WorldWideScience

Sample records for deinococcus radiodurans viewed

  1. in Deinococcus radiodurans

    STORAGESEVER

    2010-05-10

    May 10, 2010 ... from oxidation during irradiation (Daly et al., 2007; 2009). According to the first .... radiodurans R1 for bioprecipitation of Uranium from dilute nuclear waste. ... Eide DJ (1998). The molecular biology of metal ion transport in.

  2. Non-coding RNA in Deinococcus radiodurans

    Chen Zhongzhong; Wang Liangyan; Lin Jun; Tian Bing; Hua Yuejin

    2006-01-01

    Researches on DNA damage and repair pathways of Deinococcus radiodurans show its extreme resistance to ionizing radiation, ultraviolet radiation and reactive oxygen species. Non-coding (ncRNA) RNAs are involved in a variety of processes such as transcriptional regulations, RNA processing and modification, mRNA translation, protein transportation and stability. The conserved secondary structures of intergenic regions of Deinococcus radiodurans R1 were predicted using Stochastic Context Free Grammar (SCFG) scan strategy. Results showed that 28 ncRNA families were present in the non-coding regions of the genome of Deinococcus radiodurans R1. Among these families, IRE is the largest family, followed by Histone3, tRNA, SECIS. DicF, ctRNA-pGA1 and tmRNA are one discovered in bacteria. Results from the comparison with other organisms showed that these ncRNA can be applied to the study of biological function of Deinococcus radiodurans and supply reference for the further study of DNA damage and repair mechanisms of this bacterium. (authors)

  3. Research progress on polar lipids of deinococcus radiodurans

    Feng Qiong; Tian Bing; Hua Yuejin

    2013-01-01

    Deinococcus radiodurans is extremely resistant to radiation, desiccation, oxidizing agents and other extreme conditions. One of the unique lipids in Deinococcus radiodurans is the polar lipid phosphoglycolipid with alkylamine as the main component. Alkylamine derived from fatty acids. The composition characteristic of lipids is one of the classification criterias of Deinococcus. This article provided an overview of the main features of the Deinococcus radiodurans and introduced special polar lipids that have been found as well as the taxonomy significances of such lipids. The research progress of the relationship between lipids and their resistance mechanisms and the prospects of special lipids in Deinococcus radidurans have also been discussed. (authors)

  4. Repair of DNA damage in Deinococcus radiodurans

    Evans, D.M.

    1984-01-01

    The repair of DNA lesions in Deinococcus radiodurans was examined with particular reference to DNA excision repair of ultraviolet light (UV) induced pyrimidine dimers. The characteristics of excision repair via UV endonucleases α and β in vivo varied with respect to (a) the substrate range of the enzymes, (b) the rate of repair of DNA damage (c) the requirement for a protein synthesised in response to DNA damage to attenuate exonuclease action at repairing regions. UV endonuclease α is postulated to incise DNA in a different manner from UV endonuclease β thus defining the method of subsequent repair. Several DNA damage specific endonuclease activities independent of α and β are described. Mutations of the uvsA, uvsF and uvsG genes resulted in an increase in single-strand breaks in response to DNA damage producing uncontrolled DNA degradation. Evidence is presented that these genes have a role in limiting the access of UV endonuclease β to DNA lesions. uvsF and uvsG are also shown to be linked to the mtoA gene. Mutation of uvsH and reo-1 produces further distinct phenotypes which are discussed. An overall model of excision repair of DNA damage in Deinococcus radiodurans is presented. (author)

  5. Isolation and properties of plasmids from Deinococcus radiodurans Sark

    Sjarief, S.H.; Kikuchi, Masahiro; Kurita, Hiromi; Kitayama, Shigeru; Watanabe, Hiroshi.

    1990-05-01

    Radioresistant bacterium, Deinococcus radiodurans, can repair completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 kGy. In order to reveal the repair mechanism, it is necessary to develop a cloning vector available for the genetic analysis. We tried to isolate plasmids from D.radiodurans Sark strain. In the present paper the isolation and properties of plasmids were described. (author)

  6. Small-molecule antioxidant proteome-shields in Deinococcus radiodurans.

    Michael J Daly

    2010-09-01

    Full Text Available For Deinococcus radiodurans and other bacteria which are extremely resistant to ionizing radiation, ultraviolet radiation, and desiccation, a mechanistic link exists between resistance, manganese accumulation, and protein protection. We show that ultrafiltered, protein-free preparations of D. radiodurans cell extracts prevent protein oxidation at massive doses of ionizing radiation. In contrast, ultrafiltrates from ionizing radiation-sensitive bacteria were not protective. The D. radiodurans ultrafiltrate was enriched in Mn, phosphate, nucleosides and bases, and peptides. When reconstituted in vitro at concentrations approximating those in the D. radiodurans cytosol, peptides interacted synergistically with Mn(2+ and orthophosphate, and preserved the activity of large, multimeric enzymes exposed to 50,000 Gy, conditions which obliterated DNA. When applied ex vivo, the D. radiodurans ultrafiltrate protected Escherichia coli cells and human Jurkat T cells from extreme cellular insults caused by ionizing radiation. By establishing that Mn(2+-metabolite complexes of D. radiodurans specifically protect proteins against indirect damage caused by gamma-rays delivered in vast doses, our findings provide the basis for a new approach to radioprotection and insight into how surplus Mn budgets in cells combat reactive oxygen species.

  7. The characteristics of micrococcus (deinococcus) radiodurans sark plasmids

    Sjarief, Sri Hariani; Kikuchi, Masahiro; Watanabe, Hiroshi.

    1994-01-01

    The characterization of micrococcus (deinococcus) radiodurans sark plasmids. This bacterium has been classified as a new genus deinococcus radiodurans which is resistant to gamma-rays. It can repair itself completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 KGy. To reveal the repair mechanism, several investigations had been done to develop a cloning vector available for the genetic analysis. For this purpose D. radiodurans Sark are to be prepared as a vector by studying the characteristics of its plasmid. Plasmids were isolated by electrophoresis using 0.6% low-melting-temperature agarose in TAE and run for 5.5 hours, followed by the identification. An antibiotic marker was also carried out in this experiment to identify its location in the genetic materials of the cell, beside making a restriction map of the plasmid. Results have shown that D. radiodurans Sark has 4 plasmids (P1, P2, P3, and P4) and the refampicin resistant genes were not found in the plasmid. (authors). 14 refs; 4 figs

  8. Characterization of the radioresistance in the radioresistant bacterium deinococcus radiodurans

    Kong Xiangrong; Du Zeji

    1999-01-01

    The radioresistance of wild type Deinococcus radiodurans KD8301 and the factors affecting the radioresistance were investigated. KH3111 which was a DNA repair mutant of KD8301 (Zeji Du, 1998) was used to be compared with KD8301. Deinococcus radiodurans was discovered by Anderson et al (1956) in X-ray sterilized canned meat that was found to have undergone spoilage. this bacterium and other species of this genus share extreme resistance to ionizing radiation and other agents that damage DNA. Wild type KD8301 and its sensitive mutant KH3111 were irradiated with 60 Co γ-ray at the dose range 0.5 ∼ 10 kGy. Dose-survival fraction curves were made and the radio resistances were determined by LD 99 . The relative contents of DNA in cells were measured by Fluorescence Spectrophotometry (Freedman and Bruce, 1971). The results indicated that wild type KD8301 possesses more radioresistant than its mutant KH3111, LD99 were 9.5 kGy and 2.4 kGy respectively. KD8301 grown at exponential phase showed a decreased resistance to radiation, and the LD99 was 5.1 kGy. No differences of DNA/protein in cells were found between the exponential phase and the stationary phase. The results could be concluded that wild type KD8301 possesses remarkable radioresistance, but this ability was decreased or disappeared after mutation (in KH3111). None DNA relative content other than the growth stages were determinant factors of radioresistance in Deinococcus radiodurans. This results were different from other report (Dickie N et al, 1990). The cellular mechanisms might be the deference's of the bacterium cell morphology between the exponential phase and the stationary phase. Recently, the mutation site of KH3111 which was mutated chemically from wild type KD8301 was identified (Zeji Du, 1998). One base pair changed in the novel gene pprA which was isolated from KD8301 genomic DNA. This point mutation was confirmed to be responsible for the sensitivity of KH3111 to γ-ray and other DNA

  9. Deciphering peculiar protein-protein interacting modules in Deinococcus radiodurans

    Barkallah Insaf

    2009-04-01

    Full Text Available Abstract Interactomes of proteins under positive selection from ionizing-radiation-resistant bacteria (IRRB might be a part of the answer to the question as to how IRRB, particularly Deinococcus radiodurans R1 (Deira, resist ionizing radiation. Here, using the Database of Interacting Proteins (DIP and the Protein Structural Interactome (PSI-base server for PSI map, we have predicted novel interactions of orthologs of the 58 proteins under positive selection in Deira and other IRRB, but which are absent in IRSB. Among these, 18 domains and their interactomes have been identified in DNA checkpoint and repair; kinases pathways; energy and nucleotide metabolisms were the important biological processes that were found to be involved. This finding provides new clues to the cellular pathways that can to be important for ionizing-radiation resistance in Deira.

  10. Characterization of radiation-induced proteins in Deinococcus radiodurans

    Tanaka, A.; Watanabe, H.; Nozawa, R.; Hu, Q.; Kitayama, S.

    1992-01-01

    Induction of proteins after gamma-irradiation in Deinococcus radiodurans were investigated. 10 proteins were induced and about 15 proteins were reduced after irradiation with 6kGy. These proteins were classified to four groups by responses to gamma-rays, UV light, mitomycin C(MMC) treatment and heating. Additional studies were carried out for the characterization of two induced proteins. One protein was induced by gamma-rays, UV light as well as heating. This protein appeared to be a glycoprotein from its reaction with lectin. From the amino acid sequences of N-terminal and internal region, it was found that this protein is homologous to EF-Tu protein of E. coli. Meanwhile the other protein was induced not only by gamma-rays but also by UV light and MMC treatment. This protein seems to be a new enzyme as it has no homology to the known proteins which have ever been analyzed. No accumulations of these two proteins were observed in radiation sensitive strain of D. radiodurans and in both of E. coli and Bacillus pumilus, suggesting that induction of these two proteins would be specific for high resistant strain. (author)

  11. Subterranean Microhabitat Dependent Intra Versus Extracellular Enzyme Secretion Capabilities of Deinococcus radiodurans

    Jayant Biswas

    2015-04-01

    Full Text Available Deinococcus radiodurans is one of the most yet discovered extremophilic microbe, the isolation of which from the various habitats of Kotumsar cave is always a matter of enticement to discover its ecological economics. In the present work we studied the intra versus extracellular alkaline protease and glucose isomerase secretion capabilities of Deinococcus radiodurans; KCB21, KCB50, KCB93 isolated from three distinct subterranean niches of Kotumsar cave. The selected niches/zones were the entrance zone, transient zone and the deep inner zone from where the soil sediments were collected to isolate the bacterial strains. The results revealed high extracellular alkaline protease activity from the Deinococcus radiodurans strain which was isolated from the deeper zones of the cave, whereas no such phenomenon was revealed for glucose isomerase. The possible reason for the obtained results has been discussed.

  12. Deinococcus radiodurans strain R1 contains N6-methyladenine in its genome

    Prasad, Bhaskar Jyoti; Sabnis, Ketaki; Deobagkar, Deepti D.; Deobagkar, Dileep N.

    2005-01-01

    Methylation of DNA is known to be involved in DNA repair mechanisms in bacteria. Deinococcus radiodurans strain R1 on exposure to high radiation undergoes significant DNA damage, which is repaired without mutations. However, the presence of modified nucleotides has not been reported in its genome. We report here the detection of N6-methyladenine in the genome of D. radiodurans strain R1 using immunochemical techniques. This N6-methyladenine is not a part of GATC restriction-modification system. D. radiodurans cell extract also exhibited a DNA adenine methyltransferase activity which was reduced in the early post-irradiation recovery phase

  13. Design and Construction of Deinococcus Radiodurans for Biodegradation of Organic Toxins at Radioactive DOE Waste Sites

    Daly, Michael J.; Wackett, Lawrence P.; Fredrickson, James K.

    2001-01-01

    Seventy million cubic meters of ground and three trillion liters of groundwater have been contaminated by leaking radioactive waste generated in the United States during the Cold War. A cleanup technology is being developed based on the extremely radiation resistant bacterium Deinococcus radiodurans that is being engineered to express bioremediating functions. Research aimed at developing D. radiodurans for organic toxin degradation in highly radioactive waste sites containing radionuclides, heavy metals, and toxic organic compounds was started by this group.Work funded by the existing grant has already contributed to eleven papers on the fundamental biology of D. radiodurans and its design for bioremediation of highly radioactive waste environments

  14. Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

    Zhu Cong; Guo Jiangfeng

    2008-01-01

    Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

  15. Identifying the Proteins that Mediate the Ionizing Radiation Resistance of Deinococcus Radiodurans R1

    Battista, John R

    2010-02-22

    The primary objectives of this proposal was to define the subset of proteins required for the ionizing radiation (IR) resistance of Deinococcus radiodurans R1, characterize the activities of those proteins, and apply what was learned to problems of interest to the Department of Energy.

  16. ParA encoded on chromosome II of Deinococcus radiodurans binds ...

    2013-07-22

    Jul 22, 2013 ... Introduction. Cell division ..... Subsequently, the level of total FtsZ (FtsZ + FtsZ-. YFP) in cells ... could affect the productive pattern of FtsZ localization and .... maintenance and disassembly of the Z ring. Nat. ... cation tolerance of plants sensitizes Deinococcus radiodurans ... metal shadowing and decoration.

  17. Whole cell Deinococcus radiodurans ameliorates salt stress in Indian mustard through pyrroloquinoline quinone

    Srivastava, A.K.; Jadhav, P.; Suprasanna, P.; Rajpurohit, Y.S.; Misra, H.S.

    2015-01-01

    Salinity stress is considered as one of the major abiotic stresses limiting crop productivity. A variety of symbiotic and non-symbiotic bacteria are currently being used worldwide with the aim to boost built-in defense system in plants. Deinococcus radiodurans is a highly desiccation and radiation tolerant bacterium which synthesizes PQQ (pyrroloquinoline quinone) that has been shown to have a versatile role in crop productivity and as a general stress response regulator in bacteria and mammals. PQQ also acts as scavenger of reactive oxygen species and hence, can module redox signaling, one of the major regulator of stress tolerance in plants. In view of this, present research was conducted to evaluate the potential of whole cell D. radiodurans for ameliorating salt stress in plants. The soil colonization with wild-type cells led to partial amelioration of salt stress. The PQQ mutant showed an intermediate phenotype between wild-type seedlings and those grown on non-colonized soils which confirmed that the effects are largely associated with PQQ. The differential phenotype was also correlated with ROS level and ABA accumulation. The flame photometry data showed that there was no significant reduction in water soluble Na + level in control plant and those treated with either wild-type or PQQ mutant. Further, the elevated levels of antioxidant enzymes and reduced ascorbate in the plants treated with bacterial cells indicated its positive role in oxidative stress management. Although, the exact molecular basis to these effects is yet to be understood, present findings support the use of whole cell D. radiodurans for managing the growth and productivity of Indian mustard in salt affected fields. (author)

  18. Effects of heavy ions on inactivation and DNA double strand breaks in Deinococcus radiodurans R1.

    Zimmermann, H; Schafer, M; Schmitz, C; Bucker, H

    1994-10-01

    Inactivation and double strand break (dsb) induction after heavy ion irradiation were studied in stationary phase cells of the highly radiation resistant bacterium Deinococcus radiodurans R1. There is evidence that the radiation sensitivity of this bacterium is nearly independent on energy in the range of up to 15 MeV/u for lighter ions (Ar). The responses to dsb induction for charged particles show direct relationship between increasing radiation dose and residual intact DNA.

  19. The three catalases in Deinococcus radiodurans: Only two show catalase activity.

    Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

    2016-01-15

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H2O2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H2O2 treatments, whereas ΔdrA0146 showed no change in its H2O2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H2O2, but DRA0146 does not have catalase activity and is not involved in the resistance to H2O2 stress. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Gene fusions with lacZ by duplication insertion in the radioresistant bacterium Deinococcus radiodurans

    Lennon, E.; Minton, K.W.

    1990-01-01

    Deinococcus radiodurans is the most-studied species of a eubacterial family characterized by extreme resistance to DNA damage. We have focused on developing molecular biological techniques to investigate the genetics of this organism. We report construction of lacZ gene fusions by a method involving both in vitro splicing and the natural transformation of D. radiodurans. Numerous fusion strains were identified by expression of beta-galactosidase. Among these fusion strains, several were inducible by exposure to the DNA-damaging agent mitomycin C, and four of the inducible fusion constructs were cloned in Escherichia coli. Hybridization studies indicate that one of the damage-inducible genes contains a sequence reiterated throughout the D. radiodurans chromosome. Survival measurements show that two of the fusion strains have increased sensitivity to mitomycin C, suggesting that the fusions within these strains inactivate repair functions

  1. Regulation of potassium dependent ATPase (kdp) operon of Deinococcus radiodurans.

    Dani, Pratiksha; Ujaoney, Aman Kumar; Apte, Shree Kumar; Basu, Bhakti

    2017-01-01

    The genome of D. radiodurans harbors genes for structural and regulatory proteins of Kdp ATPase, in an operon pattern, on Mega plasmid 1. Organization of its two-component regulatory genes is unique. Here we demonstrate that both, the structural as well as regulatory components of the kdp operon of D. radiodurans are expressed quickly as the cells experience potassium limitation but are not expressed upon increase in osmolarity. The cognate DNA binding response regulator (RR) effects the expression of kdp operon during potassium deficiency through specific interaction with the kdp promoter. Deletion of the gene encoding RR protein renders the mutant D. radiodurans (ΔRR) unable to express kdp operon under potassium limitation. The ΔRR D. radiodurans displays no growth defect when grown on rich media or when exposed to oxidative or heat stress but shows reduced growth following gamma irradiation. The study elucidates the functional and regulatory aspects of the novel kdp operon of this extremophile, for the first time.

  2. Investigation of DNA damage and repair mechanism using deinococcus radiodurans

    Lau How Mooi; Kikuchi, M.; Kobayashi, Y.; Narumi, I.; Watanabe, H.

    1997-01-01

    Deninococcus Radiodurans, formerly known as Micrococcus Radiodurans, is a popular bacterium because of its high resistance to damage by carcinogens such as ionizing radiation (Dean et. al. 1966; Kitayama and Matsuyama 1968) and UV radiation (Gasvon et. al., 1995; Arrange et. al. 1993). In this report, we investigated the high resistance to ionizing radiation by this bacterium. The bacteria had been exposed from I to 5 kGy of gamma radiation and then incubated in TGY medium to study their ability to repair the broken DNA. The repair time was measured by Pulse Field Gel Electrophoresis (PFGE) method. The repair time for each dose was determined. Also in order to ensure that the repair was perfect, the bacterium was subjected to a second exposure of ionizing radiation after it has fully repaired. It was found that the 'second' repair characteristic was similar to the first repair. This confirmed that the repair after the exposure to the ionizing radiation was perfect

  3. UvrD in Deinococcus radiodurans is optimized for processing G-quadruplex DNA

    Das, Anubrata; Misra, H.S.

    2015-01-01

    Deinococcus radiodurans R1 is a radiation resistant Gram-positive bacterium capable of tolerating very high doses of DNA-damaging agents such as gamma radiation (D10 ∼ 12kGy) desiccation (∼ 5% relative humidity), UVC radiation (D10 ∼ 800J/m 2 ) and hydrogen peroxide (40 mM). It achieves this by using a complex regulatory mechanism and novel proteins. Recently bioinformatic analysis showed several stretches of guanine runs in D.radiodurans genome, which could form G-quartets. The role of G-quartets in regulatory processes is well documented in various organisms. The presence of G -quartets in D. radiodurans means that there are regulatory or structural proteins which would bind to these elements. Several proteins are known to bind G-quartets. Finding the proteins which would bind to G4 DNA is difficult as no specific motifs are available for binding these elements. Also most of the known proteins that are shown to bind to G-quadruplex DNA are of eukaryotic nature. To overcome these challenges we defined a set of known G-quadruplex binding proteins and used a smith-waterman algorithm with our own scoring matrix to homologs of G-quadruplex binding proteins in D.radiodurans. Using bioinformatics analysis, we showed that UvrD (DR 1775) of D. radiodurans has ability to bind/translocate along G-quadruplex DNA, a novel feature in prokaryotes. The translocase activity of DR1775 is ATP specific and this ATPase activity is attenuated by ssDNA. Data supporting UvrD of D. radiodurans as a G-quadruplex DNA metabolizing proteins would be presented. (author)

  4. Heavy metals-bioremediation by highly radioresistant Deinococcus radiodurans biofilm prospective use in nuclear reactor decontamination

    Shukla, Sudhir K.; Subba Rao, T.

    2015-01-01

    Over the past few decades, rapid growth of chemical industries have enhanced the heavy metal contamination in water, thereby raising environmental concerns. In the nuclear power industry, decontamination procedure also generates radioactive heavy metal containing wastes. Radio-resistant Deinococcus radiodurans R1 is reported to be a potential candidate for the treatment of low active waste material. To use any bacterium for bioremediation purpose, knowledge about its biofilm production characteristics is a prerequisite. This is because biofilm-mediated bioremediation processes are more efficient as compared to processes mediated by their planktonic counterparts. However, so far there are no reports on the biofilm producing capability of D. radiodurans. We observed that tagging of D. radiodurans by a plasmid harbouring gfp and kan R conferred significant biofilm producing property to the bacterium. Chemical analysis of biofilm matrix components produced by D. radiodurans showed that the matrix consists primarily of proteins and carbohydrates with small amount of extracellular DNA (eDNA). Further, we studied the effect of Ca 2+ on D. radiodurans biofilm formation and it was observed that D. radiodurans biofilm formation was enhanced at higher concentrations of Ca 2+ . We investigated the capability of D. radiodurans biofilm to remove the heavy metals Co and Ni from synthetic waste streams. Results showed that Ca 2+ enhanced the bioremediation of both heavy metals (Co, Ni) by D. radiodurans biofilms in a highly significant manner. In the presence of 50 mM Ca 2+ 35% Co removal and 25% Ni removal was observed, when compared to biofilm grown in the absence of Ca 2+ , which showed mere 7% Co and 3% Ni removal, respectively. The results showed that the presence of Ca 2+ significantly enhanced exopolysaccharide and eDNA (both negatively charged) production in the biofilm matrix. This indicated adsorption could be the major mechanism behind enhanced biofilm mediated removal

  5. The three catalases in Deinococcus radiodurans: Only two show catalase activity

    Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

    2016-01-01

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H_2O_2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H_2O_2 treatments, whereas ΔdrA0146 showed no change in its H_2O_2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H_2O_2, but DRA0146 does not have catalase activity and is not involved in the resistance to H_2O_2 stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H_2O_2 resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

  6. The three catalases in Deinococcus radiodurans: Only two show catalase activity

    Jeong, Sun-Wook [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Lim, Heon-Man [Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Lim, Sangyong, E-mail: saylim@kaeri.re.kr [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of)

    2016-01-15

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H{sub 2}O{sub 2}) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H{sub 2}O{sub 2} treatments, whereas ΔdrA0146 showed no change in its H{sub 2}O{sub 2} resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H{sub 2}O{sub 2}, but DRA0146 does not have catalase activity and is not involved in the resistance to H{sub 2}O{sub 2} stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H{sub 2}O{sub 2} resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

  7. Design of Deinococcus radiodurans thioredoxin reductase with altered thioredoxin specificity using computational alanine mutagenesis

    Obiero, Josiah; Sanders, David AR

    2011-01-01

    In this study, the X-ray crystal structure of the complex between Escherichia coli thioredoxin reductase (EC TrxR) and its substrate thioredoxin (Trx) was used as a guide to design a Deinococcus radiodurans TrxR (DR TrxR) mutant with altered Trx specificity. Previous studies have shown that TrxRs have higher affinity for cognate Trxs (same species) than that for Trxs from different species. Computational alanine scanning mutagenesis and visual inspection of the EC TrxR–Trx interface suggested...

  8. High-resolution structure of the antibiotic resistance protein NimA from Deinococcus radiodurans

    Leiros, Hanna-Kirsti S.; Tedesco, Consiglia; McSweeney, Seán M.

    2008-01-01

    In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. Many anaerobic human pathogenic bacteria are treated using 5-nitroimidazole-based (5-Ni) antibiotics, a class of inactive prodrugs that contain a nitro group. The nitro group must be activated in an anaerobic one-electron reduction and is therefore dependent on the redox system in the target cells. Antibiotic resistance towards 5-Ni drugs is found to be related to the nim genes (nimA, nimB, nimC, nimD, nimE and nimF), which are proposed to encode a reductase that is responsible for converting the nitro group of the antibiotic into a nonbactericidal amine. A mechanism for the Nim enzyme has been proposed in which two-electron reduction of the nitro group leads to the generation of nontoxic derivatives and confers resistance against these antibiotics. The cofactor was found to be important in the mechanism and was found to be covalently linked to the reactive His71. In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. A planar cofactor is clearly visible and well defined in the electron-density map adjacent to His71, the identification of the cofactor and its properties are discussed

  9. Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

    Harris, Dennis R; Tanaka, Masashi; Saveliev, Sergei V; Jolivet, Edmond; Earl, Ashlee M; Cox, Michael M; Battista, John R

    2004-10-01

    The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

  10. Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

    Dennis R Harris

    2004-10-01

    Full Text Available The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

  11. Metabolic engineering of deinococcus radiodurans based on computational analysis and functional genomics

    Edwards, Jeremy, S.

    2005-02-02

    The objective of our work is to develop novel computational tools to analyze the Deinococcus radiodurans DNA repair pathways and the influence of the metabolic flux distribution on DNA repair. These tools will be applied to provide insights for metabolic engineering of strains capable of growing under nutrient poor conditions similar to those found in mixed contaminant sites of interest to the DOE. Over the entire grant period we accomplished all our specific aims and were also able to pursue new directions of research. Below, I will list the major accomplishments over the previous 3 years. (1) Performed Monte Carlo Simulations of RecA Mediated Pairing of Homologous DNA Molecules. (2) Developed a statistical approach to study the gene expression data from D. radiodurans. We have been studying the data from John Batista's. (3) Developed an expression profiling technology to generate very accurate and precise expression data. We followed up on results from John Batista's group using this approach. (4) Developed and put online a database for metabolic reconstructions. (5) We have developed and applied new Monte Carlo algorithms that are optimized for studying biological systems. (6) We developed a flux balance model for the D. radiodurans metabolic network

  12. Impact of low-temperature plasmas on Deinococcus radiodurans and biomolecules

    Mogul, Rakesh; Bol'shakov, Alexander A.; Chan, Suzanne L.; Stevens, Ramsey M.; Khare, Bishun N.; Meyyappan, M.; Trent, Jonathan D.

    2003-01-01

    The effects of cold plasma on Deinococcus radiodurans, plasmid DNA, and model proteins were assessed using microbiological, spectrometric, and biochemical techniques. In low power O(2) plasma (approximately 25 W, approximately 45 mTorr, 90 min), D. radiodurans, a radiation-resistant bacterium, showed a 99.999% reduction in bioburden. In higher power O(2) plasma (100 W and 500 mTorr), the reduction rate increased about 10-fold and observation by atomic force microscopy showed significant damage to the cell. Damage to cellular lipids, proteins, and chromosome was indicated by losses of infrared spectroscopic peaks at 2930, 1651, 1538, and 1245 cm(-1), respectively. In vitro experiments show that O(2) plasmas induce DNA strand scissions and cross-linking as well as reduction of enzyme activity. The observed degradation and removal of biomolecules was power-dependent. Exposures to 200 W at 500 mTorr removed biomolecules to below detection limits in 60 s. Emission spectroscopy indicated that D. radiodurans cells were volatilized into CO(2), CO, N(2), and H(2)O, confirming that these plasmas were removing complex biological matter from surfaces. A CO(2) plasma was not as effective as the O(2) plasma, indicating the importance of plasma composition and the dominant role of chemical degradation. Together, these findings have implications for NASA planetary protection schemes and for the contamination of Mars.

  13. The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.

    J Scott Lockhart

    Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.

  14. Comparative genomics of Thermus thermophilus and Deinococcus radiodurans: divergent routes of adaptation to thermophily and radiation resistance

    Daly Michael J

    2005-10-01

    Full Text Available Abstract Background Thermus thermophilus and Deinococcus radiodurans belong to a distinct bacterial clade but have remarkably different phenotypes. T. thermophilus is a thermophile, which is relatively sensitive to ionizing radiation and desiccation, whereas D. radiodurans is a mesophile, which is highly radiation- and desiccation-resistant. Here we present an in-depth comparison of the genomes of these two related but differently adapted bacteria. Results By reconstructing the evolution of Thermus and Deinococcus after the divergence from their common ancestor, we demonstrate a high level of post-divergence gene flux in both lineages. Various aspects of the adaptation to high temperature in Thermus can be attributed to horizontal gene transfer from archaea and thermophilic bacteria; many of the horizontally transferred genes are located on the single megaplasmid of Thermus. In addition, the Thermus lineage has lost a set of genes that are still present in Deinococcus and many other mesophilic bacteria but are not common among thermophiles. By contrast, Deinococcus seems to have acquired numerous genes related to stress response systems from various bacteria. A comparison of the distribution of orthologous genes among the four partitions of the Deinococcus genome and the two partitions of the Thermus genome reveals homology between the Thermus megaplasmid (pTT27 and Deinococcus megaplasmid (DR177. Conclusion After the radiation from their common ancestor, the Thermus and Deinococcus lineages have taken divergent paths toward their distinct lifestyles. In addition to extensive gene loss, Thermus seems to have acquired numerous genes from thermophiles, which likely was the decisive contribution to its thermophilic adaptation. By contrast, Deinococcus lost few genes but seems to have acquired many bacterial genes that apparently enhanced its ability to survive different kinds of environmental stresses. Notwithstanding the accumulation of

  15. Laboratory simulation of interplanetary ultraviolet radiation (broad spectrum) and its effects on Deinococcus radiodurans

    Paulino-Lima, Ivan Gláucio; Pilling, Sérgio; Janot-Pacheco, Eduardo; de Brito, Arnaldo Naves; Barbosa, João Alexandre Ribeiro Gonçalves; Leitão, Alvaro Costa; Lage, Claudia de Alencar Santos

    2010-08-01

    The radiation-resistant bacterium Deinococcus radiodurans was exposed to a simulated interplanetary UV radiation at the Brazilian Synchrotron Light Laboratory (LNLS). Bacterial samples were irradiated on different substrates to investigate the influence of surface relief on cell survival. The effects of cell multi-layers were also investigated. The ratio of viable microorganisms remained virtually the same (average 2%) for integrated doses from 1.2 to 12 kJ m -2, corresponding to 16 h of irradiation at most. The asymptotic profiles of the curves, clearly connected to a shielding effect provided by multi-layering cells on a cavitary substrate (carbon tape), means that the inactivation rate may not change significantly along extended periods of exposure to radiation. Such high survival rates reinforce the possibility of an interplanetary transfer of viable microbes.

  16. Bioprecipitation of uranium from alkaline waste solutions using recombinant Deinococcus radiodurans

    Kulkarni, Sayali; Ballal, Anand; Apte, Shree Kumar, E-mail: aptesk@barc.gov.in

    2013-11-15

    Highlights: • Deinococcus radiodurans was genetically engineered to overexpress alkaline phosphatase (PhoK). • Deino-PhoK bioprecipitated U efficiently over a wide range of input U concentration. • A maximal loading of 10.7 g U/g of biomass at 10 mM input U was observed. • Radioresistance and U precipitation by Deino-PhoK remained unaffected by γ radiation. • Immobilization of Deino-PhoK facilitated easy separation of precipitated U. -- Abstract: Bioremediation of uranium (U) from alkaline waste solutions remains inadequately explored. We engineered the phoK gene (encoding a novel alkaline phosphatase, PhoK) from Sphingomonas sp. for overexpression in the radioresistant bacterium Deinococcus radiodurans. The recombinant strain thus obtained (Deino-PhoK) exhibited remarkably high alkaline phosphatase activity as evidenced by zymographic and enzyme activity assays. Deino-PhoK cells could efficiently precipitate uranium over a wide range of input U concentrations. At low uranyl concentrations (1 mM), the strain precipitated >90% of uranium within 2 h while a high loading capacity of around 10.7 g U/g of dry weight of cells was achieved at 10 mM U concentration. Uranium bioprecipitation by Deino-PhoK cells was not affected in the presence of Cs and Sr, commonly present in intermediate and low level liquid radioactive waste, or after exposure to very high doses of ionizing radiation. Transmission electron micrographs revealed the extracellular nature of bioprecipitated U, while X-ray diffraction and fluorescence analysis identified the precipitated uranyl phosphate species as chernikovite. When immobilized into calcium alginate beads, Deino-PhoK cells efficiently removed uranium, which remained trapped in beads, thus accomplishing physical separation of precipitated uranyl phosphate from solutions. The data demonstrate superior ability of Deino-PhoK, over earlier reported strains, in removal of uranium from alkaline solutions and its potential use in

  17. Imposed Environmental Stresses Facilitate Cell-Free Nanoparticle Formation by Deinococcus radiodurans.

    Chen, Angela; Contreras, Lydia M; Keitz, Benjamin K

    2017-09-15

    The biological synthesis of metal nanoparticles has been examined in a wide range of organisms, due to increased interest in green synthesis and environmental remediation applications involving heavy metal ion contamination. Deinococcus radiodurans is particularly attractive for environmental remediation involving metal reduction, due to its high levels of resistance to radiation and other environmental stresses. However, few studies have thoroughly examined the relationships between environmental stresses and the resulting effects on nanoparticle biosynthesis. In this work, we demonstrate cell-free nanoparticle production and study the effects of metal stressor concentrations and identity, temperature, pH, and oxygenation on the production of extracellular silver nanoparticles by D. radiodurans R1. We also report the synthesis of bimetallic silver and gold nanoparticles following the addition of a metal stressor (silver or gold), highlighting how production of these particles is enabled through the application of environmental stresses. Additionally, we found that both the morphology and size of monometallic and bimetallic nanoparticles were dependent on the environmental stresses imposed on the cells. The nanoparticles produced by D. radiodurans exhibited antimicrobial activity comparable to that of pure silver nanoparticles and displayed catalytic activity comparable to that of pure gold nanoparticles. Overall, we demonstrate that biosynthesized nanoparticle properties can be partially controlled through the tuning of applied environmental stresses, and we provide insight into how their application may affect nanoparticle production in D. radiodurans during bioremediation. IMPORTANCE Biosynthetic production of nanoparticles has recently gained prominence as a solution to rising concerns regarding increased bacterial resistance to antibiotics and a desire for environmentally friendly methods of bioremediation and chemical synthesis. To date, a range of organisms

  18. FtsZ from radiation resistant bacterium Deinococcus radiodurans is different from its characterized homologues

    Mehta, Kruti P.; Misra, H.S.

    2012-01-01

    Polymerization/depolymerization dynamics of FtsZ and its GTPase activity are interdependent and the regulation of these processes determines the growth rate in a bacterium. Deinococcus radiodurans R1 that is best known for its extraordinary radiation resistance and efficient DNA double strand break repair is a comparatively slow growing bacterium and its growth gets arrested in response to gamma radiation. Mechanisms of cell division and its regulation under gamma stressed growth condition would be worth investigating. Genome of this bacterium encodes at least all the known components of divisome. Recombinant FtsZ of D. radiodurans (drFtsZ) preferred Mg 2+ for its GTPase activity. Relatively a very low GTPase activity was observed in presence of Mn 2+ , Co 2+ and Ni 2+ while release of inorganic phosphate could not be detected in presence of other divalent ions including Ca 2+ . GTPase activity of drFtsZ was lower than E. coli but higher than Mycobacterium and it required both Mg 2+ and GTP for its polymerization. Its GTPase activity did not increase with increasing concentration of Mg 2+ and correlates with the bundling of protofilaments. Results obtained from transmission electron microscopy and sedimentation analysis supported the reciprocal correlation of polymerization/depolymerization with the levels of GTPase activity. Dynamic light scattering in presence of 5mM or higher concentration of Mg 2+ and Mn 2 showed a characteristic cyclic change in light scattering without addition of extra metal ion or GTP

  19. Involvement of recQ in the ultraviolet damage repair pathway in Deinococcus radiodurans

    Hua Xiaoting; Huang Lifen; Tian Bing; Hua Yuejin

    2008-01-01

    Deinococcus radiodurans is a bacterium which can survive extremely DNA damage. To investigate the relationship between recQ and the ultraviolet radiation (UV) damage repair pathway, we created a four mutant strain by constructing recQ knockout mutants in uvrA1, uvrA2, and uvsE backgrounds. Using the rpoB/Rif r system, we measured the mutation frequencies and rates in wild type, recQ (MQ), uvsE uvrA1 uvrA2 (TNK006), and uvsE uvrA1 uvrA2 recQ (TQ). We then isolated Rif r mutants of these strains and sequenced the rpoB gene. The mutation frequency of TQ was 6.4, 10.1, and 2.43 times that of wild type, MQ, and TNK006, respectively, and resulted in rates of 4.7, 6.71, and 2.15 folds higher than that of wild type, MQ, and TNK006, respectively. All the strains demonstrated specific mutational hotspots. Furthermore, the TQ strain showed a transversion bias that was different from the other three strains. The results indicate that recQ is involved in the ultraviolet damage repair pathway via the interaction between recQ and uvrA1, uvrA2, and uvsE in D. radiodurans

  20. Influence of LET on repair of DNA damages in Deinococcus radiodurans

    Kobayashi, Y; Tanaka, A; Kikuchi, M; Shimizu, T; Watanabe, H [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Cao, J P; Taucher-Scholz, G

    1997-03-01

    Inactivation caused by heavy ions was studied in dry cells of radioresistant bacterium Deinococcus radiodurans. All survival curves were characterized by a large shoulder of the curves. No final slopes of the exponential part of survival curves for heavy ion irradiation were steeper than that for 2.0 MeV electron irradiation. The plots of RBE versus LET showed no obvious peaks, suggesting that this bacterium can repair not only DNA double strand breaks (DSBs) but also clustered damage in DNA which may be induced by heavy ions. The genomic DNA of D. radiodurans was cleaved into large fragments with restriction enzyme Not I after post-irradiation incubation and the fragments were separated using pulsed-field gel electrophoresis (PFGE). DSBs induction and rejoining process were analyzed by detection of the reappearance of ladder pattern of DNA fragments. The required repair time after heavy ions irradiation was longer than the repair time for electrons at the same dose of irradiation, however, the rate of repair enzyme induction was almost similar to each other between electrons and heavy ions, suggesting that the same repair system is likely to be used after both low and high LET irradiations. (author)

  1. Gel-based proteomic approach to unravel the extreme radiation resistance of deinococcus radiodurans

    Basu, Bhakti; Apte, Shree Kumar

    2013-01-01

    The extremophile, Deinococcus radiodurans, is endowed with an extraordinary DNA repair ability and oxidative stress alleviation mechanisms that render it virtually resistant to all types of DNA damaging stressors such as ionizing radiations, UV or years of desiccation. Following DNA damage, the microbe reassembles its complete genome from multiple DNA fragments with impeccable fidelity. The deinococcal genome encodes functional homologues of both prokaryotic and eukaryotic DNA repair pathways, such as RecFOR mediated homologous recombination (HR), nucleotide/base excision repair (NER/BER), strand annealing (SA) and non-homologous end joining (NHEJ), but lacks homologues for universal prokaryotic DNA repair pathways such as RecBCD mediated HR, photo-reactivation and SOS response. It also harbors multiple enzymatic and non-enzymatic oxidative stress defense mechanisms. Proteomic approaches were employed to study the response of D. radiodurans to LD50 dose of gamma irradiation during the post-irradiation growth arrest phase by two dimensional protein electrophoresis coupled with mass spectrometry to reveal kinetics and dynamics of DNA repair, oxidative stress alleviation and resynthesis of damaged proteins, preceding growth recovery

  2. PprA phosphorylation by STPK of Deinococcus radiodurans changes its in vitro functions

    Rajpurohit, Yogendra S.; Misra, H.S.

    2011-01-01

    Deinococcus radiodurans shows amazing resistance to both ionizing and non-ionizing radiations. This phenotype is attributed also to its efficient DNA double strand breaks (DSB) repair capability of this bacterium. PprA (pleiotropic protein promoting DNA repair) is unique to D. radiodurans and its role in gamma radiation resistance and DSB repair has been shown in this bacterium. Recombinant PrA protects dsDNA from exonuclease degradation and stimulates the DNA ends joining activity of both T4 DNA ligase and E.coli NAD ligase in vitro. Phosphomotif search showed that PprA has putative phosphorylation site similar to that is characterized for Ser/Thr protein kinases in eukaryotic system. A eukaryotic type Ser/Thr protein kinase (DR2518) of D. radiodurans, could phosphorylate recombinant PprA at Thr amino acid in vitro and the phosphorylation of PprA was also observed in vivo. DR2518 kinase mediated protein phosphorylation of PprA, improves its DNA binding affinity by nearly four fold and stimulated T4 DNA ligase activity more towards intermolecular ligation, as compared to unphosphorylated PprA. Interestingly, the phospho-PprA showed lesser protection of dsDNA than unphospho-PprA when incubated with exonuclease III in solution. The putative Thr of PprA was replaced with Ala (T48A) by site directed mutagenesis, which resulted in significant reduction of PprA phosphorylation by DR2518 kinase. Detailed studies on PprA phosphorylation and its functional significance would be presented. (author)

  3. Synthesis and extracellular accumulation of silver nanoparticles by employing radiation-resistant Deinococcus radiodurans, their characterization, and determination of bioactivity

    Kulkarni RR

    2015-01-01

    Full Text Available Rasika R Kulkarni, Nayana S Shaiwale, Dileep N Deobagkar, Deepti D Deobagkar Molecular Biology Research Laboratory, Center of Advanced Studies, Department of Zoology, University of Pune, Pune, India Abstract: There has been rapid progress in exploring microorganisms for green synthesis of nanoparticles since microbes show extraordinary diversity in terms of species richness and niche localization. Microorganisms are easy to culture using relatively inexpensive and simple nutrients under varied conditions of temperature, pressure, pH, etc. In this work, Deinococcus radiodurans that possesses the ability to withstand extremely high radiation and desiccation stress has been employed for the synthesis of silver nanoparticles (AgNPs. D. radiodurans was able to accumulate AgNPs in medium under various conditions, and process optimization was carried out with respect to time, temperature, pH, and concentration of silver salt. AgNPs were characterized using UV/vis spectroscopy, scanning electron microscopy, transmission electron microscopy, X-ray diffraction, energy-dispersive X-ray spectroscopy, and Fourier transform infrared spectroscopy. The microbially synthesized AgNPs exhibited good antimicrobial activity against both Gram-negative and Gram-positive organisms and anti-biofouling activity. Their ability to inhibit growth and proliferation of cancer cell line was also examined, and it could be seen that AgNPs synthesized using D. radiodurans exhibited excellent anticancer activity. Keywords: Deinococcus radiodurans, silver nanoparticles, anticancer, radiation resistance, antibacterial, anti-biofouling 

  4. Cyclic AMP Receptor Protein Acts as a Transcription Regulator in Response to Stresses in Deinococcus radiodurans.

    Su Yang

    Full Text Available The cyclic AMP receptor protein family of transcription factors regulates various metabolic pathways in bacteria, and also play roles in response to environmental changes. Here, we identify four homologs of the CRP family in Deinococcus radiodurans, one of which tolerates extremely high levels of oxidative stress and DNA-damaging reagents. Transcriptional levels of CRP were increased under hydrogen peroxide (H2O2 treatment during the stationary growth phase, indicating that CRPs function in response to oxidative stress. By constructing all CRP single knockout mutants, we found that the dr0997 mutant showed the lowest tolerance toward H2O2, ultraviolet radiation, ionizing radiation, and mitomycin C, while the phenotypes of the dr2362, dr0834, and dr1646 mutants showed slight or no significant differences from those of the wild-type strain. Taking advantage of the conservation of the CRP-binding site in many bacteria, we found that transcription of 18 genes, including genes encoding chromosome-partitioning protein (dr0998, Lon proteases (dr0349 and dr1974, NADH-quinone oxidoreductase (dr1506, thiosulfate sulfurtransferase (dr2531, the DNA repair protein UvsE (dr1819, PprA (dra0346, and RecN (dr1447, are directly regulated by DR0997. Quantitative real-time polymerase chain reaction (qRT-PCR analyses showed that certain genes involved in anti-oxidative responses, DNA repair, and various cellular pathways are transcriptionally attenuated in the dr0997 mutant. Interestingly, DR0997 also regulate the transcriptional levels of all CRP genes in this bacterium. These data suggest that DR0997 contributes to the extreme stress resistance of D. radiodurans via its regulatory role in multiple cellular pathways, such as anti-oxidation and DNA repair pathways.

  5. Conservation of the LexA repressor binding site in Deinococcus radiodurans

    Khan Feroz

    2008-03-01

    Full Text Available The LexA protein is a transcriptional repressor of the bacterial SOS DNA repair system, which comprises a set of DNA repair and cellular survival genes that are induced in response to DNA damage. Its varied DNA binding motifs have been characterized and reported in the Escherichia coli, Bacillus subtilis, rhizobia family members, marine magnetotactic bacterium, Salmonella typhimurium and recently in Mycobacterium tuberculosis and this motifs information has been used in our theoretical analysis to detect its novel regulated genes in radio-resistant Deinococcus radiodurans genome. This bacterium showed presence of SOS-box like consensus sequence in the upstream sequences of 3166 genes with >60% motif score similarity percentage (MSSP on both strands. Attempts to identify LexA-binding sites and the composition of the putative SOS regulon in D. radiodurans have been unsuccessful so far. To resolve the problem we performed theoretical analysis with modifications on reported data set of genes related to DNA repair (61 genes, stress response (145 genes and some unusual predicted operons (21 clusters. Expression of some of the predicted SOS-box regulated operon members then was examined through the previously reported microarray data which confirm the expression of only single predicted operon i.e. DRB0143 (AAA superfamily NTPase related to 5-methylcytosine specific restriction enzyme subunit McrB and DRB0144 (homolog of the McrC subunit of the McrBC restriction modification system. The methodology involved weight matrix construction through CONSENSUS algorithm using information of conserved upstream sequences of eight known genes including dinB, tagC, lexA, recA, uvrB, yneA of B. subtilis while lexA and recA of D. radiodurans through phylogenetic footprinting method and later detection of similar conserved SOS-box like LexA binding motifs through both RSAT & PoSSuMsearch programs. The resultant DNA consensus sequence had highly conserved 14 bp SOS

  6. A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

    Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing, E-mail: tianbing@zju.edu.cn; Hua, Yuejin, E-mail: yjhua@zju.edu.cn

    2014-07-18

    Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H{sub 2}O{sub 2} and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H{sub 2}O{sub 2}) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H{sub 2}O{sub 2} stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans.

  7. A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

    Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing; Hua, Yuejin

    2014-01-01

    Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H 2 O 2 and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H 2 O 2 ) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H 2 O 2 stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans

  8. Reduction of Fe(III), Cr(VI), U(VI), and Tc(VII) by Deinococcus radiodurans R1

    Fredrickson, J.K.; Kostandarithes, H.M.; Li, S.W.; Plymake, A.E.; Daly, M.J.

    2000-01-01

    Deinococcus radiodurans is an exceptionally radiation-resistant microorganism capable of surviving acute exposures to ionizing radiation doses of 15,000 Gy and previously described as having a strictly aerobic respiratory metabolism. Under strict anaerobic conditions, D. radiodurans R1 reduced Fe(III)-nitrilotriacetic acid coupled to the oxidation of lactate to CO 2 and acetate but was unable to link this process to growth. D. radiodurans reduced the humic acid analog anthraquinone-2,6-disulfonate (AQDS) to its dihydroquinone form, AH 2 DS, which subsequently transferred electrons to the Fe(III) oxides hydrous ferric oxide and goethite via a previously described electron shuttle mechanism. D. radiodurans reduced the solid-phase Fe(III) oxides in the presence of either 0.1 mM AQDS or leonardite humic acids (2 mg ml -1 ) but not in their absence. D. radiodurans also reduced U(VI) and Tc(VII) in the presence of AQDS. In contrast, Cr(VI) was directly reduced in anaerobic cultures with lactate although the rate of reduction was higher in the presence of AQDS. The results are the first evidence that D. radiodurans can reduce Fe(III) coupled to the oxidation of lactate or other organic compounds. Also, D. radiodurans, in combination with humic acids or synthetic electron shuttle agents, can reduce U and Tc and thus has potential applications for remediation of metal- and radionuclide-contaminated sites where ionizing radiation or other DNA-damaging agents may restrict the activity of more sensitive organisms

  9. Effect of N+ beam exposure on superoxide dismutase and catalase activities and induction of Mn-SOD in Deinococcus radiodurans

    Song Daojun; Chen Ruolei; Shao Chunlin; Wu Lijun; Yu Zengliang

    2000-01-01

    Though bacteria of the radiation-resistant Deinococcus radiodurans have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced by these bacteria were measured, and the change of SOD and CAT activities by 20 keV N + beam exposure was examined. Their activities were increased by N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . The treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase in SOD activity was resulted from inducible activities of Mn-SOD in D. radiodurans AS1.633 by N + beam exposure. These results suggested that this bacteria possess inducible defense mechanisms against the deleterious effects of oxidisation

  10. Effect of N+ beam exposure on the activities of Mn-SOD and catalase in deinococcus radiodurans

    Song Daojun; Chen Ruolei; Wu Lifang; Li Hong; Yao JIanming; Shao Chunlin; Wu Lijun; Yu Zengliang

    2000-01-01

    Though the radiation-resistant bacteria Deinococcus radiodurans (D. radiodurans) have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced in bacteria (D. radiodurans AS1.633) and their change caused by 20 keV N'+ beam exposure were examined. Results showed that the activities of the enzymes were increased in the case of N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . In addition, the treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase of whole SOD activity resulted from inducible activities of Mn-SOD in (a sub-type) D. radiodurans AS1.633. These results suggested that these bacteria possess inducible defense mechanisms against the deleterious effects of oxidization

  11. Understanding the role of RecN in DSB repair pathway in Deinococcus radiodurans

    Pellegrino, S.

    2012-01-01

    Deinococcus radiodurans is a Gram-positive bacterium known for its extreme resistance to a broad variety of DNA damaging agents. Among these, Ionizing Radiations and desiccation are the most harmful for the cell, since they introduce breaks in the genome. Double Strand Breaks (DSB) are particularly hazardous for the cell and they need to be repaired very efficiently, in order to avoid mutations leading to altered, if not lethal, phenotypes. Homologous Recombination (HR) is the most efficient mechanism by which DSBs are repaired. D. radiodurans is able to completely restore its genome in only 3 hours, and it accomplishes the entire process through the RecFOR pathway. In order to be repaired, DSBs first need to be recognized. The protein believed to be responsible for this important step that takes place soon after the damage occurs in the cell, is RecN. RecN is recruited at the early stages of DNA repair and in vivo studies have demonstrated its propensity to localize to discrete foci. In vitro studies also suggest that RecN possesses a DNA end-joining activity previously observed for SMC proteins (such as cohesin), which are structurally related to RecN. Several structural studies have been carried out on the SMC-like protein, Rad50, but so far no structural information is available for RecN. The work presented here focused on the structural characterization of RecN and its constitutive domains. We obtained crystal structures of three partially overlapping constructs of RecN and Small Angle X-ray Scattering was performed on the individual domains and the full-length protein. The study of RecN in solution complemented our crystallographic study and enabled us to build a reliable, atomic model of the full-length protein. Mutations were designed and the mutant RecN proteins were produced in order to characterize the ATP hydrolysis activity of RecN, which is a conserved feature of this family of proteins. Extensive biochemical studies were carried out on wild-type and

  12. Molecular cloning and analysis of DNA repair gene from the radioresistant bacterium deinococcus radiodurans

    Du Zeji; Wang Mingsuo

    1998-12-01

    Deinococcus radiodurans (Dr) possesses a prominent ability to repair DNA injury induced by various DNA-damaging agents including mitomycin C (MC), ultraviolet light (UV) and ionizing radiation. A DNA repair mutant Dr KH3111 is a streptomycin resistant (Sm R ) derivative of KH311 which is generated by treatment with nitrosoguanidine and is sensitive to MC, 8-trimethyl-psoralen, UV and γ-ray irradiation. Gene affected by a mutation in the mutant is identified and its nucleotide sequence is determined. A complete open reading frame (ORF) which encompassed the KH3111 mutation region is found and tentatively designated as orf144b. The deduced amino acid (aa) sequence of orf144b consists of 284 aa and has no significant homology to other known proteins. The exact KH3111 mutation site is one nucleotide altered (G to A) in the sequence of orf144b in the mutant. The KH3111 mutation causes the substitution of Gly for Glu at aa position 149 of Orf144b. Survival measurements of a revertant KH3112 which was produced by transforming with DNA containing a part of the orf144b gene of KD8301 showed that the resistances to MC, UV and γ-ray in the revertant were fully restored at a level equal to the wild type. Thus, the orf144b gene required for the multiple-DNA-damaging agent resistance of Dr was designated with the name of pprA (Pleiotropic gene promoting DNA repair). This new gene can express in E. coli at very high level, and make the host E. coli resistant to MC, UV and γ-ray. The pprA gene does not express in normal Dr, but it can be induced to express by treatment with MC, UV and γ-ray. It was thought that the PprA polypeptide is a cytoplasmic protein because of the absence of characteristics found in the aa sequence of membrane proteins

  13. Identification of uvrA gene mutation sites in two mitomycin-sensitive deinococcus radiodurans strains

    Du Zeji; Kong Xianrong

    1999-01-01

    Deinococcus radiodurans (Dr) possesses a prominent ability to repair the DNA injury induced by various DNA- damaging agents including mitomycin C(MC), ultraviolet light (UV) and ionizing radiation. DNA damage resistance was restored in MC sensitive (MC s ) mutants 2621 and 3021 by transforming with DNAs of four cosmids clones derived from the gene library of strain KD8301 which showed the property of wild type phenotype to DNA-damaging agents. Gene affected by mutation (mtcA or mtcB) in both mutants was cloned and its nucleotide sequence was determined. The deduced amino acid (aa) sequence of Dr uvrA gene product consists of 1016 aa and shares homology with many bacterial UvrA proteins. The mutation sites in both mutants were identified by analyzing the polymerase chain reaction (PCR) fragments derived from the genomic DNA of the mutants. A 144-base pairs (bp) deletion including the start codon for the uvr A gene was observed in DNA of the mutant 3021, causing a defect in the gene. On the other hand, an insertion sequence (IS) element intervened in the uvrA gene of the mutant 2621, suggesting the insertional inactivation of the gene. The IS element comprise 1322-bp long, flanked by 19-bp inverted terminal repeats (ITR), and generated a 6-bp target duplication (TD). Two open reading frames (ORF) were found in the IS element. The deduced aa sequences of large and small ORF show homology to a putative transposes found in IS4 of Escherichia coli (E. coli) and to a resolvent found in IS Xc5 of Xanthomonas campestris (Xc), respectively. This is the first discovery of IS element in deino-bacteria, and the IS element was designated IS2621

  14. Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties

    Li J

    2016-11-01

    Full Text Available Jiulong Li,1,* Qinghao Li,1,* Xiaoqiong Ma,2,* Bing Tian,1 Tao Li,1 Jiangliu Yu,1 Shang Dai,1 Yulan Weng,1 Yuejin Hua1 1Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, 2Central Laboratory, The First Affiliated Hospital of Zhejiang Chinese Medical University, Hangzhou, China *These authors contributed equally to this work Abstract: Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III and biosynthesize gold nanoparticles (AuNPs was investigated in aqueous solution by ultraviolet and visible (UV/Vis absorption spectroscopy, electron microscopy, X-ray diffraction (XRD, dynamic light scattering (DLS, Fourier transform infrared spectroscopy (FTIR and X-ray photoelectron spectroscopy (XPS. D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III may be reduced to Au(I, and further reduced to Au(0 with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative (Escherichia coli and Gram-positive (Staphylococcus aureus bacteria by damaging their cytoplasmic membrane. Therefore, the extreme

  15. Repair of gamma radiation damage in wild type and a radiation sensitive mutant of Deinococcus radiodurans

    Mizuma, Nagayo

    1989-01-01

    In an effort to examine production and repair of radiation-induced single and double strand breaks in the DNA, a repair-deficient wild type and a repair-deficient mutant, UV17, of Deinococcus radiodurans were subjected to Co-60 gamma irradiation at a dose rate of 6.3 kGy/hr for wild type and 3.9 kGy/hr for UV17 mutant. The shoulder of the curve of UV17 mutant was narrow but existed with the intercept of 0.7 kGy and the corresponding value of the wild type was 4.2 kGy. Mutant cells exhibited about 6 fold increases in sensitivity for the shoulder relative to the wild type. The D 37 doses in the wild type and the mutant were 0.57 kGy and 0.25 kGy, respectively. From the survival curves, difference in the sensitivity between two strains was mainly due to difference of repair capacity than the number of radiation sensitive target. Sedimentation rate of the main component in the irradiated cells of UV17 mutant increased almost to the level of unirradiated control by the postincubation at 30deg C for 3 hrs. The results indicated that this sensitive mutant also exhibited an ability to restore single strand breaks after exposure to a sublethal dose of 0.6 kGy. When restitution of double strand breaks was analyzed by sedimentation in a neutral sucrose gradient, the wild type showed restitution to DNA-membrane complex from large part of the breaks. For UV17 mutant, the apparent increase in DNA-membrane complex formation was seen after 3 hours incubation. Large part of the decrease in the activities of peak 2 was recovered in the peak 1 for the wild type. For the mutant, there was little restitution to peak 1. Almost free DNA component in UV17 mutant, therefore, was merely degraded into shorter pieces. Restoration of DNA-membrane complex from free DNA derived from gamma-ray induced double strand scission involved closely in the repair of gamma-induced damage and survival. (N.K.)

  16. Structure determination of uracil-DNA N-glycosylase from Deinococcus radiodurans in complex with DNA.

    Pedersen, Hege Lynum; Johnson, Kenneth A; McVey, Colin E; Leiros, Ingar; Moe, Elin

    2015-10-01

    Uracil-DNA N-glycosylase (UNG) is a DNA-repair enzyme in the base-excision repair (BER) pathway which removes uracil from DNA. Here, the crystal structure of UNG from the extremophilic bacterium Deinococcus radiodurans (DrUNG) in complex with DNA is reported at a resolution of 1.35 Å. Prior to the crystallization experiments, the affinity between DrUNG and different DNA oligonucleotides was tested by electrophoretic mobility shift assays (EMSAs). As a result of this analysis, two 16 nt double-stranded DNAs were chosen for the co-crystallization experiments, one of which (16 nt AU) resulted in well diffracting crystals. The DNA in the co-crystal structure contained an abasic site (substrate product) flipped into the active site of the enzyme, with no uracil in the active-site pocket. Despite the high resolution, it was not possible to fit all of the terminal nucleotides of the DNA complex into electron density owing to disorder caused by a lack of stabilizing interactions. However, the DNA which was in contact with the enzyme, close to the active site, was well ordered and allowed detailed analysis of the enzyme-DNA interaction. The complex revealed that the interaction between DrUNG and DNA is similar to that in the previously determined crystal structure of human UNG (hUNG) in complex with DNA [Slupphaug et al. (1996). Nature (London), 384, 87-92]. Substitutions in a (here defined) variable part of the leucine loop result in a shorter loop (eight residues instead of nine) in DrUNG compared with hUNG; regardless of this, it seems to fulfil its role and generate a stabilizing force with the minor groove upon flipping out of the damaged base into the active site. The structure also provides a rationale for the previously observed high catalytic efficiency of DrUNG caused by high substrate affinity by demonstrating an increased number of long-range electrostatic interactions between the enzyme and the DNA. Interestingly, specific interactions between residues

  17. Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties.

    Li, Jiulong; Li, Qinghao; Ma, Xiaoqiong; Tian, Bing; Li, Tao; Yu, Jiangliu; Dai, Shang; Weng, Yulan; Hua, Yuejin

    Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III) and biosynthesize gold nanoparticles (AuNPs) was investigated in aqueous solution by ultraviolet and visible (UV/Vis) absorption spectroscopy, electron microscopy, X-ray diffraction (XRD), dynamic light scattering (DLS), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS). D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III) solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III) may be reduced to Au(I), and further reduced to Au(0) with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative ( Escherichia coli ) and Gram-positive ( Staphylococcus aureus ) bacteria by damaging their cytoplasmic membrane. Therefore, the extreme bacterium D. radiodurans can be used as a novel bacterial candidate for efficient biosynthesis of AuNPs, which exhibited potential in biomedical application as an antibacterial agent.

  18. Engineering Deinococcus radiodurans R1 for bioremediation of non radioactive and radioactive wastes facilitated by comparative genomics with Cupriavidus metallidurans CH34

    Badri, Hanene; Sghaier, Haitham; Barkallah, Insaf; Ben Salem, Issam; Wafa; Essouiss, Imen; Saied, Nadia; Saidi, M.; Gatri, Faten; Gatri, Maher; Boadabous, Abdellatifs; Leys, Natalie

    2009-01-01

    Deinococcus radiodurans R1 is a poly-extremophile for which a system of genetic transformation and manipulation has been developed and it is being engineered for in situ bioremediation of wastes particularly for cleanup of radioactive waste sites. In this study, additional attempts have been made to evaluate ''bioremediation determinants'' in the genome of D. radiodurans using a comparative-genomic approach with Cupriavidus metallidurans CH34, a multiple metal resistant bacterium. This resulted in the delineation of a set of ORFs that are common or peculiar to C. metallidurans and D. radiodurans. We identified 12 ORFs related to multidrug resistance efflux pumps as a special feature of C. metallidurans compared to D. radiodurans, which is the subject of further experimental work

  19. PprA contributes to Deinococcus radiodurans resistance to nalidixic acid, genome maintenance after DNA damage and interacts with deinococcal topoisomerases.

    Swathi Kota

    Full Text Available PprA is known to contribute to Deinococcus radiodurans' remarkable capacity to survive a variety of genotoxic assaults. The molecular bases for PprA's role(s in the maintenance of the damaged D. radiodurans genome are incompletely understood, but PprA is thought to promote D. radiodurans's capacity for DSB repair. PprA is found in a multiprotein DNA processing complex along with an ATP type DNA ligase, and the D. radiodurans toposiomerase IB (DraTopoIB as well as other proteins. Here, we show that PprA is a key contributor to D. radiodurans resistance to nalidixic acid (Nal, an inhibitor of topoisomerase II. Growth of wild type D. radiodurans and a pprA mutant were similar in the absence of exogenous genotoxic insults; however, the pprA mutant exhibited marked growth delay and a higher frequency of anucleate cells following treatment with DNA-damaging agents. We show that PprA interacts with both DraTopoIB and the Gyrase A subunit (DraGyrA in vivo and that purified PprA enhances DraTopoIB catalysed relaxation of supercoiled DNA. Thus, besides promoting DNA repair, our findings suggest that PprA also contributes to preserving the integrity of the D. radiodurans genome following DNA damage by interacting with DNA topoisomerases and by facilitating the actions of DraTopoIB.

  20. Method for detecting DNA strand breaks in mammalian cells using the Deinococcus radiodurans PprA protein

    Satoh, Katsuya; Wada, Seiichi; Kikuchi, Masahiro; Funayama, Tomoo; Narumi, Issay; Kobayashi, Yasuhiko

    2006-01-01

    In a previous study, we identified the novel protein PprA that plays a critical role in the radiation resistance of Deinococcus radiodurans. In this study, we focussed on the ability of PprA protein to recognize and bind to double-stranded DNA carrying strand breaks, and attempted to visualize radiation-induced DNA strand breaks in mammalian cultured cells by employing PprA protein using an immunofluorescence technique. Increased PprA protein binding to CHO-K1 nuclei immediately following irradiation suggests the protein is binding to DNA strand breaks. By altering the cell permeabilization conditions, PprA protein binding to CHO-K1 mitochondria, which is probably resulted from DNA strand break immediately following irradiation, was also detected. The method developed and detailed in this study will be useful in evaluating DNA damage responses in cultured cells, and could also be applicable to genotoxic tests in the environmental and pharmaceutical fields

  1. Effects of Low-Temperature Plasma-Sterilization on Mars Analog Soil Samples Mixed with Deinococcus radiodurans

    Janosch Schirmack

    2016-05-01

    Full Text Available We used Ar plasma-sterilization at a temperature below 80 °C to examine its effects on the viability of microorganisms when intermixed with tested soil. Due to a relatively low temperature, this method is not thought to affect the properties of a soil, particularly its organic component, to a significant degree. The method has previously been shown to work well on spacecraft parts. The selected microorganism for this test was Deinococcus radiodurans R1, which is known for its remarkable resistance to radiation effects. Our results showed a reduction in microbial counts after applying a low temperature plasma, but not to a degree suitable for a sterilization of the soil. Even an increase of the treatment duration from 1.5 to 45 min did not achieve satisfying results, but only resulted in in a mean cell reduction rate of 75% compared to the untreated control samples.

  2. Extremely radioresistant microbe Deinococcus radiodurans does not survive tellurite-mediated oxidative stress: revelation of molecular basis

    Apte, Shree Kumar; Narasimha, Anaganti; Basu, Bhakti

    2014-01-01

    Deinococcus radiodurans exhibits extraordinary resistance to gamma radiation as well as oxidative stress. Comparison of tellurite stress with gamma irradiation, both of which impart severe oxidative stress, revealed that tellurite induced less ROS and caused less oxidative damage to proteins, but was much more lethal to D. radiodurans than gamma irradiation. The proteomic changes induced by tellurite exposure were mapped by two dimensional protein electrophoresis followed by mass spectrometry. Seventy proteins belonging to major functional categories of oxidative stress alleviation, protein translation/folding and metabolism were identified. Tellurite responsive proteome dynamics displayed (i) up-regulation of proteins involved in tellurite stress resistance and oxidative stress alleviation, dehydrogenases involved in generation of reducing potential, and chaperones (such DnaK), and (ii) down regulation of key glycolysis and TCA cycle enzymes, proteins involved in protein translation/folding and energy production. Tellurite stress also resulted in nearly 50% loss in the cellular reducing potential within 1h of exposure while gamma irradiation had no such effect. The findings provide a better insight into the mechanism of tellurite toxicity, beyond metal mediated oxidative stress, in this extremophile. (author)

  3. Final Report for Grant No. DE-FG02-98ER62583 ''Functional Analysis of the Genome Sequence of Deinococcus radiodurans''

    Daly, Michael J.

    2003-01-01

    Extremophiles are nearly always defined with singular characteristics that allow existence within a singular extreme environment. The bacterium Deinococcus radiodurans qualifies as a polyextremeophile, showing remarkable resistance to a range of damage caused by ionizing radiation, dessication, ultraviolet radiation, oxidizing agents, and electrophilic mutagens. D. radiodurans is most famous for its extreme resistance to ionizing radiation; it not only can grow continuously in the presence of chronic radiation (6,000 rad per hour), but it can survive acute exposures to gamma radiation that exceed 1,500,000 rads without lethality or induced mutation. These characteristics were the impetus for sequencing its genome. We completed an extensive comparative sequence analysis of the Deinococcus radiodurans (strain R1) genome. Deinococcus is the first representative with a completely sequenced genome from a bacterial branch of extremophiles - the Thermus/Deinococcus group. Phylogenetic tree analysis, combined with the identification of several synapomorphies between Thermus and Deinococcus, support that it is a very ancient branch localized in the vicinity of the bacterial tree root. Distinctive features of the Deinoccoccus genome as well as features shared with other free-living bacteria were revealed by comparison of its proteome to a collection of Clusters of Orthologous Groups of proteins (COGs). Analysis of paralogs in Deinococcus has revealed some unique protein families. In addition, specific expansions of several protein families including phosphatases, proteases, acyl transferases and MutT pyrophosphohydrolases, were detected. Genes that potentially affect DNA repair and recombination were investigated in detail. Some proteins appear to have been horizontally transferred from eukaryotes, and are not present in other bacteria. For example, three proteins homologous to plant desiccation-resistance proteins were identified and these are particularly interesting

  4. Stress induction in the bacteria Shewanella oneidensis and Deinococcus radiodurans in response to below-background ionizing radiation.

    Castillo, Hugo; Schoderbek, Donald; Dulal, Santosh; Escobar, Gabriela; Wood, Jeffrey; Nelson, Roger; Smith, Geoffrey

    2015-01-01

    The 'Linear no-threshold' (LNT) model predicts that any amount of radiation increases the risk of organisms to accumulate negative effects. Several studies at below background radiation levels (4.5-11.4 nGy h(-1)) show decreased growth rates and an increased susceptibility to oxidative stress. The purpose of our study is to obtain molecular evidence of a stress response in Shewanella oneidensis and Deinococcus radiodurans grown at a gamma dose rate of 0.16 nGy h(-1), about 400 times less than normal background radiation. Bacteria cultures were grown at a dose rate of 0.16 or 71.3 nGy h(-1) gamma irradiation. Total RNA was extracted from samples at early-exponential and stationary phases for the rt-PCR relative quantification (radiation-deprived treatment/background radiation control) of the stress-related genes katB (catalase), recA (recombinase), oxyR (oxidative stress transcriptional regulator), lexA (SOS regulon transcriptional repressor), dnaK (heat shock protein 70) and SOA0154 (putative heavy metal efflux pump). Deprivation of normal levels of radiation caused a reduction in growth of both bacterial species, accompanied by the upregulation of katB, recA, SOA0154 genes in S. oneidensis and the upregulation of dnaK in D. radiodurans. When cells were returned to background radiation levels, growth rates recovered and the stress response dissipated. Our results indicate that below-background levels of radiation inhibited growth and elicited a stress response in two species of bacteria, contrary to the LNT model prediction.

  5. Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

    Xiangrong Dong

    Full Text Available PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

  6. Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

    Dong, Xiangrong; Tian, Bing; Dai, Shang; Li, Tao; Guo, Linna; Tan, Zhongfang; Jiao, Zhen; Jin, Qingsheng; Wang, Yanping; Hua, Yuejin

    2015-01-01

    PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah) by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

  7. Final Report for Grant No. DE-FG02-97ER62492 ''Engineering Deinococcus radiodurans for Metal Remediation in Radioactive Mixed Waste Sites''

    Michael J.; Daly, Ph.D.

    2005-01-01

    The groundwater and sediments of numerous U. S. Department of Energy (DOE) field sites are contaminated with mixtures of heavy metals (e.g., Hg, Cr, Pd) and radionuclides (e.g., U, Tc), as well as the fuel hydrocarbons benzene, toluene, ethylbenzene and xylenes (BTEX); chlorinated hydrocarbons, such as trichloroethylene (TCE); and polychlorinated biphenyls (PCBs). The remediation of such mixed wastes constitutes an immediate and complex waste management challenge for DOE, particularly in light of the costliness and limited efficacy of current physical and chemical strategies for treating mixed wastes. In situ bioremediation via natural microbial processes (e.g., metal reduction) remains a potent, potentially cost-effective approach to the reductive immobilization or detoxification of environmental contaminants. Seventy million cubic meters of soil and three trillion liters of groundwater have been contaminated by leaking radioactive waste generated in the United States during the Cold War. A cleanup technology is being developed based on the extremely radiation resistant bacterium Deinococcus radiodurans. Our recent isolation and characterization of D. radiodurans from a variety of DOE environments, including highly radioactive sediments beneath one of the leaking tanks (SX-108) at the Hanford Site in south-central Washington state, underscores the potential for this species to survive in such extreme environments. Research aimed at developing D. radiodurans for metal remediation in radioactive waste sites was started by this group in September 1997 with support from DOE NABIR grant DE-FG02-97ER62492. Our grant was renewed for the period 2000-2003, which includes work on the thermophilic radiation resistant bacterium Deinococcus geothermalis. Work funded by the existing grant contributed to 18 papers in the period 1997-2004 on the fundamental biology of D. radiodurans and its design for bioremediation of radioactive waste environments. Our progress since September

  8. Regulation of MntH by a dual Mn(II- and Fe(II-dependent transcriptional repressor (DR2539 in Deinococcus radiodurans.

    Hongxing Sun

    Full Text Available The high intracellular Mn/Fe ratio observed within the bacteria Deinococcus radiodurans may contribute to its remarkable resistance to environmental stresses. We isolated DR2539, a novel regulator of intracellular Mn/Fe homeostasis in D. radiodurans. Electrophoretic gel mobility shift assays (EMSAs revealed that DR2539 binds specifically to the promoter of the manganese acquisition transporter (MntH gene, and that DR0865, the only Fur homologue in D. radiodurans, cannot bind to the promoter of mntH, but it can bind to the promoter of another manganese acquisition transporter, MntABC. β-galactosidase expression analysis indicated that DR2539 acts as a manganese- and iron-dependent transcriptional repressor. Further sequence alignment analysis revealed that DR2539 has evolved some special characteristics. Site-directed mutagenesis suggested that His98 plays an important role in the activities of DR2539, and further protein-DNA binding activity assays showed that the activity of H98Y mutants decreased dramatically relative to wild type DR2539. Our study suggests that D. radiodurans has evolved a very efficient manganese regulation mechanism that involves its high intracellular Mn/Fe ratio and permits resistance to extreme conditions.

  9. DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

    Chen, Huan; Wu, Rongrong; Xu, Guangzhi; Fang, Xu; Qiu, Xiaoli; Guo, Hongyin; Tian, Bing; Hua, Yuejin

    2010-01-01

    Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

  10. DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

    Chen, Huan [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Wu, Rongrong [Department of Cardiology, Second Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou 310009 (China); Xu, Guangzhi [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Fang, Xu; Qiu, Xiaoli; Guo, Hongyin [Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Tian, Bing, E-mail: tianbing@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Hua, Yuejin, E-mail: yjhua@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China)

    2010-05-28

    Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

  11. THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

    Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

    2004-01-01

    Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

  12. THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

    Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

    2004-03-17

    Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

  13. PprM is necessary for up-regulation of katE1, encoding the major catalase of Deinococcus radiodurans, under unstressed culture conditions.

    Jeong, Sun-Wook; Seo, Ho Seong; Kim, Min-Kyu; Choi, Jong-Il; Lim, Heon-Man; Lim, Sangyong

    2016-06-01

    Deinococcus radiodurans is a poly-extremophilic organism, capable of tolerating a wide variety of different stresses, such as gamma/ultraviolet radiation, desiccation, and oxidative stress. PprM, a cold shock protein homolog, is involved in the radiation resistance of D. radiodurans, but its role in the oxidative stress response has not been investigated. In this study, we investigated the effect of pprM mutation on catalase gene expression. pprM disruption decreased the mRNA and protein levels of KatE1, which is the major catalase in D. radiodurans, under normal culture conditions. A pprM mutant strain (pprM MT) exhibited decreased catalase activity, and its resistance to hydrogen peroxide (H2O2) decreased accordingly compared with that of the wild-type strain. We confirmed that RecG helicase negatively regulates katE1 under normal culture conditions. Among katE1 transcriptional regulators, the positive regulator drRRA was not altered in pprM (-), while the negative regulators perR, dtxR, and recG were activated more than 2.5-fold in pprM MT. These findings suggest that PprM is necessary for KatE1 production under normal culture conditions by down-regulation of katE1 negative regulators.

  14. Engineering Deinococcus geothermailis for Bioremediation of High-Temperature Radioactive Waste Environments

    Brim, Hassan; Venkateswaran, Amudhan; Kostandarithes, Heather M.; Fredrickson, Jim K.; Daly, Michael J.

    2003-01-01

    Deinococcus geothermalis is an extremely radiation-resistant thermophilic bacterium closely related to the mesophile Deinococcus radiodurans, which is being engineered for in situ bioremediation of radioactive wastes

  15. Comparative analyses reveal different consequences of two oxidative stress inducers, gamma irradiation and potassium tellurite, in the extremophile Deinococcus radiodurans

    Narasimha, Anaganti; Basu, Bhakti; Apte, Shree Kumar

    2014-01-01

    Proteomic and mass spectrometric analyses revealed differential responses of D. radiodurans to two oxidative stressors. While both elicited oxidative stress alleviation response, major divergence was observed at the level of DNA repair, metabolic pathways and protein homeostasis. Response to gamma irradiation was focused on DNA repair and ROS scavenging but supported metabolism as well as protein homeostasis. Tellurite, induced oxidative stress alleviation but decreased reducing affected and adversely affected metabolism and protein homeostasis

  16. Isolation and properties of strains of Micrococcus (Deinococcus) radiodurans unable to excise ultraviolet light-induced pyrimidine dimers from DNA: evidence for two excision pathways

    Moseley, B.E.B.; Evans, D.M.

    1983-01-01

    A mutant of Deinococcus (formerly Micrococcus) radiodurans sensitive to both the lethal effect of mitomycin C and the mutagenic effect of simple alkylating agents, but having wild-type resistance to UV light, was treated with the mutagen N-methyl-N'-nitro-N-nitrosoguanidine. Three strains were isolated that were UV-sensitive, but had wild-type resistance to the lethal effect of methyl methanesulphonate and all were shown to be unable to excise pyrimidine dimers. The three strains UVS9, UVS25 and UVS78 had, in addition to the mutation in mtcA, mutations in loci designated uvsC, uvsD and uvsE, respectively. When the mutant mtcA gene was replaced by its wild-type allele in all three strains they became UV- and mitomycin C-resistant. On incubating the double mutants UVS9, UVS25 and UVS78 with wild-type DNA about 50% of the transformants selected for UV resistance were mitomycin C-sensitive and about 50% resistant depending on whether the mutant mtcA or the uvsC, D or E genes had been replaced by their wild-type alleles. Although strains mutant singly in uvsC, D or E were UV-resistant the rates of excision of pyrimidine dimers differed between them and was slower in all of them than in the wild-type and strain 302. (author)

  17. Inhibition of peptide bond formation by pleuromutilins: the structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin.

    Schlünzen, Frank; Pyetan, Erez; Fucini, Paola; Yonath, Ada; Harms, Jörg M

    2004-12-01

    Tiamulin, a prominent member of the pleuromutilin class of antibiotics, is a potent inhibitor of protein synthesis in bacteria. Up to now the effect of pleuromutilins on the ribosome has not been determined on a molecular level. The 3.5 A structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin provides for the first time a detailed picture of its interactions with the 23S rRNA, thus explaining the molecular mechanism of the antimicrobial activity of the pleuromutilin class of antibiotics. Our results show that tiamulin is located within the peptidyl transferase center (PTC) of the 50S ribosomal subunit with its tricyclic mutilin core positioned in a tight pocket at the A-tRNA binding site. Also, the extension, which protrudes from its mutilin core, partially overlaps with the P-tRNA binding site. Thereby, tiamulin directly inhibits peptide bond formation. Comparison of the tiamulin binding site with other PTC targeting drugs, like chloramphenicol, clindamycin and streptogramins, may facilitate the design of modified or hybridized drugs that extend the applicability of this class of antibiotics.

  18. Comparison of radiation-induced proteins in two revertants with those in a radiation sensitive mutant of Deinococcus radiodurans

    Hu Qian; Tanaka, Atsushi; Kobayashi, Yasuhiko; Nozawa, Ranko; Watanabe, Hiroshi.

    1992-01-01

    In order to search proteins responsible for DNA repair, the intracellular proteins in gamma-irradiated cells of D.radiodurans R1 and its three mutants were analyzed by means of two-dimensional gel electrophoresis. Two new proteins, P35 (M.W. 35 kDa) and P92 (M.W. 92 kDa), were found in the cells of the radioresistant revertant (KH8401-1-5) and D.radiodurans R1. However, only P92 was detected in the moderately radioresistant revertant (KH8401-10-7). Both proteins were not detected in the cells of the radiosensitive mutant (KH8401). On the other hand, one protein, P25 (M.W. 25 kDa), which was detected either before or after gamma-irradiation, was only found in KH8401-10-7. These results suggest that these special induced proteins, P35 and P92, might be directly responsible for radiation resistance. The analyses of similar proteins in the cells of E.coli B/r and Deinobactor grandis KS0460 were also carried out. (author)

  19. Design and construction of deinococcus radiodurans for biodegradation of organic toxins at radioactive DOE waste sites. 1998 annual progress report

    Daly, M.J.; Minton, K.W.; Wackett, L.P.

    1998-01-01

    'A 1992 survey of DOE waste sites indicates that about 32% of soils and 45% of groundwaters at these sites contain radionuclides and metals plus an organic toxin class. The most commonly reported combinations of these hazardous compounds being radionuclides and metals (e.g., U, Pu, Cs, Pb, Cr, As) plus chlorinated hydrocarbons (e.g., trichloroethylene), fuel hydrocarbons (e.g., toluene), or polychlorinated biphenyls (e.g., Arochlor 1248). These wastes are some of the most hazardous pollutants and pose an increasing risk to human health as they leach into the environment. The objective of this research is to develop novel organisms, that are highly resistant to radiation and the toxic effects of metals and radionuclides, for in-situ bioremediation of organic toxins. Few organisms exist that are able to remediate such environmental organic pollutants, and among those that can, the bacteria belonging to the genus Pseudomonas are the most characterized. Unfortunately, these bacteria are very radiation sensitive. For example, Pseudomonas spp. is even more sensitive than Escherichia coli and, thus, is not suitable as a bioremediation host in environments subjected to radiation. By contrast, D. radiodurans, a natural soil bacterium, is the most radiation resistant organism yet discovered; it is several thousand times more resistant to ionizing radiation than Pseudomonas. The sophisticated gene transfer and expression systems the authors have developed for D. radiodurans over the last eight years make this organism an ideal candidate for high-level expression of genes that degrade organic toxins, in radioactive environments. The authors ultimate aim is to develop organisms and approaches that will be useful for remediating the large variety of toxic organic compounds found in DOE waste sites that are too radioactive to support other bioremediation organisms. This report summarizes work after the first 6 months of a 3-year project.'

  20. Single Strand Annealing Plays a Major Role in RecA-Independent Recombination between Repeated Sequences in the Radioresistant Deinococcus radiodurans Bacterium.

    Solenne Ithurbide

    2015-10-01

    Full Text Available The bacterium Deinococcus radiodurans is one of the most radioresistant organisms known. It is able to reconstruct a functional genome from hundreds of radiation-induced chromosomal fragments. Our work aims to highlight the genes involved in recombination between 438 bp direct repeats separated by intervening sequences of various lengths ranging from 1,479 bp to 10,500 bp to restore a functional tetA gene in the presence or absence of radiation-induced DNA double strand breaks. The frequency of spontaneous deletion events between the chromosomal direct repeats were the same in recA+ and in ΔrecA, ΔrecF, and ΔrecO bacteria, whereas recombination between chromosomal and plasmid DNA was shown to be strictly dependent on the RecA and RecF proteins. The presence of mutations in one of the repeated sequence reduced, in a MutS-dependent manner, the frequency of the deletion events. The distance between the repeats did not influence the frequencies of deletion events in recA+ as well in ΔrecA bacteria. The absence of the UvrD protein stimulated the recombination between the direct repeats whereas the absence of the DdrB protein, previously shown to be involved in DNA double strand break repair through a single strand annealing (SSA pathway, strongly reduces the frequency of RecA- (and RecO- independent deletions events. The absence of the DdrB protein also increased the lethal sectoring of cells devoid of RecA or RecO protein. γ-irradiation of recA+ cells increased about 10-fold the frequencies of the deletion events, but at a lesser extend in cells devoid of the DdrB protein. Altogether, our results suggest a major role of single strand annealing in DNA repeat deletion events in bacteria devoid of the RecA protein, and also in recA+ bacteria exposed to ionizing radiation.

  1. Intrinsically disordered regions may lower the hydration free energy in proteins: a case study of nudix hydrolase in the bacterium Deinococcus radiodurans.

    Omar Awile

    Full Text Available The proteome of the radiation- and desiccation-resistant bacterium D. radiodurans features a group of proteins that contain significant intrinsically disordered regions that are not present in non-extremophile homologues. Interestingly, this group includes a number of housekeeping and repair proteins such as DNA polymerase III, nudix hydrolase and rotamase. Here, we focus on a member of the nudix hydrolase family from D. radiodurans possessing low-complexity N- and C-terminal tails, which exhibit sequence signatures of intrinsic disorder and have unknown function. The enzyme catalyzes the hydrolysis of oxidatively damaged and mutagenic nucleotides, and it is thought to play an important role in D. radiodurans during the recovery phase after exposure to ionizing radiation or desiccation. We use molecular dynamics simulations to study the dynamics of the protein, and study its hydration free energy using the GB/SA formalism. We show that the presence of disordered tails significantly decreases the hydration free energy of the whole protein. We hypothesize that the tails increase the chances of the protein to be located in the remaining water patches in the desiccated cell, where it is protected from the desiccation effects and can function normally. We extrapolate this to other intrinsically disordered regions in proteins, and propose a novel function for them: intrinsically disordered regions increase the "surface-properties" of the folded domains they are attached to, making them on the whole more hydrophilic and potentially influencing, in this way, their localization and cellular activity.

  2. Deinococcus geothermalis: The Pool of Extreme Radiation Resistance Genes Shrinks

    Makarova, Kira S.; Omelchenko, Marina V.; Gaidamakova, Elena K.; Matrosova, Vera Y.; Vasilenko, Alexander; Zhai, Min; Lapidus, Alla; Copeland, Alex; Kim, Edwin; Land, Miriam; Mavrommatis, Konstantinos; Pitluck, Samuel; Richardson, Paul M.; Detter, Chris; Brettin, Thomas; Saunders, Elizabeth; Lai, Barry; Ravel, Bruce; Kemner, Kenneth M.; Wolf, Yuri I.; Sorokin, Alexander; Gerasimova, Anna V.; Gelfand, Mikhail S.; Fredrickson, James K.; Koonin, Eugene V.; Daly, Michael J.

    2007-07-24

    Bacteria of the genus Deinococcus are extremely resistant to ionizing radiation (IR), ultraviolet light (UV) and desiccation. The mesophile Deinococcus radiodurans was the first member of this group whose genome was completely sequenced. Analysis of the genome sequence of D. radiodurans, however, failed to identify unique DNA repair systems. To further delineate the genes underlying the resistance phenotypes, we report the whole-genome sequence of a second Deinococcus species, the thermophile Deinococcus geothermalis, which at itsoptimal growth temperature is as resistant to IR, UV and desiccation as D. radiodurans, and a comparative analysis of the two Deinococcus genomes. Many D. radiodurans genes previously implicated in resistance, but for which no sensitive phenotype was observed upon disruption, are absent in D. geothermalis. In contrast, most D. radiodurans genes whose mutants displayed a radiation-sensitive phenotype in D. radiodurans are conserved in D. geothermalis. Supporting the existence of a Deinococcus radiation response regulon, a common palindromic DNA motif was identified in a conserved set of genes associated with resistance, and a dedicated transcriptional regulator was predicted. We present the case that these two species evolved essentially the same diverse set of gene families, and that the extreme stress-resistance phenotypes of the Deinococcus lineage emerged progressively by amassing cell-cleaning systems from different sources, but not by acquisition of novel DNA repair systems. Our reconstruction of the genomic evolution of the Deinococcus-Thermus phylum indicates that the corresponding set of enzymes proliferated mainly in the common ancestor of Deinococcus. Results of the comparative analysis weaken the arguments for a role of higher-order chromosome alignment structures in resistance; more clearly define and substantially revise downward the number of uncharacterized genes that might participate in DNA repair and contribute to

  3. Deinococcus antarcticus sp. nov., isolated from soil.

    Dong, Ning; Li, Hui-Rong; Yuan, Meng; Zhang, Xiao-Hua; Yu, Yong

    2015-02-01

    A pink-pigmented, non-motile, coccoid bacterial strain, designated G3-6-20(T), was isolated from a soil sample collected in the Grove Mountains, East Antarctica. This strain was resistant to UV irradiation (810 J m(-2)) and slightly more sensitive to desiccation as compared with Deinococcus radiodurans. Phylogenetic analyses based on the 16S rRNA gene sequence of the isolate indicated that the organism belongs to the genus Deinococcus. Highest sequence similarities were with Deinococcus ficus CC-FR2-10(T) (93.5 %), Deinococcus xinjiangensis X-82(T) (92.8 %), Deinococcus indicus Wt/1a(T) (92.5 %), Deinococcus daejeonensis MJ27(T) (92.3 %), Deinococcus wulumuqiensis R-12(T) (92.3 %), Deinococcus aquaticus PB314(T) (92.2 %) and Deinococcus radiodurans DSM 20539(T) (92.2 %). Major fatty acids were C18 : 1ω7c, summed feature 3 (C16 : 1ω7c and/or C16 : 1ω6c), anteiso-C15 : 0 and C16 : 0. The G+C content of the genomic DNA of strain G3-6-20(T) was 63.1 mol%. Menaquinone 8 (MK-8) was the predominant respiratory quinone. Based on its phylogenetic position, and chemotaxonomic and phenotypic characteristics, strain G3-6-20(T) represents a novel species of the genus Deinococcus, for which the name Deinococcus antarcticus sp. nov. is proposed. The type strain is G3-6-20(T) ( = DSM 27864(T) = CCTCC AB 2013263(T)). © 2015 IUMS.

  4. Topoisomerase IB of Deinococcus radiodurans resolves guanine ...

    2015-11-28

    Nov 28, 2015 ... All the oligonucleotides men- tioned here were ... further reactions with DraTopoIB were carried out at 37°C ... of G4 DNA moves faster than unfolded and intermolecular .... for its action on intramolecular G4 DNA structure was.

  5. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Daly, Michael J.

    2007-07-23

    Progress is briefly summarized in these areas: ionizing radiation resistance in bacteria; a hypothesis regarding ionizing radiation resistance emerging for bacterial cells; transcriptome analysis of irradiated D. radiodurans and Shewanella oneidensis; the role of metal reduction in Mn-dependnet Deinococcal species; and engineered Deinococcus strains as models for bioremediation. Key findings are also reported regarding protein oxidation as a possible key to bacterial desiccation resistance, and the whole-genome sequence of the thermophile Deinococcus geothermalis.

  6. Deinococcus frigens sp. nov., Deinococcus saxicola sp. nov., and Deinococcus marmoris sp. nov., low temperature and draught-tolerating, UV-resistant bacteria from continental Antarctica.

    Hirsch, Peter; Gallikowski, Claudia A; Siebert, Jörg; Peissl, Klaus; Kroppenstedt, Reiner; Schumann, Peter; Stackebrandt, Erko; Anderson, Robert

    2004-11-01

    Six Gram-positive, non-motile, UV- and draught-tolerant bacteria were isolated from antarctic soil and rock samples. The pink to orange cocci grew well on oligotrophic medium PYGV (pH 7.5) at 9-18 degrees C. They tolerated 0-10% NaCl, were aerobic to facultatively anaerobic and contained ornithine in their cell wall (type A3beta, Orn-Gly2). The lipid profiles of four strains were found to be typical for those of D. radiodurans. Major fatty acids were 16:1cis9, 15:1cis9, 17:1cis9 and i17:1cis9, the respiratory quinone of three strains was MK-8. Comparative 16S rDNA gene sequencing revealed phylogenetic relationships to the Deinococcus clade, especially to D. radiopugnans. The levels of 16S rRNA gene sequence similarity and DNA-DNA hybridisation data showed the six isolates represented new taxa. Phenotypic properties supported the description of three new species which were different from the eight known Deinococcus species and particularly from D. radiopugnans. Soil isolate AA-692T (DSM 12807T) is the type strain of Deinococcus frigens sp. nov., with AA-752 (DSM 15993) and AA-829 (DSM 15994) as additional strains from soil. The endolithic isolate AA-1444T, Deinococcus saxicola sp. nov., (DSM 15974T) came from antarctic sandstone, and Deinococcus marmoris sp. nov. (isolate AA-63T [DSM 12784T]) as well as AA-69 (DSM 15951) were isolated from antarctic marble.

  7. Small-Molecule Antioxidant Proteome-Shields in Deinococcus Radiodurans

    2010-09-01

    family of proteases [14] which appear to be activated by irradiation (Figure 4B). At least 10 complete open reading frames with considerable sequence...the experiments: MJD EKG VYM JGK RF DYL NBW GAV BSB RLL. Performed the experiments: MJD EKG VYM JGK RF DYL NBW GAV BSB RLL. Analyzed the data: MJD... EKG VYM JGK RF DYL NBW GAV BSB RLL. Wrote the paper: MJD RLL. References 1. Daly MJ, Gaidamakova EK, Matrosova VY, Vasilenko A, Zhai M, et al. (2007

  8. A New Perspective on Radiation Resistance Based on Deinococcus radiodurans

    2009-03-01

    tolerate 3,000–5000 Gy, but are rendered sterile. As a haploid, the basidiomycete fungus Ustilago maydis carries a single set of chromosomes per...salinarum NRC-1. Environ. Microbiol. 5 Jan 2009 (doi:10.1111/j.1462-2920.2008.01828.x). 21. Chan, H. L. et al. Proteomic analysis of UVC irradiation

  9. Comparative proteomics reveals key proteins recruited at the nucleoid of Deinococcus after irradiation-induced DNA damage

    Bouthier de la Tour, Claire; Passot, Fanny Marie; Toueille, Magali; Servant, Pascale; Sommer, Suzanne; Mirabella, Boris; Blanchard, Laurence; Groot, Arjan de; Guerin, Philippe; Armengaud, Jean

    2013-01-01

    The nucleoids of radiation-resistant Deinococcus species show a high degree of compaction maintained after ionizing irradiation. We identified proteins recruited after irradiation in nucleoids of Deinococcus radiodurans and Deinococcus deserti by means of comparative proteomics. Proteins in nucleoid-enriched fractions from unirradiated and irradiated Deinococcus were identified and semi quantified by shotgun proteomics. The ssDNA-binding protein SSB, DNA gyrase subunits GyrA and GyrB, DNA topoisomerase I, RecA recombinase, UvrA excinuclease, RecQ helicase, DdrA, DdrB, and DdrD proteins were found in significantly higher amounts in irradiated nucleoids of both Deinococcus species. We observed, by immunofluorescence microscopy, the subcellular localization of these proteins in D. radiodurans, showing for the first time the recruitment of the DdrD protein into the D. radiodurans nucleoid. We specifically followed the kinetics of recruitment of RecA, DdrA, and DdrD to the nucleoid after irradiation. Remarkably, RecA proteins formed irregular filament-like structures 1 h after irradiation, before being redistributed throughout the cells by 3 h post-irradiation. Comparable dynamics of DdrD localization were observed, suggesting a possible functional interaction between RecA and DdrD. Several proteins involved in nucleotide synthesis were also seen in higher quantities in the nucleoids of irradiated cells, indicative of the existence of a mechanism for orchestrating the presence of proteins involved in DNA metabolism in nucleoids in response to massive DNA damage. All MS data have been deposited in the ProteomeXchange with identifier PXD00196. (authors)

  10. Proteomics of post-irradiation recovery in D. radiodurans

    Basu, Bhakti; Apte, Shree Kumar

    2012-01-01

    An extremophile Deinococcus radiodurans is bestowed with an extraordinary DNA repair ability that renders it virtually resistant to all known forms of DNA damage caused by ionizing radiations (10 kGy of gamma rays), UV (1 kJ/m 2 ) or weeks of desiccation etc. The genome of D. radiodurans encodes a unique combination of DNA repair pathways such as prokaryotic type RecFOR mediated homologous recombination (HR) and nucleotide/base excision repair along with eukaryotic type strand annealing (SA) and non-homologous end joining (NHEJ), but is devoid of universal prokaryotic DNA repair pathways such as RecBCD mediated HR, photo-reactivation and SOS response. Collective evidence obtained so far from multiple approaches, have indicated (i) that all genes essential for DNA repair are not necessarily induced following radiation stress (ii) early RecA independent DNA assembly occurs, and (iii) absolute necessity of RecA dependent HR for final genome restitution. The 6 kGy gamma irradiation inducible proteome dynamics were mapped during the post-irradiation growth arrest phase by 2D protein electrophoresis coupled with mass spectrometry. Radiation inducible expression of at least 33 proteins was evident in the first 1h of post irradiation recovery

  11. Antibiotic Sensitivity of Micrococcus radiodurans

    Hawiger, J.; Jeljaszewicz, J.

    1967-01-01

    A wild-type strain of Micrococcus radiodurans and its nonpigmented mutant W1 were tested for sensitivity to 10 antibiotics selected from the standpoint of their mechanism of action. Representatives of groups of antibiotics inhibiting deoxyribonucleic acid (DNA) synthesis, DNA-dependent ribonucleic acid synthesis, protein synthesis, and cell wall synthesis were selected. M. radiodurans and its mutant exhibited full susceptibility to all antibiotics tested (mitomycin C, actinomycin D, chloramphenicol, dihydrostreptomycin, erythromycin, neomycin, kanamycin, benzylpenicillin, bacitracin, and vancomycin), the degree of susceptibility being of the same order as that of a standard strain of Staphylococcus aureus 209 P, with the exception of dihydrostreptomycin. PMID:4166078

  12. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Daly, Michael J.

    2006-01-01

    Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR

  13. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Fredrickson, Jim K.; Daly, Michael J.

    2006-01-01

    Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf)

  14. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Fredrickson, Jim K.; Daly, Michael J.

    2006-06-01

    Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf).

  15. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Daly, Michael J.

    2006-05-01

    Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR.

  16. Study of resistance of D. radiodurans to the combined action of ionizing radiation with an electric or magnetic fields exogenous

    Prado, Georgia Reis

    2011-01-01

    The key goal in radiotherapy is to maximize damages in a tumor while minimizing them in nearby health tissues. Several strategies have been worked out toward the enhancement of cellular radiosensitivity, as the use of exogenous fields. It is studied in this work the resistance of Deinococcus radiodurans to the combined action of conventional and non conventional radiations, with external agents (electric and magnetic fields). D. radiodurans is a bacterium having an extraordinary ability to cope with lethal and mutagenic agents harmful to the DNA, particularly ionizing radiations as gammas and UV. Given its high radioresistance and fast growing, D. radiodurans has been used as solid tumors simulators. Peculiarities associated with radioresistance at the exponential and stationary phases were delineated from growing curves. By measuring survival curves information on radiosensitivity was obtained. In gamma irradiation D. radiodurans exhibited repairing shoulders of 2 and 8 kGy at the exponential and stationary phases, respectively. When gamma irradiations were combined with expositions to the electric field the repairing shoulders were reduced to 1 and 4 kGy at the exponential and stationary phases, respectively. Radioresistance was similar in both growing phases when the number of cells were approximately equalized in these two processes. On the other hand, when gamma irradiations were combined with expositions to the magnetic field the repairing shoulders were reduced to 4 and 6 kGy at the exponential and stationary phases, respectively. In irradiations with electron beams the repairing shoulder at the exponential phase was totally depleted, while at the stationary phase it was only 1 kGy. The findings of this work revealed new and important information on the radioresistance of D. radiodurans, while providing hints to the improvement of radiotherapy protocols in association with exogenous physical agents. (author)

  17. RNA-Seq analysis of D. radiodurans find non coding RNAs expressed in response to radiation stress

    Gadewal, Nikhil; Mukhopadhyaya, Rita

    2015-01-01

    In bacteria discovery of functional RNA molecules that are not translated into protein, noncoding RNAs, became possible with advent of Next Generation Sequencing technology. Bacterial non coding RNAs are typically 50-300 nucleotides long and work as internal signals controlling various levels of gene expression. Deep sequencing of total cellular RNA captures all coding and noncoding transcripts with their differential levels of expression in the transcriptome. It provides a powerful approach to study bacterial gene expression and mechanisms of gene regulation. We subjected the 3 h transcriptome of Deinococcus radiodurans R1 cells post exposure to 6 KGy gamma radiation to 100 x 2 cycles of deep sequencing on the Illumina HiSeq 2000 to look for ncRNA transcripts. Bioinformatics pipeline for analysis and interpretation of RNA Seq data was done in house using Softwares available in public domains. Our sequence data aligned with 21 putative ncRNAs expressed in the intergenic regions of annotated genome of D radiodurans. Verification of 2 ncRNA candidates and 3 transcription factor genes by Real Time PCR confirmed presence of these transcripts in the 3 h transcriptome sequenced by us. Any relationship between ncRNAs and control of radiation induced gene expression in D radiodurans can be proved only after specific gene knock outs in future. (author)

  18. Identification and Characterization of uvrA, a DNA Repair Gene of Deinococcus radiodurans

    1996-01-01

    alkylating agents , such as methyl-N-nitro~N~nitrosoguanidine(MNNG), N-methyl-N~ nitrosourea (MNU), and to a lesser extent methyl methanesulfonate (MMS...6,4) Photoproduct 17 c. Thymine Glycols and Cross-links 17 3. Ionizing Radiation Damage " 17 4. Chemical Damage 20 a. Alkylating Agents .20 b. Cross...Examples of base damage induced by ionizing radiation 19 6. Nucleotide centers in DNA that are most reactive to alkylating agents 21 7. Schematic

  19. DNA damage response in a radiation resistant bacterium Deinococcus radiodurans: a paradigm shift

    Misra, H.S.

    2015-01-01

    Deinococcusradiodurans is best known for its extraordinary resistance to gamma radiation with its D 10 12kGy, and several other DNA damaging agents including desiccation to less than 5% humidity and chemical xenotoxicants. An efficient DNA double strand break (DSB) repair and its ability to protect biomolecules from oxidative damage are a few mechanisms attributed to these phenotypes in this bacterium. Although it regulates its proteome and transcriptome in response to DNA damage for its growth and survival, it lacks LexA mediated classical SOS response mechanism. Since LexA mediated damages response mechanism is highly and perhaps only, characterized DNA damage response processes in prokaryotes, this bacterium keeps us guessing how it responds to extreme doses of DNA damage. Interestingly, this bacterium encodes a large number of eukaryotic type serine threonine/tyrosine protein kinases (eST/YPK), phosphatases and response regulators and roles of eST/YPKs in cellular response to DNA damage and cell cycle regulations are well established in eukaryotes. Here, we characterized an antioxidant and DNA damage inducible eST/YPK (RqkA) and established its role in extraordinary radioresistance and DSB repair in this bacterium. We identified native phosphoprotein substrates for this kinase and demonstrated the involvement of some of these proteins phosphorylation in the regulation of DSB repair and growth under radiation stress. Findings suggesting the possible existence of eST/YPK mediated DNA damage response mechanism as an alternate to classical SOS response in this prokaryote would be discussed. (author)

  20. Radiation and desiccation response motif mediates radiation induced gene expression in D. radiodurans

    Anaganti, Narasimha; Basu, Bhakti; Apte, Shree Kumar

    2015-01-01

    Deinococcus radiodurans is an extremophile that withstands lethal doses of several DNA damaging agents such as gamma irradiation, UV rays, desiccation and chemical mutagens. The organism responds to DNA damage by inducing expression of several DNA repair genes. At least 25 radiation inducible gene promoters harbour a 17 bp palindromic sequence known as radiation and desiccation response motif (RDRM) implicated in gamma radiation inducible gene expression. However, mechanistic details of gamma radiation-responsive up-regulation in gene expression remain enigmatic. The promoters of highly radiation induced genes ddrB (DR0070), gyrB (DR0906), gyrA (DR1913), a hypothetical gene (DR1143) and recA (DR2338) from D. radiodurans were cloned in a green fluorescence protein (GFP)-based promoter probe shuttle vector pKG and their promoter activity was assessed in both E. coli as well as in D. radiodurans. The gyrA, gyrB and DR1143 gene promoters were active in E. coli although ddrB and recA promoters showed very weak activity. In D. radiodurans, all the five promoters were induced several fold following 6 kGy gamma irradiation. Highest induction was observed for ddrB promoter (25 fold), followed by DR1143 promoter (15 fold). The induction in the activity of gyrB, gyrA and recA promoters was 5, 3 and 2 fold, respectively. To assess the role of RDRM, the 17 bp palindromic sequence was deleted from these promoters. The promoters devoid of RDRM sequence displayed increase in the basal expression activity, but the radiation-responsive induction in promoter activity was completely lost. The substitution of two conserved bases of RDRM sequence yielded decreased radiation induction of PDR0070 promoter. Deletion of 5 bases from 5'-end of PDR0070 RDRM increased basal promoter activity, but radiation induction was completely abolished. Replacement of RDRM with non specific sequence of PDR0070 resulted in loss of basal expression and radiation induction. The results demonstrate that

  1. The study of the extreme radiation tolerance mechanisms of the bacterium Deinococcus deserti by a functional genomics approach

    Dulermo, R.

    2009-12-01

    The genome of Deinococcus deserti, a highly radiation-tolerant bacterium, was analyzed and compared to those of D. radiodurans and D. geothermalis. About 230 proteins are specifically conserved in these 3 species, including IrrE, a regulator protein essential for radio tolerance. D.deserti has several supplementary DNA repair genes, like imuY and dnaE2 (trans-lesion DNA polymerases). Moreover, D. deserti has 3 recA that code for 2 different RecA proteins (RecAC et RecAP). To study these genes, genetic tools were developed for D. deserti. Different results suggest that IrrE, required for the induction of several genes after irradiation, has peptidase activity. The 2 RecA proteins are functional for DNA repair. D. deserti is mutable by UV, which requires ImuY, DnaE2 and RecAC, but not RecAP. (author)

  2. Extracellular proteolytic activity of Deinococcus geothermalis ...

    Nonionic detergents like Triton X-100 and Tween 80 did not affect catalytic properties. It suggested that the enzyme produced by D. geothermalis could be used as a component of detergents. Keywords: Deinococcus geothermalis, alkaline protease, detergents, thermostability. African Journal of Biotechnology Vol. 12(25) ...

  3. The mechanisms of Micrococcus radiodurans radioresistance

    Samojlenko, I.I.

    1983-01-01

    Modern representations on molecular mechanisms of Micrococcus radiodurans viability under the effect of ionizing radiation have been considered. Factors conditioning a high level of micrococcus cell radiostability have been analyzed: peculiarities of structure of a cell wall, DNA, membranes; excess of genetic information; multiplicity of DNA implantation points to a membrane; high level of antioxidation and antiradical systems. It has been shown that on efficiency of accurate, properly balanced system of DNA repair combined with above Micrococcus radiodurant properties provide a high microorganism radioresistance

  4. The deoxyribonucleic acid of Micrococcus radiodurans

    Schein, Arnold H.

    1966-01-01

    The DNA of Micrococcus radiodurans was prepared by three methods. Although the recovery of DNA varied considerably, the percentage molar base ratios of the DNA from the three preparations were essentially the same: guanine, 33±2; adenine, 18±1; cytosine, 33±2; thymine, 17±1. Base compositions calculated from Tm values and from density in caesium chloride gradients also yielded guanine+cytosine contents of 66 and 68% of total bases respectively. No unusual bases were observed. The S20,w values were characteristic of high-molecular-weight DNA. Electron microscopy showed the purified DNA in long strands; occasionally these were coiled. Images(a)(b)(c)(d)(e)Fig. 1. PMID:16742439

  5. Major soluble proteome changes in Deinococcus deserti over the earliest stages following gamma-ray irradiation

    Dedieu, Alain; Sahinovic, Elodie; Guerin, Philippe; Armengaud, Jean; Blanchard, Laurence; Fochesato, Sylvain; Groot, Arjan de; Meunier, Bruno

    2013-01-01

    Deinococcus deserti VCD115 has been isolated from Sahara surface sand. This radio-tolerant bacterium represents an experimental model of choice to understand adaptation to harsh conditions encountered in hot arid deserts. We analysed the soluble proteome dynamics in this environmentally relevant model after exposure to 3 kGy gamma radiation, a non-lethal dose that generates massive DNA damages. For this, cells were harvested at different time lapses after irradiation and their soluble proteome contents have been analysed by 2-DE and mass spectrometry. In the first stage of the time course we observed accumulation of DNA damage response protein DdrB (that shows the highest fold change ∼11), SSB, and two different RecA proteins (RecAP and RecAC). Induction of DNA repair protein PprA, DNA damage response protein DdrD and the two gyrase subunits (GyrA and GyrB) was also detected. A response regulator of the SarP family, a type II site-specific deoxyribonuclease and a putative N-acetyltransferase are three new proteins found to be induced. In a more delayed stage, we observed accumulation of several proteins related to central metabolism and protein turn-over, as well as helicase UvrD and novel forms of both gyrase subunits differing in terms of isoelectric point and molecular weight. Conclusions: Post-translational modifications of GyrA (N-terminal methionine removal and acetylation) have been evidenced and their significance discussed. We found that the Deide-02842 restriction enzyme, which is specifically found in D. deserti, is a new potential member of the radiation/desiccation response regulon, highlighting the specificities of D. deserti compared to the D. radiodurans model. (authors)

  6. Repair of double-strand breaks in Micrococcus radiodurans

    Burrell, A.D.; Dean, C.J.

    1975-01-01

    Micrococcus radiodurans has been shown to sustain double-strand breaks in its DNA after exposure to x-radiation. Following sublethal doses of x-rays (200 krad in oxygen or less), the cells were able to repair these breaks, and an intermediate fast-sedimenting DNA component seemed to be involved in the repair process

  7. Effects of Deinococcus spp. supplement on egg quality traits in laying hens.

    Li, I-Chen; Wu, Szu-Yin; Liou, Jenn-Fa; Liu, Hsiao-Hui; Chen, Jiau-Hua; Chen, Chin-Chu

    2018-01-01

    To counter the ill effects of synthetic dyes, bacterial pigment production as an alternative is now one of the promising and emerging fields of research. This study was conducted to evaluate the applicability of Deinococcus genus on the egg quality traits in laying hens. In study I, 24 single comb White Leghorn layers were fed with various 1 wt % Deinococcus bacterial strains for 10 d. In study II, 84 brown Hendrix layers were fed with one of 4 diets containing 0, 0.2, 1, or 5 wt % Deinococcus sp. GKB-Aid 1995 powder for 12 wk. In study III, 60 White Leghorn laying hens were fed either with or without 1 wt % Deinococcus sp. GKB-Aid 1995 powder, 1 wt % Deinococcus sp. GKB-Aid 1995 granules, or 1 wt % Deinococcus sp. GKB-Aid 1995 oily granules for 10 successive d. In all of the experiments, feeding Deinococcus powder did not affect egg quality traits except for the yolk color. In particular, supplementation with all Deinococcus powder treatments changed the yolk color (P 1995. Moreover, longer supplementation of Deinococcus sp. GKB-Aid 1995 in study II had a significant effect on feed conversion ratio. With these findings under consideration, the present study suggests that the Deinococcus species, especially Deinococcus sp. GKB-Aid 1995, can be an excellent candidate for improving egg yolk color in laying hens. © 2017 Poultry Science Association Inc.

  8. γ-irradiated ribosomes from Micrococcus radiodurans in a cell-free protein synthesizing system

    Suessmuth, R.; Widmann, A.

    1979-01-01

    γ-irradiation inactivation of isolated ribosomes of Micrococcus radiodurans was studied by examining poly U directed synthesis of polyphenylalanine. Ribosomes of M. radiodurans did not show significant γ-radiation sensitivity up to a dose of approx. 11.6 k Gy. Cells of M. radiodurans take up more magnesium than E. coli cells under the same conditions. The magnesium content of ribosomes of M. radiodurans was 18% higher than that of E.coli ribosomes. A possible relation between Mg 2+ -content and γ-resistance is discussed. (orig.) [de

  9. Separation of DNA-dependent polymerate activities in Micrococcus radiodurans

    Kitayama, S.; Matsuyama, A.

    1977-01-01

    DNA polymerase activities in Micrococcus radiodurans were separated into two fractions after purification more than 2000 fold. They differ in pH optimum and residual activities in the absence of a full deoxyribonucleoside triphosphates complement. NAD partly inhibited one of the activities. Both activities were eluted as a single peak on gel filtration and sedimented at the same rate on glycerol gradient centrifugation. Molecular weight 140000 was calculated from Stokes radius and sedimentation constant. Deoxyribonuclease activity was detected on one of the polymerase activities which preferentially degraded double-stranded DNA. Priming activity of nicked DNA was reduced by γ-radiation. These results have been related to the possible roles in repair synthesis in vivo or DNA synthesis in permeable cells of M. radiodurans

  10. Separation of DNA-dependent polymerase activities in Micrococcus radiodurans

    Kitayama, S; Matsuyama, A [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1977-03-02

    DNA polymerase activities in Micrococcus radiodurans were separated into two fractions after purification more than 2000 fold. They differ in pH optimum and residual activities in the absence of a full deoxyribonucleoside triphosphates complement. NAD partly inhibited one of the activities. Both activities were eluted as a single peak on gel filtration and sedimented at the same rate on glycerol gradient centrifugation. Molecular weight 140000 was calculated from Stokes radius and sedimentation constant. Deoxyribonuclease activity was detected on one of the polymerase activities which preferentially degraded double-stranded DNA. Priming activity of nicked DNA was reduced by ..gamma.. radiation. These results have been related to the possible roles in repair synthesis in vivo or DNA synthesis in permeable cells of M. radiodurans.

  11. Deinococcus metallilatus sp. nov. and Deinococcus carri sp. nov., isolated from a car air-conditioning system.

    Kim, Dong-Uk; Lee, Hyosun; Lee, Ji-Hyeong; Ahn, Jae-Hyung; Lim, Sangyong; Jeong, Sunwook; Park, So Yoon; Seong, Chi Nam; Ka, Jong-Ok

    2015-09-01

    Two bacterial strains, designated MA1002(T) and MA1003(T), were isolated from the air-conditioning system of a car. Cells of both strains were Gram-reaction-positive, non-motile, non-spore-forming coccoids, catalase- and oxidase-positive and UV-radiation resistant. The major fatty acids of strain MA1002(T) were iso-C17 : 0 and iso-C15 : 0 and those of strain MA1003(T) were iso-C16 : 0 and iso-C16 : 1 H. The polar lipid profile of MA1002(T) contained phosphatidylethanolamine, two unidentified phosphoglycolipids, an unidentified phospholipid, an unidentified aminophospholipid, an unidentified aminolipid and an unidentified lipid. MA1003(T) had three unidentified phosphoglycolipids, six unidentified phospholipids, two unidentified glycolipids and two unidentified polar lipids as the polar lipids. The G+C contents of the genomic DNA of MA1002(T) and MA1003(T) were 70.5 and 76.0 mol%, respectively. MK-8 was the predominant respiratory quinone for both strains. 16S rRNA gene sequence analysis showed that strain MA1002(T) was phylogenetically related to Deinococcus apachensis DSM 19763(T), D. geothermalis DSM 11300(T), D. aerius TR0125(T) and D. aetherius ST0316(T) (92.9, 92.6, 92.0 and 91.9% sequence similarity, respectively), and MA1003(T) showed the highest sequence similarity to Deinococcus hopiensis KR-140(T) (92.9%) and D. xinjiangensis X-82(T) (91.4%). The results of genotypic and phenotypic characterizations showed that both strains could be distinguished from phylogenetically related species, and that the strains represented novel species within the genus Deinococcus, for which we propose the names Deinococcus metallilatus sp. nov. (type strain MA1002(T) = KACC 17964(T) = NBRC 110141(T)) and Deinococcus carri sp. nov. (type strain is MA1003(T) = KACC 17965(T) = NBRC 110142(T)).

  12. Loss of characteristic radiation resistance by mutation of Micrococcus radiodurans

    Kitayama, S.; Matusyama, A.

    1975-01-01

    The exceptional radioresistance of M. radiodurans was lost by a mutation, and the isolated mutant, KH840, had almost the same radiosensitivity as E. coli K12 AB1157 or B/r. DNA-strand scissions in this mutant were rejoined partly during post-irradiation incubation. Reduced DNA polymerizing activity and extensive degradation of the product was observed in vitro in the crude extract from the sensitive strain. The lower repair capability is not accompanied by the reduced transformation frequency

  13. Loss of characteristic radiation resistance by mutation of Micrococcus radiodurans

    Kitayama, S; Matusyama, A [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1975-09-01

    The exceptional radioresistance of M. radiodurans was lost by a mutation, and the isolated mutant, KH840, had almost the same radiosensitivity as E. coli K12 AB1157 or B/r. DNA-strand scissions in this mutant were rejoined partly during post-irradiation incubation. Reduced DNA polymerizing activity and extensive degradation of the product was observed in vitro in the crude extract from the sensitive strain. The lower repair capability is not accompanied by the reduced transformation frequency.

  14. Radioprotection in E. coli by an agent from M. radiodurans

    Goldstein, L S; Gersten, D M; Bruce, A K [State Univ. of New York, Buffalo (USA). Dept. of Biology

    1978-10-01

    An agent extracted from the radioresistant bacterium M. radiodurans was found to protect several strains of E. coli from X-radiation. Optimal radioprotection was observed when the repair-proficient B/r strain was irradiated in the presence of the agent under hypoxic conditions. It is proposed that this agent acts to modify damage incurred in the presence of reduced oxygen concentrations so that this damage might be subsequently repaired.

  15. Deinococcus Mn2+-peptide complex: A novel approach to alphavirus vaccine development.

    Gayen, Manoshi; Gupta, Paridhi; Morazzani, Elaine M; Gaidamakova, Elena K; Knollmann-Ritschel, Barbara; Daly, Michael J; Glass, Pamela J; Maheshwari, Radha K

    2017-06-22

    Over the last ten years, Chikungunya virus (CHIKV), an Old World alphavirus has caused numerous outbreaks in Asian and European countries and the Americas, making it an emerging pathogen of great global health importance. Venezuelan equine encephalitis virus (VEEV), a New World alphavirus, on the other hand, has been developed as a bioweapon in the past due to its ease of preparation, aerosol dispersion and high lethality in aerosolized form. Currently, there are no FDA approved vaccines against these viruses. In this study, we used a novel approach to develop inactivated vaccines for VEEV and CHIKV by applying gamma-radiation together with a synthetic Mn-decapeptide-phosphate complex (MnDpPi), based on manganous-peptide-orthophosphate antioxidants accumulated in the extremely radiation-resistant bacterium Deinococcus radiodurans. Classical gamma-irradiated vaccine development approaches are limited by immunogenicity-loss due to oxidative damage to the surface proteins at the high doses of radiation required for complete virus-inactivation. However, addition of MnDpPi during irradiation process selectively protects proteins, but not the nucleic acids, from the radiation-induced oxidative damage, as required for safe and efficacious vaccine development. Previously, this approach was used to develop a bacterial vaccine. In the present study, we show that this approach can successfully be applied to protecting mice against viral infections. Irradiation of VEEV and CHIKV in the presence of MnDpPi resulted in substantial epitope preservation even at supra-lethal doses of gamma-rays (50,000Gy). Irradiated viruses were found to be completely inactivated and safe in vivo (neonatal mice). Upon immunization, VEEV inactivated in the presence of MnDpPi resulted in drastically improved protective efficacy. Thus, the MnDpPi-based gamma-inactivation approach described here can readily be applied to developing vaccines against any pathogen of interest in a fast and cost

  16. Inactivation of the Radiation-Resistant Spoilage Bacterium Micrococcus radiodurans

    Duggan, D. E.; Anderson, A. W.; Elliker, P. R.

    1963-01-01

    A simplified technique permitting the pipetting of raw puréed meats for quantitative bacteriological study is described for use in determining survival of these non-sporing bacteria, which are exceptionally resistant to radiation. Survival curves, using gamma radiation as the sterilizing agent, were determined in raw beef with four strains of Micrococcus radiodurans. Survival curves of the R1 strain in other meat substrates showed that survival was significantly greater in raw beef and raw chicken than in raw fish or in cooked beef. Resistance was lowest in the buffer. Cells grown in broth (an artificial growth medium) and resuspended in beef did not differ in resistance from cells that had been grown and irradiated in beef. Survival rate was statistically independent of the initial cell concentration, even though there appeared to be a correlation between lower death rate and lower initial cell concentrations. The initial viable count of this culture of the domesticated R1 strain in beef was reduced by a factor of about 10-5 by 3.0 megarad, and 4.0 megarad reduced the initial count by a factor of more than 10-9. Data suggest that M. radiodurans R1 is more resistant to radiation than spore-forming spoilage bacteria for which inactivation rates have been published. PMID:14063780

  17. The resistance of Micrococcus radiodurans to killing and mutation by agents which damage DNA

    Sweet, D.M.; Moseley, B.E.B.

    1976-01-01

    The resistance of Micrococcus radiodurans to the lethal and mutagenic action of ultraviolet (UV) light, ionising (γ) radiation, mitomycin C (MTC), nitrous acid (NA), hydroxylamine (HA), N-methyl-N'-nitro-N-nitrosoguanidine (NG), ethylmethanesulphonate (EMS) and β-propiolactone (βPL) has been compared with that of Escherichia coli B/r. M. radiodurans was much more resistant than E. coli B/r to the lethal effects of UV light (by a factor of 33), γ-radiation (55), NG (15) and NA (62), showed intermediate resistance to MTC (4) and HA (7), but was sensitive to EMS (1) and βPL (2). M. radiodurans was very resistant to mutagens producing damage which can be repaired by a recombination system, indicating that it possesses an extremely efficient recombination repair mechanism. Both species were equally sensitive to mutation to trimethoprim resistance by NG, but M. radiodurans was more resistant than E. coli B/r to the other mutagens tested, being non-mutable by UV light, γ-radiation, MTC and HA, and only slightly sensitive to mutation by NA, EMS, and βPL. The resistance of M. radiodurans to mutation by UV light, γ-radiation and MTC is consistent with an hypothesis that recombination repair in M. radiodurans is accurate since these mutagens may depend on an 'error-prone' recombination system for their mutagenic effect in E. coli B/r. However, because M. radiodurans is also resistant to mutagens such as HA and EMS, which are mutagenic in E. coli in the absence of an 'error-prone' system, we propose that all the mutagens tested may have a common mode of action in E. coli B/r, but that this mutagenic pathway is missing in M. radiodurans

  18. Resistance of Micrococcus radiodurans to killing and mutation by agents which damage DNA

    Sweet, D M; Moseley, B E.B. [Edinburgh Univ. (UK). School of Agriculture

    1976-02-01

    The resistance of Micrococcus radiodurans to the lethal and mutagenic action of ultraviolet (UV) light, ionising (..gamma..) radiation, mitomycin C (MTC), nitrous acid (NA), hydroxylamine (HA), N-methyl-N'-nitro-N-nitrosoguanidine (NG), ethylmethanesulphonate (EMS) and ..beta..-propiolactone (..beta..PL) has been compared with that of Escherichia coli B/r. M. radiodurans was much more resistant than E. coli B/r to the lethal effects of UV light (by a factor of 33), ..gamma..-radiation (55), NG (15) and NA (62), showed intermediate resistance to MTC (4) and HA (7), but was sensitive to EMS (1) and ..beta..PL (2). M. radiodurans was very resistant to mutagens producing damage which can be repaired by a recombination system, indicating that it possesses an extremely efficient recombination repair mechanism. Both species were equally sensitive to mutation to trimethoprim resistance by NG, but M. radiodurans was more resistant than E. coli B/r to the other mutagens tested, being non-mutable by UV light, ..gamma..-radiation, MTC and HA, and only slightly sensitive to mutation by NA, EMS, and ..beta..PL. The resistance of M. radiodurans to mutation by UV light, ..gamma.. radiation and MTC is consistent with an hypothesis that recombination repair in M. radiodurans is accurate since these mutagens may depend on an 'error-prone' recombination system for their mutagenic effect in E. coli B/r. However, because M. radiodurans is also resistant to mutagens such as HA and EMS, which are mutagenic in E. coli in the absence of an 'error-prone' system, we propose that all the mutagens tested may have a common mode of action in E. coli B/r, but that this mutagenic pathway is missing in M. radiodurans.

  19. Deinococcus multiflagellatus sp. nov., isolated from a car air-conditioning system.

    Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

    2018-04-01

    A gamma radiation-resistant and pink-to-red pigmented bacterial strain, designated ID1504 T , was isolated from a car air-conditioning system sampled in Korea. The cells were observed to be Gram-stain negative, aerobic, motile with peritrichous flagella and short rod-shaped. Phylogenetically, the strain groups with the members of the genus Deinococcus and exhibits high 16S rRNA gene sequence similarities with Deinococcus arenae SA1 T (94.0%), Deinococcus actinosclerus BM2 T (93.9%) and Deinococcus soli N5 T (93.5%). The predominant fatty acids were identified as C 17:0 , C 16:0 , summed feature 3 (C 16:1 ω7c and/or C 16:1 ω6c) and iso-C 17:0 . The major respiratory quinone was identified as MK-8. The polar lipids were found to be comprised of unidentified phospholipids, unidentified glycolipids, an unidentified aminophospholipid and an unidentified lipid. The DNA G+C content of the strain was determined to be 68.3 mol%. On the basis of the phenotypic, genotypic and chemotaxonomic characteristics, strain ID1504 T should be classified in a novel species in the genus Deinococcus, for which the name Deinococcus multiflagellatus sp. nov. (= KACC 19287 T  = NBRC 112888 T ) is proposed.

  20. Role of manganese in the resistance of Micrococcus radiodurans to ionizing radiation

    Wierowski, J.V.

    1980-01-01

    Micrococcus radiodurans possesses a very high level of intracellular manganese compared to other organisms. This manganese content has previously been shown to participate in the exceptional ulraviolet radiation resistance of M. radiodurans. This study was undertaken to determine the role of manganese in the ionizing radiation resistant of M. radiodurans. The results indicate that manganese is essential for DNA degradation to occur during irradiation. Manganese has also proven essential for the second phase of post-irradiation thymine base damage removal. These factors work together to increase the rate of recovery from radiation damage, which is reflected in a larger Dq, D 37 and exponential portion of the survival curve of high Mn-grown cells

  1. Effects of oxygen during γ-irradiation of Micrococcus radiodurans

    Myers, D.K.; Johnson, L.D.

    1977-01-01

    A study has been made of the effects of oxygen on the yield of double strand breaks in the DNA of Micrococcus radiodurans, and of the relation of these effects to cell death. The o.e.r. values for cell survival were considerably smaller than those for the yield of double strand breaks, although they showed similar trends after irradiation in different media. The o.e.r. values for the inhibition of post-irradiation enzymatic repair were similar to those for cell survival. The o.e.r. for radiation-induced breaks in DNA therefore seems to depend on radiochemical reactions that are occurring during irradiation rather than on a preferential enzymatic repair of those strand breaks that are produced by anoxic irradiation. Cell survival depends less on the number of double strand breaks produced than on the ability of the cell to repair the double strand breaks. The maximum yield of double strand breaks after oxic γ-irradiation was approximately 1.7 breaks/krad/10 10 Daltons, corresponding to 1 break per 610 eV. (U.K.)

  2. Effects of oxygen during. gamma. irradiation of Micrococcus radiodurans

    Myers, D K; Johnson, L D [Atomic Energy of Canada Ltd., Chalk River, Ontario. Chalk River Nuclear Labs.

    1977-09-01

    A study has been made of the effects of oxygen on the yield of double strand breaks in the DNA of Micrococcus radiodurans, and of the relation of these effects to cell death. The OER values for cell survival were considerably smaller than those for the yield of double strand breaks, although they showed similar trends after irradiation in different media. The OER values for the inhibition of post-irradiation enzymatic repair were similar to those for cell survival. The OER for radiation-induced breaks in DNA therefore seems to depend on radiochemical reactions that are occurring during irradiation rather than on a preferential enzymatic repair of those strand breaks that are produced by anoxic irradiation. Cell survival depends less on the number of double strand breaks produced than on the ability of the cell to repair the double strand breaks. The maximum yield of double strand breaks after oxic ..gamma.. irradiation was approximately 1.7 breaks/krad/10/sup 10/Daltons, corresponding to 1 break per 610 eV.

  3. Genetic control over the processes of postirradiation recovery of a compact chromosome in micrococcus radiodurans

    Kudryashova, N.Yu.; Groshev, V.V.; Shestakov, S.V.

    1984-01-01

    X-irradiation of Micrococcus radiodurans cells with sublethal doses caused disturbances in the structure of a membrane-bound compact chromosome. Recovery of the compact chromosome occurred during the postirradiation incubation of the wild type cells and cells of the UVS-17 mutant deficient in DNA-polymerase. This process was blocked in cells of rec-30 mutant with the impaired system of genetic recombination: this is indicative of an important role played by rec-30 gene product in the postirradiation recovery of the compact chromosome in M. radiodurans cells

  4. Four Proteins Synthesized in Response to Deoxyribonucleic Acid Damage in Micrococcus Radiodurans

    Hansen, M. T.

    1980-01-01

    Four proteins, alpha beta, gamma, and delta, preferentially synthesized in ultraviolet light-treated cells of Micrococcus radiodurans, were characterized in terms of their molecular weights and isoelectric points. Within the sublethal-dose range, the differential rate of synthesis for these prote......Four proteins, alpha beta, gamma, and delta, preferentially synthesized in ultraviolet light-treated cells of Micrococcus radiodurans, were characterized in terms of their molecular weights and isoelectric points. Within the sublethal-dose range, the differential rate of synthesis...

  5. Deinococcus daejeonensis sp. nov., isolated from sludge in a sewage disposal plant.

    Srinivasan, Sathiyaraj; Kim, Myung Kyum; Lim, Sangyong; Joe, Minho; Lee, Myungjin

    2012-06-01

    A Gram-stain-positive, strictly aerobic, spherical, non-motile red-pigmented bacterial strain, designated MJ27(T), was isolated from a sludge sample of the Daejeon sewage disposal plant in South Korea. A polyphasic approach was used to study the taxonomic position of strain MJ27(T). Strain MJ27(T) shared highest 16S rRNA gene sequence similarity with Deinococcus grandis DSM 3963(T) (98.8 %), Deinococcus caeni Ho-08(T) (97.5 %) and Deinococcus aquaticus PB314(T) (96.6 %.); levels of sequence similarity with the type strains of other Deinococcus species were less than 96.0 %. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain MJ27(T) belonged to the clade formed by members of the genus Deinococcus in the family Deinococcaceae. The G+C content of the genomic DNA of strain MJ27(T) was 67.6 mol%. The chemotaxonomic characteristics of strain MJ27(T) were typical of members of the genus Deinococcus, with MK-8 as the predominant respiratory quinone, C(16:1)ω7c, C(15:1)ω6c, C(16:0) and C(15:0) as major fatty acids (>12 %), ornithine as the diamino acid in the cell-wall peptidoglycan and resistance to gamma radiation [D(10) (dose required to reduce the bacterial population by tenfold) >9 kGy]. The low levels of DNA-DNA relatedness reported here (5.3±1.5-29.2±2.3 %) indicate that strain MJ27(T) represents a species that is separate from its closest relatives in the genus Deinococcus. On the basis of phylogenetic inference, fatty acid profile and other phenotypic properties, strain MJ27(T) is considered to represent a novel species of the genus Deinococcus, for which the name Deinococcus daejeonensis sp. nov. is proposed. The type strain is MJ27(T) ( = KCTC 13751(T) = JCM 16918(T)).

  6. Studies on Post-Irradiation DNA Degradation in Micrococcus Radiodurans, Strain RII51

    Auda, H.; Emborg, C.

    1973-01-01

    The influence of irradiation condition on post-irradiation DNA degradation was studied in a radiation resistant mutant of M. radiodurans, strain ${\\rm R}_{{\\rm II}}5$. After irradiation with 1 Mrad or higher more DNA is degraded in cells irradiated in wet condition than in cells irradiated with t...

  7. Biofilms and planktonic cells of Deinococcus geothermalis in extreme environments

    Panitz, Corinna; Reitz, Guenther; Rabbow, Elke; Rettberg, Petra; Flemming, Hans-Curt; Wingender, Jost; Froesler, Jan

    In addition to the several extreme environments on Earth, Space can be considered as just another exceptional environment with a unique mixture of stress factors comprising UV radiation, vacuum, desiccation, temperature, ionizing radiation and microgravity. Life that processes in these environments can depend on the life forms and their state of living. The question is whether there are different strategies for individual microorganisms compared to communities of the same organisms to cope with the different factors of their surroundings. Comparative studies of the survi-val of these communities called biofilms and planktonic cell samples of Deinococcus geothermalis stand at the focal point of the presented investigations. A biofilm is a structured community of microorganisms that live encapsulated in a matrix of extracellular polymeric substances on a surface. Microorganisms living in a biofilm usually have significantly different properties to cooperate than individually living microorganisms of the same species. An advantage of the biofilm is increased resistance to various chemical and physical effects, while the dense extracellular matrix and the outer layer of the cells protect the interior of the microbial consortium. The space experiment BOSS (Biofilm organisms surfing Space) as part the ESA experimental unit EXPOSE R-2 with a planned launch date in July 2014 will be subsequently mounted on the Russian Svesda module outside the ISS. An international team of scientists coordinated by Dr. P. Rettberg will investigate the hypothesis whether microorganisms organized as biofilm outmatch the same microorganisms exposed individually in the long-term survival of the harsh environmental conditions as they occur in space and on Mars. Another protective function in the samples could be dust par-ticles for instance Mars regolith simulant contained inside the biofilms or mixed with the planktonic cells, as additional shelter especially against the extraterrestrial UV

  8. Quorum sensing circuit and reactive oxygen species resistance in Deinococcus sp.

    Fernandez-Bunster, G; Gonzalez, C; Barros, J; Martinez, M

    2012-12-01

    Genus Deinococcus is characterized by an increased resistance toward reactive oxygen species (ROS). The chromosome of five strains belonging to this genus has been sequenced and the presence of a luxS-like gene was deduced from their genome sequences. The aim of this study was to assess if a complete QS circuit is present in Deinococcus sp. and if this QS is associated with ROS. Primers for searching luxS-like gene and the putative receptor gene, namely ai2R, were designed. AI-2 signal production was evaluated by luminescence analysis using Vibrio harveyi BB170 as reporter strain. AI-2 signal was also evaluated by competitive assays using cinnamaldehyde, ascorbic acid, and 3-mercaptopropionic acid as interfering molecules. Potassium tellurite and metronidazole were used as oxidative stressors. A luxS-like gene as well as an ai2R gene was detected in strain UDEC-P1 by PCR. Cell-free supernatant of strain UDEC-P1 culture induced luminescence in V. harveyi BB170, and this property was inhibited with the three interfering molecules. The oxidative stressors metronidazole and potassium tellurite decreased Deinococcus sp. viability, but increased luminescence of the reporter strain. The results demonstrate that both a functional luxS-like gene and a putative receptor for AI-2 signal are present in Deinococcus sp. strain UDEC-P1. This finding also suggests that a complete QS circuit is present in this genus, which could be related to oxidative stress.

  9. The in vivo association of manganese with the chromosome of Micrococcus radiodurans

    Leibowitz, P J; Schwartzberg, L S; Bruce, A K [State Univ. of New York, Buffalo (USA). Dept. of Biology

    1976-01-01

    Extremely high levels of paramagnetic manganese (Mn/sup 2 +/) which quench phosphorescent reactions have been found to inhibit the formation of thymine-containing dimers in M. radiodurans. Lowering the concentration of Mn/sup 2 +/ in the culture medium resulted in a lower intracellular concentration of Mn/sup 2 +/, an increase in the uv-sensitivity of this bacterium, and a larger photochemical yield of thymine-containing dimers. High levels of paramagnetic Mn/sup 2 +/ were not found in other test organisms which are more sensitive to uv-irradiation. One interpretation of this data is that in Micrococcus radiodurans Mn2/sup +/+ may bind to the chromosome and thereby reduce the photochemical yield of thymine-containing dimers.

  10. Excision repair of 5,6-dihydroxydihydrothymine from the DNA of Micrococcus radiodurans

    Targovnik, H.S.; Hariharan, P.V.

    1980-01-01

    One of the major ionizing radiation products, 5,6-dihydroxydihydrothymine (thymine glycol), was measured in the DNA of Micrococcus radiodurans following exposure of cells to 6.8-MeV electrons or 254-nm ultraviolet light. Removal of 5,6-dihydroxydihydrothymine was measured in both an ionizing radiation-sensitive strain (262) and a highly radioresistant strain (the wild type W + ) of Micrococcus radiodurans. Within 30 min of incubation (33 0 C) following exposure to ultraviolet light (2400 J/m 2 ) approximately 60% of the thymine glycols were excised, whereas in the case of ionizing radiation (250 krad) only 35% were removed from the cellular DNA of the wild-type strain. In contrast less than 50% of the thymine glycols were excised from the sensitive strain. The amount of DNA degradation induced by radiation was less than 10% in both strains. The results suggest a possible correlation between reduced excision repair of base damage and increased radiation sensitivity

  11. Multiplicity of genome equivalents in the radiation-resistant bacterium Micrococcus radiodurans.

    Hansen, M T

    1978-01-01

    The complexity of the genome of Micrococcus radiodurans was determined to be (2.0 +/- 0.3) X 10(9) daltons by DNA renaturation kinetics. The number of genome equivalents of DNA per cell was calculated from the complexity and the content of DNA. A lower limit of four genome equivalents per cell was approached with decreasing growth rate. Thus, no haploid stage appeared to be realized in this organism. The replication time was estimated from the kinetics and amount of residual DNA synthesis after inhibiting initiation of new rounds of replication. From this, the redundancy of terminal genetic markers was calculated to vary with growth rate from four to approximately eight copies per cell. All genetic material, including the least abundant, is thus multiply represented in each cell. The potential significance of the maintenance in each cell of multiple gene copies is discussed in relation to the extreme radiation resistance of M. radiodurans. PMID:649572

  12. The in vivo association of manganese with the chromosome of Micrococcus radiodurans

    Leibowitz, P.J.; Schwartzberg, L.S.; Bruce, A.K.

    1976-01-01

    Extremely high levels of paramagnetic manganese (Mn 2+ ) which quench phosphorescent reactions have been found to inhibit the formation of thymine-containing dimers in M. radiodurans. Lowering the concentration of Mn 2+ in the culture medium resulted in a lower intracellular concentration of Mn 2+ , an increase in the UV-sensitivity of this bacterium, and a larger photochemical yield of thymine-containing dimers. High levels of paramagnetic Mn 2+ were not found in other test organisms which are more sensitive to UV-irradiation. One interpretation of this data is that in Micrococcus radiodurans Mn2 + + may bind to the chromosome and thereby reduce the photochemical yield of thymine-containing dimers. (author)

  13. Deinococcus aluminii sp. nov., isolated from an automobile air conditioning system.

    Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

    2018-01-16

    A Gram-stain-positive and pale pink-pigmented bacterial strain, designated ID0501 T , was isolated from an automobile evaporator core collected in the Republic of Korea. The cells were aerobic and coccoidal. The strain grew at 15-40 ˚C (optimum, 37 ˚C), at pH 6.0-7.0 (optimum, pH 6.5), and in the presence of 0-1.5 % (w/v) NaCl. Phylogenetically, the strain was related to members of the genus Deinococcus and showed the highest sequence similarity, of 96.9 %, with Deinococcus metallilatus MA1002 T . The major fatty acids of the strain were iso-C17 : 0, iso-C15 : 0 and iso-C13 : 0. The predominant respiratory quinone was MK-8. The polar lipids profile revealed the presence of phosphatidylethanolamine, phosphatidylglycerol, phosphatidylcholine, diphosphatidylglycerol, unidentified phospholipids, an unidentified aminolipid and unidentified glycolipids. The DNA G+C content of the strain was 68.3 mol%. On the basis of phenotypic, genotypic and chemotaxonomic data, strain ID0501 T represents a novel species of the genus Deinococcus, for which the name Deinococcusaluminii sp. nov. (=KACC 19286 T =NBRC 112889 T ) is proposed.

  14. Characterization and safety evaluation of a Deinococcus member as feed additive for hens.

    Wu, Szu-Yin; Li, I-Chen; Lin, Yi-Chin; Chen, Chin-Chu

    2016-04-01

    As previous studies mainly focus on understanding the mechanisms of radioresistance in Deinococcus bacteria, the present study aimed at characterizing and verifying the safety use of the GKB-Aid 1995 strain, a member of the radiation-resistant bacterial genus Deinococcus, as an ingredient in feed supplements. Using Vitek 2 system and 16S rRNA gene sequencing, GKB-Aid 1995 most resembles Deinococcus grandis. The Ames test, in vitro chromosomal test, in vivo micronucleus test and acute toxicity test were performed subsequently for its safety evaluation. As there is a possibility that the pigment of GKB-Aid 1995 can pass from feed to eggs intended for human consumption, an acute toxicity test was also carried out in pigmented egg yolk. The results confirmed that GKB-Aid 1995 was non-genotoxic in three genotoxicity experiments, and the LD50 of GKB-Aid 1995 and the pigmented egg yolk in ICR mice was greater than 10 and 12 g kg(-1) body weight, respectively. Overall, these data indicate that GKB-Aid 1995 is a non-toxic substance with no genotoxicity and is therefore safe to be used as a feed supplement or feed additive. This study suggests there is potential in developing GKB-Aid 1995 as an animal feed additive intended to enhance yolk coloration to meet the demand of consumers. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Origin of cell surface proteins released from Micrococcus radiodurans by ionizing radiation

    Mitchel, R.E.J.

    1975-01-01

    The exposure of Micrococcus radiodurans to sublethal doses of ionizing radiation causes the release of certain proteins into the surrounding medium. As estimated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, these proteins range from approximately 20,000 to 125,000 daltons. At least some of the proteins, including an exonuclease, have a surface location and appear to originate from the lipid-rich midwall layer. The exonuclease has two functionally distinct locations, one with its active site available to external substrate and a second with the active site masked from the exterior. Ionizing radiation releases both the masked and unmasked activity into the surrounding medium

  16. Rescue of Mitomycin C- or Psoralen-Inactivated Micrococcus Radiodurans by Additional Exposure to Radiation or Alkylating Agents

    Hansen, M. Trier

    1982-01-01

    The processing of damaged DNA was altered in a mitomycin C-sensitive mutant (mtcA) of Micrococcus radiodurans. Even though the mutant retained resistance to 254-nm UV radiation, it did not, in contrast to the wild-type strain, show any excessive DNA degradation or cell death when incubated...

  17. Studies on the Mechanism of Radiation Resistance in Micrococcus Radiodurans and its Sensitization

    Kitayama, S.; Matsuyama, A. [Radiobiology Laboratory, Institute of Physical and Chemical Research, Wako-shi, Saitama-ken (Japan)

    1978-06-15

    Efficient and accurate repair of radiation-induced lesions in M. radiodurans was investigated as to the cause of its extreme radioresistance. The cells were made permeable to deoxyribonucleoside triphosphate by treatment with non-ionic detergent, Triton X-100. After irradiation with 2 krad gamma rays more than 80% of the single-strand scissions were rejoined in the permeable cells within 10 min at 37 Degree-Sign C. This fast repair process requires the presence of deoxyribonucleoside triphosphates and NAD. However, rejoining of DNA strand scission was incomplete after prolonged incubation in the permeable cells. This suggests that alternate repair reaction(s) is necessary for complete recovery. The other type of radiation lesion was found by postirradiation incubation at non-permissive temperature, which markedly sensitizes this bacterium to radiation. Postincubation at this temperature also sensitizes the cells to chemicals that damage DNA. The extreme radioresistance of this bacterium was also lost by mutation and an isolated radiosensitive mutant showed almost the same radiosensitivity as E. coli K12 or B/r. These results are discussed in connection with the extreme radioresistance of M. radiodurans. (author)

  18. Studies on the mechanism of radiation resistance in Micrococcus radiodurans and its sensitization

    Kitayama, S.; Matsuyama, A.

    1978-01-01

    Efficient and accurate repair of radiation-induced lesions in M. radiodurans was investigated as to the cause of its extreme radioresistance. The cells were made permeable to deoxyribonucleoside triphosphate by treatment with non-ionic detergent, Triton X-100. After irradiation with 2 krad gamma rays more than 80% of the single-strand scissions were rejoined in the permeable cells within 10 min at 37 0 C. This fast repair process requires the presence of deoxyribonucleoside triphosphates and NAD. However, rejoining of DNA strand scission was incomplete after prolonged incubation in the permeable cells. This suggests that alternate repair reaction(s) is necessary for complete recovery. The other type of radiation lesion was found by post-irradiation incubation at non-permissive temperature, which markedly sensitizes this bacterium to radiation. Postincubation at this temperature also sensitizes the cells to chemicals that damage DNA. The extreme radioresistance of this bacterium was also lost by mutation and an isolated radiosensitive mutant showed almost the same radiosensitivity as E. coli K12 or B/r. These results are discussed in connection with the extreme radioresistance of M. radiodurans. (author)

  19. Deinococcus hibisci sp. nov., isolated from rhizosphere of Hibiscus syriacus L. (mugunghwa flower).

    Moya, Gabriela; Yan, Zheng-Fei; Chu, Dong-Hun; Won, KyungHwa; Yang, Jung-Eun; Wang, Qi-Jun; Kook, Moo-Chang; Yi, Tae-Hoo

    2018-01-01

    A Gram-stain-positive, pink-pigmented, coccus-shaped, strictly aerobic, non-motile bacterium, strain THG-AG1.5 T , was isolated from rhizosphere of Hibiscus syriacus L. (Mugunghwa flower) located in Kyung Hee University, Yongin, Gyeonggi, Republic of Korea. The isolated strain grew optimally at 25-30 °C, at pH 6.0-7.5 and in the presence of additional 0-1.5 % (w/v) NaCl. Strain THG-AG1.5 T exhibited tolerance to UV radiation (>1500 J m -2 ) and to gamma radiation (>12 kGy). Based on 16S rRNA gene sequence comparisons, strain THG-AG1.5 T was closely related to Deinococcus daejeonensis MJ27 T (98.03 %), Deinococcus radiotolerans C1 T (97.61 %) and Deinococcus grandis DSM 3963 T (97.32 %). The genomic DNA G+C content of strain THG-AG1.5 T was 74.8 mol%. The DNA-DNA hybridization values between strain THG-AG1.5 T and its closest phylogenetically neighbours were below 63.0 %. The peptidoglycan amino acids were alanine, valine, glutamic acid, glycine, ornithine, lysine and aspartic acid. Strain THG-AG1.5 T contained ribose, mannose and glucose as whole-cell-wall sugars and menaquinone-8 (MK-8) as the only isoprenoid quinone. The major component in the polyamine pattern was spermidine. The major polar lipids of strain THG-AG1.5 T were a phosphoglycolipid, six unidentified glycolipids and an unidentified aminophospholipid. The major fatty acids were identified as iso-C15 : 0, C15 : 1ω6c, C16 : 0, iso-C17 : 0, C17 : 0, C18 : 0 and summed feature 3. On the basis of our polyphasic taxonomy study, strain THG-AG1.5 T represents a novel species within the genus Deinococcus, for which the name Deinococcushibisci sp. nov. is proposed. The type strain is THG-AG1.5 T (=KACC 18850 T =CCTCC AB 2016078 T ).

  20. ORF Alignment: NC_001263 [GENIUS II[Archive

    Full Text Available | ... protease I [Deinococcus radiodurans R1] ... Length = 173 ... Query: 10 ... KKIAILAADGVEEIELTSP...RAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS 69 ... KKIAILAADGVEEIELTSPRAAIEA...AGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS Sbjct: 1 ... KKIAILAADGVEEIELTSPRAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS

  1. Repair of the double-strand breaks produced by /sup 125/I disintegrations in the DNA of micrococcus radiodurans

    Myers, D K [Atomic Energy of Canada Ltd., Chalk River, Ontario. Chalk River Nuclear Labs.

    1978-01-01

    Wild-type M. radiodurans and two radiosensitive mutants were used to study the lethal effects of /sup 125/I disintegrations in their DNA. The relative sensitivities of these three strains to inactivation by ..gamma..-radiation were reflected in their relative sensitivities to inactivation by /sup 125/I decay. The number of double-strand (ds) breaks in the DNA appeared to be similar at levels of ..gamma..-radiation and of /sup 125/I decay that reduced survival to 10%. All three strains of M. radiodurans rapidly repaired ds breaks produced in their DNA by either ..gamma..-radiation or /sup 125/I disintegrations. If one ds break per cell is a lethal event (Krisch. et al., 1975), cells of the three strains tested would die when they had left unrepaired one ds break out of an initial 45, 600 or 1800 ds breaks per single cell.

  2. DNA-membrane complex restoration in Micrococcus radiodurans after X-irradiation: relation to repair, DNA synthesis and DNA degradation

    Dardalhon-Samsonoff, M; Averbeck, D [Institut du Radium, 75 - Paris (France). Lab. Curie

    1980-07-01

    The DNA-membrane complex in Micrococcus radiodurans was shown to be essentially constituted of proteins, lipids and DNA. The complex was dissociated immediately after X-irradiation of cells and restored during post-incubation in complete medium. In X-irradiated protoplasts some DNA remained associated with the complex. Restoration of the complex during post-incubation was only seen in a medium favouring DNA polymerase and ligase activities. Under this condition no DNA synthesis occurred, suggesting that complex restoration may involve ligase activity. The complex restoration in the wild type and the X-ray sensitive mutant UV17 of M. radiodurans was strictly dependent on the X-ray dose. It was correlated with survival and DNA degradation but always preceded the onset of DNA synthesis after X-irradiation. At the same dose the complex restoration was about 2 fold lower in mutant than in wild type cells indicating that the restoration of the complex is related to repair capacity. The results are consistent with the idea that the complex protects X-irradiated DNA of M. radiodurans from further breakdown and, subsequently, permits DNA synthesis and repair to occur.

  3. Radiation-induced enhancement of enzymatic cell lysis of Micrococcus radiodurans

    Watanabe, H.; Takehisa, M.; Iizuka, H.

    1981-01-01

    The intact cells of M. radiodurans were rendered sensitive to the action of lytic enzyme (P2-2 enzyme) by irradiation. The radiation-induced enhancement of cell lysis with P2-2 enzyme was completely prevented by the addition of t-butanol and irradiation at liquid nitrogen temperature. These results indicate that the enhancement is due to indirect action resulting from OH radicals. Cell lysis by lysozyme was enhanced only when the cells were irradiated under N 2 O. The enhancement of cell lysis with lysozyme was also prevented by adding alcohols. On the other hand, when lipid components in cells were removed by extraction with n-butanol, the radiation-induced enhancement of cell lysis with P2-2 enzyme and lysozyme was not observed. From these results it is concluded that the enhancement of enzymatic cell lysis by irradiation is attributable to alteration in the lipid-rich layer of the cell wall caused by OH radicals

  4. Radiation-induced enhancement of enzymatic cell lysis of Micrococcus radiodurans

    Watanabe, H.; Takehisa, M. [Japan Atomic Energy Research Inst., Takasaki, Gunma, Takasaki Radiation Chemistry Research Establishment (Japan); Iizuka, H.

    1981-10-15

    The intact cells of M. radiodurans were rendered sensitive to the action of lytic enzyme (P2-2 enzyme) by irradiation. The radiation-induced enhancement of cell lysis with P2-2 enzyme was completely prevented by the addition of t-butanol and irradiation at liquid nitrogen temperature. These results indicate that the enhancement is due to indirect action resulting from OH radicals. Cell lysis by lysozyme was enhanced only when the cells were irradiated under N{sub 2}O. The enhancement of cell lysis with lysozyme was also prevented by adding alcohols. On the other hand, when lipid components in cells were removed by extraction with n-butanol, the radiation-induced enhancement of cell lysis with P2-2 enzyme and lysozyme was not observed. From these results it is concluded that the enhancement of enzymatic cell lysis by irradiation is attributable to alteration in the lipid-rich layer of the cell wall caused by OH radicals.

  5. Ionizing radiation damage in Micrococcus radiodurans cell wall: release of polysaccharide

    Mitchel, R.E.J.

    1976-01-01

    Sublethal 60 Co γ-irradiation of the bacterium Micrococcus radiodurans in aqueous suspension results in a loss of up to 6 percent of its cellular dry weight and 30 percent of its wet weight. In the process some specific cell wall polysaccharides, including a polymer of glucose and N-acylated glucosamine, are released into the surrounding medium. These polysaccharides appear to originate from a hydrophobic site in the middle, lipid-rich, cell wall layer. The damage to this layer which results in the release of these and other polymers may be due to a disruption of this hydrophobic site. The polysaccharide containing glucose and N-acylated glucosamine exists as a high molecular weight polymer in unirradiated cells, but irradiation causes some degradation prior to release. In a free state this polysaccharide is considerably less sensitive to radiolytic degradation than in a bound state. Free radicals generated from surrounding water by ionizing radiation initiate the release, hydroxyl radicals being the most important species. Oxygen protects the cell wall against loss of the polysaccharides, apparently by a mechanism which does not depend on the ability of O 2 to scavenge hydrogen atoms and aqueous electrons

  6. Effect of cordycepin(3'-deoxyadenosine) on excision repair of 5,6-dihydroxy-dihydrothymine-type products from the DNA of Micrococcus radiodurans

    Patil, M.S.; Tundo, V.J.; Locher, S.E.; Hariharan, P.V.

    1983-01-01

    Cordycepin(3'-deoxyadenosine), a nucleoside analog, has been shown to enhance radiation-induced cell killing. In an effort to elucidate the possible mechanism for enhancement of cell killing, the effect of cordycepin on the excision repair of radiation-induced 5,6-dihydroxy-dihydrothymine-type (t') products from the DNA of wild type Micrococcus radiodurans was investigated. The capacity of M. radiodurans to excise nondimeric (t') products from its DNA was significantly impaired after cordycepin treatment. The results suggest that the increased radiation sensitivity of cordycepin-treated cells could be due to alterations in cellular processes that repair DNA damage

  7. Involvement of hydroxyl radicals in the release by ionizing radiation of a cell surface nuclease from Micorcoccus radiodurans

    Mitchel, R.E.J.

    1975-01-01

    The ionizing radiation-induced release of a surface exonuclease from Micrococcus radiodurans is to a large extent inhibited by the removal of water. Irradiation of a cell suspension saturated with O 2 (an effective aqueous electron and hydrogen atom scavenger) allows the same release as irradiation in the presence of N 2 . Ethanol (a good hydroxyl radical scavenger) protects the enzyme from release. These data suggest that hydroxyl radicals produced by the radiolysis of water are important releasing agents. Hydroxyl radicals produced by the ultraviolet decomposition of H 2 O 2 were effective in releasing the enzyme

  8. Deinococcus gobiensis cold shock protein improves salt stress tolerance of escherichia coli

    Jiang Shijie; Wang Jin; Yang Mingkun; Chen Ming; Zhang Wei; Luo Xuegang

    2013-01-01

    The Deinococcus gobiensis I-0, an extremely radiation-resistant bacterium, isolated from the Gobi, has superior resistance to abiotic stress (e.g radiation, oxidation, dehydration and so on). The two cold-shock proteins encoded by csp1 (Dgo_CA1136) and csp2 (Dgo_PA0041) were identified in the complete genome sequence of D. gobiensis. In this study, we showed that D. gobiensis Csp1 protected Escherichia coli cells against cold shock and other abiotic stresses such as salt and osmotic shocks. The quantitative real-time PCR assay shows that the expression of trehalose synthase (otsA, otsB) was up-regulated remarkably under salt stress in the csp1-expressing strain, while no difference in the expression of the genes involved in trehalose degradation (treB and treC). The results suggested that Csp1 caused the accumulation of the trehalose was a major feature for improving tolerance to salt stress in E. coli. (authors)

  9. Micrococcus radiodurans surface exonuclease. Dimer to monomer conversion by ionizing radiation-generated aqueous free radicals

    Mitchel, R E.J.

    1980-01-01

    Micrococcus radiodurans possesses an exonuclease firmly bound to a middle cell wall membrane layer. Aqueous OH/sup -/ radicals generated chemically or by ionizing radiation cause the immediate release of this enzyme into the surrounding medium. The enzyme is located in a hydrophobic site and can also be released by aqueous n-butanol. When extracted by this solvent it is a non-covalently linked dimer and has a molecular weight of 260,000 as determined by gel filtration. When released by radiation generated OH/sup -/ radicals, the enzyme initially appears in solution as the dimer but is rapidly split by further aqueous radical attack into two 130,000 molecular weight subunits. Hydroxyl radicals are most effective but reducing radicals are also able to monomerize the enzyme. Only the released dimer enzyme is subject to free radical monomerization. Bound dimer enzyme is not split prior to release. No detectable loss of activity or change in catalytic properties accompanies the free radical cleavage of the enzyme. Both subunits of the dimer enzyme possess a tightly bound metal ion (probably Ca/sup 2 +/) required for activity. The monomer but not the dimer enzyme will bind to an anion exchanger. The monomer is susceptible to loss of its metal ion, and consequent inactivation, when exposed to the exchanger in the absence of Ca/sup 2 +/. Besides providing information on some of the immediate non-lethal effects of ionizing radiation, the behavior of this enzyme system demonstrates a potential cellular mechanism by which internally or externally generated free radicals could be utilized by the cell to control various enzymic reactions.

  10. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Daly, Michael J.

    2005-06-01

    Natural selection in highly radioactive waste sites may yield bacteria with favorable bioremediating characteristics. However, until recently the microbial ecology of such environments has remained unexplored because of the high costs and technical complexities associated with extracting and characterizing samples from such sites. We have examined the bacterial ecology within radioactive sediments from a high-level nuclear waste plume in the vadose zone on the DOE?s Hanford Site in south-central Washington state (Fredrickson et al, 2004). Manganese-dependent, radiation resistant bacteria have been isolated from this contaminated site including the highly Mn-dependent Deinococcus and Arthrobacter spp.

  11. Dormancy in Deinococcus sp. UDEC-P1 as a survival strategy to escape from deleterious effects of carbon starvation and temperature.

    Guerra, Matías; González, Karina; González, Carlos; Parra, Boris; Martínez, Miguel

    2015-09-01

    Dormancy is characterized by low metabolism and absence of protein synthesis and cellular division enabling bacterial cells to survive under stress. The aim was to determine if carbon starvation and low temperature are factors that modify the proportion of dormant/active cells in Deinococcus sp. UDEC-P1. By flow cytometry, RedoxSensor Green (RSG) was used to quantify metabolic activity and Propidium Iodide (PI) to evaluate membrane integrity in order to determine the percentage of dormant cells. Cell size and morphology were determined using scanning electronic microscopy. Under carbon starvation at 30°C, Deinococcus sp. UDEC-P1 increased its proportion of dormant cells from 0.1% to 20%, decreased the count of culturable cells and average cell volume decreased 7.1 times. At 4°C, however, the proportion of dormant cells increased only to 6%, without a change in the count of culturable cells and an average cellular volume decrease of 4.1 times and 3% of the dormant cells were able to be awakened. Results indicate a greater proportion of dormant Deinococcus sp. UDEC-P1 cells at 30ºC and it suggests that carbon starvation is more deleterious condition at 30ºC than 4ºC. For this reason Deinococcus sp. UDEC-P1 cells are more likely to enter into dormancy at higher temperature as a strategy to survive. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

  12. Catalyst of D. radiodurans LexA protein and its induced catalysis at alkaline pH activated by RecA

    Kong Xiangrong; Liu Fenju; Su Liaoyuan

    2003-01-01

    It is to study the catalytic reaction of LexA at alkaline pH. It has been observed that reaction has taken place under two conditions of D. radiodurans and LexA. Methods: The method of SDS polypropylene amine was adopted to make dyeing with R-250. Results: The result showed that there were no reactions when LexA protein turned to be at pH 7.0 and pH 8.0, the entire LexA protein was decreased a little at pH 9.0, while at pH 10.0, LexA protein started to decompose greatly, the fractions of protein can be seen obviously in the electrophoresis belt. Conclusion: The D. radiodurans and LexA protein will automatically drop at 37 degree C when D radiodurans LexA is at higher pH value, and its dependence on alkaline pH conditions reflects that the catalytic needs to be activated by the reaction of de- pH indicator of LexA protein ionization

  13. The Deinococcus-Thermus phylum and the effect of rRNA composition on phylogenetic tree construction

    Weisburg, W. G.; Giovannoni, S. J.; Woese, C. R.

    1989-01-01

    Through comparative analysis of 16S ribosomal RNA sequences, it can be shown that two seemingly dissimilar types of eubacteria Deinococcus and the ubiquitous hot spring organism Thermus are distantly but specifically related to one another. This confirms an earlier report based upon 16S rRNA oligonucleotide cataloging studies (Hensel et al., 1986). Their two lineages form a distinctive grouping within the eubacteria that deserved the taxonomic status of a phylum. The (partial) sequence of T. aquaticus rRNA appears relatively close to those of other thermophilic eubacteria. e.g. Thermotoga maritima and Thermomicrobium roseum. However, this closeness does not reflect a true evolutionary closeness; rather it is due to a "thermophilic convergence", the result of unusually high G+C composition in the rRNAs of thermophilic bacteria. Unless such compositional biases are taken into account, the branching order and root of phylogenetic trees can be incorrectly inferred.

  14. Synthesis of Hyperbranched Glycoconjugates by the Combined Action of Potato Phosphorylase and Glycogen Branching Enzyme from Deinococcus geothermalis

    Katja Loos

    2012-02-01

    Full Text Available Potato phosphorylase is able to synthesize linear polyglucans from maltoheptaose primers. By coupling maltoheptaose to butane diamine, tris(2-aminoethylamine and amine functionalized amine functionalized poly ethyleneglycol (PEG, new primer molecules became available. The resulting di-, tri- and macro-primers were incubated with potato phosphorylase and glycogen branching enzyme from Deinococcus geothermalis. Due to the action of both enzymes, hyperbranched polyglucan arms were grown from the maltoheptaose derivatives with a maximum degree of branching of 11%. The size of the synthesized hyperbranched polyglucans could be controlled by the ratio monomer over primer. About 60%–80% of the monomers were incorporated in the glycoconjugates. The resulting hyperbranched glycoconjugates were subjected to Dynamic Light Scattering (DLS measurements in order to determine the hydrodynamic radius and it became obvious that the structures formed agglomerates in the range of 14–32 nm.

  15. Review of anticancer and antioxidant activities of radioresistant ...

    Prof. Ogunji

    mechanism underlying the tolerance of these organisms to ionizing radiation. ... radiation dose environment, drastic temperature variations and high salinity ... extremophile like Deinococcus radiodurans for instance, is highly dependent on.

  16. Inactivation of bacterial spores by combination processes: ultraviolet plus gamma radiation. [Streptococcus faecium, micrococcus radiodurans, clostridium botulinum

    Grecz, N; Durban, E

    1973-01-01

    Bacterial spores, viruses and some vegetative bacteria such as Streptococcus faecium and Micrococcus radiodurans are distinguished by high radiation resistance. In order to lay a theoretical basis for biomedical sterilization applications, we have investigated the combined action of uv and gamma rays. Spores of two strains of C. botulinum were selected, a highly radiation resistant strain, 33A having a D/sub 10/-value of 0.32 Mrad, and a relatively radiation sensitive strain, 51B having a D/sub 10/-value of 0.12 Mrad. Strain 33A exhibits an extensive initial ''shoulder'' in its uv as well as gamma ray survival curves; strain 51B shows only a slight shoulder. The shoulder in the gamma ray survival curve of spores of strain 33A could be reduced or completely eliminated by preirradiation with uv. Simultaneously the D/sub 10/-value for gamma inactivation of spores of 33A was reduced substantially. For example, the gamma resistance was reduced almost to half of its original D/sub 10/-value by uv-preirradiation for only one minute under an 8 watt GE germicidal lamp. The effect of uv-preirradiation on the radiation sensitive strain 51B was less pronounced. In fact, there was about seven fold higher positive interaction (synergism) between uv and gamma radiation in 33A spores than in 51B spores. The experiments suggest that interference with DNA repair enzymes in the radiation resistant strain are responsible for lethal synergism between uv and gamma radiation. A hypothesis is developed attempting to explain the combined effect of these two radiations in terms of a special summation of known DNA lesions in the cell. These observations emphasize the potential practical advantages of combining uv and gamma rays for effective sterilization of certain biomedical devices, drugs and biologicals.

  17. Expression and purification of PprI protein from D.radiodurans R1 in escherichia coli

    Zhang Yongqin; Zhou Hui; Chen Jie; Yang Zhanshan

    2011-01-01

    In order to express and purify PprI protein from D.radiodurans R1 in E. coli, the full length of pprI gene was gained by PCR amplification using pCMV-HA-pprI as a template. The gene segment was inserted into vector pET-28a after digested by two restriction endonucleases Nco I and EcoR I. Then the recombinant vector pET-28a-His-pprI was transfected into E. coli BL21(DE3) RP. The PprI protein expression was induced by IPTG and the fusion protein was confirmed by SDS-PAGE and Western blotting. The expressive conditions of the protein such as E. coli' A 600 , concentration of IPTG, time and temperature of culture, were optimized. Finally the fusion protein was purified by Ni-NTA His Bind Resins and molecule boult. The experimental results show the fusion protein confirmed by Western blotting is 6 x His-PprI and its molecular weight is 37 kDa. The ladders of PprI protein at molecular weight 37 kDa were different due to difference of the PprI protein expression conditions if E. coli. The PprI protein exists both in supernatant and precipitation. The concentration of purified protein is about 0.15 mg/mL which was measured by BCA method. It is concluded that the recombinant plasmid pET-28a-His-pprI is constructed and the PprI fusion protein is expressed and purified. The results lay a solid foundation for studying the radio-resistance and immunity of PprI protein. (authors)

  18. ORF Alignment: NC_001263 [GENIUS II[Archive

    Full Text Available NC_001263 gi|15805432 >1bplA 2 169 309 525 3e-10 ... gb|AAF09983.1| alpha-dextran end...o-1,6-alpha-glucosidase [Deinococcus radiodurans] ... pir||D75524 alpha-dextran endo-1,6-alpha-glucos...idase - ... Deinococcus radiodurans (strain R1) ref|NP_294128.1| ... alpha-dextran endo-1,6-al

  19. Loss of covalently linked lipid as the mechanism for radiation-induced release of membrane-bound polysaccharide and exonuclease from Micrococcus radiodurans

    Mitchel, R.E.J.

    1981-01-01

    The mechanism of γ-radiation-induced release of polysaccharide and exonuclease from the midwall membrane of Micrococcus radiodurans has been examined. These two components appear to be released independently, but by very similar processes. Direct analysis of radiation-released polysaccharide indicated the absence of an alkali-labile neutral lipid normally present in the native material. Radiation-induced release therefore probably results from the radiolytic cleavage of a covalently linked lipid which normally serves to anchor these substances to the membrane. The absence of a natural membrane-bound carotenoid had no effect on the rate of release of these components. Likewise, the absence of exonuclease in an exonuclease minus mutant did not influence the release of polysaccharide. It is suggested that the major pathway of radical transfer from the initiating .OH and culminating in the cleavage of the neutral lipid anchor may not be via the membrane

  20. Comparative studies on the effect of ionizing and nonionizing radiations on the kinetics of DNA synthesis and postirradiation degradation in Micrococcus radiodurans R/sub 11/5

    Auda, H; Khalef, Z [Nuclear Centre Tuwaitha, Baghdad (Iraq)

    1982-06-01

    The kinetics of degradation and synthesis of DNA and the nature of radioactive substances released from M. radiodurans R/sub 11/5 labeled with thymidine-methyl-/sup 3/H after UV and gamma irradiations were investigated. The release of labeled material from the DNA began immediately upon incubation and terminated in due time 90 min and 180 min for UV and gamma irradiations, respectively. When acriflavine was added to the medium, post-irradiation degradation process did not terminate even after 9 h in the case of UV exposure. However, it terminated after 6 h in the case of gamma irradiation. In the presence of acriflavine, DNA synthesis resumed after termination of DNA degradation in the case of gamma irradiation and this was not observed in the case of UV irradiation. Degradation products were chromatographed and it was found that they were located in one major radioactive peak. However their locations were different for UV and gamma radiations. For UV irradiation, the peak fell in the thymine region, while for gamma irradiation it fell in the thymidine region.

  1. Comparative studies on the effect of ionizing and nonionizing radiations on the kinetics of DNA synthesis and postirradiation degradation in Micrococcus radiodurans R115

    Auda, H.; Khalef, Z.

    1982-01-01

    The kinetics of degradation and synthesis of DNA and the nature of radioactive substances released from M. radiodurans R 11 5 labeled with thymidine-methyl- 3 H after UV and gamma irradiations were investigated. The release of labeled material from the DNA began immediately upon incubation and terminated in due time 90 min and 180 min for UV and gamma irradiations, respectively. When acriflavine was added to the medium, post-irradiation degradation process did not terminate even after 9 h in the case of UV exposure. However, it terminated after 6 h in the case of gamma irradiation. In the presence of acriflavine, DNA synthesis resumed after termination of DNA degradation in the case of gamma irradiation and this was not observed in the case of UV irradiation. Degradation products were chromatographed and it was found that they were located in one major radioactive peak. However their locations were different for UV and gamma radiations. For UV irradiation, the peak fell in the thymine region, while for gamma irradiation it fell in the thymidine region. (author)

  2. Description of Deinococcus oregonensis sp. nov., from biological soil crusts in the Southwestern arid lands of the United States of America.

    Gundlapally, Sathyanarayana Reddy; Garcia-Pichel, Ferran

    2017-01-01

    Biological soil crusts are distinct habitats, harbor unique prokaryotic diversity and gave an impetus to isolate novel species. In the present study, a pink-pigmented bacterium, (OR316-6 T ), was isolated from biological soil crusts using oligotrophic BG11-PGY medium. Strain OR316-6 T was Gram-positive, short rods, non-motile and non-spore forming. Cells were positive for catalase, oxidase and β-galactosidase and negative for most of the enzymatic activities. The major fatty acids present were C 16:0 , C 17:0 , and C 16:1 ω7c and contained MK-8 and MK-10 as the predominant menaquinones. The cell wall peptidoglycan was of A3β variant with L-ornithine as the diamino acid. Based on the above characteristics, strain OR316-6 T was assigned to the genus Deinococcus. The phylogenetic analysis indicated that strain OR316-6 T was closely related to D. aquatilis DSM 23025 T with a 16S rRNA gene similarity of 99.3 % and clustered with a bootstrap value of 100 %. DNA-DNA similarity between strain OR316-6 T and D. aquatilis DSM 23025 T was 37.0 % indicating that strain OR316-6 T was a novel species. Further, DNA fingerprinting of stains OR316-6 T and D. aquatilis DSM 23035 T demonstrated that both strains were related to each other with a similarity coefficient of only 0.32 and supported the species status to strain OR316-6 T . In addition, phenotypic characteristics distinguished strain OR316-6 T from D. aquatilis DSM 23025 T . Based on the cumulative differences, strain OR316-16 T exhibited with its closely related species, it was identified as a novel species and proposed the name Deinococcus oregonensis sp. nov. The type strain is D. oregonensis sp. nov. (OR316-6 T  = JCM 13503 T  = DSM 17762 T ).

  3. Gene Expression Analysis of Four Radiation-resistant Bacteria

    Gao, Na; Ma, Bin-Guang; Zhang, Yu-Sheng; Song, Qin; Chen, Ling-Ling; Zhang, Hong-Yu

    2009-01-01

    To investigate the general radiation-resistant mechanisms of bacteria, bioinformatic method was employed to predict highly expressed genes for four radiation-resistant bacteria, i.e. Deinococcus geothermalis (D. geo), Deinococcus radiodurans (D. rad), Kineococcus radiotolerans (K. rad) and Rubrobacter xylanophilus (R. xyl). It is revealed that most of the three reference gene sets, i.e. ribosomal proteins, transcription factors and major chaperones, are generally highly expressed in the four ...

  4. Zograscopic viewing

    Koenderink, J.; Wijntjes, M.; Van Doorn, A.

    2013-01-01

    The “zograscope” is a “visual aid” (commonly known as “optical machine” in the 18th century) invented in the mid-18th century, and in general use until the early 20th century. It was intended to view single pictures (thus not stereographic pairs) with both eyes. The optics approximately eliminates

  5. Zograscopic viewing.

    Koenderink, Jan; Wijntjes, Maarten; van Doorn, Andrea

    2013-01-01

    The "zograscope" is a "visual aid" (commonly known as "optical machine" in the 18th century) invented in the mid-18th century, and in general use until the early 20th century. It was intended to view single pictures (thus not stereographic pairs) with both eyes. The optics approximately eliminates the physiological cues (binocular disparity, vergence, accommodation, movement parallax, and image blur) that might indicate the flatness of the picture surface. The spatial structure of pictorial space is due to the remaining pictorial cues. As a consequence, many (or perhaps most) observers are aware of a heightened "plasticity" of the pictorial content for zograscopic as compared with natural viewing. We discuss the optics of the zograscope in some detail. Such an analysis is not available in the literature, whereas common "explanations" of the apparatus are evidently nonsensical. We constructed a zograscope, using modern parts, and present psychophysical data on its performance.

  6. Remote viewing.

    Scott, C

    1988-04-15

    Remote viewing is the supposed faculty which enables a percipient, sited in a closed room, to describe the perceptions of a remote agent visiting an unknown target site. To provide convincing demonstration of such a faculty poses a range of experimental and practical problems, especially if feedback to the percipient is allowed after each trial. The precautions needed are elaborate and troublesome; many potential loopholes have to be plugged and there will be strong temptations to relax standards, requiring exceptional discipline and dedication by the experimenters. Most reports of remote viewing experiments are rather superficial and do not permit assessment of the experimental procedures with confidence; in many cases there is clear evidence of particular loopholes left unclosed. Any serious appraisal of the evidence would have to go beyond the reports. Meanwhile the published evidence is far from compelling, and certainly insufficient to justify overthrow of well-established scientific principles.

  7. Clipboard

    Unknown

    DNA Repair in Deinococcus radiodurans and in Germinating Bacterial Spores; J. Bacteriol. 186 5973–5977. Frenkiel-Krispin D, Levin-Zaidman S, Shimoni E, Wolf S G, Wachtel E J, Arad T, Finkel S E, Kolter R and. Minsky A 2001 Regulated phase transitions of bacterial chromatin: a non-enzymatic pathway for generic DNA.

  8. Journal of Biosciences | Indian Academy of Sciences

    In situ real-time evaluation of radiation-responsive promoters in the extremely radioresistant microbe Deinococcus radiodurans · Narasimha Anaganti Bhakti Basu Shree Kumar Apte · More Details Abstract Fulltext PDF. A third generation promoter probe shuttle vector pKG was constructed, using the green fluorescent ...

  9. Journal of Biosciences | Indian Academy of Sciences

    Effect of zinc and calcium ions on the rat kidney membrane-bound form of dipeptidyl ... ParA encoded on chromosome II of Deinococcus radiodurans binds to .... Repeated oral administration of capsaicin increases anxiety-like behaviours with ...

  10. Journal of Genetics | Indian Academy of Sciences

    PprA, a pleiotropic protein for radioresistance, works through DNA gyrase and shows cellular dynamics during postirradiation recovery in Deinococcus radiodurans .... Gene interactions and genetics of blast resistance and yield attributes in rice (Oryza ... Molecular mapping of a stripe rust resistance gene in wheat line C51.

  11. QlikView scripting

    Floyd, Matt

    2013-01-01

    This mini book offers information about QlikView scripting written in an easy-to-understand manner, and covers QlikView scripting from basic to advanced features in a compact format.If you are a basic orintermediate developer with some knowledge of QlikView applications and a basic understanding of QlikView scripting and data extraction and manipulation, this book will be great for you. If you are an advanced user, you can also use this book as a reference guide and teaching aid. If you are a QlikView project team member such as a business user, data/ETL professional, project manager, orsystem

  12. Synchronizing XPath Views

    Pedersen, Dennis; Pedersen, Torben Bach

    2004-01-01

    The increasing availability of XML-based data sources, e.g., for publishing data on the WWW, means that more and more applications (data consumers) rely on accessing and using XML data. Typically, the access is achieved by defining views over the XML data, and accessing data through these views....... However, the XML data sources are often independent of the data consumers and may change their schemas without notification, invalidating the XML views defined by the data consumers. This requires the view definitions to be updated to reflect the new structure of the data sources, a process termed view...... synchronization. XPath is the most commonly used language for retrieving parts of XML documents, and is thus an important cornerstone for XML view definitions. This paper presents techniques for discovering schema changes in XML data sources and synchronizing XPath-based views to reflect these schema changes...

  13. Mining Views : database views for data mining

    Blockeel, H.; Calders, T.; Fromont, É.; Goethals, B.; Prado, A.

    2008-01-01

    We present a system towards the integration of data mining into relational databases. To this end, a relational database model is proposed, based on the so called virtual mining views. We show that several types of patterns and models over the data, such as itemsets, association rules and decision

  14. Mining Views : database views for data mining

    Blockeel, H.; Calders, T.; Fromont, É.; Goethals, B.; Prado, A.; Nijssen, S.; De Raedt, L.

    2007-01-01

    We propose a relational database model towards the integration of data mining into relational database systems, based on the so called virtual mining views. We show that several types of patterns and models over the data, such as itemsets, association rules, decision trees and clusterings, can be

  15. The workplace window view

    Lottrup, Lene Birgitte Poulsen; Stigsdotter, Ulrika K.; Meilby, Henrik

    2015-01-01

    Office workers’ job satisfaction and ability to work are two important factors for the viability and competitiveness of most companies, and existing studies in contexts other than workplaces show relationships between a view of natural elements and, for example, student performance...... satisfaction, and that high view satisfaction was related to high work ability and high job satisfaction. Furthermore, the results indicated that job satisfaction mediated the effect of view satisfaction on work ability. These findings show that a view of a green outdoor environment at the workplace can...... be an important asset in workforce work ability and job satisfaction....

  16. Mastering QlikView

    Redmond, Stephen

    2014-01-01

    If you are a business application developer or a system analyst who has learned QlikView and Qlik Sense and now want to take your learning to a higher level, then this book is for you.It is assumed that you are aware of the fundamentals of QlikView and have working knowledge of development and in-memory analytics.

  17. VMware horizon view essentials

    von Oven, Peter

    2014-01-01

    If you are a desktop administrator or an end user of a computing project team looking to speed up to the latest VMware Horizon View solution, then this book is perfect for you. It is your ideal companion to deploy a solution to centrally manage and virtualize your desktop estate using Horizon View 6.0.

  18. Drupal 7 Views Cookbook

    Green, J Ayen

    2012-01-01

    This is a cookbook containing plenty of easy-to-follow practical recipes with screenshots that will help you in mastering the Drupal Views module. Drupal 7 Views Cookbook is for developers or technically proficient users who are fairly comfortable with the concepts behind websites and the Drupal environment.

  19. Hierarchical Linked Views

    Erbacher, Robert; Frincke, Deb

    2007-07-02

    Coordinated views have proven critical to the development of effective visualization environments. This results from the fact that a single view or representation of the data cannot show all of the intricacies of a given data set. Additionally, users will often need to correlate more data parameters than can effectively be integrated into a single visual display. Typically, development of multiple-linked views results in an adhoc configuration of views and associated interactions. The hierarchical model we are proposing is geared towards more effective organization of such environments and the views they encompass. At the same time, this model can effectively integrate much of the prior work on interactive and visual frameworks. Additionally, we expand the concept of views to incorporate perceptual views. This is related to the fact that visual displays can have information encoded at various levels of focus. Thus, a global view of the display provides overall trends of the data while focusing in on individual elements provides detailed specifics. By integrating interaction and perception into a single model, we show how one impacts the other. Typically, interaction and perception are considered separately, however, when interaction is being considered at a fundamental level and allowed to direct/modify the visualization directly we must consider them simultaneously and how they impact one another.

  20. "Private Views" Ungaris

    1999-01-01

    9. juulist Dunaujvarosi Kaasaegse Kunsti Instituudis eesti ja briti kunstnike ühisnäitus "Private Views. Ruum taasavastatud eesti ja briti kaasaegses kunstis". Kuraatorid Pam Skelton, Mare Tralla. Osalejad.

  1. "Private Views" Ungaris

    1999-01-01

    9. juulist Dunaujvarosi Kaasaegse Kunsti Instituudis eesti ja briti kunstnike ühisnäitus "Private Views. Ruum taasavastatud eesti ja briti kaasaegses kunstis" Kuraatorid Pam Skelton, Mare Tralla. Osalejad

  2. Japanese views on ASSET

    Hirano, M [Department of Reactor Safety Research, Japan Atomic Energy Research Inst. (Japan)

    1997-10-01

    The presentation briefly reviews the following aspects directed to ensuring NPP safety: Japanese participation in ASSET activities; views to ASSET activities; recent operating experience in Japan; future ASSET activities.

  3. BPMN process views construction

    Yongchareon, S.; Liu, Chengfei; Zhao, X.; Kowalkiewicz, M.; Kitagawa, H.; Ishikawa, Y.

    2010-01-01

    Process view technology is catching more attentions in modern business process management, as it enables the customisation of business process representation. This capability helps improve the privacy protection, authority control, flexible display, etc., in business process modelling. One of

  4. Competing views on cancer

    2014-03-15

    Mar 15, 2014 ... 'system' (or 'network'); it is, rather, between views that are. 'cell-based' and ... In the spirit of the meeting that provided the motivation for bringing out ..... of applications usually reward applications that abide by the. 'consensus'.

  5. Television viewing and snacking.

    Gore, Stacy A; Foster, Jill A; DiLillo, Vicki G; Kirk, Kathy; Smith West, Delia

    2003-11-01

    With the rise in obesity in America, the search for potential causes for this epidemic has begun to include a focus on environmental factors. Television (TV) viewing is one such factor, partially due to its potential as a stimulus for eating. The current study investigated the relationship between food intake and self-reported TV viewing in an effort to identify the impact of TV viewing on specific eating behaviors. Seventy-four overweight women seeking obesity treatment completed questionnaires assessing dietary habits and TV viewing behaviors. Results suggest that snacking, but not necessarily eating meals, while watching TV is associated with increased overall caloric intake and calories from fat. Therefore, interventions targeting stimulus control techniques to reduce snacking behavior may have an impact on overall caloric intake.

  6. Japanese views on ASSET

    Hirano, M.

    1997-01-01

    The presentation briefly reviews the following aspects directed to ensuring NPP safety: Japanese participation in ASSET activities; views to ASSET activities; recent operating experience in Japan; future ASSET activities

  7. to view fulltext PDF

    which encompasses India, Australia, a major portion of the .... Nepal earthquake in which many buildings and structures went ... The 1970 version (same as Figure 3) of code ... The national Seismic Zone Map presents a large-scale view of.

  8. Expression of lycopene biosynthesis genes fused in line with Shine-Dalgarno sequences improves the stress-tolerance of Lactococcus lactis.

    Dong, Xiangrong; Wang, Yanping; Yang, Fengyuan; Zhao, Shanshan; Tian, Bing; Li, Tao

    2017-01-01

    Lycopene biosynthetic genes from Deinococcus radiodurans were co-expressed in Lactococcus lactis to produce lycopene and improve its tolerance to stress. Lycopene-related genes from D. radiodurans, DR1395 (crtE), DR0862 (crtB), and DR0861 (crtI), were fused in line with S hine-Dalgarno (SD) sequences and co-expressed in L. lactis. The recombinant strain produced 0.36 mg lycopene g -1  dry cell wt after 48 h fermentation. The survival rate to UV irradiation of the recombinant strain was higher than that of the non-transformed strain. The L. lactis with co-expressed genes responsible for lycopene biosynthesis from D. radiodurans produced lycopene and exhibited increased resistance to UV stress, suggesting that the recombinant strain has important application potential in food industry.

  9. Immersive viewing engine

    Schonlau, William J.

    2006-05-01

    An immersive viewing engine providing basic telepresence functionality for a variety of application types is presented. Augmented reality, teleoperation and virtual reality applications all benefit from the use of head mounted display devices that present imagery appropriate to the user's head orientation at full frame rates. Our primary application is the viewing of remote environments, as with a camera equipped teleoperated vehicle. The conventional approach where imagery from a narrow field camera onboard the vehicle is presented to the user on a small rectangular screen is contrasted with an immersive viewing system where a cylindrical or spherical format image is received from a panoramic camera on the vehicle, resampled in response to sensed user head orientation and presented via wide field eyewear display, approaching 180 degrees of horizontal field. Of primary interest is the user's enhanced ability to perceive and understand image content, even when image resolution parameters are poor, due to the innate visual integration and 3-D model generation capabilities of the human visual system. A mathematical model for tracking user head position and resampling the panoramic image to attain distortion free viewing of the region appropriate to the user's current head pose is presented and consideration is given to providing the user with stereo viewing generated from depth map information derived using stereo from motion algorithms.

  10. Remote viewing of objects

    Motin, J.D.; Reformatsky, I.A.; Sinitsyn, P.R.; Ivanov, N.M.; Ivanov, B.I.; Malakhov, I.K.

    1979-01-01

    An object in a nuclear power plant is viewed through a radiation-proof shield by means of an entrance lens, optic fibre bundle and exit lens. The optic fibre bundle being heated to ensure thermostabilization of its light conducting properties in the presence of ionising radiation. Heating is by an electric heating coil. Alternatively, heating may be by argon itself heated by an electric heating element, a coating of resistive heating material, or absorption of neutrons in the material of the fibres or a coating therefor. Viewing may be on a CRT screen. (author)

  11. to view fulltext PDF

    2014-01-27

    Jan 27, 2014 ... in a short span of time in view of their safety and efficacy. However, it is ..... memory loss which is mainly caused due to reduced synthe- sis of the .... effects and 6–25 month follow-up did not reveal any long-term adverse ...

  12. Clashing world views

    Lagassa, G.

    1992-01-01

    This article examines how politics, economics, and an increasing awareness of environmental and societal impacts are affecting the market for new hydroelectric projects. The topics of the article include border conflicts, new opposition, resettlement issues, the problems and benefits of hydroelectric projects, taking action, and a clash of world views

  13. Taking a Long View

    Ougaard, Morten

    a global perspective which leads to a more positive assessment. I will do this from a historical materialist perspective and therefore I begin with a discussion of the long view in Marx. This leads on to a discussion of Marx’s law of the long term declining rate of profit (LTFRP) and its counteracting...

  14. VMware view security essentials

    Langenhan, Daniel

    2013-01-01

    A practical and fast-paced guide that gives you all the information you need to secure your virtual environment.This book is a ""how-to"" for the novice, a ""reference guide"" for the advanced user, and a ""go to"" for the experienced user in all the aspects of VMware View desktop virtualization security.

  15. to view fulltext PDF

    Prakash

    widely accepted model is the 'funnel view' of protein folding. (Bryngelson et al. ... The detailed characterization of the structure, dynamics and folding process of a protein is crucial for understanding ... molecular motor complexes that generate force towards the .... DLC8 phosphorylation by Pak1 prevents interaction with.

  16. to view fulltext PDF

    Schwarzschild metric for data interpretation or we have to use more exotic ... lensing—the Galactic Center—large telescopes—VLBI interferometry. .... telescopes were used in a 16-year long study to obtain the most detailed view ever of .... 2005) in the K-band (see also perspectives for observations with GRAVITY facili-.

  17. to view fulltext PDF

    Abstract. In the rapidly developing field of study of the transient sky, fast radio transients are perhaps the most exciting objects of scrutiny at present. The SKA, with its wide field-of-view and significant improve- ment in sensitivity over existing facilities, is expected to detect a plethora of fast transients which, in addition to help ...

  18. Stereoscopic optical viewing system

    Tallman, C.S.

    1986-05-02

    An improved optical system which provides the operator with a stereoscopic viewing field and depth of vision, particularly suitable for use in various machines such as electron or laser beam welding and drilling machines. The system features two separate but independently controlled optical viewing assemblies from the eyepiece to a spot directly above the working surface. Each optical assembly comprises a combination of eye pieces, turning prisms, telephoto lenses for providing magnification, achromatic imaging relay lenses and final stage pentagonal turning prisms. Adjustment for variations in distance from the turning prisms to the workpiece, necessitated by varying part sizes and configurations and by the operator's visual accuity, is provided separately for each optical assembly by means of separate manual controls at the operator console or within easy reach of the operator.

  19. Concert Viewing Headphones

    Kazuya Atsuta

    2011-01-01

    Full Text Available An audiovisual interface equipped with a projector, an inclina-tion sensor, and a distance sensor for zoom control has been developed that enables a user to selectively view and listen to specific performers in a video-taped group performance. Dubbed Concert Viewing Headphones, it has both image and sound processing functions. The image processing extracts the portion of the image indicated by the user and projects it free of distortion on the front and side walls. The sound processing creates imaginary microphones for those performers without one so that the user can hear the sound from any performer. Testing using images and sounds captured using a fisheye-lens camera and 37 lavalier microphones showed that sound locali-zation was fastest when an inverse square function was used for the sound mixing and that the zoom function was useful for locating the desired sound performance.

  20. Viewing Age: Lifespan Identity and Television Viewing Choices.

    Harwood, Jake

    1997-01-01

    Introduces a theoretical perspective on media viewing choices, grounded in social identity theory. Content analysis demonstrates that child, younger adult, and older adult television viewers show a preference for viewing characters of their own age. The experiment demonstrates that young adults' preference for viewing young adult characters exists…

  1. Space Elevators Preliminary Architectural View

    Pullum, L.; Swan, P. A.

    Space Systems Architecture has been expanded into a process by the US Department of Defense for their large scale systems of systems development programs. This paper uses the steps in the process to establishes a framework for Space Elevator systems to be developed and provides a methodology to manage complexity. This new approach to developing a family of systems is based upon three architectural views: Operational View OV), Systems View (SV), and Technical Standards View (TV). The top level view of the process establishes the stages for the development of the first Space Elevator and is called Architectural View - 1, Overview and Summary. This paper will show the guidelines and steps of the process while focusing upon components of the Space Elevator Preliminary Architecture View. This Preliminary Architecture View is presented as a draft starting point for the Space Elevator Project.

  2. Ultrasonic viewing device

    Ito, Juro.

    1979-01-01

    Purpose: To improve the safety of reactor operation by enabling to detect the states and positions of fuel assemblies over a wide range with a set of ultrasonic viewing device comprising a rotatable ultrasonic transmitter-receiver and a reflector mounted with an adjustable angle. Constitution: A driving portion for a ultrasonic viewing device is provided to a rotary plug closing the opening of a reactor vessel and a guide pipe suspending below the coolant level is provided to the driving portion. An ultrasonic transmitter-receiver is provided at the end of the holder tube in the guide pipe. A reflector is provided at the upper position of the reactor core so as to correspond to the ultrasonic transmitter-receiver. The ultrasonic transmitter-receiver, positioned by the driving portion, performs horizontal movement for scanning the entire surface of the top of the reactor core, as well as vertical movement covering the gap between the upper mechanism on the reactor and the reactor core, whereby the confirmation for the separation of the control rod and the detection for the states of the reactor core can be conducted by the reflection waves from the reflector. (Moriyama, K.)

  3. Side-View Face Recognition

    Santemiz, P.; Spreeuwers, Lieuwe Jan; Veldhuis, Raymond N.J.

    2010-01-01

    Side-view face recognition is a challenging problem with many applications. Especially in real-life scenarios where the environment is uncontrolled, coping with pose variations up to side-view positions is an important task for face recognition. In this paper we discuss the use of side view face

  4. The view from Kiev

    Kiselyov, S.

    1993-01-01

    This article reports the observations of correspondents for the Bulletin (two Russian journalists, one based in Moscow, the other in Kiev) who investigated the status of the Soviet Union's Black Sea Fleet and Ukraine's status as a non-nuclear-weapons state. After two years of wrangling and two earlier failed settlements, Russian President Boris Yeltsin met with Ukrainian President Leonid Kravchuk at Massandra in Crimea. On September 3, the leaders announced that Russia would buy out Ukraine's interest in the fleet and lease the port at Sevastopol. The Massandra summit was also supposed to settle Ukraine's status as a non-nuclear-weapons state. Described here are the Kiev-based correspondent's views on the Massandra summit (and its major topics), which was to have been called off by the Russian foreign ministry when Ukrainian Prime Minister Leonid Kuchma resigned

  5. False color viewing device

    Kronberg, J.W.

    1992-01-01

    A viewing device for observing objects in near-infrared false-color comprising a pair of goggles with one or more filters in the apertures, and pads that engage the face for blocking stray light from the sides so that all light reaching the user's eyes come through the filters. The filters attenuate most visible light and pass near-infrared (having wavelengths longer than approximately 700 nm) and a small amount of blue-green and blue-violet (having wavelengths in the 500 to 520 nm and shorter than 435 nm, respectively). The goggles are useful for looking at vegetation to identify different species and for determining the health of the vegetation, and to detect some forms of camouflage. 7 figs

  6. Views from Space

    Kitmacher, Gary H.

    2002-01-01

    aircraft like the high-flying U-2 spy planes for. Weather satellites permitted weather predictions as never before. Satellites were developed in the first ten years of the space program for earth resources and mapping. In this paper and presentation we will observe some of the best views taken in space and from space...of the Earth, and the moon and beyond. We will travel in space with our astronauts. Some of the photographs we will see are famous and others not nearly so. We will discuss some of the history behind the pictures and some of the benefits that have been gained from the views from space.

  7. VIRTUAL COMPETITIVENESS: YOUTHS’ VIEWS

    M. Yu. Semenov

    2018-01-01

    Full Text Available Introduction. Nowadays, the use of information and communication technologies (ICT has become an integral part both of every individual’s life and of the society in general. It is no longer possible to deny the impact of virtual environment on socialisation and development of the identity of young people. In this regard, the investigation of young people’s view on virtual social networks, and the possibility of students’ own competitiveness realization through various web services. The aim of the research presented in the article is to study the factors of students’ assessment of virtual social networks as a tool of personal fulfillment. Methodology and research methods. Content analysis and synthesis of scientific publications studies were carried out at a theoretical stage of the research; secondary sampling analysis of sociologic data material sources was conducted. The empirical research stage involved the instrument of questionnaire surveys, statistical data processing and interpretation of the results. Results and scientific novelty. The social survey conducted in 2017 with the participation of 1087 high school students and 1196 college students of the Tyumen Region shown that the more competitive students consider themselves, the more competitive they perceive the people having great popularity on the Internet. At that, compared to girls, young people are more inclined to consider the people having great popularity on the Internet competitive. It is determined that having a popular virtual media account for the young person is less worthwhile than for female respondents. The author explains this fact: male representatives regard it as “social capital” which can contribute to growth of their competitiveness in society as well as to achieve some profit. The author concludes that youth views on competitiveness are not directly related to the activity in virtual social networks. Frequent use by respondents of the Internet and

  8. Ways of Viewing Pictorial Plasticity

    Maarten W. A. Wijntjes

    2017-03-01

    Full Text Available The plastic effect is historically used to denote various forms of stereopsis. The vivid impression of depth often associated with binocular stereopsis can also be achieved in other ways, for example, using a synopter. Accounts of this go back over a hundred years. These ways of viewing all aim to diminish sensorial evidence that the picture is physically flat. Although various viewing modes have been proposed in the literature, their effects have never been compared. In the current study, we compared three viewing modes: monocular blur, synoptic viewing, and free viewing (using a placebo synopter. By designing a physical embodiment that was indistinguishable for the three experimental conditions, we kept observers naïve with respect to the differences between them; 197 observers participated in an experiment where the three viewing modes were compared by performing a rating task. Results indicate that synoptic viewing causes the largest plastic effect. Monocular blur scores lower than synoptic viewing but is still rated significantly higher than the baseline conditions. The results strengthen the idea that synoptic viewing is not due to a placebo effect. Furthermore, monocular blur has been verified for the first time as a way of experiencing the plastic effect, although the effect is smaller than synoptic viewing. We discuss the results with respect to the theoretical basis for the plastic effect. We show that current theories are not described with sufficient details to explain the differences we found.

  9. Ways of Viewing Pictorial Plasticity.

    Wijntjes, Maarten W A

    2017-01-01

    The plastic effect is historically used to denote various forms of stereopsis. The vivid impression of depth often associated with binocular stereopsis can also be achieved in other ways, for example, using a synopter. Accounts of this go back over a hundred years. These ways of viewing all aim to diminish sensorial evidence that the picture is physically flat. Although various viewing modes have been proposed in the literature, their effects have never been compared. In the current study, we compared three viewing modes: monocular blur, synoptic viewing, and free viewing (using a placebo synopter). By designing a physical embodiment that was indistinguishable for the three experimental conditions, we kept observers naïve with respect to the differences between them; 197 observers participated in an experiment where the three viewing modes were compared by performing a rating task. Results indicate that synoptic viewing causes the largest plastic effect. Monocular blur scores lower than synoptic viewing but is still rated significantly higher than the baseline conditions. The results strengthen the idea that synoptic viewing is not due to a placebo effect. Furthermore, monocular blur has been verified for the first time as a way of experiencing the plastic effect, although the effect is smaller than synoptic viewing. We discuss the results with respect to the theoretical basis for the plastic effect. We show that current theories are not described with sufficient details to explain the differences we found.

  10. A journalist's view

    Coudret, Paul

    1989-01-01

    This paper is the result of five years of experience with the nuclear world in Switzerland (five Swiss nuclear plants) from the point of view of a journalist, who doesn't pretend to know everything; who is neither scientific nor a technical journalist, he is writing for the man in the street, and works for a daily paper i.e. has to work very fast and as close to the reality as possible. Understanding and mutual confidence between the nuclear industry and media is emphasised as essential. 'Nuclear' people are specialists and are warned about the fact that they are dealing with non-specialists, journalists and the public who would like to understand what are the processes that might affect them and do not have a dictionary of technical terminology at hand. It is pointed out that the nuclear industry should speak openly about problems and accept being criticised if they want to restore confidence with the media and with the public

  11. The present view

    Salles, Samanta

    2013-01-01

    “La mirada vigente” is a homenage to Dan Beninson, who was one of the creators of radiation protection worldwide. He taught several generations of nuclear scientists in our country and abroad, playing a key role in the scientific-technological development of Argentina. He was also one of the key figures in the nuclear activity of our country; the creator of the institution that ensures its safety. Likewise, this book, is a testament about what this man meant for many people in Argentina (his country) and in the world (his yard); and simultaneously, a testament of the key moments in the history of a scientific discipline and the activity to which he dedicated his entire life. “La mirada vigente” is also a testimony of other individuals’ point of view. The eyes of others over the features of his person, and career, and his achievements. But above all, it provides a personal and almost intimate perspective, about specific episodes that describe his interesting life. “La mirada vigente” is the exploration of his versatile life, rich as only a few. And the reflection of a work legacy that still remain alive. [es

  12. Dutch radiodiagnostics viewed internationally

    Valois, J.C. de

    1990-01-01

    Dutch radiodiagnostics viewed internationally. - A quantitative description of diagnostic radiology is given in terms of radiological density (the number of radiological examinations per 1000 inhibitants), consumptions of roentgen film and contrast media. The data concerning examinations were recorded by a yearly inquiry system addressing all Dutch radiologists. The consumption of film and contrast media were derived from the data banks of the industries. In comparing these data with the data for Western Europe, Japan and the United States it is remarkable that diagnostic radiology scores lowest in regard to density, film consumption and use of contrast media. Only in the use of 35 mm cinefilm (coronary angiography) is The Netherlands number 2 on the list preceded by the United States. As a consequence radiation exposure of the population caused by diagnostic radiology is low in The Netherlands. Although the technical condition of the equipment is good due to regular and preventive service the life-span of the radiological equipment is gradually increasing beyond the limits of the normal economic depreciation. Growing arrears are found in the application of new technology: ultrasound, computer tomography and magnetic resonance imaging. The substitution of high osmolar contrast media by low osmolar media is also laggin gbehind. (author). 10 refs.; 1 fig.; 4 tab

  13. FWCW: a personal view.

    Li, A S

    1995-12-01

    The personal experiences at the Beijing Fourth World Conference on Women and the Nongovernmental Organization (NGO) Forum were described by a Chinese American veterinarian. The author became aware that women were primarily the persons living in poverty in the world. Business and government appeared more concerned with economic growth. As a consequence, developed countries with 20% of world population consume 80% of the world's resources. The privilege of money secures a position of power in the world, power to buy up the resources of the world. This process is unsustainable and inequitable. Women are viewed as key players in shifting the balance in favor of a higher quality of life. The NGO workshops on Women in Livestock Development (WILD) was run by women veterinarians, who worked at the local level with women in poor areas. WILD operates out of offices in Arkansas in the USA. WILD women work in Sichuan, China, among the Han and Tibetans in increasing family income through heifer and livestock production. Conference participants from WILD programs talked about their experiences with increased income and loans to other women. The World Women's Veterinary Association members, who attended the conference, visited a small animal clinic in Beijing run by the Agriculture Ministry, and Beijing Agricultural University and its Veterinary Teaching Hospital. Demonstrations were given of small animal acupuncture. The author found the conference to be a success and found that press reports misrepresented the energy generated by the meeting.

  14. New Paranal Views

    2001-01-01

    Last year saw very good progress at ESO's Paranal Observatory , the site of the Very Large Telescope (VLT). The third and fourth 8.2-m Unit Telescopes, MELIPAL and YEPUN had "First Light" (cf. PR 01/00 and PR 18/00 ), while the first two, ANTU and KUEYEN , were busy collecting first-class data for hundreds of astronomers. Meanwhile, work continued towards the next phase of the VLT project, the combination of the telescopes into the VLT Interferometer. The test instrument, VINCI (cf. PR 22/00 ) is now being installed in the VLTI Laboratory at the centre of the observing platform on the top of Paranal. Below is a new collection of video sequences and photos that illustrate the latest developments at the Paranal Observatory. The were obtained by the EPR Video Team in December 2000. The photos are available in different formats, including "high-resolution" that is suitable for reproduction purposes. A related ESO Video News Reel for professional broadcasters will soon become available and will be announced via the usual channels. Overview Paranal Observatory (Dec. 2000) Video Clip 02a/01 [MPEG - 4.5Mb] ESO PR Video Clip 02a/01 "Paranal Observatory (December 2000)" (4875 frames/3:15 min) [MPEG Video+Audio; 160x120 pix; 4.5Mb] [MPEG Video+Audio; 320x240 pix; 13.5 Mb] [RealMedia; streaming; 34kps] [RealMedia; streaming; 200kps] ESO Video Clip 02a/01 shows some of the construction activities at the Paranal Observatory in December 2000, beginning with a general view of the site. Then follow views of the Residencia , a building that has been designed by Architects Auer and Weber in Munich - it integrates very well into the desert, creating a welcome recreational site for staff and visitors in this harsh environment. The next scenes focus on the "stations" for the auxiliary telescopes for the VLTI and the installation of two delay lines in the 140-m long underground tunnel. The following part of the video clip shows the start-up of the excavation work for the 2.6-m VLT Survey

  15. NetView technical research

    1993-01-01

    This is the Final Technical Report for the NetView Technical Research task. This report is prepared in accordance with Contract Data Requirements List (CDRL) item A002. NetView assistance was provided and details are presented under the following headings: NetView Management Systems (NMS) project tasks; WBAFB IBM 3090; WPAFB AMDAHL; WPAFB IBM 3084; Hill AFB; McClellan AFB AMDAHL; McClellan AFB IBM 3090; and Warner-Robins AFB.

  16. Clinical Views: Object-Oriented Views for Clinical Databases

    Portoni, Luisa; Combi, Carlo; Pinciroli, Francesco

    1998-01-01

    We present here a prototype of a clinical information system for the archiving and the management of multimedia and temporally-oriented clinical data related to PTCA patients. The system is based on an object-oriented DBMS and supports multiple views and view schemas on patients' data. Remote data access is supported too.

  17. Critical Viewing and Participatory Democracy.

    Cohen, Jodi R.

    1994-01-01

    Illustrates ways that the work of some communication scholars with resistant, oppositional, and critical audiences does not, however, endorse active public life. Attempts to realign the language of critical viewing with the goals of participatory democracy by suggesting qualities of critical viewing that are conducive to achieving and maintaining…

  18. Service outsourcing with process views

    Eshuis, H.; Norta, A.H.; Kopp, O.; Pitkänen, E.

    2015-01-01

    Service outsourcing is a business paradigm in which an organization has a part of its business process performed by a service provider. Process views are pivotal to support this way of working. A process view shields secret or irrelevant details from a private business process, thus allowing an

  19. Communications and Development: Two Views.

    Development Communication Report, 1977

    1977-01-01

    Two views on current international communication are presented--that of an American academician, and that of an Indian journalist. John Lent traces the rise of development journalism and development communication from the point of view of those who believe that individual freedom of expression should be treated as an inviolable right. Narinder…

  20. The STAPL pView

    Buss, Antal

    2011-01-01

    The Standard Template Adaptive Parallel Library (STAPL) is a C++ parallel programming library that provides a collection of distributed data structures (pContainers) and parallel algorithms (pAlgorithms) and a generic methodology for extending them to provide customized functionality. STAPL algorithms are written in terms of pViews, which provide a generic access interface to pContainer data by abstracting common data structure concepts. Briefly, pViews allow the same pContainer to present multiple interfaces, e.g., enabling the same pMatrix to be \\'viewed\\' (or used) as a row-major or column-major matrix, or even as a vector. In this paper, we describe the stapl pView concept and its properties. pViews generalize the iterator concept and enable parallelism by providing random access to, and an ADT for, collections of elements. We illustrate how pViews provide support for managing the tradeoff between expressivity and performance and examine the performance overhead incurred when using pViews. © 2011 Springer-Verlag Berlin Heidelberg.

  1. The forgotten view: Chest X-ray - Lateral view

    Abraham M. Ittyachen

    2017-01-01

    Full Text Available With CT (computed tomography chest gaining more importance as a diagnostic tool, chest X-ray especially the lateral view is taken less commonly nowadays. Besides CT chest is also proven to be superior to chest X-ray in patients with major blunt trauma. We are presenting a 68-year old male who was partially treated from outside for a left sided pneumonia. He came to our hospital because of persisting chest pain. Chest X-ray, frontal view (postero-anterior was almost normal except for a mild opacity in the left lower zone. CT scan of the chest revealed a fluid collection posteriorly enclosed within enhancing pleura. Chest X-ray, left lateral view showed a corresponding posterior pleural based opacity. We are presenting this case to highlight the importance of the lateral view of the chest X-ray. In selected cases there is still a role for the lateral view. With the three dimensional visualization provided by the CT, the lateral view of the chest may be easier to understand. Consequent to the initial diagnosis by CT further follow up can be done with the chest X-ray. In a limited way this mitigates unnecessary expenditure and more importantly prevents the patient from exposure to harmful radiation in the form of repeated CT.

  2. Advanced LabVIEW Labs

    Jones, Eric D.

    1999-01-01

    In the world of computer-based data acquisition and control, the graphical interface program LabVIEW from National Instruments is so ubiquitous that in many ways it has almost become the laboratory standard. To date, there have been approximately fifteen books concerning LabVIEW, but Professor Essick's treatise takes on a completely different tack than all of the previous discussions. In the more standard treatments of the ways and wherefores of LabVIEW such as LabVIEW Graphical Programming: Practical Applications in Instrumentation and Control by Gary W. Johnson (McGraw Hill, NY 1997), the emphasis has been instructing the reader how to program LabVIEW to create a Virtual Instrument (VI) on the computer for interfacing to a particular instruments. LabVIEW is written in ''G'' a graphical programming language developed by National Instruments. In the past the emphasis has been on training the experimenter to learn ''G''. Without going into details here, ''G'' incorporates the usual loops, arithmetic expressions, etc., found in many programming languages, but in an icon (graphical) environment. The net result being that LabVIEW contains all of the standard methods needed for interfacing to instruments, data acquisition, data analysis, graphics, and also methodology to incorporate programs written in other languages into LabVIEW. Historically, according to Professor Essick, he developed a series of experiments for an upper division laboratory course for computer-based instrumentation. His observation was that while many students had the necessary background in computer programming languages, there were students who had virtually no concept about writing a computer program let alone a computer- based interfacing program. Thus the beginnings of a concept for not only teaching computer- based instrumentation techniques, but aiso a method for the beginner to experience writing a com- puter program. Professor Essick saw LabVIEW as the ''perfect environment in which to

  3. "Private Views" Ungaris / Katrin Kivimaa

    Kivimaa, Katrin, 1969-

    1999-01-01

    Inglise ja eesti kunstnike ühisprojekt 8. augustini Dunaujvarosi Kaasaegse Kunsti Instituudis Ungaris. Kuraatorid Pam Skelton, Mare Tralla. "Private Views" ülesandeks on keskenduda ruumi mõistele naiskunstniku pilgu läbi

  4. 'Private Views' Ungaris / Katrin Kivimaa

    Kivimaa, Katrin, 1969-

    1999-01-01

    Inglise js eesti kunstnike ühisprojekt 8. augustini Dunaujvarosi Kaasaegse Kunsti Instituudis Ungaris. Kuraatorid Pam Skelton, Mare Tralla. 'Private Views' ülesandeks on keskenduda ruumi mõistele naiskunstniku pilgu läbi.

  5. A broader view of justice.

    Jecker, Nancy S

    2008-10-01

    In this paper I argue that a narrow view of justice dominates the bioethics literature. I urge a broader view. As bioethicists, we often conceive of justice using a medical model. This model focuses attention at a particular point in time, namely, when someone who is already sick seeks access to scarce or expensive services. A medical model asks how we can fairly distribute those services. The broader view I endorse requires looking upstream, and asking how disease and suffering came about. In contrast to a medical model, a social model of justice considers how social determinants affect the health of a population. For example, social factors such as access to clean drinking water, education, safe workplaces, and police protection, profoundly affect risk for disease and early death. I examine one important social determinant of health, health care coverage, to show the limits of a medical model and the merits of a broader view.

  6. View synthesis using parallax invariance

    Dornaika, Fadi

    2001-06-01

    View synthesis becomes a focus of attention of both the computer vision and computer graphics communities. It consists of creating novel images of a scene as it would appear from novel viewpoints. View synthesis can be used in a wide variety of applications such as video compression, graphics generation, virtual reality and entertainment. This paper addresses the following problem. Given a dense disparity map between two reference images, we would like to synthesize a novel view of the same scene associated with a novel viewpoint. Most of the existing work is relying on building a set of 3D meshes which are then projected onto the new image (the rendering process is performed using texture mapping). The advantages of our view synthesis approach are as follows. First, the novel view is specified by a rotation and a translation which are the most natural way to express the virtual location of the camera. Second, the approach is able to synthesize highly realistic images whose viewing position is significantly far away from the reference viewpoints. Third, the approach is able to handle the visibility problem during the synthesis process. Our developed framework has two main steps. The first step (analysis step) consists of computing the homography at infinity, the epipoles, and thus the parallax field associated with the reference images. The second step (synthesis step) consists of warping the reference image into a new one, which is based on the invariance of the computed parallax field. The analysis step is working directly on the reference views, and only need to be performed once. Examples of synthesizing novel views using either feature correspondences or dense disparity map have demonstrated the feasibility of the proposed approach.

  7. Ways of Viewing Pictorial Plasticity

    Maarten W. A. Wijntjes

    2017-01-01

    The plastic effect is historically used to denote various forms of stereopsis. The vivid impression of depth often associated with binocular stereopsis can also be achieved in other ways, for example, using a synopter. Accounts of this go back over a hundred years. These ways of viewing all aim to diminish sensorial evidence that the picture is physically flat. Although various viewing modes have been proposed in the literature, their effects have never been compared. In the current study, we...

  8. Validation of a homology model of Mycobacterium tuberculosis DXS: rationalization of observed activities of thiamine derivatives as potent inhibitors of two orthologues of DXS.

    Masini, T; Lacy, B; Monjas, L; Hawksley, D; de Voogd, A R; Illarionov, B; Iqbal, A; Leeper, F J; Fischer, M; Kontoyianni, M; Hirsch, A K H

    2015-12-14

    The enzyme DXS catalyzes the first, rate-limiting step of the 2-C-methyl-d-erythritol-4-phosphate (MEP, 1) pathway using thiamine diphosphate (ThDP) as cofactor; the DXS-catalyzed reaction constitutes also the first step in vitamin B1 and B6 metabolism in bacteria. DXS is the least studied among the enzymes of this pathway in terms of crystallographic information, with only one complete crystal structure deposited in the Protein Data Bank (Deinococcus radiodurans DXS, PDB: ). We synthesized a series of thiamine and ThDP derivatives and tested them for their biochemical activity against two DXS orthologues, namely D. radiodurans DXS and Mycobacterium tuberculosis DXS. These experimental results, combined with advanced docking studies, led to the development and validation of a homology model of M. tuberculosis DXS, which, in turn, will guide medicinal chemists in rationally designing potential inhibitors for M. tuberculosis DXS.

  9. Occlusion-Aware View Interpolation

    Janusz Konrad

    2009-01-01

    Full Text Available View interpolation is an essential step in content preparation for multiview 3D displays, free-viewpoint video, and multiview image/video compression. It is performed by establishing a correspondence among views, followed by interpolation using the corresponding intensities. However, occlusions pose a significant challenge, especially if few input images are available. In this paper, we identify challenges related to disparity estimation and view interpolation in presence of occlusions. We then propose an occlusion-aware intermediate view interpolation algorithm that uses four input images to handle the disappearing areas. The algorithm consists of three steps. First, all pixels in view to be computed are classified in terms of their visibility in the input images. Then, disparity for each pixel is estimated from different image pairs depending on the computed visibility map. Finally, luminance/color of each pixel is adaptively interpolated from an image pair selected by its visibility label. Extensive experimental results show striking improvements in interpolated image quality over occlusion-unaware interpolation from two images and very significant gains over occlusion-aware spline-based reconstruction from four images, both on synthetic and real images. Although improvements are obvious only in the vicinity of object boundaries, this should be useful in high-quality 3D applications, such as digital 3D cinema and ultra-high resolution multiview autostereoscopic displays, where distortions at depth discontinuities are highly objectionable, especially if they vary with viewpoint change.

  10. Occlusion-Aware View Interpolation

    Ince Serdar

    2008-01-01

    Full Text Available Abstract View interpolation is an essential step in content preparation for multiview 3D displays, free-viewpoint video, and multiview image/video compression. It is performed by establishing a correspondence among views, followed by interpolation using the corresponding intensities. However, occlusions pose a significant challenge, especially if few input images are available. In this paper, we identify challenges related to disparity estimation and view interpolation in presence of occlusions. We then propose an occlusion-aware intermediate view interpolation algorithm that uses four input images to handle the disappearing areas. The algorithm consists of three steps. First, all pixels in view to be computed are classified in terms of their visibility in the input images. Then, disparity for each pixel is estimated from different image pairs depending on the computed visibility map. Finally, luminance/color of each pixel is adaptively interpolated from an image pair selected by its visibility label. Extensive experimental results show striking improvements in interpolated image quality over occlusion-unaware interpolation from two images and very significant gains over occlusion-aware spline-based reconstruction from four images, both on synthetic and real images. Although improvements are obvious only in the vicinity of object boundaries, this should be useful in high-quality 3D applications, such as digital 3D cinema and ultra-high resolution multiview autostereoscopic displays, where distortions at depth discontinuities are highly objectionable, especially if they vary with viewpoint change.

  11. Realistic Visualization of Virtual Views

    Livatino, Salvatore

    2005-01-01

    that can be impractical and sometime impossible. In addition, the artificial nature of data often makes visualized virtual scenarios not realistic enough. Not realistic in the sense that a synthetic scene is easy to discriminate visually from a natural scene. A new field of research has consequently...... developed and received much attention in recent years: Realistic Virtual View Synthesis. The main goal is a high fidelity representation of virtual scenarios while easing modeling and physical phenomena simulation. In particular, realism is achieved by the transfer to the novel view of all the physical...... phenomena captured in the reference photographs, (i.e. the transfer of photographic-realism). An overview of most prominent approaches in realistic virtual view synthesis will be presented and briefly discussed. Applications of proposed methods to visual survey, virtual cinematography, as well as mobile...

  12. Transient or permanent fisheye views

    Jakobsen, Mikkel Rønne; Hornbæk, Kasper

    2012-01-01

    Transient use of information visualization may support specific tasks without permanently changing the user interface. Transient visualizations provide immediate and transient use of information visualization close to and in the context of the user’s focus of attention. Little is known, however......, about the benefits and limitations of transient visualizations. We describe an experiment that compares the usability of a fisheye view that participants could call up temporarily, a permanent fisheye view, and a linear view: all interfaces gave access to source code in the editor of a widespread...... programming environment. Fourteen participants performed varied tasks involving navigation and understanding of source code. Participants used the three interfaces for between four and six hours in all. Time and accuracy measures were inconclusive, but subjective data showed a preference for the permanent...

  13. Eye Movements When Viewing Advertisements

    Emily eHiggins

    2014-03-01

    Full Text Available In this selective review, we examine key findings on eye movements when viewing advertisements. We begin with a brief, general introduction to the properties and neural underpinnings of saccadic eye movements. Next, we provide an overview of eye movement behavior during reading, scene perception, and visual search, since each of these activities is, at various times, involved in viewing ads. We then review the literature on eye movements when viewing print ads and warning labels (of the kind that appear on alcohol and tobacco ads, before turning to a consideration of advertisements in dynamic media (television and the Internet. Finally, we propose topics and methodological approaches that may prove to be useful in future research.

  14. Students' Views on Contextual Vocabulary Teaching: A Constructivist View

    Tosun, Bahadir Cahit

    2016-01-01

    The current study is a quantitative research that aims to throw light on the place of students' views on contextual vocabulary teaching in conformity with Constructivism (CVTC) in the field of foreign language teaching. Hence, the study investigates whether any significant correlation exists between the fourth year university students' attitudes…

  15. Young people’s own museum views

    Drotner, Kirsten; Knudsen, Line Vestergaard; Mortenesen, Christian Hviid

    2017-01-01

    Taking a mixed-methods, visitor-focused approach to views on museums, this article examines what views young Danes aged 13–23 years (n = 2,350) hold on museums and how these views can be categorized and articulated. Arguing that studying views of museums as socially situated meaning-making practi......Taking a mixed-methods, visitor-focused approach to views on museums, this article examines what views young Danes aged 13–23 years (n = 2,350) hold on museums and how these views can be categorized and articulated. Arguing that studying views of museums as socially situated meaning...

  16. Lighting for remote viewing systems

    Draper, J.V.

    1984-01-01

    Scenes viewed by television do not provide the same channels of information for judgment of distances as scenes viewed directly, since television eliminates or degrades several depth perception cues. However, it may be possible to improve depth perception of televised scenes by enhancing the information available through depth cues that are available from lighting. A literature survey and expert opinions were integrated to design a remote lighting arrangement which could enhance depth perception of operators performing remote handling operations. This paper describes the lighting arrangement and discusses some of its advantages and disadvantages. 10 references, 2 figures

  17. Lighting for remote viewing systems

    Draper, J.V.

    1984-01-01

    Scenes viewed by television do not provide the same channels of information for judgement of distances as scenes viewed directly, since television eliminates or degrades several depth perception cues. However, it may be possible to improve depth perception of televised scenes by enhancing the information available through depth cues that are available from lighting. A literature survey and expert opinions were integrated to design a remote lighting arrangement which could enhance depth perception of operators performing remote handling operations. This paper describes the lighting arrangement and discusses some of its advantages and disadvantages. 10 references, 2 figures

  18. Lighting for remote viewing systems

    Draper, J.V.

    1984-01-01

    Scenes viewed by television do not provide the same channels of information for judgment of distances as scenes viewed directly, since television eliminates or degrades several depth perception cues. However, it may be possible to improve depth perception of televised scenes by enhancing the information available through depth cues that are available from lighting. A literature survey and expert opinions were integrated to design a remote lighting arrangement which could enhance depth perception of operators performing remote handling operations. This paper describes the lighting arrangement and discusses some of its advantages and disadvantages

  19. Lighting for remote viewing systems

    Draper, J.V.

    1984-01-01

    Scenes viewed by television do not provide the same channels of information for judgment of distances as scenes viewed directly, since television eliminates or degrades several depth perception cues. However, it may be possible to improve depth perception of televised scenes by enhancing the information available through depth cues that are available from lighting. A literature survey and expert opinions were integrated to design a remote lighting arrangement which could enhance depth perception of operators performing remote handling operations. This paper describes the lighting arrangement and discusses some of its advantages and disadvantages. 10 references, 2 figures.

  20. Lighting for remote viewing systems

    Draper, J.V.

    1984-01-01

    Scenes viewed by television do not provide the same channels of information for judgement of distances as scenes viewed directly, since television eliminates or degrades several depth perception cues. However, it may be possible to improve depth perception of televised scenes by enhancing the information available through depth cues that are available from lighting. A literature survey and expert opinions were integrated to design a remote lighting arrangement which could enhance depth perception of operators performing remote handling operations. This paper describes the lighting arrangement and discusses some of its advantages and disadvantages. 10 references, 2 figures.

  1. View

    Prof.Thoithi

    Pesticides and household/industrial chemicals, the two most important poisoning agents, accounted for ... thousands of people are exposed to poisoning. ... highest death rate (52.9%) [2,3]. ... targeted at children must focus on these classes of ... Poison. Age in years. 0-5 6-13 14-20 21-30 31-40 41-50 > 50 Unspecified Total.

  2. Isolation and identification of a novel radio-resistant strain

    Zhang Zhidong; Mao Jun; Wang Wei; Tang Qiyong; Shi Yuhu

    2008-01-01

    A novel radio-resistant strain named RL2 was studied polyphasically, which was isolated from the soils in the Gurban-Tunggut Desert, Xinjiang. The strain is Gam-positive, sphere-shaped and pink pigmented; The DNA (G+C) contents of RL2 is 71.62mo1%; The 16S rDNA genes of RL2 and D. radiodurans type strain DSM20539 shows a high level of similarity (97.2%). According to phenotypic characteristics and phylogenetic analysis, it can be suggested that the strain RL2 has been identified as Deinococcus. sp and it may be a novel species. (authors)

  3. Epigenetic changes of DNA repair genes in cancer

    Lahtz, Christoph; Pfeifer, Gerd P.

    2011-01-01

    ‘Every Hour Hurts, The Last One Kills'. That is an old saying about getting old. Every day, thousands of DNA damaging events take place in each cell of our body, but efficient DNA repair systems have evolved to prevent that. However, our DNA repair system and that of most other organisms are not as perfect as that of Deinococcus radiodurans, for example, which is able to repair massive amounts of DNA damage at one time. In many instances, accumulation of DNA damage has been linked to cancer, ...

  4. DE-FG02-04ER63746 FinalTechnicalReport

    Lidstrom, M.E.

    2009-09-05

    This is the final technical report for a project involving the study of stress response systems in the radiation-resistant bacterium, Deinococcus radiodurans. Three stresses of importance for a mixed waste treatment strain were studied, heat shock, solvent shock, and phosphate starvation. In each case, specific genes involved in the ability to survive the stress were identified using a systems biology approach, and analysis of mutants was used to understand mechanisms. This study has led to increased understanding of the ways in which a potential treatment strain could be manipulated to survive multiple stresses for treatment of mixed wastes.

  5. Hitler's Reich Viewed from 1984

    Ward, James E.

    1971-01-01

    Viewed within a context of Orwell's 1984," the author's visit to East Germany, and particularly to the Museum for German History, revealed the efforts of an authoritarian regime to manipulate the thoughts and directions of that society to its own advantage. (JB)

  6. Ways of Viewing Pictorial Plasticity

    Wijntjes, M.W.A.

    2017-01-01

    The plastic effect is historically used to denote various forms of stereopsis. The vivid impression of depth often associated with binocular stereopsis can also be achieved in other ways, for example, using a synopter. Accounts of this go back over a hundred years. These ways of viewing all aim

  7. COMPETITION: CLASSICAL VERSUS NEOCLASSICAL VIEW

    Mihaela Cornelia Sandu

    2013-01-01

    Competition is an important element from economical theory. Over time it has experienced several definitions and classifications much of them being contradictory. In this paper I will make a parallel between classical and neoclassical point of view according to competition. Keywords. Competition; neoclassical theory; classical theory; monopolistic; perfect competition.

  8. Chemistry Teachers' Views of Creativity

    Akkanat, Çigdem; Gökdere, Murat

    2015-01-01

    The purpose of this study was to determine chemistry teachers' views of creativity. In this study, phenomenology method, one of the qualitative research patterns, was used. The participants of this study were 13 chemistry teachers working in Amasya. A semi-structured interview form was used for data collection. By using NVivo 9 qualitative…

  9. Side-View Face Recognition

    Santemiz, P.; Spreeuwers, Lieuwe Jan; Veldhuis, Raymond N.J.; van den Biggelaar, Olivier

    As a widely used biometrics, face recognition has many advantages such as being non-intrusive, natural and passive. On the other hand, in real-life scenarios with uncontrolled environment, pose variation up to side-view positions makes face recognition a challenging work. In this paper we discuss

  10. Useful field of view test.

    Wood, Joanne M; Owsley, Cynthia

    2014-01-01

    The useful field of view test was developed to reflect the visual difficulties that older adults experience with everyday tasks. Importantly, the useful field of view test (UFOV) is one of the most extensively researched and promising predictor tests for a range of driving outcomes measures, including driving ability and crash risk as well as other everyday tasks. Currently available commercial versions of the test can be administered using personal computers; these measure the speed of visual processing for rapid detection and localization of targets under conditions of divided visual attention and in the presence and absence of visual clutter. The test is believed to assess higher-order cognitive abilities, but performance also relies on visual sensory function because in order for targets to be attended to, they must be visible. The format of the UFOV has been modified over the years; the original version estimated the spatial extent of useful field of view, while the latest version measures visual processing speed. While deficits in the useful field of view are associated with functional impairments in everyday activities in older adults, there is also emerging evidence from several research groups that improvements in visual processing speed can be achieved through training. These improvements have been shown to reduce crash risk, and can have a positive impact on health and functional well-being, with the potential to increase the mobility and hence the independence of older adults. © 2014 S. Karger AG, Basel

  11. Time dependent view factor methods

    Kirkpatrick, R.C.

    1998-03-01

    View factors have been used for treating radiation transport between opaque surfaces bounding a transparent medium for several decades. However, in recent years they have been applied to problems involving intense bursts of radiation in enclosed volumes such as in the laser fusion hohlraums. In these problems, several aspects require treatment of time dependence

  12. Neural correlates of viewing paintings

    Vartanian, Oshin; Skov, Martin

    2014-01-01

    Many studies involving functional magnetic resonance imaging (fMRI) have exposed participants to paintings under varying task demands. To isolate neural systems that are activated reliably across fMRI studies in response to viewing paintings regardless of variation in task demands, a quantitative...

  13. Sublime Views and Beautiful Explanations

    Barry, Daved; Meisiek, Stefan; Hatch, Mary Jo

    To create a generative theory that provides beautiful explanations and sublime views requires both a crafts and an art approach to scientific theorizing. The search for generativity leads scholars to perform various theorizing moves between the confines of simple, yet eloquent beauty...

  14. Predicting User Views in Online News

    Hardt, Daniel; Rambow, Owen

    2017-01-01

    We analyze user viewing behavior on anonline news site. We collect data from64,000 news articles, and use text featuresto predict frequency of user views.We compare predictiveness of the headlineand “teaser” (viewed before clicking) andthe body (viewed after clicking). Both arepredictive of click...

  15. Audience Perceptions of Family Viewing Time

    Fontes, Brian F.; And Others

    1977-01-01

    Discusses a survey on Family Viewing Time designed to determine audience reactions to program content including violent and sexual content, audience perceptions of the suitability of program offerings for family viewing, and audience viewing habits with respect to Family Viewing Time. (MH)

  16. Updating Recursive XML Views of Relations

    Choi, Byron; Cong, Gao; Fan, Wenfei

    2009-01-01

    This paper investigates the view update problem for XML views published from relational data. We consider XML views defined in terms of mappings directed by possibly recursive DTDs compressed into DAGs and stored in relations. We provide new techniques to efficiently support XML view updates...... specified in terms of XPath expressions with recursion and complex filters. The interaction between XPath recursion and DAG compression of XML views makes the analysis of the XML view update problem rather intriguing. Furthermore, many issues are still open even for relational view updates, and need...... to be explored. In response to these, on the XML side, we revise the notion of side effects and update semantics based on the semantics of XML views, and present effecient algorithms to translate XML updates to relational view updates. On the relational side, we propose a mild condition on SPJ views, and show...

  17. QlikView Server and Publisher

    Redmond, Stephen

    2014-01-01

    This is a comprehensive guide with a step-by-step approach that enables you to host and manage servers using QlikView Server and QlikView Publisher.If you are a server administrator wanting to learn about how to deploy QlikView Server for server management,analysis and testing, and QlikView Publisher for publishing of business content then this is the perfect book for you. No prior experience with QlikView is expected.

  18. Views of the solar system

    Hamilton, C.

    1995-02-01

    Views of the Solar System has been created as an educational tour of the solar system. It contains images and information about the Sun, planets, moons, asteroids and comets found within the solar system. The image processing for many of the images was done by the author. This tour uses hypertext to allow space travel by simply clicking on a desired planet. This causes information and images about the planet to appear on screen. While on a planet page, hyperlinks travel to pages about the moons and other relevant available resources. Unusual terms are linked to and defined in the Glossary page. Statistical information of the planets and satellites can be browsed through lists sorted by name, radius and distance. History of Space Exploration contains information about rocket history, early astronauts, space missions, spacecraft and detailed chronology tables of space exploration. The Table of Contents page has links to all of the various pages within Views Of the Solar System.

  19. For current viewing resistor loads

    Lyons, Gregory R [Tijeras, NM; Hass, Jay B [Lee's Summit, MO

    2011-04-19

    The invention comprises a terminal unit for a flat cable comprising a BNC-PCB connector having a pin for electrically contacting one or more conducting elements of a flat cable, and a current viewing resistor having an opening through which the pin extends and having a resistor face that abuts a connector face of the BNC-PCB connector, wherein the device is a terminal unit for the flat cable.

  20. World View in Economic Science

    Kyzym Mykola O.

    2017-09-01

    Full Text Available In the process of updating the economic model of society there arose the problem of eliminating contradictions in the development of economic science that do not allow us to solve problems of practice in proven ways. Although these contradictions and methods for their resolving are partially reflected in many scientific publications, methodological and practical justifications for a comprehensive study of the reserves of the economic science development by combining the provisions of philosophy and disciplines of the humanities are still relevant. The solution of the problem of unpredictability of functioning and development of the economy using such a combination of scientific disciplines can be ensured by applying the world view models that enable justifying the vector of attention of scientists in the subject area of the problem. The constructiveness of the interaction of scientists representing different ontological views of the world depends on improving of the conceptual and categorical support of their dialogue. A scientific world view in such a composition creates a basis, firstly, for a fruitful discussion of representatives of various disciplines having a common subject of research, and, secondly, for overcoming the institutional and cognitive barriers to professional mobility of scientists. It can also serve to develop the mobility of representatives of professional communities of researchers.

  1. Physiological and molecular studies of the resistance to ionizing radiations of hyper-thermophilic archaea isolated from deep ocean hydrothermal sources

    Jolivet, E.

    2002-10-01

    In this study, we have first tested in vivo the effect of gamma irradiation on Pyrococcus abyssi, a hyper-thermophilic archaeon, isolated from a deep-sea hydrothermal vent. We have shown that this strain was as radioresistant as P. furiosus but less than Deinococcus radiodurans. The rates of double stranded breaks provoked into DNA following irradiation were monitored by the pulsed-field gel electrophoresis technique (P.F.G.E.) with P. abyssi, P. furiosus, D. radiodurans and Escherichia coli. Results clearly showed that all these rates were similar suggesting that no specific DNA protection system exits in Pyrococcus species. The growth of P. abyssi was efficiently recovered within two hours following the exposure to 2.5 kGy of gamma irradiation. As revealed by P.F.G.E., genomic DNA of P. abyssi totally fragmented after irradiation was efficiently restored within two hours presumably by inter chromosomal homologous recombination. The DNA replication in P. abyssi cells following irradiation at 2.5 kGy was blocked for 90 minutes that corresponds to the decay for repairing damaged DNA. Moreover, following irradiation P. abyssi actively expulse damaged DNA material before DNA replication resumes, preventing the amplification of genetic mutations. We have also showed that at least a subset cf P. abyssi DNA repair and replication proteins, such as RadA, RPA-41 and RFC-S. were constitutively expressed in chromatin bound forms in stationary phase cells. Our results were in agreement with the view that P. abyssi contains a very efficient DNA repair system, which is continuously ready to counteract the DNA damaged caused by the high temperature and/or ionizing radiation. For the first time, three novel hyper-thermophilic archaea species from deep-sea hydrothermal vents more radioresistant than P. abyssi were isolated and characterized, after 'y-irradiation exposures of some enrichment cultures. Thermococcus marinus, Thermococcus radiophilus and Thermococcus gammafolerans

  2. Stakeholder views on pharmacogenomic testing.

    Patel, Haridarshan N; Ursan, Iulia D; Zueger, Patrick M; Cavallari, Larisa H; Pickard, A Simon

    2014-02-01

    Pharmacogenomics has an important role in the evolution of personalized medicine, and its widespread uptake may ultimately depend on the interests and perspectives of key players in health care. Our aim was to summarize studies on stakeholder perspectives and attitudes toward pharmacogenomic testing. Thus, we conducted a review of original research studies that reported stakeholder views on pharmacogenomic testing using a structured approach in PubMed, International Pharmaceutical Abstracts, Cumulative Index to Nursing and Allied Health Literature, and EMBASE. A standardized data abstraction form was developed that included stakeholder group of interest-patients, general public, providers, and payers. Stakeholder views regarding barriers to pharmacogenetic implementation were organized into the following themes: ancillary information-related, clinical, economic, educational, ethical or legal, medical mistrust, and practicality. Of 34 studies that met our inclusion criteria, 37 perspectives were reported (15 on providers, 9 on the general public, 9 on patients, and 4 on payers). The most common topics that arose in studies of providers related to clinical usefulness of genetic data (n=11) and educational needs (n=11). Among the general public, the most common concerns were medical mistrust (n=5), insufficient education (n=5), and practicality (n=5). The most prevalent issues from the patient perspective were ethical or legal (n=6) and economic (n=5) issues. Among payers, leading issues were practicality (n=4) and clinical usefulness (n=3). There was overlap in the topics and concerns across stakeholder perspectives, including lack of knowledge about pharmacogenomic testing. Views on issues related to privacy, cost, and test result dissemination varied by stakeholder perspective. Limited research had been conducted in underrepresented groups. Efforts to address the issues raised by stakeholders may facilitate the implementation of pharmacogenomic testing into

  3. An Examination of Television Viewing Motivations.

    Rubin, Alan M.

    1981-01-01

    Identifies nine motivations for television viewing and relates these to age, viewing levels, television attitudes of attachment and reality, and program preferences. Implications of the results are discussed in terms of uses and gratifications research perspectives. (JMF)

  4. Formalizing correspondence rules for automotive architectural views

    Dajsuren, Y.; Gerpheide, C.M.; Serebrenik, A.; Wijs, A.J.; Vasilescu, B.N.; Brand, van den M.G.J.; Seinturier, L.; Bures, T.; McGregor, J.D.

    2014-01-01

    Architecture views have long been used in software industry to systematically model complex systems by representing them from the perspective of related stakeholder concerns. However, consensus has not been reached for the architecture views between automotive architecture description languages and

  5. Popperian and Inductivist Views of Science

    Fraser, Barry J.

    1977-01-01

    Illustrates that a view of the nature of science is dependent upon underlying assumptions concerning scientific proof. Compares the inductive view of science with the non-inductive viewpoint of Karl Popper. (CP)

  6. View based approach to forensic face recognition

    Dutta, A.; van Rootseler, R.T.A.; Veldhuis, Raymond N.J.; Spreeuwers, Lieuwe Jan

    Face recognition is a challenging problem for surveillance view images commonly encountered in a forensic face recognition case. One approach to deal with a non-frontal test image is to synthesize the corresponding frontal view image and compare it with frontal view reference images. However, it is

  7. Learning QlikView data visualization

    Pover, Karl

    2013-01-01

    A practical and fast-paced guide that gives you all the information you need to start developing charts from your data.Learning QlikView Data Visualization is for anybody interested in performing powerful data analysis and crafting insightful data visualization, independent of any previous knowledge of QlikView. Experience with spreadsheet software will help you understand QlikView functions.

  8. Adolescents' Motivations for Viewing Graphic Horror.

    Johnston, Deirdre D.

    1995-01-01

    Identifies four motivations adolescents report for viewing graphic horror films: gore watching, thrill watching, independent watching, and problem watching. Argues that viewing motivations are predictors of responses to graphic horror. Finds that viewing motivations were related to viewers' cognitive and affective responses and a tendency to…

  9. Views of Dr. Martin Luther King, Jr.

    Davis, Alan H.

    1990-01-01

    Discusses views of Martin Luther King, Jr., including concepts of human rights, related counseling approaches, and ethics. Claims King's views provide helpful insights for counselors and clients. Concludes King invited individuals to view challenging life situations as moral opportunities. (Author/ABL)

  10. Geophysicists' views about public engagement

    Besley, J. C.; Dudo, A.; Yuan, S.

    2016-12-01

    The proposed talk would present the results of 2016 survey of American Geophysical Union members (n = 2040) about public engagement. This survey took place as part of a broader, NSF funded, study of engagement views across eight different U.S.-based scientific societies. The presentation would include data about geophysicists' past engagement behavior and willingness to engage alongside data about engagement attitudes, perceived norms (i.e. beliefs about whether peers engage and value engagement), and perceived efficacy (i.e., scientists' beliefs about their own communication skills and the impact of engagement). The presentation would also include results that describe scientists' overall goals for engagement (e.g., increasing support for specific policy positions, changing citizen behavior, etc.), as well as their communication-specific objectives (e.g., increasing knowledge, increase excitement, etc.). All of the results would be put in the context of equivalent results from scientists from seven other societies across a variety of fields, including chemistry, biology, and the social sciences. Three themes that would be emphasized in the presentation include (1) the fact that there are substantial commonalities in engagement views across scientific fields, (2) the important role that perceived engagement skill (efficacy) appears to play in predicting engagement willingness, and (3) a lack of evidence that scientists are thinking about engagement in strategic ways. Strategic engagement, in this regard, would involve setting clear goals and then choosing activities that the social science of science communication suggests might allow one to achieve those goals. The presentation would conclude with thoughts about what might be done to improve the effectiveness of science communication training.

  11. Protease activity of PprI facilitates DNA damage response: Mn2+-dependence and substrate sequence-specificity of the proteolytic reaction.

    Yunguang Wang

    Full Text Available The extremophilic bacterium Deinococcus radiodurans exhibits an extraordinary resistance to ionizing radiation. Previous studies established that a protein named PprI, which exists only in the Deinococcus-Thermus family, acts as a general switch to orchestrate the expression of a number of DNA damage response (DDR proteins involved in cellular radio-resistance. Here we show that the regulatory mechanism of PprI depends on its Mn(2+-dependent protease activity toward DdrO, a transcription factor that suppresses DDR genes' expression. Recognition sequence-specificity around the PprI cleavage site is essential for DNA damage repair in vivo. PprI and DdrO mediate a novel DNA damage response pathway differing from the classic LexA-mediated SOS response system found in radiation-sensitive bacterium Escherichia coli. This PprI-mediated pathway in D. radiodurans is indispensable for its extreme radio-resistance and therefore its elucidation significantly advances our understanding of the DNA damage repair mechanism in this amazing organism.

  12. Perspective View, San Andreas Fault

    2000-01-01

    The prominent linear feature straight down the center of this perspective view is California's famous San Andreas Fault. The image, created with data from NASA's Shuttle Radar Topography Mission (SRTM), will be used by geologists studying fault dynamics and landforms resulting from active tectonics. This segment of the fault lies west of the city of Palmdale, Calif., about 100 kilometers (about 60 miles) northwest of Los Angeles. The fault is the active tectonic boundary between the North American plate on the right, and the Pacific plate on the left. Relative to each other, the Pacific plate is moving away from the viewer and the North American plate is moving toward the viewer along what geologists call a right lateral strike-slip fault. Two large mountain ranges are visible, the San Gabriel Mountains on the left and the Tehachapi Mountains in the upper right. Another fault, the Garlock Fault lies at the base of the Tehachapis; the San Andreas and the Garlock Faults meet in the center distance near the town of Gorman. In the distance, over the Tehachapi Mountains is California's Central Valley. Along the foothills in the right hand part of the image is the Antelope Valley, including the Antelope Valley California Poppy Reserve. The data used to create this image were acquired by SRTM aboard the Space Shuttle Endeavour, launched on February 11, 2000.This type of display adds the important dimension of elevation to the study of land use and environmental processes as observed in satellite images. The perspective view was created by draping a Landsat satellite image over an SRTM elevation model. Topography is exaggerated 1.5 times vertically. The Landsat image was provided by the United States Geological Survey's Earth Resources Observations Systems (EROS) Data Center, Sioux Falls, South Dakota.SRTM uses the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour

  13. School violence: an insider view.

    Johnson, Shelley A; Fisher, Kathleen

    2003-01-01

    To discover what teachers perceive to be contributing factors to violence in schools. Open-ended questions were asked of a convenience sample of teachers ( = 396) during an in-service education program on school violence. The teachers were in a semi-rural school district in a Mid-Atlantic state. Answers were analyzed using content analysis; all responses were reviewed and important themes were extracted. Identified themes were then placed into suitable categories and studied to determine relationships. Of the surveys analyzed ( = 239), 13 themes were identified. The three categories which then identified probable causes of school violence were (1) lack of knowledge, (2) lack of support, and (3) inadequate safety measures. Nurses can use the results of this study in multiple ways. One is to help parents understand their role in preventing school violence. Because violence in the home and violence in the media seem to foster violent acting-out behavior, nurses can teach parents about these correlations and seek solutions such as the elimination of family violence, and monitoring television viewing and video games. Nursing assessments of school-aged children and their families can include these elements. School nurses in particular can use these study results as an opportunity to develop interventions for students, teachers, and families that stress knowledge building about impulse control, anger management, appropriate parenting, and early intervention for at-risk children.

  14. Swine Flu -A Comprehensive View

    Singh, Vandana; Sood, Meenakshi

    2012-07-01

    The present article is aimed on comprehensive view of Swine flu. It was first isolated from pigs in 1930 in USA. Pandemic caused by H1N1 in 2009 brought it in limelight. Itís a viral respiratory disease caused by viruses that infects pigs, resulting in nasal secretions, barking cough, decreased appetite, and listless behavior. Swine virus consist of eight RNA strands, one strand derived from human flu strains, two from avian (bird) strains, and five from swine strains. Swine flu spreads from infected person to healthy person by inhalation or ingestion of droplets contaminated with virus while sneezing or coughing. Two antiviral agents have been reported to help prevent or reduce the effects of swine flu, flu shot and nasal spray. WHO recommended for pandemic period to prevent its future outbreaks through vaccines or non-vaccines means. Antiviral drugs effective against this virus are Tamiflu and Relenza. Rapid antigen testing (RIDT), DFA testing, viral culture, and molecular testing (RT-PCR) are used for its diagnosis in laboratory

  15. Career development: graduate nurse views.

    Cleary, Michelle; Horsfall, Jan; Muthulakshmi, Paulpandi; Happell, Brenda; Hunt, Glenn E

    2013-09-01

    To explore recent Singapore nursing graduates' experience of and views about their career development and progress. The recruitment and retention of an adequate number of registered nurses is a continuing workforce issue in Singapore and other major cities. Survey of recent nursing graduates. Recent nursing graduates from the Bachelor programme (n = 147) were sent an individual survey; a response rate of 54% was achieved. Findings show that nurses rated their self-concept in a positive manner and were most satisfied (moderately to very) with helping patients and providing effective care, and the level of patient involvement. They were least satisfied (moderately to only a little) with prestige among the general medical community and the general public, hours of work, lifestyle factors and research opportunities. The following four factors were identified as significant impediments to career development; lack of support in the work place; perceived insufficient clinical career development opportunities; excessive work hours; and limited access to merit-based places in further education. Suggestions made to overcome perceived career development barriers are as follows: broad multifactorial healthcare system changes; decreased and more flexible working hours; and fairer access to further clinical and higher education. Results highlight the value clinical nurses place on having access to career development opportunities, merit-based further education and work place supports. These factors also have the potential to influence patient care and impact on the retention of nurses in their present job and satisfaction with their nursing career. © 2013 Blackwell Publishing Ltd.

  16. Cosmological Views of Anania Shirakatsi

    Farmanyan, Sona V.; Mickaelian, Areg M.

    2017-12-01

    Since the ancient times the usage of cosmological ideas in mythology and poetry has contributed to the formation and development of human's philosophical thought. It is believed that before the M. Mashtots's alphabet, ancient Armenians have expressed their astronomical knowledge through stone structures and rock art.In the Armenian reality, the cosmological views, the idea of the spherical shape of the Earth and information of other celestial bodies more vividly were manifested in the works of Movses Khorenatsi, David Anhaght (5th century) and Anania Shirakatsi (7th century).Anania Shirakatsi is an Armenian Astronomer, Mathematician, Philosopher, Geographer and Alchemist.The importance of his work is also noted by foreign authors and he was called 7th century Cosmologist, First Scientist of Armenia and Middival Astronomer. Shirakatsi's works are united in his comprehensive knowledge, his insight of the mind, the ability of combining and analyzing facts and his literature talent.His works have simultaneous historical, cosmic, geographical, religious, literary and mystical significance. In the present study we will show Anania Shirakatsi's cosmological ideas and observations.

  17. Contemporary views on selective mutism

    Dimoski Sanja

    2016-01-01

    Full Text Available The aim of this paper is to review contemporary literature on selective mutism (SM, available in our language. The paper includes a contemporary definition of the disorder, previous studies of selective mutism, theories about its origin, and treatment. SM is a disorder that occurs in childhood, when a child's speech is selectively lacking in certain social situations. School is the context in which the disorder is typically manifested, which is why SM is often diagnosed only after children start school. The paper gives a historical account of changes in views on this disorder. Modern conceptions emphasize selective inability of children to spontaneously and successfully express themselves verbally. In researching SM, case studies on children who have selective mutism are most commonly published. Etiological factors are not precisely defined, and different conceptions give their interpretations depending on various theoretical frameworks. Some studies consistently indicate a relation between SM and social anxiety, and some with opposing behavior and delays in language development. Based on theoretical explanations of SM, psychological interventions (behavioral and cognitive-behavioral, psychodynamic and projective techniques, counseling and family therapy are created. Modern treatment of selective mutism includes an eclectic approach and emphasizes the role of teachers and school in general. Future studies should deepen the knowledge about selective mutism, specify the methodological procedure and stimulate the individualized treatment of children with SM.

  18. Stereo Viewing System. Innovative Technology Summary Report

    None

    2000-01-01

    The Stereo Viewing System provides stereoscopic viewing of Light Duty Utility Arm activities. Stereoscopic viewing allows operators to see the depth of objects. This capability improves the control of the Light Duty Utility Arm performed in DOE's underground radioactive waste storage tanks and allows operators to evaluate the depth of pits, seams, and other anomalies. Potential applications include Light Duty Utility Arm deployment operations at the Oak Ridge Reservation, Hanford Site, and the Idaho National Engineering and Environmental Laboratory

  19. The equine flexed lateral fetlock radiographic view

    Dyer, L.L.

    1993-01-01

    Recommendations for obtaining the flexed lateral radiographic view of the equine fetlock are provided. By tilting the X-ray tube in a 10-degrees dorsal direction, the angle of the flexed lateral fetlock joint is matched. While this view will not be effective on all horses, utilizing the flexed view aids in evaluating those horses that present an abnormal conformation when the fetlock joint is flexed

  20. A prospective view of radioprotection

    Barescut, Jean C.

    2008-01-01

    Full text: If we exclude the specific case of medical radioprotection and workers radioprotection, the main challenge of tomorrow radioprotection is the protection of usual people faced to a possible increase of ambient contamination, either as a consequence of usual releases of industry or as a consequence of sporadic accidents. From the view points of regulators and practitioners of radioprotection, we have to optimize today researches and studies, to optimize protection investments and to prepare future rules according to what could be the possible concerns of radioprotection in a near future. Clearly, when dealing with nuclear energy, a perspective of 30 years is not a very far one. A nuclear plant built today will still be in operation 30 years from now. But 30 years is a fairly long time compared to evolutions of science. For example, DNA was discovered in 1953 and gene engineering began seriously in the years 70s. There is no doubt that the evolution speed will not decrease and that the scientific situation will be quite different within 30 years. This could have many practical consequences. One is that the risk associated to radioactive stress could be better estimated, another is that precursors of a disease attributable to radioactivity will certainly be detected earlier and will allow cure to begin earlier. It is quite likely also that our ability to stimulate the natural defenses of organisms will improve. In an even more futuristic approach, the use of nanoengines or the use of highly selective killer processes at the cell level seems quite possible. Radioprotection will not only be influenced by science but also by the level of environmental threats. We have already a pretty good backward knowledge but, if we consider that the real beginning of industrial nuclear age was in the seventies, within 30 years, we will have more than 70 years of retrospective view. That should be enough to determine if our exposure to radioactivity is really increasing

  1. Physics and our View of the World

    Hilgevoord, Jan

    1994-11-01

    Foreword; 1. Introduction JAN HILGEVOORD; 2. Questioning the answers GERARD T. HOOFT; 3. Theories of everything JOHN BARROW; 4. The scientific view of the world DENNIS DIEKS; 5. Enlarging the world ERNAN McMULLIN; 6. The world of empiricism BAS VAN FRAASSEN; 7. Has the scientific view of the world a special status compared with other views? PAUL FEYERABEND; 8. Quantum theory and our view of the world PAUL FEYERABEND; 9. Interpretation of science - science as interpretation BAS VAN FRAASSEN; 10. Problems in debates about physics and religion WILLEM DREES; 11. The mind of God PAUL DAVIES; 12. The sources of models for God: metaphysics or metaphor? MARY HESSE; 13. Discussion.

  2. FACET, Radiation View Factor with Shadowing

    Shapiro, A.B.

    1988-01-01

    1 - Description of program or function: FACET calculates the radiation geometric view factor (alternatively called shape factor, angle factor, or configuration factor) between surfaces for axisymmetric, two-dimensional planar and three-dimensional geometries with interposed third surface obstructions. FACET was developed to calculate view factors as input data to finite element heat transfer analysis codes. 2 - Method of solution: Three algorithms are incorporated to integrate the view factor equation for three dimensional geometries. The algorithm used for any two surfaces depends on their geometric relationship and whether third surface obstructions exist. The three algorithms are the area integration (AI) method, the line integration method (LI), and the Mitalas and Stephenson (MS) method. The LI method is used to calculate the view factor between two disjoint surfaces. If the two surfaces have an adjoint edge, the MS method is used. The AI method is used if there is self or third surface shadowing. In two-dimensional planar geometries, the view factor between two surfaces is calculated using Hottel's cross string method. For axisymmetric geometries in the absence of shadowing, the view factor between two surfaces is calculated by view factor algebra using the view factors between parallel coaxial discs. In the presence of self or third surface shadowing, the geometry is represented in three dimensions before calculating the view factors

  3. Views on information literacy / Sichten auf Informationskompetenz

    Hapke, Thomas

    2017-01-01

    Poster (in English and German language) illustrating different views on information literacy. Poster in deutscher und englischer Sprache zur Veranschaulichung verschiedener Sichten auf Informationskompetenz.

  4. CRISM Views Phobos and Deimos

    2007-01-01

    These two images taken by the Compact Reconnaissance Imaging Spectrometer for Mars (CRISM) show Mars' two small moons, Phobos and Deimos, as seen from the Mars Reconnaissance Orbiter's low orbit around Mars. Both images were taken while the spacecraft was over Mars' night side, with the spacecraft turned off its normal nadir-viewing geometry to glimpse the moons. The image of Phobos, shown at the top, was taken at 0119 UTC on October 23 (9:19 p.m. EDT on Oct. 22), and shows features as small as 400 meters (1,320 feet) across. The image of Deimos, shown at the bottom, was taken at 2016 UTC (12:16 p.m. EDT) on June 7, 2007, and shows features as small as 1.3 kilometers (0.8 miles) across. Both CRISM images were taken in 544 colors covering 0.36-3.92 micrometers, and are displayed at twice the size in the original data for viewing purposes. Phobos and Deimos are about 21 and 12 kilometers (13.0 and 7.5 miles) in diameter and orbit Mars with periods of 7 hours, 39.2 minutes and 1 day, 6 hours, 17.9 minutes respectively. Because Phobos orbits Mars in a shorter time than Mars' 24 hour, 37.4-minute rotational period, to an observer on Mars' surface it would appear to rise in the west and set in the east. From Mars' surface, Phobos appears about one-third the diameter of the Moon from Earth, whereas Deimos appears as a bright star. The moons were discovered in 1877 by the astronomer Asaph Hall, and as satellites of a planet named for the Roman god of war, they were named for Greek mythological figures that personify fear and terror. The first spacecraft measurements of Phobos and Deimos, from the Mariner 9 and Viking Orbiter spacecraft, showed that both moons have dark surfaces reflecting only 5 to 7% of the sunlight that falls on them. The first reconstruction of the moons' spectrum of reflected sunlight was a difficult compilation from three different instruments, and appeared to show a flat, grayish spectrum resembling carbonaceous chondrite meteorites. Carbonaceous

  5. Symbol in View of Ambiguity

    Mohamad reza Yousefi

    2013-11-01

    Full Text Available Abstract Symbol from the perspective of rhetorical word, is phrase or sentence that apparent meaning, also inspires to reader a wide range of semantic.Since exploring the complex social and political ideas in the most mysticalway and indirectreflectionsocial and political thoughts symbolically is easier, so the symbol and symbolism especially in Persian literatureespeciallyin the realm of Persian poetry, has a special appearance.In addition to the factors mentioned in the contemporary literature, according familiar in literature and the emergence of particular schools interest toambiguoussymbolization has spreadfurther, especially the symbol has all the features of art ambiguity in the poem and it isone the major factors causing uncertainty.Thus, the precise definitions and symbols of contemporary poetry could be dominant in the unwinding ambiguous symbol detection of cryptic allusions and metaphors that matches the cursor symbol to help readers.  In the literature, especially language poetry, the inability of language toreflecting obscure mystical ideas, avoid to directexpression of political and social concerns of the reader in the course of participate to creation ambiguous literary works is the main motivation towards symbol and symbolization.According widespread use of symbol and its different of species can be viewed from different perspectives.The creation of ambiguity is the main purposes of using symbols (especially in poetry, so many poets have tried to achieve this goal have to formation of similar symbols and the explanation and resolution of this issue can open new window for understanding the poetry in front of an audience.  In this paper examines the ambiguity of symbols in terms of its precise boundaries are reviewed. Ambiguity is one of the important processes and also is the key Iranian poetry its means is today poetry. In such poetry ambiguity is a need to explore the new world from a different perspective, or explore this

  6. Enhancing multi-view autostereoscopic displays by viewing distance control (VDC)

    Jurk, Silvio; Duckstein, Bernd; Renault, Sylvain; Kuhlmey, Mathias; de la Barré, René; Ebner, Thomas

    2014-03-01

    Conventional multi-view displays spatially interlace various views of a 3D scene and form appropriate viewing channels. However, they only support sufficient stereo quality within a limited range around the nominal viewing distance (NVD). If this distance is maintained, two slightly divergent views are projected to the person's eyes, both covering the entire screen. With increasing deviations from the NVD the stereo image quality decreases. As a major drawback in usability, the manufacturer so far assigns this distance. We propose a software-based solution that corrects false view assignments depending on the distance of the viewer. Our novel approach enables continuous view adaptation based on the calculation of intermediate views and a column-bycolumn rendering method. The algorithm controls each individual subpixel and generates a new interleaving pattern from selected views. In addition, we use color-coded test content to verify its efficacy. This novel technology helps shifting the physically determined NVD to a user-defined distance thereby supporting stereopsis. The recent viewing positions can fall in front or behind the NVD of the original setup. Our algorithm can be applied to all multi-view autostereoscopic displays — independent of the ascent or the periodicity of the optical element. In general, the viewing distance can be corrected with a factor of more than 2.5. By creating a continuous viewing area the visualized 3D content is suitable even for persons with largely divergent intraocular distance — adults and children alike — without any deficiency in spatial perception.

  7. MISR Views the Middle East

    2000-01-01

    This image, generated using 16 orbits of MISR data collected between August 16 and August 30, 2000, takes us to the cradle of many civilizations. The data are from the 60-degree aftward-viewing camera. Because the individual orbit swaths are only 400 kilometers wide, they were 'mosaiced' together to form this composite picture, which covers about 2700 kilometers from west to east and 1750 kilometers from north to south. A few discontinuities are present in the mosaic, particularly near clouds, due to changes in the scene which occurred between dates when the individual orbit data were acquired.At the northern tip of the Red Sea, the Gulf of Suez and the Gulf of Aqaba frame the sandy deserts and spectacular mountains of the Sinai Peninsula. The highest peaks are Gebel Katherina (Mountain of St. Catherine, 2637 meters) and Gebel Musa (Mountain of Moses, also known as Mount Sinai, 2285 meters). To the northeast, Israel and Jordan flank the Dead Sea, one of the saltiest inland water bodies in the world. At its northern edge is Qumran, where the ancient Scrolls were discovered; the city of Jerusalem lies about 30 kilometers to the west.Several large rivers are prominent. Flowing southeastward through Iraq are the Tigris and Euphrates. The dark area between the two rivers, northwest of the Persian Gulf, is a very fertile region where fishing and farming are prevalent. Wending its way through eastern Egypt is the Nile. In the south is Lake Nasser and the Aswan Dam; continuing northward the Nile passes the Temple of Luxor as it sharply loops to the east. It then turns west and northward, eventually passing the capital city of Cairo, and finally spreading into a prominent delta as it empties into the Mediterranean Sea. The bright dot just west of the apex of the delta marks the location of the great Pyramids and Sphinx complexes on the Giza Plateau. On the coast, west of the delta, is the ancient city of Alexandria, Egypt's main seaport.'MISR', as it turns out, is the

  8. Light Pollution: The Global View

    Schwarz, H. E.

    2003-04-01

    al.), an overview of the work on radio frequency protection of sites (Cohen et al.) and the excellent introduction to the topic from the Chilean point of view (Daud). Related topics in the book are light pollution education, aircraft contrails, space advertising (with an added document provided by the relevant UN commission), and an experiment on involving the population of an entire country in measuring sky brightness, by using the internet and the media. The text is aimed at professionals from a wide range of disciplines related to lighting and its effects on the night-time environment in the broadest sense of the word. Lay persons interested in this emerging multi-disciplinary field can also find much of interest in this book. Link: http://www.wkap.nl/prod/b/1-4020-1174-1

  9. Searching for the value of a view

    Arthur W. Magill; Charles F. Schwan

    1989-01-01

    Assessing the trade-offs between market and nonmarket products of wildlands poses a major problem fornatural resource planners and managers. Scenic quality is a resource that is not quantifiable in monetary terms. To determine if market values of real estate offering views could define relative dollar values for physical dimensions and objects in views, they were...

  10. Programming Arduino with LabVIEW

    Schwartz, Marco

    2015-01-01

    If you already have some experience with LabVIEW and want to apply your skills to control physical objects and make measurements using the Arduino sensor, this book is for you. Prior knowledge of Arduino and LabVIEW is essential to fully understand the projects detailed in this book.

  11. Developing a Teachable Point of View

    Cameron, Kim

    2007-01-01

    As professors of management and organizational behavior mature in their teaching, they should begin to develop a teachable point of view. In this article, the author describes several attributes of a teachable point of view. Based on his own teaching experience, the author outlines five criteria for the content of the material taught--the what of…

  12. World View: The Second Hidden Dimension.

    Skow, Lisa; And Others

    Proposing that world view is a dimension of culture which lies below the surface of human behavior at the level of the subconscious, this paper argues that this often ignored dimension of culture profoundly influences human communication. The paper is divided into two sections. First, world view is defined and its importance in explaining how…

  13. Consumer Views: Importance of Fuel Economy

    Singer, Mark [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-04-11

    This presentation includes data captured by the National Renewable Energy Laboratory (NREL) to support the U.S. Department of Energy's Vehicle Technologies Office (VTO) research efforts. The data capture consumer views on the importance of fuel economy amongst other vehicle attributes and views on which alternative fuel types would be the best and worst replacements for gasoline.

  14. How Justice System Officials View Wrongful Convictions

    Smith, Brad; Zalman, Marvin; Kiger, Angie

    2011-01-01

    The wrongful conviction of factually innocent people is a growing concern within the United States. Reforms generated by this concern are predicated in part on the views of justice system participants. The authors surveyed judges, police officials, prosecutors, and defense lawyers in Michigan regarding their views of why wrongful convictions…

  15. Students' Views of Learning in Vocational Education.

    Eklund-Myrskog, Gunilla

    1997-01-01

    Conceptions of learning and approaches to learning within vocational education were studied with 30 Finnish students of automotive mechanics. About half the students took a quantitative view of learning and favored a surface approach. Encouraging a qualitative view of learning and deeper approaches in vocational education is discussed. (SLD)

  16. Development of application technology of radiation-resistant microorganism

    Kim, Dong Ho; Lim, Sang Yong; Joe, Min Ho; Jung, Jin Woo; Jung, Sun Wook; Song, Du Sup; Choi, Young Ji

    2009-02-01

    The scope of the project is divided into of three parts; (i) to define the survival strategy of radiation-resistant microbes, especially Deinococcus (ii) acquisition of gene resources encoding the novel protein and related with the production of functional materials (iii) development of control technology against radiation-resistant microbes. To this aim, first, the whole transcriptional response of the D. radiodurans strain haboring pprI mutation, which plays an important role in radiation resistance, was analyzed by cDNA microarray. The anti-oxidant activity of the major carotenoid of D. radiodurans, deinoxanthin, was analyzed and the strain was constructed, in which the gene necessary for bio- synthesis of deinoxanthin is deleted. The response to cadmium of D. radiodurans was also investigated through cDNA microarray analysis. Radiogenic therapy, one of the cancer treatments, is designed to use radiation-inducible gene for the treatment. To develop the gene-transfer vehicle for radiogenic therapy, we have investigated the virulence mechanism of Salmonella, which is tumor-targeting bacteria and studied the synergistic effect of some anti-cancer agents on radiation treatment for cancer. Finally, we confirmed that irradiation could decompose a fungus toxin, patulin, into various harmless by-products

  17. Development of application technology of radiation-resistant microorganism

    Kim, Dong Ho; Lim, Sang Yong; Joe, Min Ho; Jung, Jin Woo; Jung, Sun Wook; Song, Du Sup; Choi, Young Ji [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2009-02-15

    The scope of the project is divided into of three parts; (i) to define the survival strategy of radiation-resistant microbes, especially Deinococcus (ii) acquisition of gene resources encoding the novel protein and related with the production of functional materials (iii) development of control technology against radiation-resistant microbes. To this aim, first, the whole transcriptional response of the D. radiodurans strain haboring pprI mutation, which plays an important role in radiation resistance, was analyzed by cDNA microarray. The anti-oxidant activity of the major carotenoid of D. radiodurans, deinoxanthin, was analyzed and the strain was constructed, in which the gene necessary for bio- synthesis of deinoxanthin is deleted. The response to cadmium of D. radiodurans was also investigated through cDNA microarray analysis. Radiogenic therapy, one of the cancer treatments, is designed to use radiation-inducible gene for the treatment. To develop the gene-transfer vehicle for radiogenic therapy, we have investigated the virulence mechanism of Salmonella, which is tumor-targeting bacteria and studied the synergistic effect of some anti-cancer agents on radiation treatment for cancer. Finally, we confirmed that irradiation could decompose a fungus toxin, patulin, into various harmless by-products.

  18. Research of radiation-resistant microbial organisms

    Kim, Dongho; Lim, Sangyong; Joe, Minho; Park, Haejoon; Song, Hyunpa; Im, Seunghun; Kim, Haram; Kim, Whajung; Choi, Jinsu; Park, Jongchun

    2012-01-15

    Many extremophiles including radiation-resistant bacteria Deinococcus radiodurans have special characteristics such as novel enzymes and physiological active substances different from known biological materials and are being in the spotlight of biotechnology science. In this research, basic technologies for the production of new genetic resources and microbial strains by a series of studies in radiation-resistant microbial organisms were investigated and developed. Mechanisms required for radiation-resistant in Deinococcus radiodurans were partly defined by analyzing the function of dinB, pprI, recG, DRA{sub 0}279, pprM, and two-component signal transduction systems. To apply genetic resource and functional materials from Deinococcus species, omics analysis in response to cadmium, construction of macroscopic biosensor, and characterization of carotenoids and chaperon protein were performed. Additionally, potential use of D. geothermalis in monosaccharide production from non-biodegradable plant materials was evaluated. Novel radiation resistant yeasts and bacteria were isolated and identified from environmental samples to obtain microbial and genomic resources. An optimal radiation mutant breeding method was set up for efficient and rapid isolation of target microbial mutants. Furthermore, an efficient ethanol producing mutant strain with high production yield and productivity was constructed using the breeding method in collaboration with Korea Research Institute of Bioscience and Biotechnology. Three Deinococcal bioindicators for radiation dosage confirmation after radiation sterilization process were developed. These results provide a comprehensive information for novel functional genetic elements, enzymes, and physiological active substances production or application. Eventually, industrial microbial cell factories based on radiation resistant microbial genomes can be developed and the technologies can be diffused to bioindustry continuously by this project.

  19. Research of radiation-resistant microbial organisms

    Kim, Dongho; Lim, Sangyong; Joe, Minho; Park, Haejoon; Song, Hyunpa; Im, Seunghun; Kim, Haram; Kim, Whajung; Choi, Jinsu; Park, Jongchun

    2012-01-01

    Many extremophiles including radiation-resistant bacteria Deinococcus radiodurans have special characteristics such as novel enzymes and physiological active substances different from known biological materials and are being in the spotlight of biotechnology science. In this research, basic technologies for the production of new genetic resources and microbial strains by a series of studies in radiation-resistant microbial organisms were investigated and developed. Mechanisms required for radiation-resistant in Deinococcus radiodurans were partly defined by analyzing the function of dinB, pprI, recG, DRA 0 279, pprM, and two-component signal transduction systems. To apply genetic resource and functional materials from Deinococcus species, omics analysis in response to cadmium, construction of macroscopic biosensor, and characterization of carotenoids and chaperon protein were performed. Additionally, potential use of D. geothermalis in monosaccharide production from non-biodegradable plant materials was evaluated. Novel radiation resistant yeasts and bacteria were isolated and identified from environmental samples to obtain microbial and genomic resources. An optimal radiation mutant breeding method was set up for efficient and rapid isolation of target microbial mutants. Furthermore, an efficient ethanol producing mutant strain with high production yield and productivity was constructed using the breeding method in collaboration with Korea Research Institute of Bioscience and Biotechnology. Three Deinococcal bioindicators for radiation dosage confirmation after radiation sterilization process were developed. These results provide a comprehensive information for novel functional genetic elements, enzymes, and physiological active substances production or application. Eventually, industrial microbial cell factories based on radiation resistant microbial genomes can be developed and the technologies can be diffused to bioindustry continuously by this project

  20. View Ahead After Spirit's Sol 1861 Drive

    2009-01-01

    NASA's Mars Exploration Rover Spirit used its navigation camera to take the images combined into this 210-degree view of the rover's surroundings during the 1,861st to 1,863rd Martian days, or sols, of Spirit's surface mission (March 28 to 30, 2009). The center of the scene is toward the south-southwest. East is on the left. West-northwest is on the right. The rover had driven 22.7 meters (74 feet) southwestward on Sol 1861 before beginning to take the frames in this view. The drive brought Spirit past the northwestern corner of Home Plate. In this view, the western edge of Home Plate is on the portion of the horizon farthest to the left. A mound in middle distance near the center of the view is called 'Tsiolkovsky' and is about 40 meters (about 130 feet) from the rover's position. This view is presented as a cylindrical projection with geometric seam correction.

  1. LabVIEW 8 student edition

    Bishop, Robert H

    2007-01-01

    For courses in Measurement and Instrumentation, Electrical Engineering lab, and Physics and Chemistry lab. This revised printing has been updated to include new LabVIEW 8.2 Student Edition. National Instruments' LabVIEW is the defacto industry standard for test, measurement, and automation software solutions. With the Student Edition of LabVIEW, students can design graphical programming solutions to their classroom problems and laboratory experiments with software that delivers the graphical programming capabilites of the LabVIEW professional version. . The Student Edition is also compatible with all National Instruments data acquisition and instrument control hardware. Note: The LabVIEW Student Edition is available to students, faculty, and staff for personal educational use only. It is not intended for research, institutional, or commercial use. For more information about these licensing options, please visit the National Instruments website at (http:www.ni.com/academic/)

  2. MAPCERN links to Google Street View

    Matilda Heron

    2015-01-01

    CERN’s online maps, MAPCERN, now have the added bonus of Google Street View, thanks to the new release of images of many CERN sites captured by Google.   New Street View images of CERN sites have been added to MAPCERN, see bottom-right-hand image in the screenshot above.   Google Street View, an integrated service of Google Maps introduced in 2007, links 360-degree panoramic photos into a virtual tour. CERN and Google began collaborating on this Street View project in 2010 and now these Street View images have been embedded into MAPCERN, accessible by clicking the “Street View” tab in MAPCERN’s bottom-right-hand window. If you need to locate a building at CERN, or plan an operation on some equipment, you can save time by using the Street View images to check out the area in advance. The CERN Meyrin site has been fully mapped, as well as the surfaces of the eight LHC points, BA2 and BA3. New Street View images of CERN, including the Pr...

  3. Language, Thought, and Culture: Views and Arguments

    Keyvan Zahedi

    2009-07-01

    Full Text Available This study follows two aims: one to review some late views on the relations among language, thought, and culture; and the other, to offer a new strategy, in a novel model, based on last achievements in the minimalist approach. Studying views and arguments, three dichotomies are discussed: 1 the views which confirm the relation between culture and language in opposition to the views that deny this; 2 distinguishing the symmetry-procedural view and the transforming views of language; and 3 distinction among the social-communicational, and the biological-genetic motivations of language. The hypothesis for the novel strategy is that considering what the minimalist program has offered, especially from 2000 onwards, it is possible that language affects thought, while coding the and that culture affects language (which is called ethno-grammar . This is in addition to the biological-genetic base. From this point of view, language’s main function is neither to provide communication, nor to express thought, but to connect cognitive and socio-cultural terminals together.

  4. The activity view of inner speech

    Fernando eMartínez-Manrique

    2015-03-01

    Full Text Available We distinguish two general approaches to inner speech (IS –the ‘format’ and the ‘activity’ views–, and defend the activity view. The format view grounds the utility of IS on features of the representational format of language, and is related to the thesis that the proper function of IS is to make conscious thinking possible. IS appears typically as a product constituted by representations of phonological features. The view also has implications for the idea that passivity phenomena in cognition may be misattributed IS. The activity view sees IS as a speaking activity that does not have a proper function in cognition. It simply inherits the array of functions of outer speech. We argue that it is methodologically advisable to start from this variety of uses, which suggests commonalities between internal and external activities. The format view has several problems; it has to deny unsymbolized thinking; it cannot easily explain how IS makes thoughts available to consciousness, and it cannot explain those uses of IS where its format features apparently play no role. The activity view not only lacks these problems but also has explanatory advantages: construing IS as an activity allows it to be integrally constituted by its content; the view is able to construe unsymbolized thinking as part of a continuum of phenomena that exploit the same mechanisms, and it offers a simple explanation for the variety of uses of IS.

  5. Trust-based collective view prediction

    Luo, Tiejian; Xu, Guandong; Zhou, Jia

    2013-01-01

    Collective view prediction is to judge the opinions of an active web user based on unknown elements by referring to the collective mind of the whole community. Content-based recommendation and collaborative filtering are two mainstream collective view prediction techniques. They generate predictions by analyzing the text features of the target object or the similarity of users' past behaviors. Still, these techniques are vulnerable to the artificially-injected noise data, because they are not able to judge the reliability and credibility of the information sources. Trust-based Collective View

  6. Implementing VMware Horizon View 5.2

    Ventresco, Jason

    2013-01-01

    A step-by-step tutorial covering all components of the View Horizon suite in detail, to ensure that you can utilize all features of the platform, and discover all of the possible ways that it can be used within your own environment.If you are a newcomer in system administration, and you wish to implement a small to midsized Horizon View environment, then this book is for you. It will also benefit individuals who wish to administrate and manage Horizon View more efficiently or are studying for the VCP5-DT.

  7. Multi-view L2-SVM and its multi-view core vector machine.

    Huang, Chengquan; Chung, Fu-lai; Wang, Shitong

    2016-03-01

    In this paper, a novel L2-SVM based classifier Multi-view L2-SVM is proposed to address multi-view classification tasks. The proposed Multi-view L2-SVM classifier does not have any bias in its objective function and hence has the flexibility like μ-SVC in the sense that the number of the yielded support vectors can be controlled by a pre-specified parameter. The proposed Multi-view L2-SVM classifier can make full use of the coherence and the difference of different views through imposing the consensus among multiple views to improve the overall classification performance. Besides, based on the generalized core vector machine GCVM, the proposed Multi-view L2-SVM classifier is extended into its GCVM version MvCVM which can realize its fast training on large scale multi-view datasets, with its asymptotic linear time complexity with the sample size and its space complexity independent of the sample size. Our experimental results demonstrated the effectiveness of the proposed Multi-view L2-SVM classifier for small scale multi-view datasets and the proposed MvCVM classifier for large scale multi-view datasets. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. View-invariant object recognition ability develops after discrimination, not mere exposure, at several viewing angles.

    Yamashita, Wakayo; Wang, Gang; Tanaka, Keiji

    2010-01-01

    One usually fails to recognize an unfamiliar object across changes in viewing angle when it has to be discriminated from similar distractor objects. Previous work has demonstrated that after long-term experience in discriminating among a set of objects seen from the same viewing angle, immediate recognition of the objects across 30-60 degrees changes in viewing angle becomes possible. The capability for view-invariant object recognition should develop during the within-viewing-angle discrimination, which includes two kinds of experience: seeing individual views and discriminating among the objects. The aim of the present study was to determine the relative contribution of each factor to the development of view-invariant object recognition capability. Monkeys were first extensively trained in a task that required view-invariant object recognition (Object task) with several sets of objects. The animals were then exposed to a new set of objects over 26 days in one of two preparatory tasks: one in which each object view was seen individually, and a second that required discrimination among the objects at each of four viewing angles. After the preparatory period, we measured the monkeys' ability to recognize the objects across changes in viewing angle, by introducing the object set to the Object task. Results indicated significant view-invariant recognition after the second but not first preparatory task. These results suggest that discrimination of objects from distractors at each of several viewing angles is required for the development of view-invariant recognition of the objects when the distractors are similar to the objects.

  9. Exploded view diagrams of mathematical surfaces

    Karpenko, Olga A.; Li, Wilmot; Mitra, Niloy J.; Agrawala, Maneesh

    2010-01-01

    We present a technique for visualizing complicated mathematical surfaces that is inspired by hand-designed topological illustrations. Our approach generates exploded views that expose the internal structure of such a surface by partitioning

  10. Variable acuity remote viewing system flight demonstration

    Fisher, R. W.

    1983-01-01

    The Variable Acuity Remote Viewing System (VARVS), originally developed under contract to the Navy (ONR) as a laboratory brassboard, was modified for flight demonstration. The VARVS system was originally conceived as a technique which could circumvent the acuity/field of view/bandwidth tradeoffs that exists in remote viewing to provide a nearly eye limited display in both field of view (160 deg) and resolution (2 min arc) while utilizing conventional TV sensing, transmission, and display equipment. The modifications for flight demonstration consisted of modifying the sensor so it could be installed and flow in a Piper PA20 aircraft, equipped for remote control and modifying the display equipment so it could be integrated with the NASA Research RPB (RPRV) remote control cockpit.

  11. ARC Code TI: BigView

    National Aeronautics and Space Administration — BigView allows for interactive panning and zooming of images of arbitrary size on desktop PCs running linux. Additionally, it can work in a multi-screen environment...

  12. Physics at hadron colliders: Experimental view

    Siegrist, J.L.

    1987-08-01

    The physics of the hadron-hadron collider experiment is considered from an experimental point of view. The problems encountered in determination of how well the standard model describes collider results are discussed. 53 refs., 58 figs

  13. Received View of Addiction, Relapse and Treatment.

    Ndasauka, Yamikani; Wei, Zhengde; Zhang, Xiaochu

    2017-01-01

    It is important to highlight that attempts at understanding and explaining addiction have been made for centuries. It is, however, just five decades ago, with the growth of science and technology that more interest has been observed in this field. This chapter examines different views and theories that have been posited to understand and explain addiction. More attention will be given to prominent views that seem to draw consensus among researchers and medical practitioners. The first section of the chapter introduces the addiction debate, the different theories that have been provided to explain it from different perspectives and disciplines such as neurosciences, philosophy and psychology. Then, the chapter discusses different views on the role of relapse and what it entails in understanding addiction. The second section discusses different proposed and used forms of treating addiction. Thus, the chapter discusses the received view of addiction, the understanding of relapse as a critical element in addiction and treatments.

  14. Selecting materialized views in a data warehouse

    Zhou, Lijuan; Liu, Chi; Liu, Daxin

    2003-01-01

    A Data Warehouse contains lots of materialized views over the data provided by the distributed heterogeneous databases for the purpose of efficiently implementing decision-support or OLAP queries. It is important to select the right view to materialize that answer a given set of queries. In this paper, we have addressed and designed algorithm to select a set of views to materialize in order to answer the most queries under the constraint of a given space. The algorithm presented in this paper aim at making out a minimum set of views, by which we can directly respond to as many as possible user"s query requests. We use experiments to demonstrate our approach. The results show that our algorithm works better. We implemented our algorithms and a performance study of the algorithm shows that the proposed algorithm gives a less complexity and higher speeds and feasible expandability.

  15. Mormon and Jewish views of the afterlife.

    Lester, David; Portner, Jodi; Sierra, Duvan

    2004-12-01

    In their responses to a questionnaire, undergraduates, 60 Mormons, viewed the afterlife as less pleasant than did the 37 Jews, while the Jews were more concerned with sin and judgment and more often believed in reincarnation.

  16. CURRICULUM MATTERS: Physics 2000: a personal view

    Field, R. J.

    1997-03-01

    The author expresses his personal views of how Physics for A-level should develop towards the year 2000. These cover: the historical treatment of core topics, syllabus structure and the relevance of practical physics.

  17. VMware Horizon View 6 desktop virtualization cookbook

    Ventresco, Jason

    2014-01-01

    If you want a more detailed explanation concerning the implementation of several different core features of VMware Horizon View, this is the book for you. Whether you are new to VMware Horizon View or an existing user, this book will provide you with the knowledge you need to successfully deploy several core features and get introduced to the latest features of version 6.0 as well.

  18. Instant VMware view virtualization how-to

    Geddam, Ramesh

    2013-01-01

    Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks.This is a Packt Instant How-to guide, which provides concise and clear recipes for getting started with setting up the VDI in different environments.Instant VMware View 5 Virtualization How-to is for architects, solution providers, consultants, engineers, and anyone planning to design and implement a solution based on VMware View 5.

  19. Modified ITER In-Vessel Viewing System

    Ahola, H.; Heikkinen, V.; Keraenen, K.; Suomela, J.

    2001-01-01

    The original ITER In-Vessel Viewing System (IVVS) prototype (Proc. of the 20th SOFT, vol. 2 (1998) 1051), which demonstrates the feasibility of linear fibre arrays for ITER in-vessel viewing, has been modified. In order to reduce the viewing time and to improve the image quality the beam dispersing mirrors was replaced by a diffractive optics element (DOE), which enhanced the laser illumination considerably. The performance of the system was tested using various target surfaces: the results obtained clearly indicate its adequacy for in-vessel viewing. Mechanical damage on smooth metal surfaces (scratches etc.) can be easily distinguished and the viewing resolution at a distance of 2 m is better than 1 mm. The IVVS has been re-designed to be compatible with the new ITER-FEAT. A conceptual study which covers all the functions and subsystems required for viewing has been completed. These results will be used to further modify the prototype: items to be tested include horizontal probe operation and laser illumination with an optical fibre

  20. Determination of some radiative view factors

    Ghosh, B.; Mukhopadhyay, D.; Lele, H.G.; Fichot, F.; Guillard, G.

    2011-01-01

    View factors are essential components for analysis for of radiative heat transfer through enclosure methods like radiosity approach, direct/total exchange area approach etc. View factor is defined as the integral over the interacting surface. View factor integral can be calculated by following various approaches, such as: view factor algebra, direction analytical approach, contour integration method, Monte Carlo method, numerical methods based of FDM or FEM, Hottle's string method etc. The present module of work on determination of view factor is aimed for use in ASTEC code system for severe accident analysis. There exist many routines (RADB, RADC, GRADEB, RADR, RADL) in the ICARE module of ASTEC code system to model radiative heat transfer from different types of assemblies of interacting surfaces of different nature. The present work is specially targeted for radiative heat transfer model for lower plenum (RADILOWE) and for extension of ICARE module for IPHWR. In interacting surfaces within the lower plenum comprises of different types of circular, cylindrical and conical surface. In the work completed so far, view factor relations have been derived/compiled based on exact/approximate analytical and numerical approaches. (author)

  1. TFTR vertically viewing electron cyclotron emission diagnostic

    Taylor, G.

    1990-01-01

    The Tokamak Fusion Test Reactor (TFTR) Michelson interferometer has a spectral coverage of 75--540 GHz, allowing measurement of the first four electron cyclotron harmonics. Until recently the instrument has been configured to view the TFTR plasma on the horizontal midplane, primarily in order to measure the electron temperature profile. Electron cyclotron emission (ECE) extraordinary mode spectra from TFTR Supershot plasmas exhibit a pronounced, spectrally narrow feature below the second harmonic. A similar feature is seen with the ECE radiometer diagnostic below the electron cyclotron fundamental frequency in the ordinary mode. Analysis of the ECE spectra indicates the possibility of a non-Maxwellian 40--80 keV tail on the electron distribution in or near the core. During 1990 three vertical views with silicon carbide viewing targets will be installed to provide a direct measurement of the electron energy distribution at major radii of 2.54, 2.78, and 3.09 m with an energy resolution of approximately 20% at 100 keV. To provide the maximum flexibility, the optical components for the vertical views will be remotely controlled to allow the Michelson interferometer to be reconfigured to either the midplane horizontal view or one of the three vertical views between plasma shots

  2. LabVIEW Support at CERN

    HR Department

    2010-01-01

    Since the beginning of 2009, due to the CERN restructuring, LabVIEW support moved from the IT to the EN department, joining the Industrial Controls and Electronics Group (ICE). LabVIEW support has been merged with the Measurement, Test and Analysis (MTA) section which, using LabVIEW, has developed most of the measurement systems to qualify the LHC magnets and components over the past 10 years. The post mortem analysis for the LHC hardware commissioning has also been fully implemented using LabVIEW, customised into a framework, called RADE, for CERN needs. The MTA section has started with a proactive approach sharing its tools and experience with the CERN LabVIEW community. Its framework (RADE) for CERN integrated application development has been made available to the users. Courses on RADE have been integrated into the standard National Instruments training program at CERN. RADE and LabVIEW support were merged together in 2010 on a single email address:labview.support@cern.ch For more information please...

  3. Semi-Supervised Multi-View Ensemble Learning Based On Extracting Cross-View Correlation

    ZALL, R.

    2016-05-01

    Full Text Available Correlated information between different views incorporate useful for learning in multi view data. Canonical correlation analysis (CCA plays important role to extract these information. However, CCA only extracts the correlated information between paired data and cannot preserve correlated information between within-class samples. In this paper, we propose a two-view semi-supervised learning method called semi-supervised random correlation ensemble base on spectral clustering (SS_RCE. SS_RCE uses a multi-view method based on spectral clustering which takes advantage of discriminative information in multiple views to estimate labeling information of unlabeled samples. In order to enhance discriminative power of CCA features, we incorporate the labeling information of both unlabeled and labeled samples into CCA. Then, we use random correlation between within-class samples from cross view to extract diverse correlated features for training component classifiers. Furthermore, we extend a general model namely SSMV_RCE to construct ensemble method to tackle semi-supervised learning in the presence of multiple views. Finally, we compare the proposed methods with existing multi-view feature extraction methods using multi-view semi-supervised ensembles. Experimental results on various multi-view data sets are presented to demonstrate the effectiveness of the proposed methods.

  4. Genetic engineering of a radiation-resistant bacterium for biodegradation of mixed wastes. 1998 annual progress report

    Lidstrom, M.E.

    1998-01-01

    'Because of their tolerance to very high levels of ionizing radiation, members of the genus Deinococcus have received considerable attention over the past years. The type species of the genus, Deinococcus radiodurans, has been studied extensively in several labs. Although researchers are only beginning to understand the mechanisms by which this Gram-positive bacterium is able to repair massive DNA damage after radiation dosages as high as 5 Mrad, it has become evident that its recombination machinery has several unique characteristics (1--4). The aim of the present studies is to engineer D. radiodurans into a detoxifier for bioremediation of complex waste mixtures, containing heavy metals, halo-organics and radionuclides, making use of its ability to be biologically active in environments where they will be exposed to high levels of radiation. For that purpose, the authors aim to clone and express several broad spectrum oxygenases and heavy metal resistance determinants, and test survival and activities of these strains in artificial mixtures of contaminants, designed to simulate DOE mixed waste streams. This report summarizes work after 0.5 year of a 3-year project. The initial studies have focused on the development of an insertional expression system for D. radiodurans R1. This effort has involved two parts, namely: (1) promoter analysis, and (2) development of insertion systems. Several studies have shown that the expression signals used by D. radiodurans differ considerably from those found in other bacteria. Although D. radiodurans contains a typical eubacterial RNA polymerase core enzyme (based on TBLASTN searches on the genome sequence), Escherichia coli promoters are not recognized in D. radiodurans and vice versa (5). To expand the basic understanding of the requirements for transcription, and to optimize expression of (heterologous) genes, they will follow two strategies. First, a promoter-probe vector is being developed for the selection of promoter

  5. Mothers’ views of their preschool child’s screen-viewing behaviour:a qualitative study

    Bentley, Georgina F; Turner, Katrina M; Jago, Russ

    2016-01-01

    BackgroundResearch on screen-viewing in preschool children has predominantly focused on television viewing. The rapid development of mobile devices (e.g. tablets, smart phones and e-readers) and the increase in their use by preschool children means there is a need to understand how and why these devices are used by this age group. The aim of this study was to explore mothers’ views of their preschool children’s screen viewing behaviour (including mobile devices) and investigate how preschool ...

  6. View Estimation Based on Value System

    Takahashi, Yasutake; Shimada, Kouki; Asada, Minoru

    Estimation of a caregiver's view is one of the most important capabilities for a child to understand the behavior demonstrated by the caregiver, that is, to infer the intention of behavior and/or to learn the observed behavior efficiently. We hypothesize that the child develops this ability in the same way as behavior learning motivated by an intrinsic reward, that is, he/she updates the model of the estimated view of his/her own during the behavior imitated from the observation of the behavior demonstrated by the caregiver based on minimizing the estimation error of the reward during the behavior. From this view, this paper shows a method for acquiring such a capability based on a value system from which values can be obtained by reinforcement learning. The parameters of the view estimation are updated based on the temporal difference error (hereafter TD error: estimation error of the state value), analogous to the way such that the parameters of the state value of the behavior are updated based on the TD error. Experiments with simple humanoid robots show the validity of the method, and the developmental process parallel to young children's estimation of its own view during the imitation of the observed behavior of the caregiver is discussed.

  7. Effect of viewing distance on 3D fatigue caused by viewing mobile 3D content

    Mun, Sungchul; Lee, Dong-Su; Park, Min-Chul; Yano, Sumio

    2013-05-01

    With an advent of autostereoscopic display technique and increased needs for smart phones, there has been a significant growth in mobile TV markets. The rapid growth in technical, economical, and social aspects has encouraged 3D TV manufacturers to apply 3D rendering technology to mobile devices so that people have more opportunities to come into contact with many 3D content anytime and anywhere. Even if the mobile 3D technology leads to the current market growth, there is an important thing to consider for consistent development and growth in the display market. To put it briefly, human factors linked to mobile 3D viewing should be taken into consideration before developing mobile 3D technology. Many studies have investigated whether mobile 3D viewing causes undesirable biomedical effects such as motion sickness and visual fatigue, but few have examined main factors adversely affecting human health. Viewing distance is considered one of the main factors to establish optimized viewing environments from a viewer's point of view. Thus, in an effort to determine human-friendly viewing environments, this study aims to investigate the effect of viewing distance on human visual system when exposing to mobile 3D environments. Recording and analyzing brainwaves before and after watching mobile 3D content, we explore how viewing distance affects viewing experience from physiological and psychological perspectives. Results obtained in this study are expected to provide viewing guidelines for viewers, help ensure viewers against undesirable 3D effects, and lead to make gradual progress towards a human-friendly mobile 3D viewing.

  8. En face view of the mitral valve: definition and acquisition.

    Mahmood, Feroze; Warraich, Haider Javed; Shahul, Sajid; Qazi, Aisha; Swaminathan, Madhav; Mackensen, G Burkhard; Panzica, Peter; Maslow, Andrew

    2012-10-01

    A 3-dimensional echocardiographic view of the mitral valve, called the "en face" or "surgical view," presents a view of the mitral valve similar to that seen by the surgeon from a left atrial perspective. Although the anatomical landmarks of this view are well defined, no comprehensive echocardiographic definition has been presented. After reviewing the literature, we provide a definition of the left atrial and left ventricular en face views of the mitral valve. Techniques used to acquire this view are also discussed.

  9. Multi-view collimators for scintillation cameras

    Hatton, J.; Grenier, R.P.

    1982-01-01

    This patent specification describes a collimator for obtaining multiple images of a portion of a body with a scintillation camera comprises a body of radiation-impervious material defining two or more groups of channels each group comprising a plurality of parallel channels having axes intersecting the portion of the body being viewed on one side of the collimator and intersecting the input surface of the camera on the other side of the collimator to produce a single view of said body, a number of different such views of said body being provided by each of said groups of channels, each axis of each channel lying in a plane approximately perpendicular to the plane of the input surface of the camera and all of such planes containing said axes being approximately parallel to each other. (author)

  10. LabVIEW Real-Time

    CERN. Geneva; Flockhart, Ronald Bruce; Seppey, P

    2003-01-01

    With LabVIEW Real-Time, you can choose from a variety of RT Series hardware. Add a real-time data acquisition component into a larger measurement and automation system or create a single stand-alone real-time solution with data acquisition, signal conditioning, motion control, RS-232, GPIB instrumentation, and Ethernet connectivity. With the various hardware options, you can create a system to meet your precise needs today, while the modularity of the system means you can add to the solution as your system requirements grow. If you are interested in Reliable and Deterministic systems for Measurement and Automation, you will profit from this seminar. Agenda: Real-Time Overview LabVIEW RT Hardware Platforms - Linux on PXI Programming with LabVIEW RT Real-Time Operating Systems concepts Timing Applications Data Transfer

  11. Palliative care nurses' views on euthanasia.

    Verpoort, Charlotte; Gastmans, Chris; Dierckx de Casterlé, Bernadette

    2004-09-01

    In debates on euthanasia legalization in Belgium, the voices of nurses were scarcely heard. Yet studies have shown that nurses are involved in the caring process surrounding euthanasia. Consequently, they are in a position to offer valuable ideas about this problem. For this reason, the views of these nurses are important because of their palliative expertise and their daily confrontation with dying patients. The aim of this paper is to report a study of the views of palliative care nurses about euthanasia. A grounded theory approach was chosen, and interviews were carried out with a convenience sample of 12 palliative care nurses in Flanders (Belgium). The data were collected between December 2001 and April 2002. The majority of the nurses were not a priori for or against euthanasia, and their views were largely dependent on the situation. What counted was the degree of suffering and available palliative options. Depending on the situation, we noted both resistance and acceptance towards euthanasia. The underlying arguments for resistance included respect for life and belief in the capabilities of palliative care; arguments underlying acceptance included the quality of life and respect for patient autonomy. The nurses commented that working in palliative care had a considerable influence on one's opinion about euthanasia. In light of the worldwide debate on euthanasia, it is essential to know how nurses, who are confronted with terminally ill patients every day, think about it. Knowledge of these views can also contribute to a realistic and qualified view on euthanasia itself. This can be enlightening to the personal views of caregivers working in a diverse range of care settings.

  12. THE WORLD VIEW, IDENTITY AND SOCIOCULTUR HOMEOSTASIS

    Marina Yur’evna Neronova

    2016-02-01

    Full Text Available The paper presents the relationship between the phenomenon of world view and sociocultural identity both individuals and the community as a whole. The research is being carried out in the context of current crisis of world view accepted in so-called art Nouveau era. This paper also presents the identity crisis typical for modern civilized societies. A new notion of sociocultural homeostasis is introduced in connection with analyzable phenomena and their mutual relations.Purpose. Study of the relationship between the phenomenon of the world view and sociocultural identity as a structural and functional mechanism.Methodology. Phenomenological and systematic methods with the elements of historical method were employed. Cultural analysis is based on using both axiological and phenomenological approach, and also the elements of semiotic approach.Results. The dependence of identity on the world view is revealed (or is being revealed?, the phenomenon of sociocultural homeostasis is singled out (or is being singled out in the capacity of the mechanism setting up the correspondence in the contradictory unity between the world view as a subjective image and concrete reality as an objective part of this contradictory. The analysis of sociocultural homeostasis is carried out (or is being carried out and the conclusion is being drown that instability of the latter leads to serious problems in the identification of both individuals and communities as a whole. Besides, (moreover the relationship between the legitimacy level of the world view and stability of sociocultural homeostasis is established. (is being established.Practical implications: the system of education.

  13. View-based 3-D object retrieval

    Gao, Yue

    2014-01-01

    Content-based 3-D object retrieval has attracted extensive attention recently and has applications in a variety of fields, such as, computer-aided design, tele-medicine,mobile multimedia, virtual reality, and entertainment. The development of efficient and effective content-based 3-D object retrieval techniques has enabled the use of fast 3-D reconstruction and model design. Recent technical progress, such as the development of camera technologies, has made it possible to capture the views of 3-D objects. As a result, view-based 3-D object retrieval has become an essential but challenging res

  14. Depth Perception In Remote Stereoscopic Viewing Systems

    Diner, Daniel B.; Von Sydow, Marika

    1989-01-01

    Report describes theoretical and experimental studies of perception of depth by human operators through stereoscopic video systems. Purpose of such studies to optimize dual-camera configurations used to view workspaces of remote manipulators at distances of 1 to 3 m from cameras. According to analysis, static stereoscopic depth distortion decreased, without decreasing stereoscopitc depth resolution, by increasing camera-to-object and intercamera distances and camera focal length. Further predicts dynamic stereoscopic depth distortion reduced by rotating cameras around center of circle passing through point of convergence of viewing axes and first nodal points of two camera lenses.

  15. Collective Attitudes and the Anthropocentric View

    Gallotti Mattia

    2016-03-01

    Full Text Available The anthropocentric view holds that the social world is a projection of mental states and attitudes onto the real world. However, there is more to a society of individuals than their psychological make up. In The Ant Trap, Epstein hints at the possibility that collective intentionality can, and should, be discarded as a pillar of social ontology. In this commentary I argue that this claim is motivated by an outdated view of the nature and structure of collective attitudes. If we aim at a good theory of social ontology, we need a good theory of collective intentionality.

  16. Labour in Capitalist Society : Marx's View

    Tsuto, Masahiro

    2007-01-01

    Marx's view on labour is many-sided. I will argue the multiple character of labour in five aspects, based on his 1857-58 note. We can grasp his view in following five phases. Namely, (1) material metabolism between man and Nature, (2) abstract human labour, (3) labour and free time, (4) active and creative labour, and (5) painful labour. In general, Marx's statements on (3), (4) and (5) phases of labour are less in his "Capital" than in his 1857-58 note. This is the reason why we often deal w...

  17. Multi-view collimator for scintillation cameras

    Hatton, J.; Grenier, R.P.

    1979-01-01

    A collimator comprises a block or blocks of radiation-impervious material which defines a first plurality of parallel channels, each channel defining a direction of acceptance of radiation from a body. The axes of a second plurality channels define another direction of acceptance of radiation from the body and intersect the same portion of the body as the axes of the first plurality of channels thus producing a second view of the body. Where the collimator is built up as a stack of blocks, each pair of adjacent blocks defines a slice of the body which is viewed from two angles defined by the channels. (UK)

  18. Bilingual Education and Accountability: A Perceptual View.

    Hernandez-Domingues, Jose L.; Gertenbach, Donald

    This paper discusses (1) The Current Definition of Bilingual Education, (2) The Origin of Accountability, (3) The Empirical and Rational View of Education, (4) Man Defines Himself or Is Defined, and (5) Who Is Accountable? A list of notes is included in the study. (SK)

  19. Views of Chinese Psychologists toward Intelligence

    Yan, Gonggu; Saklofske, Donald H.; Oakland, Thomas

    2009-01-01

    The concepts of intelligence and methods to assess it constitute important contributions to psychology and have had a profound impact on school psychology practice. While the perspectives and practices of North American and European psychologists toward the construct and assessment of intelligence generally are well known, the views held by…

  20. Incremental computation of set difference views

    Bækgaard, Lars; Mark, Leo

    1997-01-01

    mellemliggende databaseforandringer, når et view anvendes. I distribuerede omgivelser som f.eks. data warehousing omgivelser er inkrementelle metoder nødvendige af hensyn til inkrementel beregning af mængdedifferencer i relationelle databaser. Disse metoder kan med fordel benyttes som supplement til eksisterende...

  1. Greek Secondary School Students' Views about Biology

    Mavrikaki, Evangelia; Koumparou, Helen; Kyriakoudi, Margarita; Papacharalampous, Irene; Trimandili, Maria

    2012-01-01

    This paper aims to give a picture of Greek students' views about biology and some of the factors that affect them. A questionnaire measuring students' intrinsic motivation to learn biology, individual interest in biology and perceived difficulty of biology, along with information about students' gender, level, parents' occupation and educational…

  2. How Do Positive Views Maintain Life Satisfaction?

    Wu, Chia-Huei; Tsai, Ying-Mei; Chen, Lung Hung

    2009-01-01

    This study proposes three mediation pathways to explain how the positive views (perceived control, optimism and self-enhancement) proposed by Cummins and Nistico (Journal of Happiness Studies 3:37-69 2002) maintain life satisfaction. The three pathways were enhancing self-esteem, reducing have-want discrepancy and changing importance perceptions.…

  3. The nuclear spread: a Third World view

    Kapur, A.

    1980-01-01

    The view of the Third World of nuclear power and international relations is contrasted with that of the superpowers. Aspects considered include the Non-Proliferation Treaty, factors for and against proliferation, regional and international environments, vertical versus horizontal proliferation. (U.K.)

  4. Selective Television Viewing: A Limited Possibility.

    Signorielli, Nancy

    1986-01-01

    Indicates that prime-time television presents a remarkably consistent portrayal of the world across program genres and that it offers few scheduling alternatives to avoiding violence-laden adventure programs. Finds that the average viewer has little opportunity to exercise any kind of choice in viewing. (JD)

  5. American Muslim Undergraduates' Views on Evolution

    Fouad, Khadija Engelbrecht

    2016-01-01

    A qualitative investigation into American Muslim undergraduates' views on evolution revealed three main positions on evolution: theistic evolution, a belief in special creation of all species, and a belief in special creation of humans with evolution for all non-human species. One can conceive of the manner in which respondents chose their…

  6. Response effectiveness: views of the affected population

    Anisya Thomas

    2005-07-01

    Full Text Available While relief organisations are now reviewing their post-tsunami operations, few evaluations include multiple organisations. Rarer still is an assessment of the views of those at the receiving end of rescue and relief services – the ‘beneficiaries’.

  7. IBM Brazil: and environmental modern view

    Cremonesi, Valter [IBM Brasil, Industria, Maquinas e Servicos Ltda., Rio de Janeiro, Rj (Brazil)

    1993-12-31

    Information of practical experiences on Environmental Affairs at IBM Brazil plant and branch offices is presented, with a modern view of the mission, resources, support, waste management, monitoring programs, recycling, energy conservation, partners programs, nature preservation 2rograms, recognitions and image. (author). 4 figs., 2 tabs.

  8. A rewriting view of simple typing

    Stump, A.; Zantema, H.; Kimmell, G.; El Haj Omar, R.

    2013-01-01

    This paper shows how a recently developed view of typing as small-step abstract reduction, due to Kuan, MacQueen, and Findler, can be used to recast the development of simple type theory from a rewriting perspective. We show how standard meta-theoretic results can be proved in a completely new way,

  9. Constructing process views for service outsourcing

    Eshuis, H.; Norta, A.H.; Shin, S.Y.; Ossowski, S.

    2009-01-01

    Service outsourcing is a business paradigm in which an organization has a part of its business process performed by a service provider. The outsourced service can be specified in a public process view, which shields secret or irrelevant details from the internal business process of the provider.

  10. Changing the Diameter of a Viewing Tube

    Obara, Samuel

    2009-01-01

    This article is about the students' investigation about the relationship between the diameter of the view tubes (x) of constant lengths and the viewable vertical distance (y) on the wall while keeping the perpendicular distance from the eyeball to the wall constant. The students collected data and used and represented it in tabular and graphical…

  11. Theory in Teacher Education: Students' Views

    Higgs, Leonie G.

    2012-01-01

    This paper investigates the views of Post Graduate Certificate in Education (PGCE) students' of the theoretical component in one of the modules in their teacher education programme. In this module students are exposed to the following theoretical frameworks: Empiricism, Critical Rationalism, Feminism, Critical Theory, African Philosophy and…

  12. FluView National Flu Activity Map

    U.S. Department of Health & Human Services — The FluView National Flu Activity Map is a complementary widget to the state-by-state flu map widget introduced in the 2007-2008 flu season. This interactive map...

  13. Political Implications of Heavy Television Viewing.

    Jackson-Beeck, Marilyn

    This paper empirically evaluates the proposition that political conformism, specifically structural, passive, psychological, and defensive conformism, is a function of exposure to mass media. Secondary analysis of data from the National Opinion Research Center's 1975 General Social Survey revealed a significant relationship between TV viewing and…

  14. Dewey and Culture: Responding to "Extreme Views"

    Heilbronn, Ruth

    2017-01-01

    Dewey famously believed that we learn through experience, through which we build up habits. Education should be about developing good habits. Experience for Dewey, is not an individual possession but grows out of social interaction, which always takes place in a given culture. Dewey's views on culture are significant in relation to a current issue…

  15. Children's Views about the Water Cycle.

    Bar, Varda

    1989-01-01

    Israeli children's (kindergarten to grade nine) explanations about the water cycle are described. Reports the children's views about the source of clouds and the mechanism of rainfall. It was concluded that understanding evaporation is a necessary condition for explaining a mechanism of rain containing the ideas of condensation and heaviness. (YP)

  16. Turkish Primary School Pupils' Views on Punishment

    Aydin, Bahri

    2010-01-01

    Teachers meet with unwanted behavior when they are acting as facilitators of the learning process and they resort to certain tactics to deal with them. One of these tactics is punishment. This study aimed to identify the views held by Turkish primary school pupils on punishment. According to the results of the study, pupils were punished for…

  17. HIGH SCHOOL STUDENTS’ VIEWS ON BLENDED LEARNING

    Ibrahim Umit YAPICI,

    2012-08-01

    Full Text Available In this study, it is aimed to determine the high school students’ views on blended learning. The study was carried out in biology course for the lesson unit of “Classification of Living Things and Biodiversity” with 47 9th grade students attending Nevzat Ayaz Anatolian High School in the second term of the academic year of 2009-2010. The lessons were taught in a way appropriate to the blended learning model both via the Internet and on face-to-face basis. As the online dimension of the blended learning model, Moodle, a Learning Management System (LMS, was used. The application lasted 10 weeks. The scale of learners’ views on blended learning was applied and interviews were held to determine the views. As a result of the analysis of the scale, it was seen that their views were “highly” positive. The interviews held with the students revealed that the blended learning model provided students with various opportunities such as getting prepared for the lessons, reviewing the lessons as many times as wanted, reaching the subject-related materials without being dependent on time and place, testing oneself and communicating with the teacher and other students out of the school. The interviews also revealed that there were various problems though such as lack of Internet connection at home and problems experienced while playing the videos.

  18. High School Students' Views on Blended Learning

    Yapici, Ibrahim Umit; Akbayin, Hasan

    2012-01-01

    In this study, it is aimed to determine the high school students' views on blended learning. The study was carried out in biology course for the lesson unit of "Classification of Living Things and Biodiversity" with 47 9[superscript th] grade students attending Nevzat Ayaz Anatolian High School in the second term of the academic year of…

  19. Participation in Sex Work: Students' Views

    Roberts, Ron; Sanders, Teela; Myers, Ellie; Smith, Debbie

    2010-01-01

    Increasing evidence points to student involvement in the sex industry. The current study comprised a cross-sectional sample of 315 undergraduates at a London university. Using a semi-structured questionnaire, data were gathered on students' financial and employment circumstances and their views on participation in sex work. Results suggested…

  20. Changing Student Teachers' Views of Comprehension Instruction ...

    At the same time research shows that little, if any, explicit and continuous strategy instruction takes place in classrooms. Reasons seem ... This article reports on the effect of a reading comprehension instruction course on university student teachers' lesson planning, strategy use and views about comprehension instruction.

  1. A rewriting view of simple typing

    Stump, A.; Zantema, H.; Kimmell, G.; El Haj Omar, R.

    2012-01-01

    This paper shows how a recently developed view of typing as small-step abstract reduction, due to Kuan, MacQueen, and Findler, can be used to recast the development of simple type theory from a rewriting perspective. We show how standard meta-theoretic results can be proved in a completely new way,

  2. The road from Rio - OPEC's view

    Subroto

    1994-01-01

    The Secretary General of OPEC presents the views of OPEC on the environmental debate at the Rio Summit, the topic of environmental taxation. Recommendations are put forward on the financing of Agenda 21 programs and on the concept of technology transfer, to help achieve sustainable development

  3. Multilingualism and Multicompetence: A Conceptual View

    Franceschini, Rita

    2011-01-01

    The overall aim of this article is to argue that the functioning of every language system is based on a potential multilingual competence. The empirical basis for this is now broad enough to gain a comprehensive view on the overall competence of a multilingual individual. Moreover, increasing theoretical reflection has conferred an increasingly…

  4. Bevarage consumption during television viewing and tooth ...

    Aim: The study assessed the television (TV) viewing habits, preferred energy and acidic drinks consumed when watching television and the history of tooth sensitivity among adolescents who watched television >2 hours daily (HTV) and <2 hour daily. (LTV). Subjects and Methods: This is a descriptive study conducted in Ife ...

  5. End-view of the DELPHI detector

    1996-01-01

    End-view of the 10-m diameter DELPHI detector at CERN's LEP electron-positron collider from 1989 to 2000. Its concentric modules, including a pioneer large-scale application of the Ring Imaging Cherenkov technique to differentiate between all the various secondary particles, ensure high precision and 'granularity'.

  6. View all initiatives | IDRC - International Development Research ...

    View all initiatives. You are looking at projects supported by The William and Flora Hewlett Foundation. Displaying 1 - 2 of 2. Growth and Economic Opportunities for Women. Initiative. Women around the world increasingly participate in economic activities, but they continue to face significant challenges in pursuing better ...

  7. Evolving Technologies: A View to Tomorrow

    Tamarkin, Molly; Rodrigo, Shelley

    2011-01-01

    Technology leaders must participate in strategy creation as well as operational delivery within higher education institutions. The future of higher education--the view to tomorrow--is irrevocably integrated and intertwined with evolving technologies. This article focuses on two specific evolving technologies: (1) alternative IT sourcing; and (2)…

  8. An Emergent Framework: Views of Mathematical Processes

    Sanchez, Wendy B.; Lischka, Alyson E.; Edenfield, Kelly W.; Gammill, Rebecca

    2015-01-01

    The findings reported in this paper were generated from a case study of teacher leaders at a state-level mathematics conference. Investigation focused on how participants viewed the mathematical processes of communication, connections, representations, problem solving, and reasoning and proof. Purposeful sampling was employed to select nine…

  9. Uranium enrichment : global view and Brazilian perspectives

    Zouain, D.M.; Sakamoto, L.H.

    1981-12-01

    A global view of isotope enrichment involving a general description of process (technical-economical aspects and policy) and status in developing countries is done. An enrichment demand in function of the Brazilian Nuclear Program is evaluated, analyzing a probable market and a low market. The perspectives to attend this demand, are studied. (E.G.) [pt

  10. IBM Brazil: and environmental modern view

    Cremonesi, Valter [IBM Brasil, Industria, Maquinas e Servicos Ltda., Rio de Janeiro, Rj (Brazil)

    1994-12-31

    Information of practical experiences on Environmental Affairs at IBM Brazil plant and branch offices is presented, with a modern view of the mission, resources, support, waste management, monitoring programs, recycling, energy conservation, partners programs, nature preservation 2rograms, recognitions and image. (author). 4 figs., 2 tabs.

  11. A UK view of Bulgaria's potential

    Haddon, J.

    2002-01-01

    This is a personal view of the options and challenges for the future of Eastern Europe countries. The widening of Europe, UK situation and investment criteria are discussed. Bulgaria is considered in better shape than some European states as a host for new or replacement nuclear power station construction

  12. A consensus view on liquidity risk

    Acharya, V.; Krishnamurthy, A.; Perotti, E.

    2011-01-01

    Liquidity risk - which was at the heart of the September 2008 financial meltdown and explains regulatory concerns about a Greek default today - remains an open issue in financial regulatory reform. This column presents a consensus view of several leading academics on what more needs to be done to

  13. Critical point of view: a Wikipedia reader

    Lovink, G.; Tkacz, N.

    2011-01-01

    For millions of internet users around the globe, the search for new knowledge begins with Wikipedia. The encyclopedia’s rapid rise, novel organization, and freely offered content have been marveled at and denounced by a host of commentators. Critical Point of View moves beyond unflagging praise,

  14. Decoupled Multicamera Sensing for Flexible View Generation

    Vivek K. Singh

    2016-01-01

    Full Text Available Any sensing paradigm has three important components, namely, the actor, the sensor, and the environment. Traditionally, the sensors have been attached to either the actor or the environment. This restricts the kind of sensing that can be undertaken. We study a newer decoupled sensing paradigm, which separates the sensors from both the actor and the environment and tremendously increases the flexibility with which the scenes can be viewed. For example, instead of showing just one view, “how the environment sees the actor” or “how the actor sees the environment,” a viewer can choose to see either one or both of these views and even choose to see the scene from any desired position in any desired direction. We describe a methodology using mobile autonomous sensors to undertake such decoupled sensing and study the feasible number as well as the placement of such sensors. Also, we describe how the sensors can coordinate their movements around a moving actor so as to continue capturing the required views with minimum overall cost. The practical results obtained demonstrate the viability of the proposed approach.

  15. The ViewPoint radioprotection supervision workstation

    Gaultier, E.

    2009-01-01

    The author briefly presents the ViewPoint supervision global solution which incorporates audio and video advanced technologies to manage radioprotection operational measurements. Data can be transmitted by-wire or wireless. It can integrate a large number of radioprotection measurement instruments, such as a belt for the monitoring of physiological parameters (body temperature, breathing rhythm, body posture)

  16. American Views of the Cultural Imperialism Charge.

    Breen, Myles P.

    The United States is a major exporter but a minor importer of films and television programs; this situation has been described as a one-way flow of information from the United States to other nations. Although the official United States position is one of dedication to the two-way flow of communication, the "majority" view is that the…

  17. College science teachers' views of classroom inquiry

    Brown, Patrick L.; Abell, Sandra K.; Demir, Abdulkadir; Schmidt, Francis J.

    2006-09-01

    The purposes of this study were to (a) gain an understanding of the views of inquiry held by faculty members involved in undergraduate science teaching and (b) describe the challenges, constraints, and opportunities that they perceived in designing and teaching inquiry-based laboratories. Participants included 19 college professors, representing both life and physical science disciplines, from (a) 2-year community college, (b) small, private nonprofit liberal arts college, (c) public master's granting university, and (d) public doctoral/research extensive university. We collected data through semistructured interviews and applied an iterative data analysis process. College science faculty members held a full and open inquiry view, seeing classroom inquiry as time consuming, unstructured, and student directed. They believed that inquiry was more appropriate for upper level science majors than for introductory or nonscience majors. Although faculty members valued inquiry, they perceived limitations of time, class size, student motivation, and student ability. These limitations, coupled with their view of inquiry, constrained them from implementing inquiry-based laboratories. Our proposed inquiry continuum represents a broader view of inquiry that recognizes the interaction between two dimensions of inquiry: (a) the degree of inquiry and (b) the level of student directedness, and provides for a range of inquiry-based classroom activities.

  18. Business Educators' Views on the Entrepreneurial Competencies ...

    This study investigated Business Educators' views on the entrepreneurial competencies eeded by business education graduates in Nigeria. A 23-item instrument was used for this study. The study sample comprised all the 66 Business Education lecturers in the universities and colleges of Education in Edo and Delta states ...

  19. Children's violent television viewing: are parents monitoring?

    Cheng, Tina L; Brenner, Ruth A; Wright, Joseph L; Sachs, Hari Cheryl; Moyer, Patricia; Rao, Malla R

    2004-07-01

    Violent media exposure has been associated with aggressive behavior, and it has been suggested that child health professionals counsel families on limiting exposure. Effective violence prevention counseling requires an understanding of norms regarding parental attitudes, practices, and influencing factors. Both theories of reasoned action and planned behavior emphasize that subjective norms and attitudes affect people's perceptions and intended behavior. Few data exist on violent television viewing and monitoring from a cross-section of families. By understanding the spectrum of parental attitudes, community-sensitive interventions for violence prevention can be developed. The objective of this study was to assess attitudes about and monitoring of violent television viewing from the perspective of parents. An anonymous self-report assisted survey was administered to a convenience sample of parents/guardians who visited child health providers at 3 sites: an urban children's hospital clinic, an urban managed care clinic, and a suburban private practice. The parent questionnaire included questions on child-rearing attitudes and practices and sociodemographic information. A total of 1004 adults who accompanied children for health visits were recruited for the study; 922 surveys were completed (participation rate: 92%). A total of 830 (90%) respondents were parents and had complete child data. Of the 830 respondents, 677 had questions on television viewing included in the survey and were the focus of this analysis. Seventy-five percent of families reported that their youngest child watched television. Of these, 53% reported always limiting violent television viewing, although 73% believed that their children viewed television violence at least 1 time a week. Among television viewers, 81% reported usually or always limiting viewing of sexual content on television and 45% reported usually or always watching television with their youngest child. Among children who watched

  20. Optimizing Aggregate SPARQL Queries Using Materialized RDF Views

    Ibragimov, Dilshod; Hose, Katja; Pedersen, Torben Bach

    2016-01-01

    , this paper proposes MARVEL (MAterialized Rdf Views with Entailment and incompLetness). The approach consists of a view selection algorithm based on an associated RDF-specific cost model, a view definition syntax, and an algorithm for rewriting SPARQL queries using materialized RDF views. The experimental...

  1. Value of the lateral view in diagnosing pleural plaques

    Hillerdal, G.

    1986-01-01

    To assess the value of the lateral view in the diagnosis of pleural plaques, 2018 chest roentgenograms from the general population were scrutinized for such plaques. The lateral and posterior-anterior (PA) views were read separately and without knowledge of the occupational history or other clinical data. Of the males, 4.8% had pleural plaques in the PA view and 2% had dorsal pleural plaques in the lateral view. A total of 54% of the positive cases in the PA view also showed typical plaques in the PA view. Thus, there remained a number of cases which were diagnosed only in the lateral view; in all, these constituted 18.8%

  2. Topic D. Retrievability: a spectrum of views radioactive waste disposal: taking societal views into account

    Rip, A.; Smit, W.A.; Van der Meulen, B.J.R.

    1994-01-01

    This work deals with the radioactive waste disposal. It takes into account the societal views. The main results as well as the methodological approach of argumentation patterns and argumentation scenarios are presented. (O.L.). 7 refs

  3. Contrastings views on bullying in Schools

    Hansen, Helle Rabøl

    Contrasting views on bullying in schools Which views on bullying influence teachers intervention strategies? This question is discussed  on the basis of the findings of my empirical study of that aspect of bullying that has to do with the position of the teacher (a quantitative survey...... of the teachers' staff room, observations, interviews and analysis of explicit ‘bullying-politics'). I found contradictions in teachers' definitions of the phenomenon of bullying, in how they describe causality and furthermore in how they would attempt to solve a specific and complicated bullying case....... The informants describe ‘bullying' in general terms that include group dynamic signs, when pressed for a causal explanation, or asked how they would handle a specific case. Most commonly, however, their focus is on the individual bully. In this, the teachers' positions seem to follow the commonplace conception...

  4. Environment monitoring using LabVIEW

    Hawtree, J.

    1995-01-01

    A system has been developed for electronically recording and monitoring temperature, humidity, and other environmental variables at the Silicon Detector Facility located in Lab D. The data is collected by LabVIEW software, which runs in the background on an Apple Macintosh. The software is completely portable between Macintosh, MS Windows, and Sun platforms. The hardware includes a Macintosh with 8 MB of RAM; an external ADC-1 analog-to-digital converter that uses a serial port; LabVIEW software; temperature sensors; humidity sensors; and other voltage/current sensing devices. ADC values are converted to ASCII strings and entered into files which are read over Ethernet. Advantages include automatic logging, automatic recovery after power interruptions, and the availability of stand-alone applications for other locations with inexpensive software and hardware

  5. A view at "Talco de vidro"

    Lielson Zeni

    2015-12-01

    Full Text Available This article aims to find a way of viewing comic books by borrowing the lenses and the views of Maurice Marleau-Ponty. The object of study is the work of Marcello Quintanilha, more specifically the album Talco de Vidro (Glass Powder - free translation. Through the ideas proposed by Merleau-Ponty, it was tried to understand the cutting mechanisms, a typical interruption in comic books, as a space between a place where the reader´s imagination is activated, and the meanings that may come up. All of that is taken into account having as background the story of Rosangela, the main character of Talco de Vidro, who sees the world in a very particular way.

  6. BAMUD Features Demonstration by System View

    D. Kocur

    2004-09-01

    Full Text Available Direct-sequence code-division multiple access (DS-CDMA is afrequently used wireless technology in DS-CDMA communications. Theconventional DS-CDMA detector follows a single-user detection strategyin which each user is detected separately without regard for the otherusers. The better strategy is multi-user detection (MUD, whereinformation about multiple users is used to improve detection of eachindividual user. This paper presents an adaptive multi-user detectorconverging (for any initialization to the minimum mean square error(MMSE detector without requiring training sequences. This blindmulti-user detector (BAMUD requires no more knowledge than does theconventional single-user detector. The structure of adaptive blinddetector is simulated by the system design tool SystemView. The aimfocus is to verify theoretical knowledge of BAMUD structure usinghardware-oriented PC-based model in SystemView.

  7. Ravintolaelämys : case Wine & View

    Piirainen, Anu

    2010-01-01

    Tämä opinnäytetyö käsittelee ravintolaelämystä ja sen syntyyn vaikuttavia tekijöitä. Työn toimeksiantaja on Wine & view viinibaari Helsinki-Vantaan lentoasemalla. Wine & view viinibaari on osa SSP Finland Oy:n ravintolatarjontaa lentoasemalla. Opinnäytetyön teoriaosuudessa selvitetään elämystä yhteiskunnan, asiakaspalveluyrityksen ja asiakkaan näkökulmasta. Lisäksi teoriaosuudessa lähestytään aihetta kuluttajakäyttäytymisen näkökulmasta. Työn empiirisessä osuudessa haetaan asiakkaiden hav...

  8. Spectral evolution of galaxies: current views

    Bruzual, A.G.

    1985-01-01

    A summary of current views on the interpretation of the various evolutionary tests aimed at detecting spectral evolution in galaxies is presented. It is concluded that the evolution taking place in known galaxy samples is a slow process (perhaps consistent with no evolution at all), and that the early phases of rapid spectral evolution in early-type galaxies have not yet been detected. (author)

  9. New views of the solar system

    2010-01-01

    Are you up to date on the solar system? When the International Astronomical Union redefined the term ""planet,"" Pluto was downgraded to a lower status. New Views of the Solar System looks at scientists' changing perspectives, with articles on Pluto, the eight chief planets, and dwarf planets. Brilliant photos and drawings showcase the planets, asteroids, comets, and more, providing a stunning collection of vivid images.

  10. New views of the solar system

    2013-01-01

    Are you up to date on the solar system?  When the International Astronomical Union redefined the term ""planet,"" Pluto was downgraded to a lower status. New Views of the Solar System 2013 looks at scientists' changing perspectives, with articles on Pluto, the eight chief planets, and dwarf planets, new missions, updates for ongoing missions, newly-discovered moons, and updated tables. Brilliant photos and drawings showcase the planets, asteroids, comets, and more, providing a stunning collection of vivid images.

  11. View of software for HEP experiments

    Johnstad, H.; Lebrun, P.; Lessner, E.S.; Montgomery, H.E.

    1986-05-01

    A view of the software structure typical of a High Energy Physics experiment is given and the availability of general software modules in most of the important regions is discussed. The aim is to provide a framework for discussion of capabilities and inadequecies and thereby define areas where effort should be assigned and perhaps also to serve as a useful source document for the newcomer to High Energy Physics. 74 refs.

  12. Creating and Viewing HTML Files with Python

    William J. Turkel

    2012-07-01

    Full Text Available This lesson uses Python to create and view an HTML file. If you write programs that output HTML, you can use any browser to look at your results. This is especially convenient if your program is automatically creating hyperlinks or graphic entities like charts and diagrams. Here you will learn how to create HTML files with Python scripts, and how to use Python to automatically open an HTML file in Firefox.

  13. World view of the EGEE infrastrucutre

    2007-01-01

    This view is of the Enabling Grids for E-sciencE (EGEE) project seen on the world scale. The EGEE allows the processing power of many computers to be shared so that the huge amount of data produced at CERN's new collider, the Large Hadron Collider (LHC) can be processed. The sites used in the Grid can be downloaded in a zipped .kmz format, which can be imported into Google Earth.

  14. European view of the EGEE infrastructure

    2007-01-01

    This view is of the Enabling Grids for E-sciencE (EGEE) infrastructure zoomed in on Europe. The EGEE allows the processing power of many computers to be shared so that the huge amount of data produced at CERN's new collider, the Large Hadron Collider (LHC) can be processed. The sites used in the Grid can be downloaded in a zipped .kmz format, which can be imported into Google Earth.

  15. A Deported View Concept for Touch Interaction

    Alapetite, Alexandre; Andersen, Henning Boje; Fogh, Rune

    2013-01-01

    Following the paradigm shift where physical controls are replaced by touch-enabled surfaces, we report on an experimental evaluation of a user interface concept that allows touchscreen-based panels to be manipulated partially blindly (aircrafts, cars). The proposed multi-touch interaction strategy...... – involving visual front-view feedback to the user from a copy of the peripheral panel being manipulated – compares favourably against trackballs or head-down interactions....

  16. French views on the nuclear fuel cycle

    Chavardes, D.

    1986-01-01

    Fuel cycle activities are viewed in France as a very important and indissociable part of our nuclear program. Supply of material and services are firmly assured for domestic needs and overcapacities provide opportunities for industry to compete on the international market. A permanent and consistent R and D effort is continuously undertaken, aiming to apply new advanced technologies improving safety, economy and reliability of fuel cycle installations

  17. Endogenous money: the evolutionary versus revolutionary views

    Louis-Philippe Rochon; Sergio Rossi

    2013-01-01

    The purpose of this paper is to shed light on the endogenous nature of money. Contrary to the established post-Keynesian, or evolutionary, view, this paper argues that money has always been endogenous, irrespective of the historical period. Instead of the evolutionary theory of money and banking that can be traced back to Chick (1986), this paper puts forward a revolutionary definition of endogenous money consistent with many aspects of post-Keynesian economics as well as with the monetary ci...

  18. View of software for HEP experiments

    Johnstad, H.; Lebrun, P.; Lessner, E.S.; Montgomery, H.E.

    1986-05-01

    A view of the software structure typical of a High Energy Physics experiment is given and the availability of general software modules in most of the important regions is discussed. The aim is to provide a framework for discussion of capabilities and inadequecies and thereby define areas where effort should be assigned and perhaps also to serve as a useful source document for the newcomer to High Energy Physics. 74 refs

  19. Animal experimentation--a personal view.

    Gershoff, Stanley N

    2009-02-01

    Disagreement about the use of animals in biomedical research has resulted in absurd positions by both sides. Increasingly, some zealots against animal experimentation have resorted to violence or other illegal acts to support their points of view. The value of animal research in providing better health for man and animals is incontrovertible. This is illustrated by references to animal research in the field of nutrition.

  20. Viewing Chinese art on an interactive tabletop.

    Hsieh, Chun-ko; Hung, Yi-Ping; Ben-Ezra, Moshe; Hsieh, Hsin-Fang

    2013-01-01

    To protect fragile paintings and calligraphy, Taiwan's National Palace Museum (NPM) has policies controlling the frequency and duration of their exposure. So, visitors might not see the works they planned to see. To address this problem, the NPM installed an interactive tabletop for viewing the works. This tabletop, the first to feature multiresolution and gigapixel photography technology, displays extremely high-quality images revealing brushwork-level detail. A user study at the NPM examined the tabletop's performance and collected visitor feedback.

  1. New views of the solar system

    2009-01-01

    Is your library up to date on the Solar System? When the International Astronomical Union redefined the term "planet," Pluto was stripped of its designation as the solar system''s ninth planet. New Views of the Solar System looks at scientists'' changing perspectives on the solar system, with articles on Pluto, the eight chief planets, and dwarf planets. Brilliant photos and drawings showcase the planets, asteroids, comets, and more, providing a stunning collection of vivid and detailed images of the solar system.

  2. Distributed Access View Integrated Database (DAVID) system

    Jacobs, Barry E.

    1991-01-01

    The Distributed Access View Integrated Database (DAVID) System, which was adopted by the Astrophysics Division for their Astrophysics Data System, is a solution to the system heterogeneity problem. The heterogeneous components of the Astrophysics problem is outlined. The Library and Library Consortium levels of the DAVID approach are described. The 'books' and 'kits' level is discussed. The Universal Object Typer Management System level is described. The relation of the DAVID project with the Small Business Innovative Research (SBIR) program is explained.

  3. Summary view on demonstration reactor safety

    Satoh, Kazuziro; Kotake, Shoji; Tsukui, Yutaka; Inagaki, Tatsutoshi; Miura, Masanori

    1991-01-01

    This work presents a summary view on safety design approaches for the demonstration fast breeder reactor (DFBR). The safety objective of DFBR is to be at lea as safe as a LWR. Major safety issues discussed in this paper are; reduction of sodium void reactivity worth, adoption of self-actuated mechanism in the backup shutdown system, use of the direct reactor auxiliary cooling system (DRACS), provision of the containment system. (author)

  4. Creating and Viewing HTML Files with Python

    William J. Turkel; Adam Crymble

    2012-01-01

    This lesson uses Python to create and view an HTML file. If you write programs that output HTML, you can use any browser to look at your results. This is especially convenient if your program is automatically creating hyperlinks or graphic entities like charts and diagrams. Here you will learn how to create HTML files with Python scripts, and how to use Python to automatically open an HTML file in Firefox.

  5. The economics of roadside bear viewing

    Richardson, Leslie; Rosen, Tatjana; Gunther, Kerry; Schwartz, Chuck

    2014-01-01

    Viewing bears along roadside habitats is a popular recreational activity in certain national parks throughout the United States. However, safely managing visitors during traffic jams that result from this activity often requires the use of limited park resources. Using unique visitor survey data, this study quantifies economic values associated with roadside bear viewing in Yellowstone National Park, monetary values that could be used to determine whether this continued use of park resources is warranted on economic grounds. Based on visitor expenditure data and results of a contingent visitation question, it is estimated that summer Park visitation would decrease if bears were no longer allowed to stay along roadside habitats, resulting in a loss of 155 jobs in the local economy. Results from a nonmarket valuation survey question indicate that on average, visitors to Yellowstone National Park are willing to pay around $41 more in Park entrance fees to ensure that bears are allowed to remain along roads within the Park. Generalizing this value to the relevant population of visitors indicates that the economic benefits of allowing this wildlife viewing opportunity to continue could outweigh the costs of using additional resources to effectively manage these traffic jams.

  6. Television viewing associates with delayed language development.

    Chonchaiya, Weerasak; Pruksananonda, Chandhita

    2008-07-01

    To identify impact of television viewing on language development. The case-control study included 56 new patients with language delay and 110 normal children, aged 15-48 months. Language delay was diagnosed by reviewing language milestones and Denver-II. Television viewing variables and child/parental characteristics between both groups were interviewed. The data were analyzed by ANOVA and chi-square test. Adjusted odds ratios and 95% confidence intervals were calculated from multivariate logistic regression model. Forty-six boys and 10 girls; mean [+/-SD] age, 2.11+/-0.47 years of the case group and 59 boys and 51 girls; mean [+/-SD] age, 2.23+/-0.80 years of the control group were enrolled. Children who had language delay usually started watching television earlier at age 7.22+/-5.52 months vs. 11.92+/-5.86 months, p-valuetelevision than normal children (3.05+/-1.90 h/day vs. 1.85+/-1.18 h/day; p-valuetelevision attelevision>2 h/day were approximately six times more likely to have language delays. There is a relationship between early onset and high frequency of TV viewing and language delay.

  7. Retrievable disposal - opposing views on ethics

    Selling, H.A.

    2000-01-01

    In the previous decades many research programmes on the disposal of radioactive waste have been completed in the Netherlands. The experts involved have reconfirmed their view that deep underground disposal in suitable geological formations would ensure a safe and prolonged isolation of the waste from the biosphere. Both rock salt and clay formations are considered to qualify as a suitable host rock. In 1993 the government in a position paper stated that such a repository should be designed in a way that the waste can be retrieved from it, should the need arise. In an attempt to involve stakeholders in the decision-making process, a research contract was awarded to an environmental group to study the ethical aspects related to retrievable disposal of radioactive waste. In their report which was published in its final form in January 2000 the authors concluded that retrievable disposal is acceptable from an ethical point of view. However, this conclusion was reached in the understanding that this situation of retrievability would be permanent. From the concept of equity between generations, each successive generation should be offered equal opportunities to decide for itself how to dispose of the radioactive waste. Consequently, the preferred disposal option is retrievable disposal (or long term storage) in a surface facility. Although this view is not in conformity with the ''official'' position on radioactive waste disposal, there is a benefit of having established a dialogue between interested parties in a broad sense. (author)

  8. Usability of stereoscopic view in teleoperation

    Boonsuk, Wutthigrai

    2015-03-01

    Recently, there are tremendous growths in the area of 3D stereoscopic visualization. The 3D stereoscopic visualization technology has been used in a growing number of consumer products such as the 3D televisions and the 3D glasses for gaming systems. This technology refers to the idea that human brain develops depth of perception by retrieving information from the two eyes. Our brain combines the left and right images on the retinas and extracts depth information. Therefore, viewing two video images taken at slightly distance apart as shown in Figure 1 can create illusion of depth [8]. Proponents of this technology argue that the stereo view of 3D visualization increases user immersion and performance as more information is gained through the 3D vision as compare to the 2D view. However, it is still uncertain if additional information gained from the 3D stereoscopic visualization can actually improve user performance in real world situations such as in the case of teleoperation.

  9. Introduction of hind foot coronal alignment view

    Moon, Il Bong; Jeon, Ju Seob; Yoon, Kang Cheol; Choi, Nam Kil; Kim, Seung Kook

    2006-01-01

    Accurate clinical evaluation of the alignment of the calcaneus relative to the tibia in the coronal plane is essential in the evaluation and treatment of hind foot pathologic condition. Previously described standard anteroposterior, lateral, and oblique radiographic methods of the foot or ankle do not demonstrate alignment of the tibia relation to the calcaneus in the coronal plane. The purpose of this study was to introduce hind foot coronal alignment view. Both feet were imaged simultaneously on an elevated, radiolucent foot stand equipment. Both feet stood on a radiolucent platform with equal weight on both feet. Both feet are located foot axis longitudinal perpendicular to the platform. Silhouette tracing around both feet are made, and line is then drawn to bisect the silhouette of the second toe and the outline of the heel. The x-ray beam is angled down approximately 15 .deg. to 20 .deg. This image described tibial axis and medial, lateral tuberosity of calcaneus. Calcaneus do not rotated. The view is showed by talotibial joint space. Although computed tomographic and magnetic resonance imaging techniques are capable of demonstrating coronal hind foot alignment, they lack usefulness in most clinical situations because the foot is imaged in a non-weight bearing position. But hind foot coronal alignment view is obtained for evaluating position changing of inversion, eversion of the hind foot and varus, valgus deformity of calcaneus

  10. Viewing Teaching Techniques in Enhancing Viewing Comprehension Skills of Undergraduate Students in Literature

    Ruth Ortega-Dela Cruz

    2017-06-01

    Full Text Available In today’s generation of digital natives, students find it unexciting to sit down and read literary texts in its entirety. Thus, students nowadays hardly understand and appreciate literature as a subject. This calls for additional challenge to teachers who had been used to deliver their lessons or any subject matter in traditional ways. This study used descriptive-correlational research design to unveil the most effective viewing teaching techniques that will help develop the viewing comprehension skills of literature students in a tertiary level. Findings reveal how literature students perceive the use of movies or videos as a powerful viewing teaching technique. Result of chi-square test of independence indicates the viewing teaching techniques are not significantly related to students’ viewing comprehension. This suggests that no single teaching technique suits the learners’ interest and ability to learn. Therefore, teachers can make use of technology combined with other viewing techniques to ensure that students will find a love for literature that will help establish their academic success in the future.

  11. Cross-View Action Recognition via Transferable Dictionary Learning.

    Zheng, Jingjing; Jiang, Zhuolin; Chellappa, Rama

    2016-05-01

    Discriminative appearance features are effective for recognizing actions in a fixed view, but may not generalize well to a new view. In this paper, we present two effective approaches to learn dictionaries for robust action recognition across views. In the first approach, we learn a set of view-specific dictionaries where each dictionary corresponds to one camera view. These dictionaries are learned simultaneously from the sets of correspondence videos taken at different views with the aim of encouraging each video in the set to have the same sparse representation. In the second approach, we additionally learn a common dictionary shared by different views to model view-shared features. This approach represents the videos in each view using a view-specific dictionary and the common dictionary. More importantly, it encourages the set of videos taken from the different views of the same action to have the similar sparse representations. The learned common dictionary not only has the capability to represent actions from unseen views, but also makes our approach effective in a semi-supervised setting where no correspondence videos exist and only a few labeled videos exist in the target view. The extensive experiments using three public datasets demonstrate that the proposed approach outperforms recently developed approaches for cross-view action recognition.

  12. LabVIEW A Developer's Guide to Real World Integration

    Fairweather, Ian

    2011-01-01

    LabVIEW(t) has become one of the preeminent platforms for the development of data acquisition and data analysis programs. LabVIEW(t): A Developer's Guide to Real World Integration explains how to integrate LabVIEW into real-life applications. Written by experienced LabVIEW developers and engineers, the book describes how LabVIEW has been pivotal in solving real-world challenges. Each chapter is self-contained and demonstrates the power and simplicity of LabVIEW in various applications, from image processing to solar tracking systems. Many of the chapters explore how exciting new technologies c

  13. Contemporary views on human aging and longevity

    Chmielewski Piotr

    2016-06-01

    Full Text Available Aging is currently stimulating intense interest of both researchers and the general public. In developed countries, the average life expectancy has increased by roughly 30 years within the last century, and human senescence has been delayed by around a decade. Although aging is arguably the most familiar aspect of human biology, its proximate and ultimate causes have not been elucidated fully and understood yet. Nowadays there are two main approaches to the ultimate causes of aging. These are deterministic and stochastic models. The proximate theories constitute a distinct group of explanations. They focus on mechanistic causes of aging. In this view, there is no reason to believe that there is only one biological mechanism responsible for aging. The aging process is highly complex and results from an accumulation of random molecular damage. Currently, the disposable soma theory (DST, proposed by Thomas Kirkwood, is the most influential and coherent line of reasoning in biogerontology. This model does not postulate any particular mechanism underpinning somatic defense. Therefore, it is compatible with various models, including mechanistic and evolutionary explanations. Recently, however, an interesting theory of hyper-function of mTOR as a more direct cause of aging has been formulated by Mikhail Blagosklonny, offering an entirely different approach to numerous problems and paradoxes in current biogerontology. In this view, aging is quasi-programmed, which means that it is an aimless continuation of developmental growth. This mTOR-centric model allows the prediction of completely new relationships. The aim of this article is to present and compare the views of both parties in the dispute, based on the results of some recent experimental studies, and the contemporary knowledge of selected major aspects of human aging and longevity

  14. A molecular view of heterogeneous catalysis

    Christensen, Claus H.; Nørskov, Jens Kehlet

    2008-01-01

    The establishment of a molecular view of heterogeneous catalysis has been hampered for a number of reasons. There are, however, recent developments, which show that we are now on the way towards reaching a molecular-scale picture of the way solids work as catalysts. By a combination of new...... by enabling a rational design of new catalysts. We illustrate this important development in heterogeneous catalysis by highlighting recent examples of catalyst systems for which it has been possible to achieve such a detailed understanding. In particular, we emphasize examples where this progress has made...

  15. Two views of functional mapping and autoradiography

    McEachron, D.L.; Adler, N.T.; Tretiak, O.J.

    1986-01-01

    This chapter is meant to serve as an initial introduction into the use and analysis of functional mapping with radiotracers and film autoradiography. The first section describes functional autoradiography from a biologist's point of view, reviewing the advantages of radiotracers for bridging the gap between behavior and neurophysiology. The physical and chemical assumptions underlying the use of radiotracers in biological systems are then examined. The second section looks at the autoradiogram from an engineering standpoint and investigates how the basic physics of radioactive decay influences the measured parameters of autoradiographs. The problems of video densitometry and the quantification of optical density and isotope concentrations are discussed

  16. Masturbation: Scientific Evidence and Islam's View.

    Hoseini, Sayed Shahabuddin

    2017-12-01

    Masturbation is the stimulation of sexual organs usually to the point of orgasm with an essential autoerotic component. Due to the high prevalence of this sexual behavior, it was and still is a matter of debate if masturbation is a normal action without any side effects and even if it is advantageous or it is associated with side effects necessitating public education how to avoid it. In addition, it is a common question if masturbation is religiously lawful or not. In this study, I assess the results of scientific studies about this sexual behavior and also shed some light on the Islam's view about it.

  17. E-Business Development : A Strategic View

    Saad Haj Bakry

    2002-06-01

    Full Text Available E-business is becoming increasingly important for countries, organizations and individuals, as it gives them efficiency, and as it integrates them together, and with the world at large. This paper aims at providing a strategic view of the development of e-business. It starts by identifying e-business, and by reviewing its current progress. It then presents an e-business development profile, that defines the various elements associated with it. Based on the profile, the paper then provides future development guidelines, and identifies recommended plans.

  18. Tensionless superstrings: view from the worldsheet

    Bagchi, Arjun [Center for Theoretical Physics, Massachusetts Institute of Technology,77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Indian Institute of Technology Kanpur,Kanpur 208016 (India); Chakrabortty, Shankhadeep [Van Swinderen Institute for Particle Physics and Gravity, University of Groningen, Nijenborgh 4, 9747 AG Groningen (Netherlands); Parekh, Pulastya [Indian Institute of Technology Kanpur,Kanpur 208016 (India); Indian Institute of Science Education and Research,Dr Homi Bhabha Road, Pashan. Pune 411008, Iindia (India)

    2016-10-21

    In this brief note, we show that the residual symmetries that arise in the analysis of the tensionless superstrings in the equivalent of the conformal gauge is (a trivial extension of) the recently discovered 3d Super Bondi-Metzner-Sachs algebra, discussed in the context of asymptotic symmetries of 3d Supergravity in flat-spacetimes. This helps us uncover a limiting approach to the construction of the tensionless superstring from the point of view of the worldsheet, analogous to the one we had adopted earlier for the closed tensionless bosonic string.

  19. Remote viewing system development in BNFL

    Case, D.R.; Garlick, D.R.; Crawford, G.; Montgomerie, J.

    1996-01-01

    The application of imaging systems to BNFL's plants is primarily provided by the Company's Engineering Group. Many systems have been developed for active service and several new developments are currently in an advanced stage of implementation. BNFL has acquired extensive experience of remote viewing from a series of projects undertaken for the Sellafield site in West Cumbria. Applications vary in size and complexity, from simple identification of bar-codes to more complex schemes for remotely storing UO 3 drums. Some are high speed and highly repetitive, whereas others are low speed but require high precision. In this paper the authors outline a selection of current applications. (UK)

  20. Common views of potentially attractive fusion concepts

    Piet, S.J.

    1986-01-01

    Fusion is viewed through three windows to help determine what constitutes a very attractive fusion concept. These windows are economics, maintenance and reliability, and safety and environment. Achievement of many desired features cannot yet be quantified. Although these differing perspectives can lead to some conflicting desires, five common desired features are apparent - (a) minimum failure rates, (b) minimum failure effects, (c) minimum complexity, (d) minimum short-term radioactivity, and (e) maximum mass power density. Some innovative fusion concepts are briefly examined in the light of these commonalities

  1. Anglo-American views of Gavrilo Princip

    Markovich Slobodan G.

    2015-01-01

    Full Text Available The paper deals with Western (Anglo-American views on the Sarajevo assassination/attentat and Gavrilo Princip. Articles on the assassination and Princip in two leading quality dailies (The Times and The New York Times have particularly been analysed as well as the views of leading historians and journalists who covered the subject including: R. G. D. Laffan, R. W. Seton-Watson, Winston Churchill, Sidney Fay, Bernadotte Schmitt, Rebecca West, A. J. P. Taylor, Vladimir Dedijer, Christopher Clark and Tim Butcher. In the West, the original general condemnation of the assassination and its main culprits was challenged when Rebecca West published her famous travelogue on Yugoslavia in 1941. Another Brit, the remarkable historian A. J. P. Taylor, had a much more positive view on the Sarajevo conspirators and blamed Germany and Austria-Hungary for the outbreak of the Great War. A turning point in Anglo-American perceptions was the publication of Vladimir Dedijer’s monumental book The Road to Sarajevo (1966, which humanised the main conspirators, a process initiated by R. West. Dedijer’s book was translated from English into all major Western languages and had an immediate impact on the understanding of the Sarajevo assassination. The rise of national antagonisms in Bosnia gradually alienated Princip from Bosnian Muslims and Croats, a process that began in the 1980s and was completed during the wars of the Yugoslav succession. Although all available sources clearly show that Princip, an ethnic Serb, gradually developed a broader Serbo-Croat and Yugoslav identity, he was ethnified and seen exclusively as a Serb by Bosnian Croats and Bosniaks and Western journalists in the 1990s. In the past century imagining Princip in Serbia and the West involved a whole spectrum of views. In interwar Anglo-American perceptions he was a fanatic and lunatic. He became humanised by Rebecca West (1941, A. J. P. Taylor showed understanding for his act (1956, he was fully

  2. Modern Meteor Science An Interdisciplinary View

    Hawkes, Robert; Brown, Peter

    2005-01-01

    This volume represents a blend of leading edge research and authoritative reviews in meteor science. It provides a comprehensive view of meteoroid research including the dynamics, sources and distribution of these bodies, and their chemistry and physical processes in the interplanetary medium and the Earth’s atmosphere. Techniques for investigation of meteor phenomena in the book include conventional and large aperture radar systems, spacecraft detection, optical systems, spectral measurements, and laboratory based interplanetary dust particle studies. The book will be of interest to researchers and students in astronomy, astrophysics, cosmochemistry, space engineering and space science. Cover photograph was taken by Masayuki Toda.

  3. Ergonomics, education and children: a personal view.

    Woodcock, A

    2007-10-01

    Educational ergonomics - the teaching of ergonomics and the design of environments where ergonomics teaching and learning might occur - has received little attention from ergonomists. This paper first describes the roots of the author's interest and research in educational ergonomics; second it provides a personal view of the opportunities and challenges posed by the two streams of educational ergonomics; and lastly it considers the implications of teaching ergonomics to children in terms of their personal development, the design of schools and the impact such initiatives might have on wider societal problems.

  4. Common views of potentially attractive fusion concepts

    Piet, S.J.

    1986-01-01

    Several innovative fusion concepts have recently been proposed with the intent of improving radically the attractiveness of fusion energy. Before their assessment is complete, however, the question of what constitutes an especially attractive fusion product should be examined from multiple viewpoints. The primary purpose of this paper is to examine views of potentially attractive fusion concepts from three perspectives, trying to determine commonalities. These viewpoints are (a) economics, (b) maintenance and reliability, and (c) safety and environment. The secondary purpose of the paper is to review some innovative concepts from these viewpoints

  5. Remote viewing system development in BNFL

    Case, D.R.; Garlick, D.R.; Crawford, G.; Montgomerie, J.

    1996-01-01

    The application of imaging systems to BNFL's plants is primarily provided by the Company's Engineering Group. Many systems have been developed for active service and several new developments are currently in an advanced stage of implementation. BNFL has acquired extensive experience of remote viewing from a series of projects undertaken for the Sellafield site in West Cumbria. Applications vary in size and complexity, from simple identification of bar-codes to more complex schemes for remotely storing UO 3 drums. Some are high speed and highly repetitive, whereas others are low speed but require high precision. In this paper the authors shall outline a selection of current applications. (Author)

  6. Views from the japanese regulatory authority

    Aoyama, S.

    2004-01-01

    The legislation system for regulation of radioisotope in Japan was established in 1957. The system has been revised gradually since its establishment. Major amendments of the law were made in 1988 on the basis of ICRP Publication 26 and in 2000 on the basis of Publication 60. Main principles provided in the publication have been already introduced into the law. However, some concepts proposed in the recommendations are still under discussion. The current status of implementation of the ICRP recommendations in the Japanese regulatory system is summarised. Views from the regulatory authority of Japan on the points to be improved in the current system of radiological protection are presented. (author)

  7. TOWARDS A UNIFIED VIEW OF METAHEURISTICS

    El-Ghazali Talbi

    2013-02-01

    Full Text Available This talk provides a complete background on metaheuristics and presents in a unified view the main design questions for all families of metaheuristics and clearly illustrates how to implement the algorithms under a software framework to reuse both the design and code. The key search components of metaheuristics are considered as a toolbox for: - Designing efficient metaheuristics (e.g. local search, tabu search, simulated annealing, evolutionary algorithms, particle swarm optimization, scatter search, ant colonies, bee colonies, artificial immune systems for optimization problems. - Designing efficient metaheuristics for multi-objective optimization problems. - Designing hybrid, parallel and distributed metaheuristics. - Implementing metaheuristics on sequential and parallel machines.

  8. A view to the new safeguards system

    Tsuboi, Hiroshi

    2000-01-01

    The Additional Protocol to the Safeguards Agreement between Japan and the IAEA entered into force on 16 December 1999. An initial declaration of the expanded information will be provided to the IAEA by next June in accordance with the Additional Protocol. In Japan the new integrated safeguards system, which strengthens the effectiveness and improves efficiency of IAEA Safeguards, is considered to be very important issue. The establishment of a permanent and universal safeguards system including application of safeguards in Nuclear Weapon States also is an important issue from the view-point of not only non-proliferation but also nuclear disarmament. Safeguards are expected to have an increasingly important role. (author)

  9. Statistical view on nuclear multifragmentation: Primary decays

    Raduta, A.H.; Raduta, A.R.

    1997-01-01

    An overall view on the universe of primary decays appearing in the process of nuclear multifragmentation via a microcanonical Monte Carlo Metropolis type simulation is given. General characteristics like mass and charge distributions, relative probabilities of evaporation, fission, fragmentation and vaporization, average number of fragments and distributions of a number of intermediate mass fragments offer valuable information about the intimacy of the process. The capability of the model to describe unitary very different breakup regimes is pointed out. Predictions for charge distributions, isotopic yields, and fission mass distributions are compared with experimental data. copyright 1997 The American Physical Society

  10. Parental TV viewing, parental self-efficacy, media equipment and TV viewing among preschool children.

    Jago, Russell; Sebire, Simon J; Edwards, Mark J; Thompson, Janice L

    2013-11-01

    This study examined if parental TV viewing, parental self-efficacy or access to media equipment were associated with TV viewing among UK preschool-aged children. Data were derived from a cross-sectional survey of 252 parents of 3-5-year-old children. Parents reported child and parent TV viewing and the number of TVs, DVDs, computers, games consoles, hand-held games consoles, music players and laptop computers in the home. Parents also completed scales which assessed their self-efficacy to limit the screen viewing (SV) and promote the physical activity (PA) and their own PA self-efficacy. Analysis indicated that around two thirds of the children spent two or more hours per day watching TV while 75 % of parents watched ≥ 2 h of TV per day. Logistic regression models showed that children who had a parent who watched ≥ 2 h of TV per day were over five times more likely to also watch ≥ 2 h of TV per day. Each unit increase in parental self-efficacy to limit SV was associated with a 77 % reduction in the likelihood that the child watched ≥ 2 h of TV per day. Each additional piece of media equipment in the home was associated with a 28 % increase in the likelihood that parents watched ≥ 2 h of TV per day. Family-based interventions focusing on changing access to home media equipment and building parental self-efficacy to reduce child TV viewing could form part of efforts to reduce TV viewing among preschool children.

  11. Automatic Sky View Factor Estimation from Street View Photographs—A Big Data Approach

    Jianming Liang

    2017-04-01

    Full Text Available Hemispherical (fisheye photography is a well-established approach for estimating the sky view factor (SVF. High-resolution urban models from LiDAR and oblique airborne photogrammetry can provide continuous SVF estimates over a large urban area, but such data are not always available and are difficult to acquire. Street view panoramas have become widely available in urban areas worldwide: Google Street View (GSV maintains a global network of panoramas excluding China and several other countries; Baidu Street View (BSV and Tencent Street View (TSV focus their panorama acquisition efforts within China, and have covered hundreds of cities therein. In this paper, we approach this issue from a big data perspective by presenting and validating a method for automatic estimation of SVF from massive amounts of street view photographs. Comparisons were made with SVF estimates derived from two independent sources: a LiDAR-based Digital Surface Model (DSM and an oblique airborne photogrammetry-based 3D city model (OAP3D, resulting in a correlation coefficient of 0.863 and 0.987, respectively. The comparisons demonstrated the capacity of the proposed method to provide reliable SVF estimates. Additionally, we present an application of the proposed method with about 12,000 GSV panoramas to characterize the spatial distribution of SVF over Manhattan Island in New York City. Although this is a proof-of-concept study, it has shown the potential of the proposed approach to assist urban climate and urban planning research. However, further development is needed before this approach can be finally delivered to the urban climate and urban planning communities for practical applications.

  12. Opportunity's View After Drive on Sol 1806

    2009-01-01

    NASA's Mars Exploration Rover Opportunity used its navigation camera to take the images combined into this full-circle view of the rover's surroundings just after driving 60.86 meters (200 feet) on the 1,806th Martian day, or sol, of Opportunity's surface mission (Feb. 21, 2009). North is at the center; south at both ends. Tracks from the drive extend northward across dark-toned sand ripples and light-toned patches of exposed bedrock in the Meridiani Planum region of Mars. For scale, the distance between the parallel wheel tracks is about 1 meter (about 40 inches). Engineers designed the Sol 1806 drive to be driven backwards as a strategy to redistribute lubricant in the rovers wheels. The right-front wheel had been showing signs of increased friction. The rover's position after the Sol 1806 drive was about 2 kilometer (1.2 miles) south southwest of Victoria Crater. Cumulative odometry was 14.74 kilometers (9.16 miles) since landing in January 2004, including 2.96 kilometers (1.84 miles) since climbing out of Victoria Crater on the west side of the crater on Sol 1634 (August 28, 2008). This view is presented as a cylindrical projection with geometric seam correction.

  13. A unified view of "how allostery works".

    Tsai, Chung-Jung; Nussinov, Ruth

    2014-02-01

    The question of how allostery works was posed almost 50 years ago. Since then it has been the focus of much effort. This is for two reasons: first, the intellectual curiosity of basic science and the desire to understand fundamental phenomena, and second, its vast practical importance. Allostery is at play in all processes in the living cell, and increasingly in drug discovery. Many models have been successfully formulated, and are able to describe allostery even in the absence of a detailed structural mechanism. However, conceptual schemes designed to qualitatively explain allosteric mechanisms usually lack a quantitative mathematical model, and are unable to link its thermodynamic and structural foundations. This hampers insight into oncogenic mutations in cancer progression and biased agonists' actions. Here, we describe how allostery works from three different standpoints: thermodynamics, free energy landscape of population shift, and structure; all with exactly the same allosteric descriptors. This results in a unified view which not only clarifies the elusive allosteric mechanism but also provides structural grasp of agonist-mediated signaling pathways, and guides allosteric drug discovery. Of note, the unified view reasons that allosteric coupling (or communication) does not determine the allosteric efficacy; however, a communication channel is what makes potential binding sites allosteric.

  14. Views of US drivers about driving safety.

    Williams, Allan F

    2003-01-01

    To assess how drivers view dangers on the highway, what motivates them to drive safely, how they say they reduce their crash and injury risk, and how they rate their own driving skills. Most drivers rated their skills as better than average. The biggest motivating factor for safe driving was concern for safety of others in their vehicle, followed by negative outcomes such as being in a crash, increased insurance costs, and fines. The greatest threats to their safety were thought to be other drivers' actions that increase crash risk such as alcohol impairment or running red lights. In terms of reducing crashes and injuries, drivers tended to focus on actions they could take such as driving defensively or using seat belts. There was less recognition of the role of vehicles and vehicle features in crash or injury prevention. Knowing how drivers view themselves and others, their concerns, and their motivations and techniques for staying out of trouble on the roads provides insight into the difficulty of changing driving practices.

  15. Three points of view in transport theory

    Ruben, Panta Pazos [Faculdade de Matematica, PUCRS, Porto Alegre, RS (Brazil); Tilio de Vilhena, M. [Instituto de Matematica, UFRGS, Porto Alegre, RS (Brazil)

    2001-07-01

    A lot of efforts in Transport Theory is used to develop numerical methods or hybrid numerical-analytical techniques. We present in this work three points of view about transport problems. First the C0 semigroup approach, in which the free transport operator {psi} {yields} {mu} {nabla} generates an strongly continuous semigroup. The operators operator {psi} {yields} {sigma}t and operator {psi} {yields} {integral} {nabla} k(x,{mu},{mu}') {psi}(x,{mu}') d{mu}' are bounded operators, and by perturbation the transport operator {psi} {yields} {mu} {nabla} {psi} + {sigma}t {psi} - K {psi} also generates an strongly continuous semigroup. To prove the convergence of the approximations of a numerical methods to the exact solution we use the approximation theorem of C0 semi-groups in canonical form. In other way, the discrete schemes theory is employed in searching the rate of convergence of numerical techniques in transport theory. For 1D dependent of time transport problem and two-dimensional steady state problem we summarize some estimates, incorporating different boundary conditions. Finally we give a survey about the dynamical behavior of the SN approximations. In order to give a unified approach, some results illustrates the equivalence of the three points of views for the case of the steady-state transport problem for slab geometry. (author)

  16. Three points of view in transport theory

    Ruben, Panta Pazos; Tilio de Vilhena, M.

    2001-01-01

    A lot of efforts in Transport Theory is used to develop numerical methods or hybrid numerical-analytical techniques. We present in this work three points of view about transport problems. First the C0 semigroup approach, in which the free transport operator ψ → μ ∇ generates an strongly continuous semigroup. The operators operator ψ → σt and operator ψ → ∫ ∇ k(x,μ,μ' ψ(x,μ') dμ' are bounded operators, and by perturbation the transport operator ψ → μ ∇ ψ + σt ψ - K ψ also generates an strongly continuous semigroup. To prove the convergence of the approximations of a numerical methods to the exact solution we use the approximation theorem of C0 semi-groups in canonical form. In other way, the discrete schemes theory is employed in searching the rate of convergence of numerical techniques in transport theory. For 1D dependent of time transport problem and two-dimensional steady state problem we summarize some estimates, incorporating different boundary conditions. Finally we give a survey about the dynamical behavior of the SN approximations. In order to give a unified approach, some results illustrates the equivalence of the three points of views for the case of the steady-state transport problem for slab geometry. (author)

  17. NATO Human View Architecture and Human Networks

    Handley, Holly A. H.; Houston, Nancy P.

    2010-01-01

    The NATO Human View is a system architectural viewpoint that focuses on the human as part of a system. Its purpose is to capture the human requirements and to inform on how the human impacts the system design. The viewpoint contains seven static models that include different aspects of the human element, such as roles, tasks, constraints, training and metrics. It also includes a Human Dynamics component to perform simulations of the human system under design. One of the static models, termed Human Networks, focuses on the human-to-human communication patterns that occur as a result of ad hoc or deliberate team formation, especially teams distributed across space and time. Parameters of human teams that effect system performance can be captured in this model. Human centered aspects of networks, such as differences in operational tempo (sense of urgency), priorities (common goal), and team history (knowledge of the other team members), can be incorporated. The information captured in the Human Network static model can then be included in the Human Dynamics component so that the impact of distributed teams is represented in the simulation. As the NATO militaries transform to a more networked force, the Human View architecture is an important tool that can be used to make recommendations on the proper mix of technological innovations and human interactions.

  18. Energy and sustainability: a global view

    Goldemberg, J.

    1995-01-01

    A discussion is made of the conflicting concepts of sustainable development, focusing primarily on energy resources, as viewed by economists and environmentalists. According to the 'preservationist' view we 'borrow' the Earth from generations to come and have no right to use exhaustible resources. According to 'developmentalists' natural resources are either infinite or can be substituted by alternatives so there is no real problem of exhaustion of resources. It is shown that a compromise between such extreme positions is being forced by the heightened concerns for environmental protection. Outstanding among them are the problems of climate changes resulting from CO 2 (carbon dioxide) emissions from fossil fuel combustion. The energy consumed at present by industrialized and developing countries, and their projections to the year 2020 will be presented as well as the serious environmental consequences of a 'business-as-usual' scenario. These consequences will be much harder to cope with in the developing countries. Carbon emissions will be shown to increase with population, GDP and the 'energy intensity' of the economy. The 'decarbonization' trends of the present economies will be related to the decrease in total fertility rate and 'energy intensity' which is linked to technological advances in energy conservation and structural changes. Mechanisms to accelerate such trends will be discussed as well as financial mechanisms to pay for it, such as carbon taxes. (author) figs., tabs., refs

  19. Clarifying Parents' and Pediatricians' Views of Partnership.

    Rapp, Richard C; Pascoe, John

    2016-01-01

    Given the importance of partnership in improving health care outcomes among children, there is a substantial need to understand better what partnership means to parents and physicians. The goal of this study was to develop a partnership survey that was based on parents' and pediatricians' opinions about the key concepts of partnership. Parents of patients visiting an affluent suburban private practice and a federally qualified health center, and 2 groups of pediatricians, were asked to review 61 partnership concepts and identify those they considered as being important to partnership. Parents and pediatricians from both practices agreed that 42 (68.9%) of the concepts were important to partnership. Sixteen of these concepts were dropped because they were redundant. Parents from both the suburban practice and health center identified 5 (8.2%) concepts that they believed contributed to partnership. Seven (11.5%) concepts were viewed as important to parents and pediatricians from the suburban practice but not to parents from the health center. Significant socioeconomic differences between the 2 parent groups suggested factors that explained the differences between parent groups. The 38 concepts endorsed by parents and pediatricians provided a nuanced view of partnership and formed the Parent Pediatrician Partnership Survey. © Copyright 2016 by the American Board of Family Medicine.

  20. Scientists' views about attribution of global warming.

    Verheggen, Bart; Strengers, Bart; Cook, John; van Dorland, Rob; Vringer, Kees; Peters, Jeroen; Visser, Hans; Meyer, Leo

    2014-08-19

    Results are presented from a survey held among 1868 scientists studying various aspects of climate change, including physical climate, climate impacts, and mitigation. The survey was unique in its size, broadness and level of detail. Consistent with other research, we found that, as the level of expertise in climate science grew, so too did the level of agreement on anthropogenic causation. 90% of respondents with more than 10 climate-related peer-reviewed publications (about half of all respondents), explicitly agreed with anthropogenic greenhouse gases (GHGs) being the dominant driver of recent global warming. The respondents' quantitative estimate of the GHG contribution appeared to strongly depend on their judgment or knowledge of the cooling effect of aerosols. The phrasing of the IPCC attribution statement in its fourth assessment report (AR4)-providing a lower limit for the isolated GHG contribution-may have led to an underestimation of the GHG influence on recent warming. The phrasing was improved in AR5. We also report on the respondents' views on other factors contributing to global warming; of these Land Use and Land Cover Change (LULCC) was considered the most important. Respondents who characterized human influence on climate as insignificant, reported having had the most frequent media coverage regarding their views on climate change.

  1. Exploded view diagrams of mathematical surfaces

    Karpenko, Olga A.

    2010-11-01

    We present a technique for visualizing complicated mathematical surfaces that is inspired by hand-designed topological illustrations. Our approach generates exploded views that expose the internal structure of such a surface by partitioning it into parallel slices, which are separated from each other along a single linear explosion axis. Our contributions include a set of simple, prescriptive design rules for choosing an explosion axis and placing cutting planes, as well as automatic algorithms for applying these rules. First we analyze the input shape to select the explosion axis based on the detected rotational and reflective symmetries of the input model. We then partition the shape into slices that are designed to help viewers better understand how the shape of the surface and its cross-sections vary along the explosion axis. Our algorithms work directly on triangle meshes, and do not depend on any specific parameterization of the surface. We generate exploded views for a variety of mathematical surfaces using our system. © 2006 IEEE.

  2. Condensed matter view of giant resonance phenomena

    Zangwill, A.

    1987-01-01

    The intent of this article is to present a view of giant resonance phenomena (an essentially atomic phenomenon) from the perspective of a condensed matter physicist with an interest in the optical properties of matter. As we shall see, this amounts to a particular prejudice about how one should think about many-body effects in a system of interacting electrons. Some of these effects are special to condensed matter systems and will be dealt with in the second half of this paper. However, it turns out that the authors view of the main ingredient to a giant resonance differs significantly from that normally taken by scientists trained in the traditional methods of atomic physics. Therefore, in the first section the author will take advantage of the fact that his contribution to this volume was composed and delivered to the publishers somewhat after the conclusion of the School (rather than before as requested by the organizers) and try to clearly distinguish the differences of opinion presented by the lecturers from the unalterable experimental facts. 46 references, 9 figures

  3. Lensless imaging for wide field of view

    Nagahara, Hajime; Yagi, Yasushi

    2015-02-01

    It is desirable to engineer a small camera with a wide field of view (FOV) because of current developments in the field of wearable cameras and computing products, such as action cameras and Google Glass. However, typical approaches for achieving wide FOV, such as attaching a fisheye lens and convex mirrors, require a trade-off between optics size and the FOV. We propose camera optics that achieve a wide FOV, and are at the same time small and lightweight. The proposed optics are a completely lensless and catoptric design. They contain four mirrors, two for wide viewing, and two for focusing the image on the camera sensor. The proposed optics are simple and can be simply miniaturized, since we use only mirrors for the proposed optics and the optics are not susceptible to chromatic aberration. We have implemented the prototype optics of our lensless concept. We have attached the optics to commercial charge-coupled device/complementary metal oxide semiconductor cameras and conducted experiments to evaluate the feasibility of our proposed optics.

  4. A cybernetic view on wind-up.

    Farajidavar, Aydin; Gharibzadeh, Shahriar; Towhidkhah, Farzad; Saeb, Sohrab

    2006-01-01

    Wind-up is described traditionally as a frequency dependent increase in the excitability of spinal cord neurons, evoked by electrical stimulation of afferent C-fibers. Different kinds of wind-up have been reported, but wind-up of Abeta fibers in hyperalgesic states has gained little attention. In this paper, we present a cybernetic view on Abeta fiber wind-up and consider the involved molecular mechanisms as feedback and feedforward processes. Furthermore, our previous hypothesis, the sprouting phenomenon, is included in this view. Considering the proposed model, wind-up in hyperalgesic states might leave out in three different ways: (1) blocking the NMDA receptors by increasing extracellular Mg2+, 2) blocking the receptors and channels that contribute to Ca2+ inward current, and 3) blocking the Abeta fibers by local anesthetics. It seems that wind-up may be inhibited more effectively by using these three blocking mechanisms simultaneously, because in this case, the feedback process (main controller), the feedforward process (trigger), and Abeta stimulation (trigger) would be inhibited concurrently. Wind up may aggravate the pain in clinical hyperalgesic situations such as post-surgical states, some neuropathic pains, fibromyalgia syndrome, and post-herpetic neuralgia. Surely, clinical studies are needed to validate the effectiveness of our abovementioned suggestions in relieving such clinical pains.

  5. The public view of Pacific Northwest forests

    West, P.R.

    1991-01-01

    There are diverse communities that make up the public in the Pacific Northwest, all with differing views on the forest. To the media, the public are those indirect stakeholders, or average citizens, who have become keenly aware of the importance of environmental issues, including the implications for global change. Linkages between the forests, deforestation, global climate change, and overall environmental sustainability have been widely publicized, though less frequently analyzed in depth. Consequently, the state of Northwest forests has become a vital public interest. The need for an overall margin of global environmental security, and a concern over unsuspected consequences of all economic activity (including forestry) have created a community of interest among the urban population. In part, this is a spillover effect from promoting individual environmental responsibility and the conserver ethic into issues beyond the city boundary. In the Northwest, this often translates as a deep concern over forest management issues and strong conviction that changes are needed. At the same time, and largely as a direct response, the socioeconomic interests of rural forest communities have become a high-profile issue, raising debate over local empowerment and local forest stewardship models. The consequences of this complex and rapidly evolving public view of the forests are critical to forest managers and policymakers. 12 refs

  6. Political view of youth voters in surabaya

    Kartikasari, M. M.; Suwanda, I. M.; Adi, A. S.

    2018-01-01

    In the study of political socialization, youth voters are one of the targets of political parties in obtaining constituents. This article will reveal the views of youth voters in interpreting politics. Youth voters who are the subject of the study are college students in the first year. In general, they have different social life backgrounds but are in the same environment, the life of urban people, where their involvement with information technology is high. Political knowledge of youth voters is widely gained through mass media, where information is produced based on market needs. It encourages inconsistency in the direction of thinking that develops by voters. On the one hand, politics is seen as an activity based on ideal democratic values, but on the other hand politics is also seen as a practice that focuses on winning the battle of interests. This suggests that the youth voter political views are oriented toward superficial knowledge directed more by the mass media, not from experience gained through the process of political socialization.

  7. The good midwife: commencing students' views.

    Carolan, Mary

    2011-08-01

    to explore commencing students' views of the good midwife. This study was set against a background of high course attrition and concerns that discordant students' views of midwifery practice may have been associated with course attrition. qualitative thematic analysis. Melbourne, Australia. all commencing midwifery students, in 2008, were invited to participate (n = 41). students spoke of a series of key attributes they felt were important to the role of the midwife. Most fell into the affective domain and four themes were identified: personal qualities and attitudes; a belief in women and natural birth; compatible work ethic; and the possession of additional attributes. commencing students showed a clear understanding of the affective attributes required of a good midwife but a lesser understanding of requirements of knowledge and competence. A small number of students felt that they were already equipped to advise pregnant women, despite their early stage in the course. This is an issue that needs to be addressed. Copyright © 2010 Elsevier Ltd. All rights reserved.

  8. Detection of DNA strand breaks in mammalian cells using the radioresistant bacterium PprA protein

    Satoh, Katsuya; Wada, Seiichi; Narumi, Issay; Kikuchi, Masahiro; Funayama, Tomoo; Kobayashi, Yasuhiko

    2003-01-01

    We have previously found that the PprA protein from Deinococcus radiodurans possesses ability to recognize DNA carrying strand breaks. In the present study, we attempted to visualize radiation-induced DNA strand breaks with PprA protein using immunofluorescence technique to elucidate the DNA damage response mechanism in mammalian cultured cells. As a result, colocalization of Cy2 and DAPI fluorescent signals was observed. This observation suggests that DNA strand breaks in the nucleus of CHO-K1 cells were effectively detected using the PprA protein. The amount of DNA strand breaks (integrated density of Cy2 fluorescent signals) was increased with the increase in the radiation dose. (author)

  9. High resistance of some oligotrophic bacteria to ionizing radiation

    Nikitin, D.I.; Tashtemirova, M.A.; Pitryuk, I.A.; Sorokin, V.V.; Oranskaya, M.S.; Nikitin, L.E.

    1994-01-01

    The resistance of seven cultures of eutrophic and oligotrophic bacteria to gamma radiation (at doses up to 360 Gy) was investigated. The bacteria under study were divided into three groups according to their survival ability after irradiation. Methylobacterium organophilum and open-quotes Pedodermatophilus halotoleransclose quotes (LD 50 = 270 Gy) were highly tolerant. By their tolerance, these organisms approached Deinococcus radiodurans. Aquatic ring-shaped (toroidal) bacteria Flectobacillus major and open-quotes Arcocella aquaticaclose quotes (LD 5 = 173 and 210 Gy, respectively) were moderately tolerant. Eutrophic Pseudomonas fluorescens and Escherichia coli (LD 50 = 43 and 38 Gy, respectively) were the most sensitive. X-ray microanalysis showed that in tolerant bacteria the intracellular content of potassium increased and the content of calcium decreased after irradiation. No changes in the element composition of the eutrophic bacterium E. coli were detected. Possible mechanisms of the resistance of oligotrophic bacteria to gamma radiation are discussed

  10. Epigenetic changes of DNA repair genes in cancer.

    Lahtz, Christoph; Pfeifer, Gerd P

    2011-02-01

    'Every Hour Hurts, The Last One Kills'. That is an old saying about getting old. Every day, thousands of DNA damaging events take place in each cell of our body, but efficient DNA repair systems have evolved to prevent that. However, our DNA repair system and that of most other organisms are not as perfect as that of Deinococcus radiodurans, for example, which is able to repair massive amounts of DNA damage at one time. In many instances, accumulation of DNA damage has been linked to cancer, and genetic deficiencies in specific DNA repair genes are associated with tumor-prone phenotypes. In addition to mutations, which can be either inherited or somatically acquired, epigenetic silencing of DNA repair genes may promote tumorigenesis. This review will summarize current knowledge of the epigenetic inactivation of different DNA repair components in human cancer.

  11. Spectroelectrochemical insights into structural and redox properties of immobilized endonuclease III and its catalytically inactive mutant

    Moe, Elin; Rollo, Filipe; Silveira, Célia M.; Sezer, Murat; Hildebrandt, Peter; Todorovic, Smilja

    2018-01-01

    Endonuclease III is a Fe-S containing bifunctional DNA glycosylase which is involved in the repair of oxidation damaged DNA. Here we employ surface enhanced IR spectroelectrochemistry and electrochemistry to study the enzyme from the highly radiation- and desiccation-resistant bacterium Deinococcus radiodurans (DrEndoIII2). The experiments are designed to shed more light onto specific parameters that are currently proposed to govern damage search and recognition by endonucleases III. We demonstrate that electrostatic interactions required for the redox activation of DrEndoIII2 may result in high electric fields that alter its structural and thermodynamic properties. Analysis of inactive DrEndoIII2 (K132A/D150A double mutant) interacting with undamaged DNA, and the active enzyme interacting with damaged DNA also indicate that the electron transfer is modulated by subtle differences in the protein-DNA complex.

  12. Adaptability and variability of the cell functions to the environmental factors

    Kikuchi, Tadatoshi [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.

    1995-02-01

    Adaptive phenomenon of the cells to the environmental factors is one of the most important functions of cells. In the initial research program, yeast, Saccharomyces cerevisiae, as model species of eukaryote was selected to use for the experiments and copper sulfate was adopted as one of the ideal environmental factors, and then adaptation mechanisms of yeast cells in the environment surrounded by copper ions were analyzed metabolically and morphologically. Furthermore, in the relationships between environmental factors and the cells, the researches performed were as follows: (1) Induced mutation in the extranuclear-inheritable system: Mutagenic effect of ethidium bromide on mitochondria and plastids. (2) Induction of gene expression by light exposure in the early development of chloroplast in Chlamydomonas reinhardi. (3) Some features of RNA and protein syntheses in thermophilic alga Cyanidium caldarium. (4) Satellite DNA of Ochromonas danica. (5) Analyses of cell functions using various kinds of radiations. (6) Novel methionine requirement of radiation resistant bacterium, Deinococcus radiodurans. (author).

  13. Modeling the Gratification-Seeking Process of Television Viewing.

    Lin, Carolyn A.

    1993-01-01

    Examines adolescents' television viewing motives, activities, and satisfaction, in an attempt to integrate the audience activity construct into the uses and gratifications model. Suggests that more strongly motivated viewers engage more actively in various audience activities throughout the viewing process and receive greater viewing satisfaction…

  14. Modular Verification of Linked Lists with Views via Separation Logic

    Jensen, Jonas Braband; Birkedal, Lars; Sestoft, Peter

    2011-01-01

    We present a separation logic specification and verification of linked lists with views, a data structure from the C5 collection library for .NET. A view is a generalization of the well-known concept of an iterator. Linked lists with views form an interesting case study for verification since...

  15. 48 CFR 2052.242-70 - Resolving differing professional views.

    2010-10-01

    ... resolution of differing professional views (DPVs) of health and safety related concerns associated with the... professional views. 2052.242-70 Section 2052.242-70 Federal Acquisition Regulations System NUCLEAR REGULATORY....242-70 Resolving differing professional views. As prescribed in 2042.570-1, the contracting officer...

  16. 36 CFR 13.918 - Sable Pass Wildlife Viewing Area.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Sable Pass Wildlife Viewing... Preserve General Provisions § 13.918 Sable Pass Wildlife Viewing Area. (a) Entry into the Sable Pass Wildlife Viewing Area is prohibited from May 1 to September 30 unless authorized by the Superintendent. (b...

  17. Experiential Learning of Digital Communication Using LabVIEW

    Zhan, Wei; Porter, Jay R.; Morgan, Joseph A.

    2014-01-01

    This paper discusses the design and implementation of laboratories and course projects using LabVIEW in an instrumentation course. The pedagogical challenge is to enhance students' learning of digital communication using LabVIEW. LabVIEW was extensively used in the laboratory sessions, which better prepared students for the course projects. Two…

  18. Exploring Natural and Social Scientists' Views of Nature of Science

    Bayir, Eylem; Cakici, Yilmaz; Ertas, Ozge

    2014-01-01

    Science education researchers recently turned their attention to exploring views about nature of science (NOS). A large body of research indicates that both students and teachers have many naïve views about the NOS. Unfortunately, less attention has been directed at the issue of exploring the views of the scientists. Also, the little research in…

  19. 75 FR 12163 - Class E Airspace; Mountain View, AR

    2010-03-15

    ...-1181; Airspace Docket No. 09-ASW-36] Class E Airspace; Mountain View, AR AGENCY: Federal Aviation... Class E airspace at Mountain View, AR. Decommissioning of the Wilcox non-directional beacon (NDB) at... View, AR. Airspace reconfiguration is necessary due to the decommissioning of the Wilcox NDB and the...

  20. 45 CFR 1218.6 - Freedom to present views.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Freedom to present views. 1218.6 Section 1218.6 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE VISTA VOLUNTEERS-HEARING OPPORTUNITY § 1218.6 Freedom to present views. The expression by a volunteer of his views with respect to the...

  1. Monitoring Requirements Coverage Using Reconstructed Views : An Industrial Case Study

    Lormans, M.; Gross, H.; Van Deursen, A.; Van Solingen, R.; Stehouwer, A.

    2006-01-01

    Requirements views, such as coverage and status views, are an important asset for monitoring and managing software development. We have developed a method that automates the process for reconstructing these views, and built a tool, ReqAnalyst, to support this method. In this paper, we investigate to

  2. An industrial case study in reconstructing requirements views

    Lormans, M.; Van Deursen, A.; Gross, H.G.

    2008-01-01

    Requirements views, such as coverage and status views, are an important asset for monitoring and managing software development projects. We have developed a method that automates the process of reconstructing these views, and we have built a tool, REQANALYST, that supports this method. This paper

  3. Studying boat-based bear viewing: Methodological challenges and solutions

    Sarah Elmeligi

    2007-01-01

    Wildlife viewing, a growing industry throughout North America, holds much potential for increased revenue and public awareness regarding species conservation. In Alaska and British Columbia, grizzly bear (Ursus arctos) viewing is becoming more popular, attracting tourists from around the world. Viewing is typically done from a land-based observation...

  4. 3D View of Grand Canyon, Arizona

    2000-01-01

    The Grand Canyon is one of North America's most spectacular geologic features. Carved primarily by the Colorado River over the past six million years, the canyon sports vertical drops of 5,000 feet and spans a 445-kilometer-long stretch of Arizona desert. The strata along the steep walls of the canyon form a record of geologic time from the Paleozoic Era (250 million years ago) to the Precambrian (1.7 billion years ago).The above view was acquired by the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) instrument aboard the Terra spacecraft. Visible and near infrared data were combined to form an image that simulates the natural colors of water and vegetation. Rock colors, however, are not accurate. The image data were combined with elevation data to produce this perspective view, with no vertical exaggeration, looking from above the South Rim up Bright Angel Canyon towards the North Rim. The light lines on the plateau at lower right are the roads around the Canyon View Information Plaza. The Bright Angel Trail, which reaches the Colorado in 11.3 kilometers, can be seen dropping into the canyon over Plateau Point at bottom center. The blue and black areas on the North Rim indicate a forest fire that was smoldering as the data were acquired on May 12, 2000.Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) is one of five Earth-observing instruments launched December 18, 1999, on NASA's Terra satellite. The instrument was built by Japan's Ministry of International Trade and Industry. A joint U.S./Japan science team is responsible for validation and calibration of the instrument and the data products. Dr. Anne Kahle at NASA's Jet Propulsion Laboratory, Pasadena, Calif., is the U.S. Science team leader; Moshe Pniel of JPL is the project manager. ASTER is the only high resolution imaging sensor on Terra. The primary goal of the ASTER mission is to obtain high-resolution image data in 14 channels over the entire land surface, as

  5. Perspective View with Landsat Overlay, Costa Rica

    2002-01-01

    This perspective view shows the Caribbean coastal plain of Costa Rica, with the Cordillera Central rising in the background and the Pacific Ocean in the distance. The prominent river in the center of the image is the Rio Sucio, which merges with the Rio Sarapiqui at the bottom of the image and eventually joins with Rio San Juan on the Nicaragua border.Like much of Central America, Costa Rica is generally cloud covered so very little satellite imagery is available. The ability of the Shuttle Radar Topography Mission (SRTM) instrument to penetrate clouds and make three-dimensional measurements will allow generation of the first complete high-resolution topographic map of the entire region. These data were used to generate the image.This three-dimensional perspective view was generated using elevation data from SRTM and an enhanced false-color Landsat 7 satellite image. Colors are from Landsat bands 5, 4, and 2 as red, green and blue, respectively. Topographic expression is exaggerated two times.Landsat has been providing visible and infrared views of the Earth since 1972. SRTM elevation data matches the 30-meter resolution of most Landsat images and will substantially help in analyses of the large and growing Landsat image archive. The Landsat 7 Thematic Mapper image used here was provided to the SRTM by the United States Geological Survey, Earth Resources Observation Systems (EROS) Data Center, Sioux Falls, S.D.Elevation data used in this image was acquired by the SRTM aboard the Space Shuttle Endeavour, launched on February 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter-long (200-foot) mast, installed additional C-band and X-band antennas, and improved tracking and navigation devices

  6. Modeling views in the layered view model for XML using UML

    Rajugan, R.; Dillon, T.S.; Chang, E.; Feng, L.

    In data engineering, view formalisms are used to provide flexibility to users and user applications by allowing them to extract and elaborate data from the stored data sources. Conversely, since the introduction of Extensible Markup Language (XML), it is fast emerging as the dominant standard for

  7. The Resource-Based View and Value: The Customer-Based View of the Firm

    Clulow, Val; Barry, Carol; Gerstman, Julie

    2007-01-01

    Purpose: The resource-based view (RBV) explores the role of key resources, identified as intangible assets and capabilities, in creating competitive advantage and superior performance. To a great extent the conceptual analysis and empirical research within the RBV has focused on the firm's perspective of key resources and the value to the firm of…

  8. Enhancing Student Self-Worth in the Primary School Learning Environment: Teachers' Views and Students' Views

    Cushman, Penni; Cowan, Jackie

    2010-01-01

    This paper reports the findings from a study of teachers and students' views regarding self-worth in the primary school learning environment. The revised New Zealand curriculum recognises the importance of self-worth in students' motivation and ability to learn. While the need to enhance self-worth in the classroom has been well established in the…

  9. Nucleotide fluctuation of radiation-resistant Halobacterium sp. NRC-1 single-stranded DNA-binding protein (RPA) genes

    Holden, Todd; Tremberger, G., Jr.; Cheung, E.; Subramaniam, R.; Gadura, N.; Schneider, P.; Sullivan, R.; Flamholz, A.; Lieberman, D.; Cheung, T. D.

    2009-08-01

    The Single-Stranded DNA-Binding Protein (RPA) Genes in gamma ray radiation-resistant halophilic archaeon Halobacterium sp. NRC-1 were analyzed in terms of their nucleotide fluctuations. In an ATCG sequence, each base was assigned a number equal to its atomic number. The resulting numerical sequence was the basis of the statistical analysis in this study. Fractal analysis using the Higuchi method gave fractal dimensions of 2.04 and 2.06 for the gene sequences VNG2160 and VNG2162, respectively. The 16S rRNA sequence has a fractal dimension of 1.99. The di-nucleotide Shannon entropy values were found to be negatively correlated with the observed fractal dimensions (R2~ 0.992, N=3). Inclusion of Deinococcus radiodurans Rad-A in the regression analysis decreases the R2 slightly to 0.98 (N=4). A third VNG2163 RPA gene of unknown function but with upregulation activity under irradiation was found to have a fractal dimension of 2.05 and a Shannon entropy of 3.77 bits. The above results are similar to those found in bacterial Deinococcus radiodurans and suggest that their high radiation resistance property would have favored selection of CG di-nucleotide pairs. The two transcription factors TbpD (VNG7114) and TfbA (VNG 2184) were also studied. Using VNG7114, VNG2184, and VNG2163; the regression analysis of fractal dimension versus Shannon entropy shows that R2 ~ 0.997 for N =3. The VNG2163 unknown function may be related to the pathways with transcriptions closely regulated to sequences VNG7114 and VNG2184.

  10. Mothers’ views of their preschool child’s screen-viewing behaviour: a qualitative study

    Georgina F. Bentley

    2016-08-01

    Full Text Available Abstract Background Research on screen-viewing in preschool children has predominantly focused on television viewing. The rapid development of mobile devices (e.g. tablets, smart phones and e-readers and the increase in their use by preschool children means there is a need to understand how and why these devices are used by this age group. The aim of this study was to explore mothers’ views of their preschool children’s screen viewing behaviour (including mobile devices and investigate how preschool children use different screen-viewing devices. Methods One-to-one, semi-structured interviews with mothers of preschool children (aged between 2 and 4 years old. Mothers were recruited through preschools, nurseries, and mother and toddler groups located within four areas of varying socio-economic status within Bristol, UK. Data were analysed thematically using a framework approach. Results Twenty-six mothers were interviewed. Mobile devices were regularly used as a form of screen-viewing for most children but were used on an ad hoc basis rather than being a habitual activity. The reasons and influences of mobile device use described by mothers were similar to that of television viewing. However, the portability of mobile devices meant that they were often used outside of the home as a distraction tool. Their multi-functionality meant that they could be used as a portable television, or for purposeful learning through educational games and applications. Some mothers showed concerns over mobile device use by their child, whilst others felt it was an important and useful educational tool. Although the majority of mothers felt they needed to set rules and restrictions for mobile device use, many mothers felt that they are also a necessary and unavoidable part of life. Conclusions Mothers in this study suggested that mobile device use by preschool children is common. More research is needed to determine the impact of mobile device use in preschool

  11. Mothers' views of their preschool child's screen-viewing behaviour: a qualitative study.

    Bentley, Georgina F; Turner, Katrina M; Jago, Russell

    2016-08-04

    Research on screen-viewing in preschool children has predominantly focused on television viewing. The rapid development of mobile devices (e.g. tablets, smart phones and e-readers) and the increase in their use by preschool children means there is a need to understand how and why these devices are used by this age group. The aim of this study was to explore mothers' views of their preschool children's screen viewing behaviour (including mobile devices) and investigate how preschool children use different screen-viewing devices. One-to-one, semi-structured interviews with mothers of preschool children (aged between 2 and 4 years old). Mothers were recruited through preschools, nurseries, and mother and toddler groups located within four areas of varying socio-economic status within Bristol, UK. Data were analysed thematically using a framework approach. Twenty-six mothers were interviewed. Mobile devices were regularly used as a form of screen-viewing for most children but were used on an ad hoc basis rather than being a habitual activity. The reasons and influences of mobile device use described by mothers were similar to that of television viewing. However, the portability of mobile devices meant that they were often used outside of the home as a distraction tool. Their multi-functionality meant that they could be used as a portable television, or for purposeful learning through educational games and applications. Some mothers showed concerns over mobile device use by their child, whilst others felt it was an important and useful educational tool. Although the majority of mothers felt they needed to set rules and restrictions for mobile device use, many mothers felt that they are also a necessary and unavoidable part of life. Mothers in this study suggested that mobile device use by preschool children is common. More research is needed to determine the impact of mobile device use in preschool children, how much time preschool children spend using mobile devices

  12. PROSPECTIVE ROMANIAN LEADERS' VIEW ON LEADERSHIP DIMENSIONS

    CATANA DOINA

    2010-07-01

    Full Text Available This study deals with Romanian prospective leaders' view on outstanding leadership dimensions (styles. It is a part of a European research project, GLOBE Students, dealing with the interrelations between societal culture and leadership. The basic theoretical constructs and methodological framework of investigation are those developed by GLOBE international research project. The sample consists in 429 students in business/economics and engineering, belonging to three Romanian universities. The findings show that the most preferred leadership styles are team oriented and charismatic (value based. Only a few leadership styles seem to have weak, but statistically significant correlations against a sig. = 0.50 probability threshold with important socialization agents for the students.

  13. Intermediate view synthesis for eye-gazing

    Baek, Eu-Ttuem; Ho, Yo-Sung

    2015-01-01

    Nonverbal communication, also known as body language, is an important form of communication. Nonverbal behaviors such as posture, eye contact, and gestures send strong messages. In regard to nonverbal communication, eye contact is one of the most important forms that an individual can use. However, lack of eye contact occurs when we use video conferencing system. The disparity between locations of the eyes and a camera gets in the way of eye contact. The lock of eye gazing can give unapproachable and unpleasant feeling. In this paper, we proposed an eye gazing correction for video conferencing. We use two cameras installed at the top and the bottom of the television. The captured two images are rendered with 2D warping at virtual position. We implement view morphing to the detected face, and synthesize the face and the warped image. Experimental results verify that the proposed system is effective in generating natural gaze-corrected images.

  14. Consumer Views on Transportation and Energy

    Steiner, E.

    2003-08-01

    This report has been assembled to provide the Office of Energy Efficiency and Renewable Energy (EERE) with an idea of how the American public views various transportation, energy, and environmental issues. An issue that still needs attention from EERE is the finding that the public tends to lack information about hybrid vehicles, hydrogen, and alternative fuels for passenger vehicles. Also, the public seems to want fuel-efficiency improvements and cleaner fuels, but is not very willing to pay for these benefits. The public also says that it supports initiatives to promote energy conservation over increased production and that it is willing to make changes such as driving less in an effort to reduce oil consumption.

  15. Nursing professionals’ views on the workplace

    B.J. Erasmus

    1998-09-01

    Full Text Available This article reports on a survey done among registered, enrolled and auxiliary nurses registered with the South African Nursing Council. The survey was carried out in the period from the end of December 1997 to the beginning of 1998. The purpose of the survey was to obtain the views of female nurses on various aspects of the workplace. The important findings were the fact that nurses liked working as part of a team and that this contributed the most to th eir job satisfaction. The item that contributed least to job satisfaction was pay. The most important problems were that they felt that they were not paid enough and that they need better benefits. The majority of nurses were however positive about their jobs and the items the highest on the list of career expectations were job satisfaction, followed by a need for recognition.

  16. Interactive computer-enhanced remote viewing system

    Tourtellott, J.A.; Wagner, J.F.

    1995-01-01

    Remediation activities such as decontamination and decommissioning (D ampersand D) typically involve materials and activities hazardous to humans. Robots are an attractive way to conduct such remediation, but for efficiency they need a good three-dimensional (3-D) computer model of the task space where they are to function. This model can be created from engineering plans and architectural drawings and from empirical data gathered by various sensors at the site. The model is used to plan robotic tasks and verify that selected paths are clear of obstacles. This report describes the development of an Interactive Computer-Enhanced Remote Viewing System (ICERVS), a software system to provide a reliable geometric description of a robotic task space, and enable robotic remediation to be conducted more effectively and more economically

  17. Shirakatsi Astronomical and Natural Philosophical Views

    Mkrtchyan, Lilit

    2016-12-01

    Our work is aimed at presenting Shirakatsi astronomical and natural philosophical views. Karl Anania Shirakatsi is classified as one of the world-class intellectual geniuses. He was endowed with exceptional talent and analyzing scientific understanding of natural phenomena. He refers his philosophical works to almost all fields of science, cosmography, mathematics, calendarology, historiography, etc. Shirakatsy's earnings of natural science and natural philosophy in medieval is too big He was the first prominent scholar and thinker of his time, creating a unique, comprehensive gitapilisopayakan system that still feeds the human mind. The scientific value of Shirakatsi has great importance not only for Armenians but also for the whole world of science, history, culture and philosophy. Shirakatsi can be considered not only national but also universal greatness.

  18. Radiation oncology a physicist's-eye view

    Goitein, Michael

    2007-01-01

    Radiation Oncology: A Physicist's-Eye View was written for both physicists and medical oncologists with the aim of helping them approach the use of radiation in the treatment of cancer with understanding, confidence, and imagination. The book will let practitioners in one field understand the problems of, and find solutions for, practitioners in the other. It will help them to know "why" certain approaches are fruitful while, at the same time, encouraging them to ask the question "Why not?" in the face of assertions that some proposal of theirs is impractical, unreasonable, or impossible. Unlike a textbook, formal and complete developments of the topics are not among the goals. Instead, the reader will develop a foundation for understanding what the author has found to be matters of importance in radiation oncology during over thirty years of experience. Presentations cover, in largely non-technical language, the principal physical and biological aspects of radiation treatment and address practical clinical c...

  19. Students’ Views on Different Learning Objects Types

    Natsis, Antonios; Hormova, Hara; Mikropoulos, Tassos

    2014-01-01

    of different type: an educational game, a dynamic simulation and a digital concept map. The basic difference among these three LOs is the fact that both dynamic simulation and concept map are lacking game-like characteristics. The educational game has as a learning goal to familiarize students......The paper attempts to compare students’ views on three different Learning Objects (LOs), also known as Web-Based Learning Tools (WBLTs), which are used for educational purposes aiming at natural disaster readiness. Following an iterative development process, 100 LOs of various types are being...... they will be protected during the earthquake. The educational game comprises of 9 levels of ascending difficulty that have to be completed so as the game to be ended. The dynamic simulation aims to familiarize students with the causes of fog. In that context, they move temperature, wind and humidity bars and thus...

  20. Multiple Clustering Views via Constrained Projections

    Dang, Xuan-Hong; Assent, Ira; Bailey, James

    2012-01-01

    Clustering, the grouping of data based on mutual similarity, is often used as one of principal tools to analyze and understand data. Unfortunately, most conventional techniques aim at finding only a single clustering over the data. For many practical applications, especially those being described...... in high dimensional data, it is common to see that the data can be grouped into different yet meaningful ways. This gives rise to the recently emerging research area of discovering alternative clusterings. In this preliminary work, we propose a novel framework to generate multiple clustering views....... The framework relies on a constrained data projection approach by which we ensure that a novel alternative clustering being found is not only qualitatively strong but also distinctively different from a reference clustering solution. We demonstrate the potential of the proposed framework using both synthetic...

  1. The art of Pirandello: a psychoanalytic view.

    Coppolillo, H P

    1997-01-01

    Luigi Pirandello, a playwright of immense profundity and creativity, won the Nobel Prize for his work in theater. A brief history of his personal and educational development is presented here, followed by an excellent translation by Gigi Gatti and Terry Doyle of one of his plays, The Man with the Flower in His Mouth, written in 1926. It is a play that is little known in the United States, but which conveys his style and many of his views in a succinct manner. This is followed by an interpretation of some of the symbols, the psychodynamics, and the ego states of the characters that Pirandello described before those ego states were described in psychoanalytic literature.

  2. Instrumentation requirements from the user's view

    Harsha, P.T.

    1988-01-01

    The use of combustor diagnostics is considered from the point of view of demonstration of performance of an airbreathing hypersonic engine. The basic need is seen to be that of providing the data necessary to verify performance predictions for the engine as installed in the airplane. This necessitates the use of a diagnostics capability that can provide the inputs required by the computational analyses that will be used to assess this performance. Because of the cost of ground test facilities, a premium is placed on measurement technique reliability and redundancy of instrumentation. A mix of nonintrusive optical techniques and probe-based measurements is seen to be the best approach using current diagnostics capability; one such instrument mix is outlined for a ramjet/scramjet test program. 11 references

  3. [Childhood obesity prevention from a community view].

    Ariza, Carles; Ortega-Rodríguez, Eduard; Sánchez-Martínez, Francesca; Valmayor, Sara; Juárez, Olga; Pasarín, M Isabel

    2015-04-01

    The percentage of failure and relapse in the treatment of obesity is high. Where possible, the preferred strategy for preventing obesity is to modify eating habits and lifestyles. This article aims to provide a framework for evidence on the most effective interventions for addressing childhood obesity, both from a prevention point of view, as well as reducing it, when it is already established. After a review of the scientific literature, the issues that must be considered both in the universal and selective prevention of childhood obesity are presented. Also, in light of the controversy over the tools for measuring and controlling the problem, some clarification is provided on the criteria. Finally, the approach to the prevention of overweight and obesity with a community perspective is separated, with two short protocols being offered with diagrams of the basic procedure to follow. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  4. [Robotic splenectomy--a personal view].

    Vasilescu, C

    2010-01-01

    Until now 40 robotic splenectomies were performed in our department, the first case being done on February 25, 2008. Our data show that robotic splenectomy with the DaVinci surgical system is technically feasible and safe, with good results and without complications. The main advantages are a better tridimensional view and an increased versatility of the surgical instruments. The DaVinci system allows an accurate dissection around the splenic hilum and preservation of the splenic remnant vessels in partial splenectomy. Robotic splenectomy will probably not replace the laparoscopic splenectomy for the most common indications like ITP, hemolytic anemia. It may be a very useful surgical tool in difficult splenectomy: partial splenectomy, splenectomy in liver cirrhosis, splenic tumors or malignant hemopathies. In these cases the robotic approach may shorten the operative time, decrease the blood loss and the risk of remorrhagic complications during surgery and even make possible a minimally invasive splenectomy very difficult to be performed by classical laparoscopy.

  5. Development in distributed beam-view

    Bhole, R.B.; Pal, Satbajit; Dasgupta, S.

    2003-01-01

    A computerized distributed beam-viewer has been developed using PC-add on image digitizer card plugged into a Pentium PC running Windows NT. Image Acquisition card (IMAQ-1408) from National Instruments is driven to digitise inputs from CCD cameras placed along the beam transport lines. The multiple clients situated across a switched Ethernet LAN, collects the data and displays beam-views on a desirable Window size. Only one privilege client at the control room has the selection facility of the channel (camera), whereas image display processing and storing facility are provided at all other clients end. The client server S/W written on Window SDK is implemented using Window Socket ver 2.0 library functions. (author)

  6. Toward a Neurocentric View of Learning.

    Titley, Heather K; Brunel, Nicolas; Hansel, Christian

    2017-07-05

    Synaptic plasticity (e.g., long-term potentiation [LTP]) is considered the cellular correlate of learning. Recent optogenetic studies on memory engram formation assign a critical role in learning to suprathreshold activation of neurons and their integration into active engrams ("engram cells"). Here we review evidence that ensemble integration may result from LTP but also from cell-autonomous changes in membrane excitability. We propose that synaptic plasticity determines synaptic connectivity maps, whereas intrinsic plasticity-possibly separated in time-amplifies neuronal responsiveness and acutely drives engram integration. Our proposal marks a move away from an exclusively synaptocentric toward a non-exclusive, neurocentric view of learning. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Slavic Phraseology: A View Through Corpora

    Zakharov Victor

    2017-12-01

    Full Text Available The study of word collocability is one of the main tasks of linguistics. The combinatory ability of language units, collocability, is one of the linguistic syntagmatic laws. This phenomenon is the main object of the phraseology and lexicography. The article deals with set phrases of different types in Russian, Czech and Slovak from the point of view of their quantitative evaluation. Corpus linguistics understand set phrases as statistically determined unities. This approach is the basic point of different automatic ways to extract idioms and collocations. The paper describes experiments which show how text corpora and corpus methods and tools can be used to expand the entries in existing dictionaries and how set phrases could be evaluated quantitatively. It is shown and maintained that corpus linguistics methods and tools allow to create dictionaries of new type which have to include a larger amount of set phrases and collocations than before.

  8. Fluid mechanics a geometrical point of view

    Rajeev, S G

    2018-01-01

    Fluid Mechanics: A Geometrical Point of View emphasizes general principles of physics illustrated by simple examples in fluid mechanics. Advanced mathematics (e.g., Riemannian geometry and Lie groups) commonly used in other parts of theoretical physics (e.g. General Relativity or High Energy Physics) are explained and applied to fluid mechanics. This follows on from the author's book Advanced Mechanics (Oxford University Press, 2013). After introducing the fundamental equations (Euler and Navier-Stokes), the book provides particular cases: ideal and viscous flows, shocks, boundary layers, instabilities, and transients. A restrained look at integrable systems (KdV) leads into a formulation of an ideal fluid as a hamiltonian system. Arnold's deep idea, that the instability of a fluid can be understood using the curvature of the diffeomorphism group, will be explained. Leray's work on regularity of Navier-Stokes solutions, and the modern developments arising from it, will be explained in language for physicists...

  9. Disruptive Technologies, A Critical Yet Hopeful View

    Carlos Alvarez Pereira

    2017-06-01

    Full Text Available A new perspective is attempted on the role played by Information and Communication Technologies (ICTs in the evolution of human societies in the last few decades. Particular attention is paid to their (lack of relationship with the challenges of sustainable development, presenting the view contrary to mainstream perception that for now ICTs have a negative impact on sustainability overall. This in turn is described as a result of how ICTs and innovation in general are presently conceived and framed in a way that actually inhibits their potential for human progress in harmony with the environment. Some hints are suggested on how to reverse this situation and make digital tech useful for life as a whole.

  10. System View of Business Continuity Management

    Vlasta Svata

    2013-04-01

    Full Text Available We are living in time where the impact on continuity still grows both on the side our personal lives and business activities. In the same time different international, regional, national, state and private organizations initiated to provide different actions and regulations in order to find the best solutions of this situation. The result is that there exist the whole set of different views over this problem. The main aim of this article is to map this situation, to provide the general framework of business continuity management (BCM and to discuss its main parts and their mutual relationships. Special impact is given to the integration of the business and IT oriented solutions and ways of assurance initiatives helping managers to assess the implemented solutions and their compliance to the business strategy and other existing regulations.

  11. Love, from a sociological point of view

    Chiara Piazzesi

    2015-08-01

    Full Text Available What does it mean to examine erotic love and intimacy from a sociological point of view? Does this endeavour entail a definition of love, and, if so, is such a definition possible from a sociological perspective? This paper discusses the epistemological challenges implied by the task of constructing love as the object of sociological inquiry. We will start by giving a definition of the task itself and by detailing the peculiarities of a sociological inquiry on love. We will point out why it is imperative for such an inquiry to remain open to the historicity of love as an emotion and as a form of interaction. Finally we will explore love as the object of a sociological investigation in order to spell out what becomes visible to the sociological eye once the correct epistemological precautions are taken.

  12. Interactive computer-enhanced remote viewing system

    Tourtellott, J.A.; Wagner, J.F. [Mechanical Technology Incorporated, Latham, NY (United States)

    1995-10-01

    Remediation activities such as decontamination and decommissioning (D&D) typically involve materials and activities hazardous to humans. Robots are an attractive way to conduct such remediation, but for efficiency they need a good three-dimensional (3-D) computer model of the task space where they are to function. This model can be created from engineering plans and architectural drawings and from empirical data gathered by various sensors at the site. The model is used to plan robotic tasks and verify that selected paths are clear of obstacles. This report describes the development of an Interactive Computer-Enhanced Remote Viewing System (ICERVS), a software system to provide a reliable geometric description of a robotic task space, and enable robotic remediation to be conducted more effectively and more economically.

  13. Minority College Women's Views on Condom Negotiation.

    McLaurin-Jones, TyWanda; Lashley, Maudry-Beverly; Marshall, Vanessa

    2015-12-22

    This study utilized quantitative and qualitative methods to (1) investigate the relationship between frequency of condom use and negotiation strategies and (2) evaluate experiences with condom negotiations among sexually active, heterosexual, African American college women. One hundred female students from a Historically Black Colleges and Universities (HBCU) completed a questionnaire that included the Condom Influence Strategies Scale (CIS) and participated in a focus group. An ANOVA was conducted to compare differences between never, inconsistent, and consistent condom users. Consistent condom users scored higher than never users on the "withholding sex" subscale of the CIS (4.88 vs. 3.55; p negotiation included deciding the "right timing" of discussion and having a previous history of sexual intercourse without a condom with their partner. Other key concepts that contribute to condom negotiation are the views that condoms are a male's responsibility and stigma of women who carry condoms.

  14. A view to a (staged) kill?

    Gamborg, Christian; Jensen, Frank Søndergaard; Sandøe, Peter

    2015-01-01

    Is it acceptable, in principle, to shoot wild animals as a sport? The ethical controversy around recreational hunting is not only of academic interest but plays an important role in public and political discussions concerning the legitimacy of hunting. For the hunter, hunting is typically imbued...... with a perception of deeper meaning. For ardent non-hunters it may be hard to understand the meaning of enjoying nature by shooting at other living beings. This lack of mutual understanding makes it difficult to create a dialogue. However, the issue is not just about whether or not to accept hunting but also......-based questionnaires) of different Danish stakeholders. Results show that a majority of the general public is primarily against the practice; a majority of hunters are pro, and landowners somewhere in between. Reasons may be found in relation to views on wildlife, naturalness and what constitutes ‘proper’ hunting...

  15. Art, Scholarship, Community: Experiences of Viewing

    Alice Eden

    2017-04-01

    Full Text Available This critical reflection originated in a visit to the ‘Artists and Academics’ exhibition held at Fargo Creative Village, Coventry, 26 November 2016. My thoughts about the exhibition have served as a springboard to consider ideas of scholarship, art and community more broadly. I use my research on British artists from the early twentieth century, their ideas about the processes of viewing art and the spiritual in art, to discuss examples in the exhibition. I conclude by considering how this collaborative event can bring academic ideas into conversation with artworks. I suggest that the resulting exchanges may enable viewers to think differently about art and scholarship as well as enrich academic practice.

  16. Professional choice early education teachers’ views

    Ive Carina Rodrigues Lima Brasil

    2012-05-01

    Full Text Available This qualitative and exploratory research aimed at investigating the underlying reasons for the professional choice of teachers who work with early education. 17 teachers (7 from public schools and 10 from private schools were interviewed in depth in a semi-structured manner. Questions concerned the reasons that guided participants’ professional choice. According to the results, the main reasons for choosing to work with children were associated with love for children, family influence, opportunity, idealism, enchantment and special talent to work with children. Some of the interviewees’ had working with children as a professional option consciously made, whether others were merely taken by the circumstances. Stereotyped views of the profession (feminine profession are also addressed.

  17. [To cognize retinitis pigmentosa with scientific view].

    Li, Gen-lin

    2009-03-01

    Retinitis pigmentosa (RP) is the most common inherited eye disease that usually leads into blind, and is high simplex and clinical heterogeneity. Recent years, some new hereditary forms have been found, such as digenic RP, mitochondrial RP, incomplete dominant inheritance RP. The phenotype of RP is multiplicity. Incompatible phenomenon between genotype and phenotypes was shown in some genes such as peripherin/RDS, RHO, RP2 and RP3. The complicated phenotype was shown in the rare RP forms, such as centricity RP, stemma RP, retinitis pigmentosa sine pigmento, and retinal degeneration slow. Retinal transplantation, retinal implantation, drug and neurotrophic factor therapy, and gene therapy have been well studied worldwide and presented some hopeful efficacy. Ophthalmologists and practitioners should cognize the new advance and new knowledge on RP therapy with a scientific view for better serving the RP patients.

  18. The Relational View of Interorganizational Competitive Advantage

    Hu, Yimei; Zhang, Si; Li, Jizhen

    Collaborating with external partners on R&D and forming strategic partnership for R&D have been popular phenomena for long, which leads new development in existing theories. Though the relational view of competitive advantage has been proposed for more than a decade, few in-depth empirical...... they generate relational rents (interorganizational competitive advantage) from this alliance? Based on this case study, we will propose some implications for the R&D collaboration between Chinese and Scandinavian countries. Also, the case will help us to test and enrich the existing theories...... on interorganizational competitive advantage. At the end of the paper, based on existing theories and the case study result, we will propose our conceptual framework on researching R&D strategic alliance between Scandinavian and Chinese firms....

  19. VIEWS ON SUCCESS IN LIFE BASED GENDER

    Adina Magdalena IORGA

    2014-12-01

    Full Text Available In order to study the characteristics of success in life we must consider the social construction of genders (male and female manifested in the interaction between the sexes. Social interpretation of biological sex leads to the identification of a set of behaviors particular to each sex, both in society and subsequently in private life as well as in the public eye. The research aims to identify the opinions and beliefs on the matter of students from the Veterinary Medicine University of Bucharest, their views on success in life, in the work place, in their study environment and in society as a whole, the characteristics of each gender, equality between women and men. The research findings reveal a specific social pattern determined by gender and residential environment.

  20. A broad view of model validation

    Tsang, C.F.

    1989-10-01

    The safety assessment of a nuclear waste repository requires the use of models. Such models need to be validated to ensure, as much as possible, that they are a good representation of the actual processes occurring in the real system. In this paper we attempt to take a broad view by reviewing step by step the modeling process and bringing out the need to validating every step of this process. This model validation includes not only comparison of modeling results with data from selected experiments, but also evaluation of procedures for the construction of conceptual models and calculational models as well as methodologies for studying data and parameter correlation. The need for advancing basic scientific knowledge in related fields, for multiple assessment groups, and for presenting our modeling efforts in open literature to public scrutiny is also emphasized. 16 refs