sigma modulated signals. The design and single-chip implementation of a fifth-order delta-sigma based IIR filter are described. The filter coefficients are fully programmable and with the use of a structure that is inherently scaled for dynamic range, good filter performance is maintained over a wide variety of transfer functions. To eliminate multi-bit multiplications, five second-order digital delta-sigma modulators were used and dynamic range improvement was obtained through the use of multi-bit quantizers in these modulators. The filter was implemented as a very large scale integration chip using 1.2 micron complementary metal oxide semiconductor technology, occupying an area of 4,355 by 5,962 square microns. Simulations indicate that the clock range should operate up to 45 MHz.

  1. Yukon Delta National Wildlife Refuge coastal survey, final report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Aerial surveys were conducted along the coastline of the Yukon Delta National Wildlife Refuge to determine the distribution and abundance of waterfowl and...

  2. Alternative Interpretation for the Eberswalde Delta, Holden NE Crater, Mars

    Science.gov (United States)

    Fedo, C. M.; Finkelstein, D. B.; Moersch, J. E.

    2008-03-01

    Examination of HiRISE images from the Eberswalde Delta reveal that it is hard to identify sedimentologic and stratigraphic components of a fluvio-deltaic system, leaving open alternative interpretations for the origin of the strata and geomorphpology.

  3. Linear delta expansion technique for the solution of anharmonic oscillations

    Indian Academy of Sciences (India)

    P K Bera; J Datta

    2007-01-01

    The linear delta expansion technique has been developed for solving the differential equation of motion for symmetric and asymmetric anharmonic oscillators. We have also demonstrated the sophistication and simplicity of this new perturbation technique.

  4. Lead analysis of waterfowl from Yukon Delta NWR

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In 1995, WAES received funds from the Yukon Delta Ecosystem Team to analyze livers of waterfowl, other than spectacled eiders, for lead concentrations. Nineteen...

  5. LiDAR data for the Delta Area of California

    Data.gov (United States)

    California Department of Resources — LiDAR data for the Delta Area of California from the California Department of Water Resources. Bare earth grids from LiDAR.This data is in ESRI Grid format with 2...

  6. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1992

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1992 calendar year. The report begins with a summary...

  7. Migratory Bird Avian Influenza Sampling; Yukon Kuskokwim Delta, Alaska, 2015

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Data set containing avian influenza sampling information for spring and summer waterbirds on the Yukon Kuskokwim Delta, 2015. Data contains sample ID, species common...

  8. Delta and Breton National Wildlife Refuges: Comprehensive Conservation Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This Comprehensive Conservation Plan (CCP) was written to guide management on Delta and Breton NWRs for the next 15 years. This plan outlines the refuges' vision and...

  9. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1995

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1995 calendar year. The report begins with a summary...

  10. EAARL Coastal Topography--Pearl River Delta 2008: Bare Earth

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A bare earth elevation map (also known as a Digital Elevation Model, or DEM) of the Pearl River Delta in Louisiana and Mississippi was produced from remotely sensed,...

  11. Topography data from the Elwha River delta, Washington, September 2014

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of the data release presents topography data from the Elwha River delta collected in September 2014. Topography data were collected on foot with global...

  12. Calculating Lake Morphology in the Colville River Delta, Alaska

    Science.gov (United States)

    McGraw, M.; Walker, H. J.

    2013-12-01

    The morphology and surface area of a lake can be determined using simple mathematical formulas. These formulas can be plugged into a Geographic Information System (GIS) and used to calculate the circularity, smoothness, compactness and orientation of a lake or pond in remotely sensed imagery. The calculated output can then be used to differentiate circular lakes from elongated lakes, lakes with smooth shorelines from those with complex shorelines, and lake orientation; such information can then be used to classify and quantify different types of lakes in complex environments such as river deltas. The Colville River delta is located on the North Slope of Arctic Alaska. Previous studies have classified the delta's 230,000+ lakes into five types: 1. thermokarst (thaw) lakes, 2. oriented lakes, 3. perched lakes, 4 channel lakes and 5. ice-wedge polygon ponds. This study uses 2004 aerial photography and 2011 satellite imagery to quantify the different types of lake in the delta.

  13. Water Quality Assessment of River Areba, Niger Delta, Nigeria ...

    African Journals Online (AJOL)

    Water Quality Assessment of River Areba, Niger Delta, Nigeria Using Physical ... phosphate (0.78mg/l) were above World Health Organization limits for drinking water. Seasonally, water temperatures, total dissolved solids, biological oxygen ...

  14. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1983

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1983 calendar year. The report begins with a summary...

  15. Hypertension in a Rural Community in Rivers State, Niger Delta ...

    African Journals Online (AJOL)

    Hypertension in a Rural Community in Rivers State, Niger Delta Region of Nigeria: ... (SSA), is now a serious endemic threat and an important public health issue. ... Medical history such as prior knowledge of blood pressure status and family ...

  16. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1994

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1994 calendar year. The report begins with a summary...

  17. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1987

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1987 calendar year. The report begins with a summary...

  18. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 2001 calendar year. The report begins with a summary...

  19. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1986

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1986 calendar year. The report begins with a summary...

  20. Birds and mammals of the Copper River Delta

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this report are: (1) to describe the habitats available for birds and mammals on the Copper River Delta (2) to present an annotated list of birds...

  1. Inventory Management in Delta Allied Wire Industries Limited Asaba ...

    African Journals Online (AJOL)

    Inventory Management in Delta Allied Wire Industries Limited Asaba. ... review and customers' handling processes equally studied for improvement. The data collated were collated were analyzed using the Economic Order Quantity (EOQ) ...

  2. Profiling risk and sustainability in coastal deltas of the world

    Science.gov (United States)

    Tessler, Z. D.; Vörösmarty, C. J.; Grossberg, M.; Gladkova, I.; Aizenman, H.; Syvitski, J. P. M.; Foufoula-Georgiou, E.

    2015-08-01

    Deltas are highly sensitive to increasing risks arising from local human activities, land subsidence, regional water management, global sea-level rise, and climate extremes. We quantified changing flood risk due to extreme events using an integrated set of global environmental, geophysical, and social indicators. Although risks are distributed across all levels of economic development, wealthy countries effectively limit their present-day threat by gross domestic product-enabled infrastructure and coastal defense investments. In an energy-constrained future, such protections will probably prove to be unsustainable, raising relative risks by four to eight times in the Mississippi and Rhine deltas and by one-and-a-half to four times in the Chao Phraya and Yangtze deltas. The current emphasis on short-term solutions for the world’s deltas will greatly constrain options for designing sustainable solutions in the long term.

  3. EAARL Coastal Topography--Pearl River Delta 2008: First Surface

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A first surface elevation map (also known as a Digital Elevation Model, or DEM) of the Pearl River Delta in Louisiana and Mississippi was produced from remotely...

  4. LiDAR data for the Delta Area of California

    Data.gov (United States)

    California Department of Resources — LiDAR data for the Delta Area of California from the California Department of Water Resources. Bare earth grids from LiDAR.This data is in ESRI Grid format with 2...

  5. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1998

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1998 calendar year. The report begins with a summary...

  6. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 2002

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 2002 calendar year. The report begins with a summary...

  7. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1996

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1996 calendar year. The report begins with a summary...

  8. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1997

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1997 calendar year. The report begins with a summary...

  9. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1982

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta, Nunivak National Wildlife Refuge outlines Refuge accomplishments during the 1982 calendar year. The report begins with...

  10. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1989

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1989 calendar year. The report begins with a summary...

  11. The Byron Syring DELTA Center--Leadership in Action.

    Science.gov (United States)

    Snyder, Timothy

    1997-01-01

    Byron Spring DELTA Center serves a small farming community in Colorado offers high school diploma programs, English-as-a-Second-Language courses, lifelong learning, and a variety of other programs for teens and adults. (JOW)

  12. Rarotonga Radiocarbon (delta 14C) for 1950 to 1997

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Rarotonga coral radiocarbon (14C) timeseries. Coral radiocarbon (Delta-14C) on untreated, low-speed drilled samples. Precision is +/- 4 per mil as documented by an...

  13. precise delta extraction scheme for reprogramming of wireless ...

    African Journals Online (AJOL)

    eobe

    Keywords- reprogramming; operating system, wireless sensor network, Delta. 1. ... implemented via the use of embedded operating systems. Jun-Zhao in [6] as well as Dunkiels et al. in [7] ..... Pister, “System architecture directions for.

  14. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 1999

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 1999 calendar year. The report begins with a summary...

  15. Yukon Delta National Wildlife Refuge : Narrative Report : Calendar Year 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Yukon Delta National Wildlife Refuge outlines Refuge accomplishments during the 2000 calendar year. The report begins with a summary...

  16. Morphologic and stratigraphic evolution of muddy ebb-tidal deltas along a subsiding coast: Barataria Bay, Mississippi River delta

    Science.gov (United States)

    FitzGerald, D.M.; Kulp, M.; Penland, S.; Flocks, J.; Kindinger, J.

    2004-01-01

    The Barataria barrier coast formed between two major distributaries of the Mississippi River delta: the Plaquemines deltaic headland to the east and the Lafourche deltaic headland to the west. Rapid relative sea-level rise (1??03 cm year-1) and other erosional processes within Barataria Bay have led to substantial increases in the area of open water (> 775 km2 since 1956) and the attendant bay tidal prism. Historically, the increase in tidal discharge at inlets has produced larger channel cross-sections and prograding ebb-tidal deltas. For example, the ebb delta at Barataria Pass has built seaward > 2??2 km since the 1880s. Shoreline erosion and an increasing bay tidal prism also facilitated the formation of new inlets. Four major lithofacies characterize the Barataria coast ebb-tidal deltas and associated sedimentary environments. These include a proximal delta facies composed of massive to laminated, fine grey-brown to pale yellow sand and a distal delta facies consisting of thinly laminated, grey to pale yellow sand and silty sand with mud layers. The higher energy proximal delta deposits contain a greater percentage of sand (75-100%) compared with the distal delta sediments (60-80%). Associated sedimentary units include a nearshore facies consisting of horizontally laminated, fine to very fine grey sand with mud layers and an offshore facies that is composed of grey to dark grey, laminated sandy silt to silty clay. All facies coarsen upwards except the offshore facies, which fines upwards. An evolutionary model is presented for the stratigraphic development of the ebb-tidal deltas in a regime of increasing tidal energy resulting from coastal land loss and tidal prism growth. Ebb-tidal delta facies prograde over nearshore sediments, which interfinger with offshore facies. The seaward decrease in tidal current velocity of the ebb discharge produces a gradational contact between proximal and distal tidal delta facies. As the tidal discharge increases and the inlet

  17. The late-Holocene progradation of the Mahakam Delta, Indonesia - A case study of tidal, tropical deltas

    Science.gov (United States)

    Dalman, R.; Ranawijaya, D.; Missiaen, T.; Kroonenberg, S.; Storms, J.

    2011-12-01

    The Mahakam Delta is an oft-cited example of a mixed fluvial-tidally influenced delta. Yet the distinct separation of the tide-dominated delta plain and the fluvial distributaries make the delta unique amongst tidally influenced deltas. The delta prograded an average of 60 km over the last 5000 years. Most sediment transport is induced by tidal currents and fluvial discharge, which resulted in a distinct, dense network of distributary and tidal channels. In order to characterize the Holocene sedimentary architecture we describe a dataset of 10 new cores and a large survey of very high-resolution, shallow seismics. The seismics are recorded using an echosounder with a novel parametric source, allowing subsurface penetration in excess of 15 m while achieving a vertical resolution of 0.2 m. Distinct sedimentary facies are described in detail for delta plain, delta front, distributary and mouthbar deposits. A notable difference in stratal pattern has been observed between the inner and outer tide-dominated delta plain facies. The inner tidal channels cut deeply into the underlying deltafront deposits and form a distinct heterogenic laterally accreting and intercutting facies. Whereas the outer tide-dominated delta plain deposits accrete conformably on the marine deltafront facies and show a much more homogenous sedimentary architecture. The continual reworking of the inner tide-dominated delta plain results in a patchwork of deposits greatly varying in thickness and age albeit with a similar silty clay lithology. The area of the present-day delta was largely flooded after the early to mid-Holocene transgression, our data indicate that a small branch of fluvial distributaries was active on the current delta plain around 5 ka. Subsequently, the northernmost fluvial distributary built out rapidly over a period of 3 kyrs. The southern distributaries built out later, from 2 ka to the present. The mouthbar deposits in the south are significantly thicker than in the northern

  18. Longitudinal spin asymmetries and $\\Delta G$ at COMPASS

    CERN Document Server

    Le Goff, Jean-Marc

    2008-01-01

    The spin structure $g_{1}$ of the deuteron has been measured by COMPASS with unprecedented accuracy at low $x$, providing much more reliable values for the first moment $\\Gamma_{1}$ and for the quark spin contribution $\\Delta\\Sigma$. Difference-charge semi-inclusive asymmetries have been measured and seem to favor a flavor asymmetric polarized sea. The gluon polarization has been measured in the open-charm and high-$p_{t}$ channels. Large values of $\\Delta G$ are now unlikely.

  19. delta. t tuneup procedure for the LAMPF 805-MHz linac

    Energy Technology Data Exchange (ETDEWEB)

    Crandall, K.R.

    1976-05-01

    An important part of tuning the LAMPF accelerator is the adjustment of the phases and amplitudes in the 805-MHz linac. The technique used is called the ..delta..t procedure because of the time-of-flight measurements that are required. The theory behind the ..delta..t procedure, a brief description of the hardware, and a description of the many computer programs that have been written to implement the procedure are presented.

  20. Properties of the $\\delta$ Scorpii Circumstellar Disk from Continuum Modeling

    OpenAIRE

    Carciofi, A. C.; Miroshnichenko, A. S.; Kusakin, A. V.; Bjorkman, J. E.; Bjorkman, K. S.; Marang, F.; Kuratov, K.S.; a-Lario, P. Garcí; Calderón, J. V. Perea; Fabregat, J.; Magalhães, A.M.

    2006-01-01

    We present optical $WBVR$ and infrared $JHKL$ photometric observations of the Be binary system $\\delta$ Sco, obtained in 2000--2005, mid-infrared (10 and $18 \\mu$m) photometry and optical ($\\lambda\\lambda$ 3200--10500 \\AA) spectropolarimetry obtained in 2001. Our optical photometry confirms the results of much more frequent visual monitoring of $\\delta$ Sco. In 2005, we detected a significant decrease in the object's brightness, both in optical and near-infrared brightness, which is associate...

  1. Multimegawatt DAE$\\delta$ALUS Cyclotrons for Neutrino Physics

    CERN Document Server

    Abs, M; Alonso, J R; Barletta, W A; Barlow, R; Calabretta, L; Calanna, A; Campo, D; Celona, L; Conrad, J M; Gammino, S; Kleeven, W; Koeth, T; Maggiore, M; Okuno, H; Piazza, L A C; Seidel, M; Shaevitz, M H; Stingelin, L; Yang, J J; Yeck, J

    2012-01-01

    DAE$\\delta$ALUS (Decay-At-rest Experiment for $\\delta_{CP}$ studies At the Laboratory for Underground Science) provides a new approach to the search for CP violation in the neutrino sector. High-power continuous-wave proton cyclotrons efficiently provide the necessary proton beams with an energy of up to 800 MeV to create neutrinos from pion and muon decay-at-rest. The experiment searches for $\\bar{\

  2. Automatisierte VHDL-Code-Generierung eines Delta-Sigma Modulators

    Directory of Open Access Journals (Sweden)

    R. Spilka

    2006-01-01

    Full Text Available Im vorliegenden Beitrag wird eine automatische Generierung des VHDL-Codes eines Delta-Sigma Modulators präsentiert. Die Koeffizientenmultiplikation wird hierbei durch Bit-Serielle-Addition durchgeführt. Mit Hilfe zweier neuer Matlab Funktionen wird der Systementwurf durch die bekannte Delta-Sigma Toolbox von R. Schreier erweitert und direkt synthesefähiger VHDL Code erzeugt.

  3. Sedimentation patterns in floodplains of the Mekong Delta - Vietnam

    Science.gov (United States)

    Van Manh, Nguyen; Merz, Bruno; Viet Dung, Nguyen; Apel, Heiko

    2013-04-01

    Quantification of floodplain sedimentation during the flood season in the Mekong Delta (MD) plays a very important role in the assessment of flood deposits for a sustainable agro-economic development. Recent studies on floodplain sedimentation in the region are restricted to small pilot sites because of the large extend of the Delta, and the complex channel. This research aims at a quantification of the sediment deposition in floodplains of the whole Mekong Delta, and to access the impacts of the upstream basin development on the sedimentation in the Delta quantitatively. To achieve this, a suspended sediment transport model is developed based on the quasi-2D hydrodynamic model of the whole Mekong Delta developed by Dung et al. (2011). The model is calibrated and validated using observed data derived from several sediment measurement campaigns in channel networks and floodplains. Measured sediment data and hydrodynamic model quantify the spatio-temporal variability of sediment depositions in different spatial units: individual dyke compartments, and the sub-regions Plain of Reeds, Long Xuyen Quadrangle and the area between Tien River and Hau River. It is shown that the distribution of sediment deposition over the delta is highly depended on the flood magnitude, that in turn drives the operation policy of flood control systems in floodplains of the Mekong Delta. Thus, the sedimentation distribution is influenced by the protection level of the dyke systems in place and the distance to the Tien River and Hau River, the main branches of the Mekong in the Delta. This corroborates the main findings derived from data analysis obtained from a small scale test site by Hung et al, (2011, 2012a). Moreover, the results obtained here underlines the importance of the main channels for the sediment transport into the floodplains, and the deposition rate in floodplains is strongly driven by the intake locations and the distance from these to the main channels as well.

  4. An integrated assessment framework for land subsidence in delta cities

    Directory of Open Access Journals (Sweden)

    T. H. M. Bucx

    2015-11-01

    Full Text Available In many delta cities land subsidence exceeds absolute sea level rise up to a factor of ten by excessive groundwater extraction related to rapid urbanization and population growth. Without change, parts of Jakarta, Ho Chi Minh City, Bangkok and numerous other delta (and coastal cities will sink below sea level. Increased flooding and also other widespread impacts of land subsidence result already in damage of billions of dollars per year. In order to gain insight in the complex, multi-sectoral aspects of subsidence, to raise awareness and to support decision making on appropriate adaptation strategies and measures, an Integrated Assessment Framework (IAF for subsidence is introduced, illustrated by several (delta case studies. Based on that a list of 10 generic key issues and possible solutions is presented in order to further develop and support a (generic approach how to deal with subsidence in current and future subsidence-prone areas. For exchange of experiences and knowledge development.on subsidence in deltas the Delta Alliance, a knowledge network of deltas worldwide, can be supportive.

  5. Near-infrared spectropolarimetry of a delta-spot

    CERN Document Server

    Balthasar, H; Louis, R E; Verma, M; Denker, C

    2014-01-01

    Sunspots harboring umbrae of both magnetic polarities within a common penumbra (delta-spots) are often but not always related to flares. We present first near-infrared (NIR) observations (Fe I 1078.3 nm and Si I 1078.6 nm spectra) obtained with the Tenerife Infrared Polarimeter (TIP) at the Vacuum Tower Telescope (VTT) in Tenerife on 2012 June 17, which afford accurate and sensitive diagnostics to scrutinize the complex fields along the magnetic neutral line of a delta-spot within active region NOAA 11504. We examine the vector magnetic field, line-of-sight (LOS) velocities, and horizontal proper motions of this rather inactive delta-spot. We find a smooth transition of the magnetic vector field from the main umbra to that of opposite polarity (delta-umbra), but a discontinuity of the horizontal magnetic field at some distance from the delta-umbra on the polarity inversion line. The magnetic field decreases faster with height by a factor of two above the delta-umbra. The latter is surrounded by its own Eversh...

  6. An integrated assessment framework for land subsidence in delta cities

    Science.gov (United States)

    Bucx, T. H. M.; van Ruiten, C. J. M.; Erkens, G.; de Lange, G.

    2015-11-01

    In many delta cities land subsidence exceeds absolute sea level rise up to a factor of ten by excessive groundwater extraction related to rapid urbanization and population growth. Without change, parts of Jakarta, Ho Chi Minh City, Bangkok and numerous other delta (and coastal) cities will sink below sea level. Increased flooding and also other widespread impacts of land subsidence result already in damage of billions of dollars per year. In order to gain insight in the complex, multi-sectoral aspects of subsidence, to raise awareness and to support decision making on appropriate adaptation strategies and measures, an Integrated Assessment Framework (IAF) for subsidence is introduced, illustrated by several (delta) case studies. Based on that a list of 10 generic key issues and possible solutions is presented in order to further develop and support a (generic) approach how to deal with subsidence in current and future subsidence-prone areas. For exchange of experiences and knowledge development.on subsidence in deltas the Delta Alliance, a knowledge network of deltas worldwide, can be supportive.

  7. Governance of ‘long term delta planning’ in Bangladesh, Vietnam and the Netherlands

    NARCIS (Netherlands)

    Staveren, van M.F.

    2014-01-01

    The Deltas in Times of Climate Change Conference II, taking place in September 2014, Rotterdam, presented a suitable occasion to discuss both delta challenges and interesting approaches to how ‘delta dynamics’ are being dealt with worldwide.1 Delta dynamics include here both environmental (including

  8. Identifying environmental controls on the shoreline of a natural river delta

    NARCIS (Netherlands)

    Geleynse, N.; Hiatt, M.; Sangireddy, H.; Passalacqua, P.

    River deltas form where sediment-laden water debouches into a basin. The spatial delineation of a delta is nontrivial and yet is fundamental to systematically evaluating fluxes across its surface. Here we study shoreline dynamics of the Wax Lake Delta (WLD), a naturally developing delta, downstream

  9. Identifying environmental controls on the shoreline of a natural river delta

    NARCIS (Netherlands)

    Geleynse, N.; Hiatt, M.; Sangireddy, H.; Passalacqua, P.

    2015-01-01

    River deltas form where sediment-laden water debouches into a basin. The spatial delineation of a delta is nontrivial and yet is fundamental to systematically evaluating fluxes across its surface. Here we study shoreline dynamics of the Wax Lake Delta (WLD), a naturally developing delta, downstream

  10. Simulating radiation damage in {delta}-plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, M. [Department of Mathematical Sciences, Loughborough University, Loughborough, LE11 3TU (United Kingdom)], E-mail: m.robinson@lboro.ac.uk; Kenny, S.D.; Smith, R. [Department of Mathematical Sciences, Loughborough University, Loughborough, LE11 3TU (United Kingdom); Storr, M.T.; McGee, E. [Atomic Weapons Establishment, Aldermaston, Reading, RG7 4PR (United Kingdom)

    2009-09-15

    Radiation events in {delta}-Pu (fcc) have been simulated in an attempt to understand the fundamental mechanisms that contribute to the Pu ageing process. The Pu interactions are modelled using a potential based on the modified embedded atom method (MEAM). The energetics of point defects have been investigated using static calculations together with molecular dynamics (MD) to simulate radiation events. All MD simulations were carried out with Pu initially in the face-centred-cubic (fcc) structure, although this is not the lowest energy configuration for the pure metal. The point defect study suggests that the mono-vacancy has the lowest formation energy (0.46 eV), with interstitial defects favouring the <100> - split orientation over occupation of the native fcc octahedral site. Displacement threshold energy calculations at room temperature give a minimum value of between 5 and 6 eV, increasing to 8-14 eV along the major crystallographic directions. Low energy collision cascades, initiated with energies in the range of 0.4-1 keV, show that the cascades form in a similar manner to other fcc metals with a vacancy rich zone at the cascade core, surrounded by isolated interstitial defects. Higher energy cascades show similar features but with occasional channelling of energetic atoms and sub-cascade branching which significantly reduces defect production. A common trait observed across all the cascades was the relatively slow annealing period, compared to cascades in other fcc metals, with simulations at energies above 5 keV requiring many 10's of picoseconds before the ballistic phase was completed.

  11. Chromosomal damage induced by human adenovirus type 12 requires expression of the E1B 55-kilodalton viral protein.

    Science.gov (United States)

    Schramayr, S; Caporossi, D; Mak, I; Jelinek, T; Bacchetti, S

    1990-01-01

    Infection of human embryonic kidney cells with adenovirus type 12 results in the induction of damage at specific (17q21-22, 1p36, 1q21, and 1q42-43) and random sites in the cellular chromosomes. A previous study by Durnam et al. (D. M. Durnam, P. P. Smith, J. C. Menninger, and J. K. McDougall, Cancer Cells 4:349-354, 1986) indicated that the expression of viral early region 1 (E1) is sufficient for the induction of damage at band 17q21-22. In the present report we used an adenovirus type 12-adenovirus type 5 recombinant with E1A hybrid sequences as well as viruses with mutations in the adenovirus type 12 E1B genes to map adenovirus type 12 E1 functions involved in the induction of genetic damage. Our results show that the expression of the E1A proteins is not sufficient for this effect. On the other hand, mutations within the E1B 55-kilodalton protein but not the E1B 19-kilodalton protein affect the ability of the virus to induce both specific and random chromosomal damage. Images PMID:2325204

  12. Adenovirus type 12 E1B 55-kilodalton oncoprotein promotes p53-mediated apoptotic response of ovarian cancer to cisplatin.

    Science.gov (United States)

    Wang, Junnai; Gao, Qinglei; Li, Qiang

    2015-08-01

    The tumor suppressor p53-mediated apoptotic response plays an important role in cisplatin resistant in ovarian cancer. The adenovirus (Ad) type 12 E1B 55-kDa protein binds to p53 and inactivates its transcriptional transactivation function. In this study, we test the hypothesis that Ad12 E1B 55-kDa oncoprotein promotes p53-mediated apoptotic response of ovarian cancer to cisplatin. First, we observed the upregulation protein level of p53 target genes in cisplatin-resistant or cisplatin-sensitive ovarian cancer by Western blotting. Second, after transfection of Ad12 E1b 55-kDa expression plasmid, the expressions of p53 target genes in A2780 cells were further enhanced. Co-IP experiment demonstrated Ad12 E1b 55 kDa associated with p53. MTT assay confirmed that the cell proliferation was enhanced after transfection, as well as the enhanced cell inhibitory rate in the presence of cisplatin. Using flow cytometry, transfection of Ad12 E1B 55-kDa protein induced apoptosis and promoted S-phase transition in proliferation. Finally, results showed that all these changes promoted by Ad12 E1b 55 kDa were attenuated by the exposure of specific inhibitor of p53 signaling, pifithrin-α. Taken together, we concluded that Ad E1B 55-kDa oncoprotein promotes p53-mediated apoptotic response of ovarian cancer to cisplatin.

  13. 基于Delta-s的高速果奶装箱机器人工程示范%Demonstration project of high-speed robot packing fruit milk based on the Delta-s

    Institute of Scientific and Technical Information of China (English)

    刘凤臣; 陈凯; 张良安; 尤晨; 周东; 刘黎明; 冯进友

    2011-01-01

    This paper focus on the practical application of the Delta-s robot on the fruit milk packing machine, including its system layout and functional requirements, gripper design based on Delta-S robot, software design and engineering practice. Based on the analysis of the basic design, this paper selects filling stations to make a specific analysis. The results showed that the application of the Delta-s robot on the fruit milk packing machine made a substantial increase in the level of automation and speed of packing! Which proved the application of the Delta-s robot on the industrial production line had very good prospects.%研究Delta-S机器人在果奶装箱机上的工程示范应用,包括其系统布局及功能要求及Delta-S机器人的抓取器设计、软件设计和工程实践等问题.在基本设计分析的基础上,选取装填工位做具体分析.分析结果表明,Delta-S机器人在高速果奶装箱机上的应用使得装箱自动化水平和速度都大幅提高,进一步说明Delta-S机器人在工业生产线上的应用具有很好的应用前景.

  14. Delta isobars in relativistic mean-field models with $\\sigma$-scaled hadron masses and couplings

    CERN Document Server

    Kolomeitsev, E E; Voskresensky, D N

    2016-01-01

    We extend the relativistic mean-field models with hadron masses and meson-baryon coupling constants dependent on the scalar $\\sigma$ field, studied previously to incorporate $\\Delta(1232)$ baryons. Available empirical information is analyzed to put constraints on the couplings of $\\Delta$s with meson fields. Conditions for the appearance of $\\Delta$s are studied. We demonstrate that with inclusion of the $\\Delta$s our equations of state continue to fulfill majority of known empirical constraints including the pressure-density constraint from heavy-ion collisions, the constraint on the maximum mass of the neutron stars, the direct Urca and the gravitational-baryon mass ratio constraints.

  15. Architecture of a Coarse-Grained Upper Middle Cambrian Alluvial Delta Dominated by Braidplain and Gilbert-Style Delta Components

    Science.gov (United States)

    Pound, K. S.

    2014-12-01

    The ~500-m thick upper Middle Cambrian Lockett Conglomerate was deposited as part of an alluvial delta that includes Gilbert-type mega-crossbeds as well as braidplain conglomerates, and was constructed across an accretionary prism. Internal Lockett Conglomerate architecture indicates at least three phases of progradation are recorded by Gilbert-type, delta-front deposits that are separated by delta-top distributaries and/or braidplain deposits, all of which form discontinuous sheets and lenses, and record aggradation. Evaluation of sedimentary features (particle size and organization, bedding features) allows identification of eight facies within the Lockett Conglomerate; sedimentary features were used to infer transportational and depositional mechanisms. Conglomerate facies HL-1 - HL-8 were assigned to one or more of the following depositional associations: Beachface/shoreface, Deltafront, Alluvial fan, Braidplain (fluvial, unchannelized), Delta-top distributaries, and Mouth-bars. A series of Depositional Packages was identified, and mapped; integration with measured sections allowed development of a facies model for an alluvial delta in which the subaerial component is dominated by the braidplain association, and the subaqueous component by the (Gilbert-type) deltafront association as well as the delta-top distributary and mouthbar associations. Locally, the beachface association marks the transition between the subaqueous and subaerial components of the alluvial delta. Alluvial fan deposits are absent, but the rounded pebbles, cobbles and boulders with a new and distinctive provenance signature indicate derivation from a newly exposed igneous and metamorphic basement, and abrasion during transport through the fluvial (braidplain) system prior to deposition as part of the alluvial delta.

  16. A Conceptual Framework for Analyzing Deltas as Coupled Social-Ecological Systems: An example from the Amazon Delta

    Science.gov (United States)

    Brondizio, E.; Vogt, N. D.; Hetrick, S.; da Costa, S. M. F.; Anthony, E.

    2015-12-01

    At the nexus of watersheds, land, coastal areas, oceans, and human settlements, river delta regions pose specific challenges to environmental governance and sustainability. Using the Amazon Delta (AD) as our focus we reflect on the challenges created by the high degree of functional interdependencies shaping social-ecological dynamics of delta regions. The article introduces the initial design of an integrated conceptual framework to analyze delta regions as coupled social-ecological systems (SES). The first component of the framework is used to provide integrated definitions of delta regions according to a problem and/or collective action dilemma. Five different systematic components are suggested: social-economic systems, governance systems, ecosystems-resource systems, topographic-hydrological systems, and oceanic-climate systems. The second component of the framework presents a strategy for nested social ecological analysis to examine collective action situations in delta regions from local to regional and basin levels. The article provides illustrative applications of the framework to the Amazon Delta. First, it is used to define the AD region as a coupled, multi-level SES. We further proposed a definition of what we call the core SES of the AD. We then utilize the framework to diagnose an example collective action problem related to the impacts of urban growth and pollution on small-scale fishing resources. We argue that the functional interdependencies characteristic of delta regions require new approaches to understand, diagnose, and evaluate the current and future impact of social and environmental changes and potential solutions to the sustainability dilemmas characteristic of these regions.

  17. Intranuclear targeting and nuclear export of the adenovirus E1B-55K protein are regulated by SUMO1 conjugation

    OpenAIRE

    Kindsmüller, Kathrin; Groitl, Peter; Härtl, Barbara; Blanchette, Paola; Hauber, Joachim; Dobner, Thomas

    2007-01-01

    We have investigated the requirements for CRM1-mediated nuclear export and SUMO1 conjugation of the adenovirus E1B-55K protein during productive infection. Our data show that CRM1 is the major export receptor for E1B-55K in infected cells. Functional inactivation of the E1B-55K CRM1-dependent nuclear export signal (NES) or leptomycin B treatment causes an almost complete redistribution of the viral protein from the cytoplasm to the nucleus and its accumulation at the periphery of the viral re...

  18. H20-20 E1远端模块在调度系统中的应用

    Institute of Scientific and Technical Information of China (English)

    欧阳雪松; 陈立新

    2005-01-01

    文章主要针对H20-20交换机系统下的E1远端模块进行了详细的描述,阐述E1远端模块的性能特点和联接方式.重点介绍了E1远端模块在电力调度系统中的实际应用,以及在和PDH/SDH设备联接时时钟同步问题的解决方案.

  19. CYP2E1 Pst Ⅰ/Rsa Ⅰ polymorphism and colorectal cancer risk:A meta-analysis

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM:To clarify the association between CYP2E1 PstⅠ/RsaⅠ polymorphism and susceptibility to colorectal cancer.METHODS:A meta-analysis based on 10 eligible casecontrol studies involving 4979 cases and 6012 controls was carried out to summarize the data on the association between CYP2E1 RsaⅠ/PstⅠ polymorphism and colorectal cancer risk.RESULTS:In comparison of the homozygote c2c2 and c2 carriers(c1c2 + c2c2) and the homozygous wild-type genotype(c1c1),no association was found between CYP2E1 RsaⅠ/PstⅠ polymorph...

  20. High-yield expression in Escherichia coli and purification of mouse ubiquitin-activating enzyme E1.

    Science.gov (United States)

    Carvalho, Andreia F; Pinto, Manuel P; Grou, Cláudia P; Vitorino, Rui; Domingues, Pedro; Yamao, Fumiaki; Sá-Miranda, Clara; Azevedo, Jorge E

    2012-07-01

    Research in the ubiquitin field requires large amounts of ubiquitin-activating enzyme (E1) for in vitro ubiquitination assays. Typically, the mammalian enzyme is either isolated from natural sources or produced recombinantly using baculovirus/insect cell protein expression systems. Escherichia coli is seldom used to produce mammalian E1 probably due to the instability and insolubility of this high-molecular mass protein. In this report, we show that 5-10 mg of histidine-tagged mouse E1 can be easily obtained from a 1 l E. coli culture. A low temperature during the protein induction step was found to be critical to obtain an active enzyme.