WorldWideScience

Sample records for deinococcus radiodurans r1

  1. Deinococcus radiodurans strain R1 contains N6-methyladenine in its genome

    International Nuclear Information System (INIS)

    Prasad, Bhaskar Jyoti; Sabnis, Ketaki; Deobagkar, Deepti D.; Deobagkar, Dileep N.

    2005-01-01

    Methylation of DNA is known to be involved in DNA repair mechanisms in bacteria. Deinococcus radiodurans strain R1 on exposure to high radiation undergoes significant DNA damage, which is repaired without mutations. However, the presence of modified nucleotides has not been reported in its genome. We report here the detection of N6-methyladenine in the genome of D. radiodurans strain R1 using immunochemical techniques. This N6-methyladenine is not a part of GATC restriction-modification system. D. radiodurans cell extract also exhibited a DNA adenine methyltransferase activity which was reduced in the early post-irradiation recovery phase

  2. Identifying the Proteins that Mediate the Ionizing Radiation Resistance of Deinococcus Radiodurans R1

    Energy Technology Data Exchange (ETDEWEB)

    Battista, John R

    2010-02-22

    The primary objectives of this proposal was to define the subset of proteins required for the ionizing radiation (IR) resistance of Deinococcus radiodurans R1, characterize the activities of those proteins, and apply what was learned to problems of interest to the Department of Energy.

  3. Effects of heavy ions on inactivation and DNA double strand breaks in Deinococcus radiodurans R1.

    Science.gov (United States)

    Zimmermann, H; Schafer, M; Schmitz, C; Bucker, H

    1994-10-01

    Inactivation and double strand break (dsb) induction after heavy ion irradiation were studied in stationary phase cells of the highly radiation resistant bacterium Deinococcus radiodurans R1. There is evidence that the radiation sensitivity of this bacterium is nearly independent on energy in the range of up to 15 MeV/u for lighter ions (Ar). The responses to dsb induction for charged particles show direct relationship between increasing radiation dose and residual intact DNA.

  4. Reduction of Fe(III), Cr(VI), U(VI), and Tc(VII) by Deinococcus radiodurans R1

    International Nuclear Information System (INIS)

    Fredrickson, J.K.; Kostandarithes, H.M.; Li, S.W.; Plymake, A.E.; Daly, M.J.

    2000-01-01

    Deinococcus radiodurans is an exceptionally radiation-resistant microorganism capable of surviving acute exposures to ionizing radiation doses of 15,000 Gy and previously described as having a strictly aerobic respiratory metabolism. Under strict anaerobic conditions, D. radiodurans R1 reduced Fe(III)-nitrilotriacetic acid coupled to the oxidation of lactate to CO 2 and acetate but was unable to link this process to growth. D. radiodurans reduced the humic acid analog anthraquinone-2,6-disulfonate (AQDS) to its dihydroquinone form, AH 2 DS, which subsequently transferred electrons to the Fe(III) oxides hydrous ferric oxide and goethite via a previously described electron shuttle mechanism. D. radiodurans reduced the solid-phase Fe(III) oxides in the presence of either 0.1 mM AQDS or leonardite humic acids (2 mg ml -1 ) but not in their absence. D. radiodurans also reduced U(VI) and Tc(VII) in the presence of AQDS. In contrast, Cr(VI) was directly reduced in anaerobic cultures with lactate although the rate of reduction was higher in the presence of AQDS. The results are the first evidence that D. radiodurans can reduce Fe(III) coupled to the oxidation of lactate or other organic compounds. Also, D. radiodurans, in combination with humic acids or synthetic electron shuttle agents, can reduce U and Tc and thus has potential applications for remediation of metal- and radionuclide-contaminated sites where ionizing radiation or other DNA-damaging agents may restrict the activity of more sensitive organisms

  5. Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

    Science.gov (United States)

    Harris, Dennis R; Tanaka, Masashi; Saveliev, Sergei V; Jolivet, Edmond; Earl, Ashlee M; Cox, Michael M; Battista, John R

    2004-10-01

    The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

  6. Preserving genome integrity: the DdrA protein of Deinococcus radiodurans R1.

    Directory of Open Access Journals (Sweden)

    Dennis R Harris

    2004-10-01

    Full Text Available The bacterium Deinococcus radiodurans can withstand extraordinary levels of ionizing radiation, reflecting an equally extraordinary capacity for DNA repair. The hypothetical gene product DR0423 has been implicated in the recovery of this organism from DNA damage, indicating that this protein is a novel component of the D. radiodurans DNA repair system. DR0423 is a homologue of the eukaryotic Rad52 protein. Following exposure to ionizing radiation, DR0423 expression is induced relative to an untreated control, and strains carrying a deletion of the DR0423 gene exhibit increased sensitivity to ionizing radiation. When recovering from ionizing-radiation-induced DNA damage in the absence of nutrients, wild-type D. radiodurans reassembles its genome while the mutant lacking DR0423 function does not. In vitro, the purified DR0423 protein binds to single-stranded DNA with an apparent affinity for 3' ends, and protects those ends from nuclease degradation. We propose that DR0423 is part of a DNA end-protection system that helps to preserve genome integrity following exposure to ionizing radiation. We designate the DR0423 protein as DNA damage response A protein.

  7. in Deinococcus radiodurans

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-10

    May 10, 2010 ... from oxidation during irradiation (Daly et al., 2007; 2009). According to the first .... radiodurans R1 for bioprecipitation of Uranium from dilute nuclear waste. ... Eide DJ (1998). The molecular biology of metal ion transport in.

  8. Engineering Deinococcus radiodurans R1 for bioremediation of non radioactive and radioactive wastes facilitated by comparative genomics with Cupriavidus metallidurans CH34

    International Nuclear Information System (INIS)

    Badri, Hanene; Sghaier, Haitham; Barkallah, Insaf; Ben Salem, Issam; Wafa; Essouiss, Imen; Saied, Nadia; Saidi, M.; Gatri, Faten; Gatri, Maher; Boadabous, Abdellatifs; Leys, Natalie

    2009-01-01

    Deinococcus radiodurans R1 is a poly-extremophile for which a system of genetic transformation and manipulation has been developed and it is being engineered for in situ bioremediation of wastes particularly for cleanup of radioactive waste sites. In this study, additional attempts have been made to evaluate ''bioremediation determinants'' in the genome of D. radiodurans using a comparative-genomic approach with Cupriavidus metallidurans CH34, a multiple metal resistant bacterium. This resulted in the delineation of a set of ORFs that are common or peculiar to C. metallidurans and D. radiodurans. We identified 12 ORFs related to multidrug resistance efflux pumps as a special feature of C. metallidurans compared to D. radiodurans, which is the subject of further experimental work

  9. Non-coding RNA in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Chen Zhongzhong; Wang Liangyan; Lin Jun; Tian Bing; Hua Yuejin

    2006-01-01

    Researches on DNA damage and repair pathways of Deinococcus radiodurans show its extreme resistance to ionizing radiation, ultraviolet radiation and reactive oxygen species. Non-coding (ncRNA) RNAs are involved in a variety of processes such as transcriptional regulations, RNA processing and modification, mRNA translation, protein transportation and stability. The conserved secondary structures of intergenic regions of Deinococcus radiodurans R1 were predicted using Stochastic Context Free Grammar (SCFG) scan strategy. Results showed that 28 ncRNA families were present in the non-coding regions of the genome of Deinococcus radiodurans R1. Among these families, IRE is the largest family, followed by Histone3, tRNA, SECIS. DicF, ctRNA-pGA1 and tmRNA are one discovered in bacteria. Results from the comparison with other organisms showed that these ncRNA can be applied to the study of biological function of Deinococcus radiodurans and supply reference for the further study of DNA damage and repair mechanisms of this bacterium. (authors)

  10. Research progress on polar lipids of deinococcus radiodurans

    International Nuclear Information System (INIS)

    Feng Qiong; Tian Bing; Hua Yuejin

    2013-01-01

    Deinococcus radiodurans is extremely resistant to radiation, desiccation, oxidizing agents and other extreme conditions. One of the unique lipids in Deinococcus radiodurans is the polar lipid phosphoglycolipid with alkylamine as the main component. Alkylamine derived from fatty acids. The composition characteristic of lipids is one of the classification criterias of Deinococcus. This article provided an overview of the main features of the Deinococcus radiodurans and introduced special polar lipids that have been found as well as the taxonomy significances of such lipids. The research progress of the relationship between lipids and their resistance mechanisms and the prospects of special lipids in Deinococcus radidurans have also been discussed. (authors)

  11. Repair of DNA damage in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Evans, D.M.

    1984-01-01

    The repair of DNA lesions in Deinococcus radiodurans was examined with particular reference to DNA excision repair of ultraviolet light (UV) induced pyrimidine dimers. The characteristics of excision repair via UV endonucleases α and β in vivo varied with respect to (a) the substrate range of the enzymes, (b) the rate of repair of DNA damage (c) the requirement for a protein synthesised in response to DNA damage to attenuate exonuclease action at repairing regions. UV endonuclease α is postulated to incise DNA in a different manner from UV endonuclease β thus defining the method of subsequent repair. Several DNA damage specific endonuclease activities independent of α and β are described. Mutations of the uvsA, uvsF and uvsG genes resulted in an increase in single-strand breaks in response to DNA damage producing uncontrolled DNA degradation. Evidence is presented that these genes have a role in limiting the access of UV endonuclease β to DNA lesions. uvsF and uvsG are also shown to be linked to the mtoA gene. Mutation of uvsH and reo-1 produces further distinct phenotypes which are discussed. An overall model of excision repair of DNA damage in Deinococcus radiodurans is presented. (author)

  12. Deciphering peculiar protein-protein interacting modules in Deinococcus radiodurans

    Directory of Open Access Journals (Sweden)

    Barkallah Insaf

    2009-04-01

    Full Text Available Abstract Interactomes of proteins under positive selection from ionizing-radiation-resistant bacteria (IRRB might be a part of the answer to the question as to how IRRB, particularly Deinococcus radiodurans R1 (Deira, resist ionizing radiation. Here, using the Database of Interacting Proteins (DIP and the Protein Structural Interactome (PSI-base server for PSI map, we have predicted novel interactions of orthologs of the 58 proteins under positive selection in Deira and other IRRB, but which are absent in IRSB. Among these, 18 domains and their interactomes have been identified in DNA checkpoint and repair; kinases pathways; energy and nucleotide metabolisms were the important biological processes that were found to be involved. This finding provides new clues to the cellular pathways that can to be important for ionizing-radiation resistance in Deira.

  13. Isolation and properties of plasmids from Deinococcus radiodurans Sark

    International Nuclear Information System (INIS)

    Sjarief, S.H.; Kikuchi, Masahiro; Kurita, Hiromi; Kitayama, Shigeru; Watanabe, Hiroshi.

    1990-05-01

    Radioresistant bacterium, Deinococcus radiodurans, can repair completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 kGy. In order to reveal the repair mechanism, it is necessary to develop a cloning vector available for the genetic analysis. We tried to isolate plasmids from D.radiodurans Sark strain. In the present paper the isolation and properties of plasmids were described. (author)

  14. Small-molecule antioxidant proteome-shields in Deinococcus radiodurans.

    Directory of Open Access Journals (Sweden)

    Michael J Daly

    2010-09-01

    Full Text Available For Deinococcus radiodurans and other bacteria which are extremely resistant to ionizing radiation, ultraviolet radiation, and desiccation, a mechanistic link exists between resistance, manganese accumulation, and protein protection. We show that ultrafiltered, protein-free preparations of D. radiodurans cell extracts prevent protein oxidation at massive doses of ionizing radiation. In contrast, ultrafiltrates from ionizing radiation-sensitive bacteria were not protective. The D. radiodurans ultrafiltrate was enriched in Mn, phosphate, nucleosides and bases, and peptides. When reconstituted in vitro at concentrations approximating those in the D. radiodurans cytosol, peptides interacted synergistically with Mn(2+ and orthophosphate, and preserved the activity of large, multimeric enzymes exposed to 50,000 Gy, conditions which obliterated DNA. When applied ex vivo, the D. radiodurans ultrafiltrate protected Escherichia coli cells and human Jurkat T cells from extreme cellular insults caused by ionizing radiation. By establishing that Mn(2+-metabolite complexes of D. radiodurans specifically protect proteins against indirect damage caused by gamma-rays delivered in vast doses, our findings provide the basis for a new approach to radioprotection and insight into how surplus Mn budgets in cells combat reactive oxygen species.

  15. The characteristics of micrococcus (deinococcus) radiodurans sark plasmids

    International Nuclear Information System (INIS)

    Sjarief, Sri Hariani; Kikuchi, Masahiro; Watanabe, Hiroshi.

    1994-01-01

    The characterization of micrococcus (deinococcus) radiodurans sark plasmids. This bacterium has been classified as a new genus deinococcus radiodurans which is resistant to gamma-rays. It can repair itself completely almost all of DNA damages including double strand breaks induced by gamma-rays up to about 5 KGy. To reveal the repair mechanism, several investigations had been done to develop a cloning vector available for the genetic analysis. For this purpose D. radiodurans Sark are to be prepared as a vector by studying the characteristics of its plasmid. Plasmids were isolated by electrophoresis using 0.6% low-melting-temperature agarose in TAE and run for 5.5 hours, followed by the identification. An antibiotic marker was also carried out in this experiment to identify its location in the genetic materials of the cell, beside making a restriction map of the plasmid. Results have shown that D. radiodurans Sark has 4 plasmids (P1, P2, P3, and P4) and the refampicin resistant genes were not found in the plasmid. (authors). 14 refs; 4 figs

  16. UvrD in Deinococcus radiodurans is optimized for processing G-quadruplex DNA

    International Nuclear Information System (INIS)

    Das, Anubrata; Misra, H.S.

    2015-01-01

    Deinococcus radiodurans R1 is a radiation resistant Gram-positive bacterium capable of tolerating very high doses of DNA-damaging agents such as gamma radiation (D10 ∼ 12kGy) desiccation (∼ 5% relative humidity), UVC radiation (D10 ∼ 800J/m 2 ) and hydrogen peroxide (40 mM). It achieves this by using a complex regulatory mechanism and novel proteins. Recently bioinformatic analysis showed several stretches of guanine runs in D.radiodurans genome, which could form G-quartets. The role of G-quartets in regulatory processes is well documented in various organisms. The presence of G -quartets in D. radiodurans means that there are regulatory or structural proteins which would bind to these elements. Several proteins are known to bind G-quartets. Finding the proteins which would bind to G4 DNA is difficult as no specific motifs are available for binding these elements. Also most of the known proteins that are shown to bind to G-quadruplex DNA are of eukaryotic nature. To overcome these challenges we defined a set of known G-quadruplex binding proteins and used a smith-waterman algorithm with our own scoring matrix to homologs of G-quadruplex binding proteins in D.radiodurans. Using bioinformatics analysis, we showed that UvrD (DR 1775) of D. radiodurans has ability to bind/translocate along G-quadruplex DNA, a novel feature in prokaryotes. The translocase activity of DR1775 is ATP specific and this ATPase activity is attenuated by ssDNA. Data supporting UvrD of D. radiodurans as a G-quadruplex DNA metabolizing proteins would be presented. (author)

  17. Heavy metals-bioremediation by highly radioresistant Deinococcus radiodurans biofilm prospective use in nuclear reactor decontamination

    International Nuclear Information System (INIS)

    Shukla, Sudhir K.; Subba Rao, T.

    2015-01-01

    Over the past few decades, rapid growth of chemical industries have enhanced the heavy metal contamination in water, thereby raising environmental concerns. In the nuclear power industry, decontamination procedure also generates radioactive heavy metal containing wastes. Radio-resistant Deinococcus radiodurans R1 is reported to be a potential candidate for the treatment of low active waste material. To use any bacterium for bioremediation purpose, knowledge about its biofilm production characteristics is a prerequisite. This is because biofilm-mediated bioremediation processes are more efficient as compared to processes mediated by their planktonic counterparts. However, so far there are no reports on the biofilm producing capability of D. radiodurans. We observed that tagging of D. radiodurans by a plasmid harbouring gfp and kan R conferred significant biofilm producing property to the bacterium. Chemical analysis of biofilm matrix components produced by D. radiodurans showed that the matrix consists primarily of proteins and carbohydrates with small amount of extracellular DNA (eDNA). Further, we studied the effect of Ca 2+ on D. radiodurans biofilm formation and it was observed that D. radiodurans biofilm formation was enhanced at higher concentrations of Ca 2+ . We investigated the capability of D. radiodurans biofilm to remove the heavy metals Co and Ni from synthetic waste streams. Results showed that Ca 2+ enhanced the bioremediation of both heavy metals (Co, Ni) by D. radiodurans biofilms in a highly significant manner. In the presence of 50 mM Ca 2+ 35% Co removal and 25% Ni removal was observed, when compared to biofilm grown in the absence of Ca 2+ , which showed mere 7% Co and 3% Ni removal, respectively. The results showed that the presence of Ca 2+ significantly enhanced exopolysaccharide and eDNA (both negatively charged) production in the biofilm matrix. This indicated adsorption could be the major mechanism behind enhanced biofilm mediated removal

  18. Characterization of the radioresistance in the radioresistant bacterium deinococcus radiodurans

    International Nuclear Information System (INIS)

    Kong Xiangrong; Du Zeji

    1999-01-01

    The radioresistance of wild type Deinococcus radiodurans KD8301 and the factors affecting the radioresistance were investigated. KH3111 which was a DNA repair mutant of KD8301 (Zeji Du, 1998) was used to be compared with KD8301. Deinococcus radiodurans was discovered by Anderson et al (1956) in X-ray sterilized canned meat that was found to have undergone spoilage. this bacterium and other species of this genus share extreme resistance to ionizing radiation and other agents that damage DNA. Wild type KD8301 and its sensitive mutant KH3111 were irradiated with 60 Co γ-ray at the dose range 0.5 ∼ 10 kGy. Dose-survival fraction curves were made and the radio resistances were determined by LD 99 . The relative contents of DNA in cells were measured by Fluorescence Spectrophotometry (Freedman and Bruce, 1971). The results indicated that wild type KD8301 possesses more radioresistant than its mutant KH3111, LD99 were 9.5 kGy and 2.4 kGy respectively. KD8301 grown at exponential phase showed a decreased resistance to radiation, and the LD99 was 5.1 kGy. No differences of DNA/protein in cells were found between the exponential phase and the stationary phase. The results could be concluded that wild type KD8301 possesses remarkable radioresistance, but this ability was decreased or disappeared after mutation (in KH3111). None DNA relative content other than the growth stages were determinant factors of radioresistance in Deinococcus radiodurans. This results were different from other report (Dickie N et al, 1990). The cellular mechanisms might be the deference's of the bacterium cell morphology between the exponential phase and the stationary phase. Recently, the mutation site of KH3111 which was mutated chemically from wild type KD8301 was identified (Zeji Du, 1998). One base pair changed in the novel gene pprA which was isolated from KD8301 genomic DNA. This point mutation was confirmed to be responsible for the sensitivity of KH3111 to γ-ray and other DNA

  19. Characterization of radiation-induced proteins in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Tanaka, A.; Watanabe, H.; Nozawa, R.; Hu, Q.; Kitayama, S.

    1992-01-01

    Induction of proteins after gamma-irradiation in Deinococcus radiodurans were investigated. 10 proteins were induced and about 15 proteins were reduced after irradiation with 6kGy. These proteins were classified to four groups by responses to gamma-rays, UV light, mitomycin C(MMC) treatment and heating. Additional studies were carried out for the characterization of two induced proteins. One protein was induced by gamma-rays, UV light as well as heating. This protein appeared to be a glycoprotein from its reaction with lectin. From the amino acid sequences of N-terminal and internal region, it was found that this protein is homologous to EF-Tu protein of E. coli. Meanwhile the other protein was induced not only by gamma-rays but also by UV light and MMC treatment. This protein seems to be a new enzyme as it has no homology to the known proteins which have ever been analyzed. No accumulations of these two proteins were observed in radiation sensitive strain of D. radiodurans and in both of E. coli and Bacillus pumilus, suggesting that induction of these two proteins would be specific for high resistant strain. (author)

  20. Subterranean Microhabitat Dependent Intra Versus Extracellular Enzyme Secretion Capabilities of Deinococcus radiodurans

    Directory of Open Access Journals (Sweden)

    Jayant Biswas

    2015-04-01

    Full Text Available Deinococcus radiodurans is one of the most yet discovered extremophilic microbe, the isolation of which from the various habitats of Kotumsar cave is always a matter of enticement to discover its ecological economics. In the present work we studied the intra versus extracellular alkaline protease and glucose isomerase secretion capabilities of Deinococcus radiodurans; KCB21, KCB50, KCB93 isolated from three distinct subterranean niches of Kotumsar cave. The selected niches/zones were the entrance zone, transient zone and the deep inner zone from where the soil sediments were collected to isolate the bacterial strains. The results revealed high extracellular alkaline protease activity from the Deinococcus radiodurans strain which was isolated from the deeper zones of the cave, whereas no such phenomenon was revealed for glucose isomerase. The possible reason for the obtained results has been discussed.

  1. FtsZ from radiation resistant bacterium Deinococcus radiodurans is different from its characterized homologues

    International Nuclear Information System (INIS)

    Mehta, Kruti P.; Misra, H.S.

    2012-01-01

    Polymerization/depolymerization dynamics of FtsZ and its GTPase activity are interdependent and the regulation of these processes determines the growth rate in a bacterium. Deinococcus radiodurans R1 that is best known for its extraordinary radiation resistance and efficient DNA double strand break repair is a comparatively slow growing bacterium and its growth gets arrested in response to gamma radiation. Mechanisms of cell division and its regulation under gamma stressed growth condition would be worth investigating. Genome of this bacterium encodes at least all the known components of divisome. Recombinant FtsZ of D. radiodurans (drFtsZ) preferred Mg 2+ for its GTPase activity. Relatively a very low GTPase activity was observed in presence of Mn 2+ , Co 2+ and Ni 2+ while release of inorganic phosphate could not be detected in presence of other divalent ions including Ca 2+ . GTPase activity of drFtsZ was lower than E. coli but higher than Mycobacterium and it required both Mg 2+ and GTP for its polymerization. Its GTPase activity did not increase with increasing concentration of Mg 2+ and correlates with the bundling of protofilaments. Results obtained from transmission electron microscopy and sedimentation analysis supported the reciprocal correlation of polymerization/depolymerization with the levels of GTPase activity. Dynamic light scattering in presence of 5mM or higher concentration of Mg 2+ and Mn 2 showed a characteristic cyclic change in light scattering without addition of extra metal ion or GTP

  2. Design and Construction of Deinococcus Radiodurans for Biodegradation of Organic Toxins at Radioactive DOE Waste Sites

    International Nuclear Information System (INIS)

    Daly, Michael J.; Wackett, Lawrence P.; Fredrickson, James K.

    2001-01-01

    Seventy million cubic meters of ground and three trillion liters of groundwater have been contaminated by leaking radioactive waste generated in the United States during the Cold War. A cleanup technology is being developed based on the extremely radiation resistant bacterium Deinococcus radiodurans that is being engineered to express bioremediating functions. Research aimed at developing D. radiodurans for organic toxin degradation in highly radioactive waste sites containing radionuclides, heavy metals, and toxic organic compounds was started by this group.Work funded by the existing grant has already contributed to eleven papers on the fundamental biology of D. radiodurans and its design for bioremediation of highly radioactive waste environments

  3. Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

    International Nuclear Information System (INIS)

    Zhu Cong; Guo Jiangfeng

    2008-01-01

    Deinococcus radiodurans was inoculated into the soil which was spiked with 134 Cs to investigate its effect on chemical speciation of 134 Cs. The relationship between chemical speciation of 134 Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134 Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134 Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

  4. Imposed Environmental Stresses Facilitate Cell-Free Nanoparticle Formation by Deinococcus radiodurans.

    Science.gov (United States)

    Chen, Angela; Contreras, Lydia M; Keitz, Benjamin K

    2017-09-15

    The biological synthesis of metal nanoparticles has been examined in a wide range of organisms, due to increased interest in green synthesis and environmental remediation applications involving heavy metal ion contamination. Deinococcus radiodurans is particularly attractive for environmental remediation involving metal reduction, due to its high levels of resistance to radiation and other environmental stresses. However, few studies have thoroughly examined the relationships between environmental stresses and the resulting effects on nanoparticle biosynthesis. In this work, we demonstrate cell-free nanoparticle production and study the effects of metal stressor concentrations and identity, temperature, pH, and oxygenation on the production of extracellular silver nanoparticles by D. radiodurans R1. We also report the synthesis of bimetallic silver and gold nanoparticles following the addition of a metal stressor (silver or gold), highlighting how production of these particles is enabled through the application of environmental stresses. Additionally, we found that both the morphology and size of monometallic and bimetallic nanoparticles were dependent on the environmental stresses imposed on the cells. The nanoparticles produced by D. radiodurans exhibited antimicrobial activity comparable to that of pure silver nanoparticles and displayed catalytic activity comparable to that of pure gold nanoparticles. Overall, we demonstrate that biosynthesized nanoparticle properties can be partially controlled through the tuning of applied environmental stresses, and we provide insight into how their application may affect nanoparticle production in D. radiodurans during bioremediation. IMPORTANCE Biosynthetic production of nanoparticles has recently gained prominence as a solution to rising concerns regarding increased bacterial resistance to antibiotics and a desire for environmentally friendly methods of bioremediation and chemical synthesis. To date, a range of organisms

  5. ParA encoded on chromosome II of Deinococcus radiodurans binds ...

    Indian Academy of Sciences (India)

    2013-07-22

    Jul 22, 2013 ... Introduction. Cell division ..... Subsequently, the level of total FtsZ (FtsZ + FtsZ-. YFP) in cells ... could affect the productive pattern of FtsZ localization and .... maintenance and disassembly of the Z ring. Nat. ... cation tolerance of plants sensitizes Deinococcus radiodurans ... metal shadowing and decoration.

  6. The three catalases in Deinococcus radiodurans: Only two show catalase activity.

    Science.gov (United States)

    Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

    2016-01-15

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H2O2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H2O2 treatments, whereas ΔdrA0146 showed no change in its H2O2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H2O2, but DRA0146 does not have catalase activity and is not involved in the resistance to H2O2 stress. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. Gene fusions with lacZ by duplication insertion in the radioresistant bacterium Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Lennon, E.; Minton, K.W.

    1990-01-01

    Deinococcus radiodurans is the most-studied species of a eubacterial family characterized by extreme resistance to DNA damage. We have focused on developing molecular biological techniques to investigate the genetics of this organism. We report construction of lacZ gene fusions by a method involving both in vitro splicing and the natural transformation of D. radiodurans. Numerous fusion strains were identified by expression of beta-galactosidase. Among these fusion strains, several were inducible by exposure to the DNA-damaging agent mitomycin C, and four of the inducible fusion constructs were cloned in Escherichia coli. Hybridization studies indicate that one of the damage-inducible genes contains a sequence reiterated throughout the D. radiodurans chromosome. Survival measurements show that two of the fusion strains have increased sensitivity to mitomycin C, suggesting that the fusions within these strains inactivate repair functions

  8. Regulation of potassium dependent ATPase (kdp) operon of Deinococcus radiodurans.

    Science.gov (United States)

    Dani, Pratiksha; Ujaoney, Aman Kumar; Apte, Shree Kumar; Basu, Bhakti

    2017-01-01

    The genome of D. radiodurans harbors genes for structural and regulatory proteins of Kdp ATPase, in an operon pattern, on Mega plasmid 1. Organization of its two-component regulatory genes is unique. Here we demonstrate that both, the structural as well as regulatory components of the kdp operon of D. radiodurans are expressed quickly as the cells experience potassium limitation but are not expressed upon increase in osmolarity. The cognate DNA binding response regulator (RR) effects the expression of kdp operon during potassium deficiency through specific interaction with the kdp promoter. Deletion of the gene encoding RR protein renders the mutant D. radiodurans (ΔRR) unable to express kdp operon under potassium limitation. The ΔRR D. radiodurans displays no growth defect when grown on rich media or when exposed to oxidative or heat stress but shows reduced growth following gamma irradiation. The study elucidates the functional and regulatory aspects of the novel kdp operon of this extremophile, for the first time.

  9. Investigation of DNA damage and repair mechanism using deinococcus radiodurans

    International Nuclear Information System (INIS)

    Lau How Mooi; Kikuchi, M.; Kobayashi, Y.; Narumi, I.; Watanabe, H.

    1997-01-01

    Deninococcus Radiodurans, formerly known as Micrococcus Radiodurans, is a popular bacterium because of its high resistance to damage by carcinogens such as ionizing radiation (Dean et. al. 1966; Kitayama and Matsuyama 1968) and UV radiation (Gasvon et. al., 1995; Arrange et. al. 1993). In this report, we investigated the high resistance to ionizing radiation by this bacterium. The bacteria had been exposed from I to 5 kGy of gamma radiation and then incubated in TGY medium to study their ability to repair the broken DNA. The repair time was measured by Pulse Field Gel Electrophoresis (PFGE) method. The repair time for each dose was determined. Also in order to ensure that the repair was perfect, the bacterium was subjected to a second exposure of ionizing radiation after it has fully repaired. It was found that the 'second' repair characteristic was similar to the first repair. This confirmed that the repair after the exposure to the ionizing radiation was perfect

  10. Effects of Low-Temperature Plasma-Sterilization on Mars Analog Soil Samples Mixed with Deinococcus radiodurans

    Directory of Open Access Journals (Sweden)

    Janosch Schirmack

    2016-05-01

    Full Text Available We used Ar plasma-sterilization at a temperature below 80 °C to examine its effects on the viability of microorganisms when intermixed with tested soil. Due to a relatively low temperature, this method is not thought to affect the properties of a soil, particularly its organic component, to a significant degree. The method has previously been shown to work well on spacecraft parts. The selected microorganism for this test was Deinococcus radiodurans R1, which is known for its remarkable resistance to radiation effects. Our results showed a reduction in microbial counts after applying a low temperature plasma, but not to a degree suitable for a sterilization of the soil. Even an increase of the treatment duration from 1.5 to 45 min did not achieve satisfying results, but only resulted in in a mean cell reduction rate of 75% compared to the untreated control samples.

  11. Final Report for Grant No. DE-FG02-98ER62583 ''Functional Analysis of the Genome Sequence of Deinococcus radiodurans''

    International Nuclear Information System (INIS)

    Daly, Michael J.

    2003-01-01

    Extremophiles are nearly always defined with singular characteristics that allow existence within a singular extreme environment. The bacterium Deinococcus radiodurans qualifies as a polyextremeophile, showing remarkable resistance to a range of damage caused by ionizing radiation, dessication, ultraviolet radiation, oxidizing agents, and electrophilic mutagens. D. radiodurans is most famous for its extreme resistance to ionizing radiation; it not only can grow continuously in the presence of chronic radiation (6,000 rad per hour), but it can survive acute exposures to gamma radiation that exceed 1,500,000 rads without lethality or induced mutation. These characteristics were the impetus for sequencing its genome. We completed an extensive comparative sequence analysis of the Deinococcus radiodurans (strain R1) genome. Deinococcus is the first representative with a completely sequenced genome from a bacterial branch of extremophiles - the Thermus/Deinococcus group. Phylogenetic tree analysis, combined with the identification of several synapomorphies between Thermus and Deinococcus, support that it is a very ancient branch localized in the vicinity of the bacterial tree root. Distinctive features of the Deinoccoccus genome as well as features shared with other free-living bacteria were revealed by comparison of its proteome to a collection of Clusters of Orthologous Groups of proteins (COGs). Analysis of paralogs in Deinococcus has revealed some unique protein families. In addition, specific expansions of several protein families including phosphatases, proteases, acyl transferases and MutT pyrophosphohydrolases, were detected. Genes that potentially affect DNA repair and recombination were investigated in detail. Some proteins appear to have been horizontally transferred from eukaryotes, and are not present in other bacteria. For example, three proteins homologous to plant desiccation-resistance proteins were identified and these are particularly interesting

  12. The three catalases in Deinococcus radiodurans: Only two show catalase activity

    International Nuclear Information System (INIS)

    Jeong, Sun-Wook; Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong; Lim, Heon-Man; Lim, Sangyong

    2016-01-01

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H_2O_2) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H_2O_2 treatments, whereas ΔdrA0146 showed no change in its H_2O_2 resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H_2O_2, but DRA0146 does not have catalase activity and is not involved in the resistance to H_2O_2 stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H_2O_2 resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

  13. The three catalases in Deinococcus radiodurans: Only two show catalase activity

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Sun-Wook [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Jung, Jong-Hyun; Kim, Min-Kyu; Seo, Ho Seong [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of); Lim, Heon-Man [Department of Biological Sciences, College of Biological Sciences and Biotechnology, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Lim, Sangyong, E-mail: saylim@kaeri.re.kr [Research Division for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup, 580-185 (Korea, Republic of)

    2016-01-15

    Deinococcus radiodurans, which is extremely resistant to ionizing radiation and oxidative stress, is known to have three catalases (DR1998, DRA0146, and DRA0259). In this study, to investigate the role of each catalase, we constructed catalase mutants (Δdr1998, ΔdrA0146, and ΔdrA0259) of D. radiodurans. Of the three mutants, Δdr1998 exhibited the greatest decrease in hydrogen peroxide (H{sub 2}O{sub 2}) resistance and the highest increase in intracellular reactive oxygen species (ROS) levels following H{sub 2}O{sub 2} treatments, whereas ΔdrA0146 showed no change in its H{sub 2}O{sub 2} resistance or ROS level. Catalase activity was not attenuated in ΔdrA0146, and none of the three bands detected in an in-gel catalase activity assay disappeared in ΔdrA0146. The purified His-tagged recombinant DRA0146 did not show catalase activity. In addition, the phylogenetic analysis of the deinococcal catalases revealed that the DR1998-type catalase is common in the genus Deinococcus, but the DRA0146-type catalase was found in only 4 of 23 Deinococcus species. Taken together, these results indicate that DR1998 plays a critical role in the anti-oxidative system of D. radiodurans by detoxifying H{sub 2}O{sub 2}, but DRA0146 does not have catalase activity and is not involved in the resistance to H{sub 2}O{sub 2} stress. - Highlights: • The dr1998 mutant strain lost 90% of its total catalase activity. • Increased ROS levels and decreased H{sub 2}O{sub 2} resistance were observed in dr1998 mutants. • Lack of drA0146 did not affect any oxidative stress-related phenotypes. • The purified DRA0146 did not show catalase activity.

  14. Design of Deinococcus radiodurans thioredoxin reductase with altered thioredoxin specificity using computational alanine mutagenesis

    OpenAIRE

    Obiero, Josiah; Sanders, David AR

    2011-01-01

    In this study, the X-ray crystal structure of the complex between Escherichia coli thioredoxin reductase (EC TrxR) and its substrate thioredoxin (Trx) was used as a guide to design a Deinococcus radiodurans TrxR (DR TrxR) mutant with altered Trx specificity. Previous studies have shown that TrxRs have higher affinity for cognate Trxs (same species) than that for Trxs from different species. Computational alanine scanning mutagenesis and visual inspection of the EC TrxR–Trx interface suggested...

  15. High-resolution structure of the antibiotic resistance protein NimA from Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Leiros, Hanna-Kirsti S.; Tedesco, Consiglia; McSweeney, Seán M.

    2008-01-01

    In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. Many anaerobic human pathogenic bacteria are treated using 5-nitroimidazole-based (5-Ni) antibiotics, a class of inactive prodrugs that contain a nitro group. The nitro group must be activated in an anaerobic one-electron reduction and is therefore dependent on the redox system in the target cells. Antibiotic resistance towards 5-Ni drugs is found to be related to the nim genes (nimA, nimB, nimC, nimD, nimE and nimF), which are proposed to encode a reductase that is responsible for converting the nitro group of the antibiotic into a nonbactericidal amine. A mechanism for the Nim enzyme has been proposed in which two-electron reduction of the nitro group leads to the generation of nontoxic derivatives and confers resistance against these antibiotics. The cofactor was found to be important in the mechanism and was found to be covalently linked to the reactive His71. In this paper, the 1.2 Å atomic resolution crystal structure of the 5-nitroimidazole antibiotic resistance protein NimA from Deinococcus radiodurans (DrNimA) is presented. A planar cofactor is clearly visible and well defined in the electron-density map adjacent to His71, the identification of the cofactor and its properties are discussed

  16. Metabolic engineering of deinococcus radiodurans based on computational analysis and functional genomics

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Jeremy, S.

    2005-02-02

    The objective of our work is to develop novel computational tools to analyze the Deinococcus radiodurans DNA repair pathways and the influence of the metabolic flux distribution on DNA repair. These tools will be applied to provide insights for metabolic engineering of strains capable of growing under nutrient poor conditions similar to those found in mixed contaminant sites of interest to the DOE. Over the entire grant period we accomplished all our specific aims and were also able to pursue new directions of research. Below, I will list the major accomplishments over the previous 3 years. (1) Performed Monte Carlo Simulations of RecA Mediated Pairing of Homologous DNA Molecules. (2) Developed a statistical approach to study the gene expression data from D. radiodurans. We have been studying the data from John Batista's. (3) Developed an expression profiling technology to generate very accurate and precise expression data. We followed up on results from John Batista's group using this approach. (4) Developed and put online a database for metabolic reconstructions. (5) We have developed and applied new Monte Carlo algorithms that are optimized for studying biological systems. (6) We developed a flux balance model for the D. radiodurans metabolic network

  17. Impact of low-temperature plasmas on Deinococcus radiodurans and biomolecules

    Science.gov (United States)

    Mogul, Rakesh; Bol'shakov, Alexander A.; Chan, Suzanne L.; Stevens, Ramsey M.; Khare, Bishun N.; Meyyappan, M.; Trent, Jonathan D.

    2003-01-01

    The effects of cold plasma on Deinococcus radiodurans, plasmid DNA, and model proteins were assessed using microbiological, spectrometric, and biochemical techniques. In low power O(2) plasma (approximately 25 W, approximately 45 mTorr, 90 min), D. radiodurans, a radiation-resistant bacterium, showed a 99.999% reduction in bioburden. In higher power O(2) plasma (100 W and 500 mTorr), the reduction rate increased about 10-fold and observation by atomic force microscopy showed significant damage to the cell. Damage to cellular lipids, proteins, and chromosome was indicated by losses of infrared spectroscopic peaks at 2930, 1651, 1538, and 1245 cm(-1), respectively. In vitro experiments show that O(2) plasmas induce DNA strand scissions and cross-linking as well as reduction of enzyme activity. The observed degradation and removal of biomolecules was power-dependent. Exposures to 200 W at 500 mTorr removed biomolecules to below detection limits in 60 s. Emission spectroscopy indicated that D. radiodurans cells were volatilized into CO(2), CO, N(2), and H(2)O, confirming that these plasmas were removing complex biological matter from surfaces. A CO(2) plasma was not as effective as the O(2) plasma, indicating the importance of plasma composition and the dominant role of chemical degradation. Together, these findings have implications for NASA planetary protection schemes and for the contamination of Mars.

  18. The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.

    Directory of Open Access Journals (Sweden)

    J Scott Lockhart

    Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.

  19. DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Chen, Huan; Wu, Rongrong; Xu, Guangzhi; Fang, Xu; Qiu, Xiaoli; Guo, Hongyin; Tian, Bing; Hua, Yuejin

    2010-01-01

    Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

  20. DR2539 is a novel DtxR-like regulator of Mn/Fe ion homeostasis and antioxidant enzyme in Deinococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Huan [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Wu, Rongrong [Department of Cardiology, Second Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou 310009 (China); Xu, Guangzhi [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Fang, Xu; Qiu, Xiaoli; Guo, Hongyin [Zhejiang Institute of Microbiology, Zhejiang Province, Hangzhou 310012 (China); Tian, Bing, E-mail: tianbing@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China); Hua, Yuejin, E-mail: yjhua@zju.edu.cn [Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, Hangzhou 310029 (China)

    2010-05-28

    Transcriptional regulators of the diphtheria toxin repressor (DtxR) family control the expression of genes involved in the uptake of iron and manganese, which is not only necessitous nutrients but also was suggested to be essential for intracellular redox cycling of microorganisms. We identified a unique DtxR homologue (DR2539) with special characteristics from Deinococcus radiodurans, which is known for its extreme resistance to radiation and oxidants. The dr2539 mutant showed higher resistance to hydrogen peroxide than the wild-type strain R1. Intracellular catalase activity assay and semiquantitative PCR analysis demonstrated that this DtxR is a negative regulator of catalase (katE). Furthermore, quantitative real-time PCR, global transcription profile and inductively coupled plasma-mass spectrometry analysis showed that the DtxR is involved in the regulation of antioxidant system by maintaining the intracellular Mn/Fe ion homeostasis of D. radiodurans. However, unlike the other DtxR homologues, the DtxR of D. radiodurans acts as a negative regulator of a Mn transporter gene (dr2283) and as a positive regulator of Fe-dependent transporter genes (dr1219, drb0125) in D. radiodurans.

  1. Comparative genomics of Thermus thermophilus and Deinococcus radiodurans: divergent routes of adaptation to thermophily and radiation resistance

    Directory of Open Access Journals (Sweden)

    Daly Michael J

    2005-10-01

    Full Text Available Abstract Background Thermus thermophilus and Deinococcus radiodurans belong to a distinct bacterial clade but have remarkably different phenotypes. T. thermophilus is a thermophile, which is relatively sensitive to ionizing radiation and desiccation, whereas D. radiodurans is a mesophile, which is highly radiation- and desiccation-resistant. Here we present an in-depth comparison of the genomes of these two related but differently adapted bacteria. Results By reconstructing the evolution of Thermus and Deinococcus after the divergence from their common ancestor, we demonstrate a high level of post-divergence gene flux in both lineages. Various aspects of the adaptation to high temperature in Thermus can be attributed to horizontal gene transfer from archaea and thermophilic bacteria; many of the horizontally transferred genes are located on the single megaplasmid of Thermus. In addition, the Thermus lineage has lost a set of genes that are still present in Deinococcus and many other mesophilic bacteria but are not common among thermophiles. By contrast, Deinococcus seems to have acquired numerous genes related to stress response systems from various bacteria. A comparison of the distribution of orthologous genes among the four partitions of the Deinococcus genome and the two partitions of the Thermus genome reveals homology between the Thermus megaplasmid (pTT27 and Deinococcus megaplasmid (DR177. Conclusion After the radiation from their common ancestor, the Thermus and Deinococcus lineages have taken divergent paths toward their distinct lifestyles. In addition to extensive gene loss, Thermus seems to have acquired numerous genes from thermophiles, which likely was the decisive contribution to its thermophilic adaptation. By contrast, Deinococcus lost few genes but seems to have acquired many bacterial genes that apparently enhanced its ability to survive different kinds of environmental stresses. Notwithstanding the accumulation of

  2. Laboratory simulation of interplanetary ultraviolet radiation (broad spectrum) and its effects on Deinococcus radiodurans

    Science.gov (United States)

    Paulino-Lima, Ivan Gláucio; Pilling, Sérgio; Janot-Pacheco, Eduardo; de Brito, Arnaldo Naves; Barbosa, João Alexandre Ribeiro Gonçalves; Leitão, Alvaro Costa; Lage, Claudia de Alencar Santos

    2010-08-01

    The radiation-resistant bacterium Deinococcus radiodurans was exposed to a simulated interplanetary UV radiation at the Brazilian Synchrotron Light Laboratory (LNLS). Bacterial samples were irradiated on different substrates to investigate the influence of surface relief on cell survival. The effects of cell multi-layers were also investigated. The ratio of viable microorganisms remained virtually the same (average 2%) for integrated doses from 1.2 to 12 kJ m -2, corresponding to 16 h of irradiation at most. The asymptotic profiles of the curves, clearly connected to a shielding effect provided by multi-layering cells on a cavitary substrate (carbon tape), means that the inactivation rate may not change significantly along extended periods of exposure to radiation. Such high survival rates reinforce the possibility of an interplanetary transfer of viable microbes.

  3. Bioprecipitation of uranium from alkaline waste solutions using recombinant Deinococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Kulkarni, Sayali; Ballal, Anand; Apte, Shree Kumar, E-mail: aptesk@barc.gov.in

    2013-11-15

    Highlights: • Deinococcus radiodurans was genetically engineered to overexpress alkaline phosphatase (PhoK). • Deino-PhoK bioprecipitated U efficiently over a wide range of input U concentration. • A maximal loading of 10.7 g U/g of biomass at 10 mM input U was observed. • Radioresistance and U precipitation by Deino-PhoK remained unaffected by γ radiation. • Immobilization of Deino-PhoK facilitated easy separation of precipitated U. -- Abstract: Bioremediation of uranium (U) from alkaline waste solutions remains inadequately explored. We engineered the phoK gene (encoding a novel alkaline phosphatase, PhoK) from Sphingomonas sp. for overexpression in the radioresistant bacterium Deinococcus radiodurans. The recombinant strain thus obtained (Deino-PhoK) exhibited remarkably high alkaline phosphatase activity as evidenced by zymographic and enzyme activity assays. Deino-PhoK cells could efficiently precipitate uranium over a wide range of input U concentrations. At low uranyl concentrations (1 mM), the strain precipitated >90% of uranium within 2 h while a high loading capacity of around 10.7 g U/g of dry weight of cells was achieved at 10 mM U concentration. Uranium bioprecipitation by Deino-PhoK cells was not affected in the presence of Cs and Sr, commonly present in intermediate and low level liquid radioactive waste, or after exposure to very high doses of ionizing radiation. Transmission electron micrographs revealed the extracellular nature of bioprecipitated U, while X-ray diffraction and fluorescence analysis identified the precipitated uranyl phosphate species as chernikovite. When immobilized into calcium alginate beads, Deino-PhoK cells efficiently removed uranium, which remained trapped in beads, thus accomplishing physical separation of precipitated uranyl phosphate from solutions. The data demonstrate superior ability of Deino-PhoK, over earlier reported strains, in removal of uranium from alkaline solutions and its potential use in

  4. Involvement of recQ in the ultraviolet damage repair pathway in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Hua Xiaoting; Huang Lifen; Tian Bing; Hua Yuejin

    2008-01-01

    Deinococcus radiodurans is a bacterium which can survive extremely DNA damage. To investigate the relationship between recQ and the ultraviolet radiation (UV) damage repair pathway, we created a four mutant strain by constructing recQ knockout mutants in uvrA1, uvrA2, and uvsE backgrounds. Using the rpoB/Rif r system, we measured the mutation frequencies and rates in wild type, recQ (MQ), uvsE uvrA1 uvrA2 (TNK006), and uvsE uvrA1 uvrA2 recQ (TQ). We then isolated Rif r mutants of these strains and sequenced the rpoB gene. The mutation frequency of TQ was 6.4, 10.1, and 2.43 times that of wild type, MQ, and TNK006, respectively, and resulted in rates of 4.7, 6.71, and 2.15 folds higher than that of wild type, MQ, and TNK006, respectively. All the strains demonstrated specific mutational hotspots. Furthermore, the TQ strain showed a transversion bias that was different from the other three strains. The results indicate that recQ is involved in the ultraviolet damage repair pathway via the interaction between recQ and uvrA1, uvrA2, and uvsE in D. radiodurans

  5. Influence of LET on repair of DNA damages in Deinococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Y; Tanaka, A; Kikuchi, M; Shimizu, T; Watanabe, H [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Cao, J P; Taucher-Scholz, G

    1997-03-01

    Inactivation caused by heavy ions was studied in dry cells of radioresistant bacterium Deinococcus radiodurans. All survival curves were characterized by a large shoulder of the curves. No final slopes of the exponential part of survival curves for heavy ion irradiation were steeper than that for 2.0 MeV electron irradiation. The plots of RBE versus LET showed no obvious peaks, suggesting that this bacterium can repair not only DNA double strand breaks (DSBs) but also clustered damage in DNA which may be induced by heavy ions. The genomic DNA of D. radiodurans was cleaved into large fragments with restriction enzyme Not I after post-irradiation incubation and the fragments were separated using pulsed-field gel electrophoresis (PFGE). DSBs induction and rejoining process were analyzed by detection of the reappearance of ladder pattern of DNA fragments. The required repair time after heavy ions irradiation was longer than the repair time for electrons at the same dose of irradiation, however, the rate of repair enzyme induction was almost similar to each other between electrons and heavy ions, suggesting that the same repair system is likely to be used after both low and high LET irradiations. (author)

  6. Gel-based proteomic approach to unravel the extreme radiation resistance of deinococcus radiodurans

    International Nuclear Information System (INIS)

    Basu, Bhakti; Apte, Shree Kumar

    2013-01-01

    The extremophile, Deinococcus radiodurans, is endowed with an extraordinary DNA repair ability and oxidative stress alleviation mechanisms that render it virtually resistant to all types of DNA damaging stressors such as ionizing radiations, UV or years of desiccation. Following DNA damage, the microbe reassembles its complete genome from multiple DNA fragments with impeccable fidelity. The deinococcal genome encodes functional homologues of both prokaryotic and eukaryotic DNA repair pathways, such as RecFOR mediated homologous recombination (HR), nucleotide/base excision repair (NER/BER), strand annealing (SA) and non-homologous end joining (NHEJ), but lacks homologues for universal prokaryotic DNA repair pathways such as RecBCD mediated HR, photo-reactivation and SOS response. It also harbors multiple enzymatic and non-enzymatic oxidative stress defense mechanisms. Proteomic approaches were employed to study the response of D. radiodurans to LD50 dose of gamma irradiation during the post-irradiation growth arrest phase by two dimensional protein electrophoresis coupled with mass spectrometry to reveal kinetics and dynamics of DNA repair, oxidative stress alleviation and resynthesis of damaged proteins, preceding growth recovery

  7. PprA phosphorylation by STPK of Deinococcus radiodurans changes its in vitro functions

    International Nuclear Information System (INIS)

    Rajpurohit, Yogendra S.; Misra, H.S.

    2011-01-01

    Deinococcus radiodurans shows amazing resistance to both ionizing and non-ionizing radiations. This phenotype is attributed also to its efficient DNA double strand breaks (DSB) repair capability of this bacterium. PprA (pleiotropic protein promoting DNA repair) is unique to D. radiodurans and its role in gamma radiation resistance and DSB repair has been shown in this bacterium. Recombinant PrA protects dsDNA from exonuclease degradation and stimulates the DNA ends joining activity of both T4 DNA ligase and E.coli NAD ligase in vitro. Phosphomotif search showed that PprA has putative phosphorylation site similar to that is characterized for Ser/Thr protein kinases in eukaryotic system. A eukaryotic type Ser/Thr protein kinase (DR2518) of D. radiodurans, could phosphorylate recombinant PprA at Thr amino acid in vitro and the phosphorylation of PprA was also observed in vivo. DR2518 kinase mediated protein phosphorylation of PprA, improves its DNA binding affinity by nearly four fold and stimulated T4 DNA ligase activity more towards intermolecular ligation, as compared to unphosphorylated PprA. Interestingly, the phospho-PprA showed lesser protection of dsDNA than unphospho-PprA when incubated with exonuclease III in solution. The putative Thr of PprA was replaced with Ala (T48A) by site directed mutagenesis, which resulted in significant reduction of PprA phosphorylation by DR2518 kinase. Detailed studies on PprA phosphorylation and its functional significance would be presented. (author)

  8. Whole cell Deinococcus radiodurans ameliorates salt stress in Indian mustard through pyrroloquinoline quinone

    International Nuclear Information System (INIS)

    Srivastava, A.K.; Jadhav, P.; Suprasanna, P.; Rajpurohit, Y.S.; Misra, H.S.

    2015-01-01

    Salinity stress is considered as one of the major abiotic stresses limiting crop productivity. A variety of symbiotic and non-symbiotic bacteria are currently being used worldwide with the aim to boost built-in defense system in plants. Deinococcus radiodurans is a highly desiccation and radiation tolerant bacterium which synthesizes PQQ (pyrroloquinoline quinone) that has been shown to have a versatile role in crop productivity and as a general stress response regulator in bacteria and mammals. PQQ also acts as scavenger of reactive oxygen species and hence, can module redox signaling, one of the major regulator of stress tolerance in plants. In view of this, present research was conducted to evaluate the potential of whole cell D. radiodurans for ameliorating salt stress in plants. The soil colonization with wild-type cells led to partial amelioration of salt stress. The PQQ mutant showed an intermediate phenotype between wild-type seedlings and those grown on non-colonized soils which confirmed that the effects are largely associated with PQQ. The differential phenotype was also correlated with ROS level and ABA accumulation. The flame photometry data showed that there was no significant reduction in water soluble Na + level in control plant and those treated with either wild-type or PQQ mutant. Further, the elevated levels of antioxidant enzymes and reduced ascorbate in the plants treated with bacterial cells indicated its positive role in oxidative stress management. Although, the exact molecular basis to these effects is yet to be understood, present findings support the use of whole cell D. radiodurans for managing the growth and productivity of Indian mustard in salt affected fields. (author)

  9. Synthesis and extracellular accumulation of silver nanoparticles by employing radiation-resistant Deinococcus radiodurans, their characterization, and determination of bioactivity

    Directory of Open Access Journals (Sweden)

    Kulkarni RR

    2015-01-01

    Full Text Available Rasika R Kulkarni, Nayana S Shaiwale, Dileep N Deobagkar, Deepti D Deobagkar Molecular Biology Research Laboratory, Center of Advanced Studies, Department of Zoology, University of Pune, Pune, India Abstract: There has been rapid progress in exploring microorganisms for green synthesis of nanoparticles since microbes show extraordinary diversity in terms of species richness and niche localization. Microorganisms are easy to culture using relatively inexpensive and simple nutrients under varied conditions of temperature, pressure, pH, etc. In this work, Deinococcus radiodurans that possesses the ability to withstand extremely high radiation and desiccation stress has been employed for the synthesis of silver nanoparticles (AgNPs. D. radiodurans was able to accumulate AgNPs in medium under various conditions, and process optimization was carried out with respect to time, temperature, pH, and concentration of silver salt. AgNPs were characterized using UV/vis spectroscopy, scanning electron microscopy, transmission electron microscopy, X-ray diffraction, energy-dispersive X-ray spectroscopy, and Fourier transform infrared spectroscopy. The microbially synthesized AgNPs exhibited good antimicrobial activity against both Gram-negative and Gram-positive organisms and anti-biofouling activity. Their ability to inhibit growth and proliferation of cancer cell line was also examined, and it could be seen that AgNPs synthesized using D. radiodurans exhibited excellent anticancer activity. Keywords: Deinococcus radiodurans, silver nanoparticles, anticancer, radiation resistance, antibacterial, anti-biofouling 

  10. Cyclic AMP Receptor Protein Acts as a Transcription Regulator in Response to Stresses in Deinococcus radiodurans.

    Directory of Open Access Journals (Sweden)

    Su Yang

    Full Text Available The cyclic AMP receptor protein family of transcription factors regulates various metabolic pathways in bacteria, and also play roles in response to environmental changes. Here, we identify four homologs of the CRP family in Deinococcus radiodurans, one of which tolerates extremely high levels of oxidative stress and DNA-damaging reagents. Transcriptional levels of CRP were increased under hydrogen peroxide (H2O2 treatment during the stationary growth phase, indicating that CRPs function in response to oxidative stress. By constructing all CRP single knockout mutants, we found that the dr0997 mutant showed the lowest tolerance toward H2O2, ultraviolet radiation, ionizing radiation, and mitomycin C, while the phenotypes of the dr2362, dr0834, and dr1646 mutants showed slight or no significant differences from those of the wild-type strain. Taking advantage of the conservation of the CRP-binding site in many bacteria, we found that transcription of 18 genes, including genes encoding chromosome-partitioning protein (dr0998, Lon proteases (dr0349 and dr1974, NADH-quinone oxidoreductase (dr1506, thiosulfate sulfurtransferase (dr2531, the DNA repair protein UvsE (dr1819, PprA (dra0346, and RecN (dr1447, are directly regulated by DR0997. Quantitative real-time polymerase chain reaction (qRT-PCR analyses showed that certain genes involved in anti-oxidative responses, DNA repair, and various cellular pathways are transcriptionally attenuated in the dr0997 mutant. Interestingly, DR0997 also regulate the transcriptional levels of all CRP genes in this bacterium. These data suggest that DR0997 contributes to the extreme stress resistance of D. radiodurans via its regulatory role in multiple cellular pathways, such as anti-oxidation and DNA repair pathways.

  11. Conservation of the LexA repressor binding site in Deinococcus radiodurans

    Directory of Open Access Journals (Sweden)

    Khan Feroz

    2008-03-01

    Full Text Available The LexA protein is a transcriptional repressor of the bacterial SOS DNA repair system, which comprises a set of DNA repair and cellular survival genes that are induced in response to DNA damage. Its varied DNA binding motifs have been characterized and reported in the Escherichia coli, Bacillus subtilis, rhizobia family members, marine magnetotactic bacterium, Salmonella typhimurium and recently in Mycobacterium tuberculosis and this motifs information has been used in our theoretical analysis to detect its novel regulated genes in radio-resistant Deinococcus radiodurans genome. This bacterium showed presence of SOS-box like consensus sequence in the upstream sequences of 3166 genes with >60% motif score similarity percentage (MSSP on both strands. Attempts to identify LexA-binding sites and the composition of the putative SOS regulon in D. radiodurans have been unsuccessful so far. To resolve the problem we performed theoretical analysis with modifications on reported data set of genes related to DNA repair (61 genes, stress response (145 genes and some unusual predicted operons (21 clusters. Expression of some of the predicted SOS-box regulated operon members then was examined through the previously reported microarray data which confirm the expression of only single predicted operon i.e. DRB0143 (AAA superfamily NTPase related to 5-methylcytosine specific restriction enzyme subunit McrB and DRB0144 (homolog of the McrC subunit of the McrBC restriction modification system. The methodology involved weight matrix construction through CONSENSUS algorithm using information of conserved upstream sequences of eight known genes including dinB, tagC, lexA, recA, uvrB, yneA of B. subtilis while lexA and recA of D. radiodurans through phylogenetic footprinting method and later detection of similar conserved SOS-box like LexA binding motifs through both RSAT & PoSSuMsearch programs. The resultant DNA consensus sequence had highly conserved 14 bp SOS

  12. A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing, E-mail: tianbing@zju.edu.cn; Hua, Yuejin, E-mail: yjhua@zju.edu.cn

    2014-07-18

    Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H{sub 2}O{sub 2} and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H{sub 2}O{sub 2}) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H{sub 2}O{sub 2} stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans.

  13. A PerR-like protein involved in response to oxidative stress in the extreme bacterium Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Liu, Chengzhi; Wang, Liangyan; Li, Tao; Lin, Lin; Dai, Shang; Tian, Bing; Hua, Yuejin

    2014-01-01

    Highlights: • We report a novel PerR-like protein of Fur family in D. radiodurans that is not annotated in the current database. • drperR responses to H 2 O 2 and functions as a negative regulator of katE and dps. • We provided implications on how to utilize sequenced genome data and the importance of genome data mining. • This study adds knowledge to complicated regulatory network that responds to ROS stress in D. radiodurans. - Abstract: Response and defense systems against reactive oxygen species (ROS) contribute to the remarkable resistance of Deinococcus radiodurans to oxidative stress induced by oxidants or radiation. However, mechanisms involved in ROS response and defense systems of D. radiodurans are not well understood. Fur family proteins are important in ROS response. Only a single Fur homolog is predicted by sequence similarity in the current D. radiodurans genome database. Our bioinformatics analysis demonstrated an additional guanine nucleotide in the genome of D. radiodurans that is not in the database, leading to the discovery of another Fur homolog DrPerR. Gene disruption mutant of DrPerR showed enhanced resistance to hydrogen peroxide (H 2 O 2 ) and increased catalase activity in cell extracts. Real-time PCR results indicated that DrPerR functions as a repressor of the catalase gene katE. Meanwhile, derepression of dps (DNA-binding proteins from starved cells) gene under H 2 O 2 stress by DrPerR point to its regulatory role in metal ions hemostasis. Thus, DrPerR might function as a Fur homolog protein which is involved in ROS response and defense. These results help clarify the complicated regulatory network that responds to ROS stress in D. radiodurans

  14. Effect of N+ beam exposure on superoxide dismutase and catalase activities and induction of Mn-SOD in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Song Daojun; Chen Ruolei; Shao Chunlin; Wu Lijun; Yu Zengliang

    2000-01-01

    Though bacteria of the radiation-resistant Deinococcus radiodurans have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced by these bacteria were measured, and the change of SOD and CAT activities by 20 keV N + beam exposure was examined. Their activities were increased by N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . The treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase in SOD activity was resulted from inducible activities of Mn-SOD in D. radiodurans AS1.633 by N + beam exposure. These results suggested that this bacteria possess inducible defense mechanisms against the deleterious effects of oxidisation

  15. Effect of N+ beam exposure on the activities of Mn-SOD and catalase in deinococcus radiodurans

    International Nuclear Information System (INIS)

    Song Daojun; Chen Ruolei; Wu Lifang; Li Hong; Yao JIanming; Shao Chunlin; Wu Lijun; Yu Zengliang

    2000-01-01

    Though the radiation-resistant bacteria Deinococcus radiodurans (D. radiodurans) have a high resistance to the lethal and mutagenic effects of many DNA-damaging agents, the mechanisms involved in the response of these bacteria to oxidative stress are poorly understood. The superoxide dismutase (SOD) and catalase (CAT) activities produced in bacteria (D. radiodurans AS1.633) and their change caused by 20 keV N'+ beam exposure were examined. Results showed that the activities of the enzymes were increased in the case of N + beam exposure from 8 x 10 14 ions/cm 2 to 6 x 10 15 ions/cm 2 . In addition, the treatment of H 2 O 2 and [CHCl 3 + CH 3 CH 2 OH] and the measurement of absorption spectrum showed that the increase of whole SOD activity resulted from inducible activities of Mn-SOD in (a sub-type) D. radiodurans AS1.633. These results suggested that these bacteria possess inducible defense mechanisms against the deleterious effects of oxidization

  16. Understanding the role of RecN in DSB repair pathway in Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Pellegrino, S.

    2012-01-01

    Deinococcus radiodurans is a Gram-positive bacterium known for its extreme resistance to a broad variety of DNA damaging agents. Among these, Ionizing Radiations and desiccation are the most harmful for the cell, since they introduce breaks in the genome. Double Strand Breaks (DSB) are particularly hazardous for the cell and they need to be repaired very efficiently, in order to avoid mutations leading to altered, if not lethal, phenotypes. Homologous Recombination (HR) is the most efficient mechanism by which DSBs are repaired. D. radiodurans is able to completely restore its genome in only 3 hours, and it accomplishes the entire process through the RecFOR pathway. In order to be repaired, DSBs first need to be recognized. The protein believed to be responsible for this important step that takes place soon after the damage occurs in the cell, is RecN. RecN is recruited at the early stages of DNA repair and in vivo studies have demonstrated its propensity to localize to discrete foci. In vitro studies also suggest that RecN possesses a DNA end-joining activity previously observed for SMC proteins (such as cohesin), which are structurally related to RecN. Several structural studies have been carried out on the SMC-like protein, Rad50, but so far no structural information is available for RecN. The work presented here focused on the structural characterization of RecN and its constitutive domains. We obtained crystal structures of three partially overlapping constructs of RecN and Small Angle X-ray Scattering was performed on the individual domains and the full-length protein. The study of RecN in solution complemented our crystallographic study and enabled us to build a reliable, atomic model of the full-length protein. Mutations were designed and the mutant RecN proteins were produced in order to characterize the ATP hydrolysis activity of RecN, which is a conserved feature of this family of proteins. Extensive biochemical studies were carried out on wild-type and

  17. Molecular cloning and analysis of DNA repair gene from the radioresistant bacterium deinococcus radiodurans

    International Nuclear Information System (INIS)

    Du Zeji; Wang Mingsuo

    1998-12-01

    Deinococcus radiodurans (Dr) possesses a prominent ability to repair DNA injury induced by various DNA-damaging agents including mitomycin C (MC), ultraviolet light (UV) and ionizing radiation. A DNA repair mutant Dr KH3111 is a streptomycin resistant (Sm R ) derivative of KH311 which is generated by treatment with nitrosoguanidine and is sensitive to MC, 8-trimethyl-psoralen, UV and γ-ray irradiation. Gene affected by a mutation in the mutant is identified and its nucleotide sequence is determined. A complete open reading frame (ORF) which encompassed the KH3111 mutation region is found and tentatively designated as orf144b. The deduced amino acid (aa) sequence of orf144b consists of 284 aa and has no significant homology to other known proteins. The exact KH3111 mutation site is one nucleotide altered (G to A) in the sequence of orf144b in the mutant. The KH3111 mutation causes the substitution of Gly for Glu at aa position 149 of Orf144b. Survival measurements of a revertant KH3112 which was produced by transforming with DNA containing a part of the orf144b gene of KD8301 showed that the resistances to MC, UV and γ-ray in the revertant were fully restored at a level equal to the wild type. Thus, the orf144b gene required for the multiple-DNA-damaging agent resistance of Dr was designated with the name of pprA (Pleiotropic gene promoting DNA repair). This new gene can express in E. coli at very high level, and make the host E. coli resistant to MC, UV and γ-ray. The pprA gene does not express in normal Dr, but it can be induced to express by treatment with MC, UV and γ-ray. It was thought that the PprA polypeptide is a cytoplasmic protein because of the absence of characteristics found in the aa sequence of membrane proteins

  18. Identification of uvrA gene mutation sites in two mitomycin-sensitive deinococcus radiodurans strains

    International Nuclear Information System (INIS)

    Du Zeji; Kong Xianrong

    1999-01-01

    Deinococcus radiodurans (Dr) possesses a prominent ability to repair the DNA injury induced by various DNA- damaging agents including mitomycin C(MC), ultraviolet light (UV) and ionizing radiation. DNA damage resistance was restored in MC sensitive (MC s ) mutants 2621 and 3021 by transforming with DNAs of four cosmids clones derived from the gene library of strain KD8301 which showed the property of wild type phenotype to DNA-damaging agents. Gene affected by mutation (mtcA or mtcB) in both mutants was cloned and its nucleotide sequence was determined. The deduced amino acid (aa) sequence of Dr uvrA gene product consists of 1016 aa and shares homology with many bacterial UvrA proteins. The mutation sites in both mutants were identified by analyzing the polymerase chain reaction (PCR) fragments derived from the genomic DNA of the mutants. A 144-base pairs (bp) deletion including the start codon for the uvr A gene was observed in DNA of the mutant 3021, causing a defect in the gene. On the other hand, an insertion sequence (IS) element intervened in the uvrA gene of the mutant 2621, suggesting the insertional inactivation of the gene. The IS element comprise 1322-bp long, flanked by 19-bp inverted terminal repeats (ITR), and generated a 6-bp target duplication (TD). Two open reading frames (ORF) were found in the IS element. The deduced aa sequences of large and small ORF show homology to a putative transposes found in IS4 of Escherichia coli (E. coli) and to a resolvent found in IS Xc5 of Xanthomonas campestris (Xc), respectively. This is the first discovery of IS element in deino-bacteria, and the IS element was designated IS2621

  19. Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties

    Directory of Open Access Journals (Sweden)

    Li J

    2016-11-01

    Full Text Available Jiulong Li,1,* Qinghao Li,1,* Xiaoqiong Ma,2,* Bing Tian,1 Tao Li,1 Jiangliu Yu,1 Shang Dai,1 Yulan Weng,1 Yuejin Hua1 1Key Laboratory for Nuclear-Agricultural Sciences of Chinese Ministry of Agriculture and Zhejiang Province, Institute of Nuclear-Agricultural Sciences, Zhejiang University, 2Central Laboratory, The First Affiliated Hospital of Zhejiang Chinese Medical University, Hangzhou, China *These authors contributed equally to this work Abstract: Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III and biosynthesize gold nanoparticles (AuNPs was investigated in aqueous solution by ultraviolet and visible (UV/Vis absorption spectroscopy, electron microscopy, X-ray diffraction (XRD, dynamic light scattering (DLS, Fourier transform infrared spectroscopy (FTIR and X-ray photoelectron spectroscopy (XPS. D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III may be reduced to Au(I, and further reduced to Au(0 with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative (Escherichia coli and Gram-positive (Staphylococcus aureus bacteria by damaging their cytoplasmic membrane. Therefore, the extreme

  20. Repair of gamma radiation damage in wild type and a radiation sensitive mutant of Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Mizuma, Nagayo

    1989-01-01

    In an effort to examine production and repair of radiation-induced single and double strand breaks in the DNA, a repair-deficient wild type and a repair-deficient mutant, UV17, of Deinococcus radiodurans were subjected to Co-60 gamma irradiation at a dose rate of 6.3 kGy/hr for wild type and 3.9 kGy/hr for UV17 mutant. The shoulder of the curve of UV17 mutant was narrow but existed with the intercept of 0.7 kGy and the corresponding value of the wild type was 4.2 kGy. Mutant cells exhibited about 6 fold increases in sensitivity for the shoulder relative to the wild type. The D 37 doses in the wild type and the mutant were 0.57 kGy and 0.25 kGy, respectively. From the survival curves, difference in the sensitivity between two strains was mainly due to difference of repair capacity than the number of radiation sensitive target. Sedimentation rate of the main component in the irradiated cells of UV17 mutant increased almost to the level of unirradiated control by the postincubation at 30deg C for 3 hrs. The results indicated that this sensitive mutant also exhibited an ability to restore single strand breaks after exposure to a sublethal dose of 0.6 kGy. When restitution of double strand breaks was analyzed by sedimentation in a neutral sucrose gradient, the wild type showed restitution to DNA-membrane complex from large part of the breaks. For UV17 mutant, the apparent increase in DNA-membrane complex formation was seen after 3 hours incubation. Large part of the decrease in the activities of peak 2 was recovered in the peak 1 for the wild type. For the mutant, there was little restitution to peak 1. Almost free DNA component in UV17 mutant, therefore, was merely degraded into shorter pieces. Restoration of DNA-membrane complex from free DNA derived from gamma-ray induced double strand scission involved closely in the repair of gamma-induced damage and survival. (N.K.)

  1. Structure determination of uracil-DNA N-glycosylase from Deinococcus radiodurans in complex with DNA.

    Science.gov (United States)

    Pedersen, Hege Lynum; Johnson, Kenneth A; McVey, Colin E; Leiros, Ingar; Moe, Elin

    2015-10-01

    Uracil-DNA N-glycosylase (UNG) is a DNA-repair enzyme in the base-excision repair (BER) pathway which removes uracil from DNA. Here, the crystal structure of UNG from the extremophilic bacterium Deinococcus radiodurans (DrUNG) in complex with DNA is reported at a resolution of 1.35 Å. Prior to the crystallization experiments, the affinity between DrUNG and different DNA oligonucleotides was tested by electrophoretic mobility shift assays (EMSAs). As a result of this analysis, two 16 nt double-stranded DNAs were chosen for the co-crystallization experiments, one of which (16 nt AU) resulted in well diffracting crystals. The DNA in the co-crystal structure contained an abasic site (substrate product) flipped into the active site of the enzyme, with no uracil in the active-site pocket. Despite the high resolution, it was not possible to fit all of the terminal nucleotides of the DNA complex into electron density owing to disorder caused by a lack of stabilizing interactions. However, the DNA which was in contact with the enzyme, close to the active site, was well ordered and allowed detailed analysis of the enzyme-DNA interaction. The complex revealed that the interaction between DrUNG and DNA is similar to that in the previously determined crystal structure of human UNG (hUNG) in complex with DNA [Slupphaug et al. (1996). Nature (London), 384, 87-92]. Substitutions in a (here defined) variable part of the leucine loop result in a shorter loop (eight residues instead of nine) in DrUNG compared with hUNG; regardless of this, it seems to fulfil its role and generate a stabilizing force with the minor groove upon flipping out of the damaged base into the active site. The structure also provides a rationale for the previously observed high catalytic efficiency of DrUNG caused by high substrate affinity by demonstrating an increased number of long-range electrostatic interactions between the enzyme and the DNA. Interestingly, specific interactions between residues

  2. Biosynthesis of gold nanoparticles by the extreme bacterium Deinococcus radiodurans and an evaluation of their antibacterial properties.

    Science.gov (United States)

    Li, Jiulong; Li, Qinghao; Ma, Xiaoqiong; Tian, Bing; Li, Tao; Yu, Jiangliu; Dai, Shang; Weng, Yulan; Hua, Yuejin

    Deinococcus radiodurans is an extreme bacterium known for its high resistance to stresses including radiation and oxidants. The ability of D. radiodurans to reduce Au(III) and biosynthesize gold nanoparticles (AuNPs) was investigated in aqueous solution by ultraviolet and visible (UV/Vis) absorption spectroscopy, electron microscopy, X-ray diffraction (XRD), dynamic light scattering (DLS), Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS). D. radiodurans efficiently synthesized AuNPs from 1 mM Au(III) solution in 8 h. The AuNPs were of spherical, triangular and irregular shapes with an average size of 43.75 nm and a polydispersity index of 0.23 as measured by DLS. AuNPs were distributed in the cell envelope, across the cytosol and in the extracellular space. XRD analysis confirmed the crystallite nature of the AuNPs from the cell supernatant. Data from the FTIR and XPS showed that upon binding to proteins or compounds through interactions with carboxyl, amine, phospho and hydroxyl groups, Au(III) may be reduced to Au(I), and further reduced to Au(0) with the capping groups to stabilize the AuNPs. Biosynthesis of AuNPs was optimized with respect to the initial concentration of gold salt, bacterial growth period, solution pH and temperature. The purified AuNPs exhibited significant antibacterial activity against both Gram-negative ( Escherichia coli ) and Gram-positive ( Staphylococcus aureus ) bacteria by damaging their cytoplasmic membrane. Therefore, the extreme bacterium D. radiodurans can be used as a novel bacterial candidate for efficient biosynthesis of AuNPs, which exhibited potential in biomedical application as an antibacterial agent.

  3. PprA contributes to Deinococcus radiodurans resistance to nalidixic acid, genome maintenance after DNA damage and interacts with deinococcal topoisomerases.

    Directory of Open Access Journals (Sweden)

    Swathi Kota

    Full Text Available PprA is known to contribute to Deinococcus radiodurans' remarkable capacity to survive a variety of genotoxic assaults. The molecular bases for PprA's role(s in the maintenance of the damaged D. radiodurans genome are incompletely understood, but PprA is thought to promote D. radiodurans's capacity for DSB repair. PprA is found in a multiprotein DNA processing complex along with an ATP type DNA ligase, and the D. radiodurans toposiomerase IB (DraTopoIB as well as other proteins. Here, we show that PprA is a key contributor to D. radiodurans resistance to nalidixic acid (Nal, an inhibitor of topoisomerase II. Growth of wild type D. radiodurans and a pprA mutant were similar in the absence of exogenous genotoxic insults; however, the pprA mutant exhibited marked growth delay and a higher frequency of anucleate cells following treatment with DNA-damaging agents. We show that PprA interacts with both DraTopoIB and the Gyrase A subunit (DraGyrA in vivo and that purified PprA enhances DraTopoIB catalysed relaxation of supercoiled DNA. Thus, besides promoting DNA repair, our findings suggest that PprA also contributes to preserving the integrity of the D. radiodurans genome following DNA damage by interacting with DNA topoisomerases and by facilitating the actions of DraTopoIB.

  4. Method for detecting DNA strand breaks in mammalian cells using the Deinococcus radiodurans PprA protein

    International Nuclear Information System (INIS)

    Satoh, Katsuya; Wada, Seiichi; Kikuchi, Masahiro; Funayama, Tomoo; Narumi, Issay; Kobayashi, Yasuhiko

    2006-01-01

    In a previous study, we identified the novel protein PprA that plays a critical role in the radiation resistance of Deinococcus radiodurans. In this study, we focussed on the ability of PprA protein to recognize and bind to double-stranded DNA carrying strand breaks, and attempted to visualize radiation-induced DNA strand breaks in mammalian cultured cells by employing PprA protein using an immunofluorescence technique. Increased PprA protein binding to CHO-K1 nuclei immediately following irradiation suggests the protein is binding to DNA strand breaks. By altering the cell permeabilization conditions, PprA protein binding to CHO-K1 mitochondria, which is probably resulted from DNA strand break immediately following irradiation, was also detected. The method developed and detailed in this study will be useful in evaluating DNA damage responses in cultured cells, and could also be applicable to genotoxic tests in the environmental and pharmaceutical fields

  5. Extremely radioresistant microbe Deinococcus radiodurans does not survive tellurite-mediated oxidative stress: revelation of molecular basis

    International Nuclear Information System (INIS)

    Apte, Shree Kumar; Narasimha, Anaganti; Basu, Bhakti

    2014-01-01

    Deinococcus radiodurans exhibits extraordinary resistance to gamma radiation as well as oxidative stress. Comparison of tellurite stress with gamma irradiation, both of which impart severe oxidative stress, revealed that tellurite induced less ROS and caused less oxidative damage to proteins, but was much more lethal to D. radiodurans than gamma irradiation. The proteomic changes induced by tellurite exposure were mapped by two dimensional protein electrophoresis followed by mass spectrometry. Seventy proteins belonging to major functional categories of oxidative stress alleviation, protein translation/folding and metabolism were identified. Tellurite responsive proteome dynamics displayed (i) up-regulation of proteins involved in tellurite stress resistance and oxidative stress alleviation, dehydrogenases involved in generation of reducing potential, and chaperones (such DnaK), and (ii) down regulation of key glycolysis and TCA cycle enzymes, proteins involved in protein translation/folding and energy production. Tellurite stress also resulted in nearly 50% loss in the cellular reducing potential within 1h of exposure while gamma irradiation had no such effect. The findings provide a better insight into the mechanism of tellurite toxicity, beyond metal mediated oxidative stress, in this extremophile. (author)

  6. Stress induction in the bacteria Shewanella oneidensis and Deinococcus radiodurans in response to below-background ionizing radiation.

    Science.gov (United States)

    Castillo, Hugo; Schoderbek, Donald; Dulal, Santosh; Escobar, Gabriela; Wood, Jeffrey; Nelson, Roger; Smith, Geoffrey

    2015-01-01

    The 'Linear no-threshold' (LNT) model predicts that any amount of radiation increases the risk of organisms to accumulate negative effects. Several studies at below background radiation levels (4.5-11.4 nGy h(-1)) show decreased growth rates and an increased susceptibility to oxidative stress. The purpose of our study is to obtain molecular evidence of a stress response in Shewanella oneidensis and Deinococcus radiodurans grown at a gamma dose rate of 0.16 nGy h(-1), about 400 times less than normal background radiation. Bacteria cultures were grown at a dose rate of 0.16 or 71.3 nGy h(-1) gamma irradiation. Total RNA was extracted from samples at early-exponential and stationary phases for the rt-PCR relative quantification (radiation-deprived treatment/background radiation control) of the stress-related genes katB (catalase), recA (recombinase), oxyR (oxidative stress transcriptional regulator), lexA (SOS regulon transcriptional repressor), dnaK (heat shock protein 70) and SOA0154 (putative heavy metal efflux pump). Deprivation of normal levels of radiation caused a reduction in growth of both bacterial species, accompanied by the upregulation of katB, recA, SOA0154 genes in S. oneidensis and the upregulation of dnaK in D. radiodurans. When cells were returned to background radiation levels, growth rates recovered and the stress response dissipated. Our results indicate that below-background levels of radiation inhibited growth and elicited a stress response in two species of bacteria, contrary to the LNT model prediction.

  7. Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

    Directory of Open Access Journals (Sweden)

    Xiangrong Dong

    Full Text Available PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

  8. Expression of PprI from Deinococcus radiodurans Improves Lactic Acid Production and Stress Tolerance in Lactococcus lactis.

    Science.gov (United States)

    Dong, Xiangrong; Tian, Bing; Dai, Shang; Li, Tao; Guo, Linna; Tan, Zhongfang; Jiao, Zhen; Jin, Qingsheng; Wang, Yanping; Hua, Yuejin

    2015-01-01

    PprI is a general switch protein that regulates the expression of certain proteins involved in pathways of cellular resistance in the extremophilic bacterium Deinococcus radiodurans. In this study, we transformed pprI into Lactococcus lactis strain MG1363 using the lactococcal shuttle vector pMG36e and investigated its effects on the tolerance and lactic acid production of L. lactis while under stress. PprI was stably expressed in L. lactis as confirmed by western blot assays. L. lactis expressing PprI exhibited significantly improved resistance to oxidative stress and high osmotic pressure. This enhanced cellular tolerance to stressors might be due to the regulation of resistance-related genes (e.g., recA, recO, sodA, and nah) by pprI. Moreover, transformed L. lactis demonstrated increased lactic acid production, attributed to enhanced lactate dehydrogenase activity. These results suggest that pprI can improve the tolerance of L. lactis to environmental stresses, and this transformed bacterial strain is a promising candidate for industrial applications of lactic acid production.

  9. Comparison of radiation-induced proteins in two revertants with those in a radiation sensitive mutant of Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Hu Qian; Tanaka, Atsushi; Kobayashi, Yasuhiko; Nozawa, Ranko; Watanabe, Hiroshi.

    1992-01-01

    In order to search proteins responsible for DNA repair, the intracellular proteins in gamma-irradiated cells of D.radiodurans R1 and its three mutants were analyzed by means of two-dimensional gel electrophoresis. Two new proteins, P35 (M.W. 35 kDa) and P92 (M.W. 92 kDa), were found in the cells of the radioresistant revertant (KH8401-1-5) and D.radiodurans R1. However, only P92 was detected in the moderately radioresistant revertant (KH8401-10-7). Both proteins were not detected in the cells of the radiosensitive mutant (KH8401). On the other hand, one protein, P25 (M.W. 25 kDa), which was detected either before or after gamma-irradiation, was only found in KH8401-10-7. These results suggest that these special induced proteins, P35 and P92, might be directly responsible for radiation resistance. The analyses of similar proteins in the cells of E.coli B/r and Deinobactor grandis KS0460 were also carried out. (author)

  10. Final Report for Grant No. DE-FG02-97ER62492 ''Engineering Deinococcus radiodurans for Metal Remediation in Radioactive Mixed Waste Sites''

    International Nuclear Information System (INIS)

    Michael J.; Daly, Ph.D.

    2005-01-01

    The groundwater and sediments of numerous U. S. Department of Energy (DOE) field sites are contaminated with mixtures of heavy metals (e.g., Hg, Cr, Pd) and radionuclides (e.g., U, Tc), as well as the fuel hydrocarbons benzene, toluene, ethylbenzene and xylenes (BTEX); chlorinated hydrocarbons, such as trichloroethylene (TCE); and polychlorinated biphenyls (PCBs). The remediation of such mixed wastes constitutes an immediate and complex waste management challenge for DOE, particularly in light of the costliness and limited efficacy of current physical and chemical strategies for treating mixed wastes. In situ bioremediation via natural microbial processes (e.g., metal reduction) remains a potent, potentially cost-effective approach to the reductive immobilization or detoxification of environmental contaminants. Seventy million cubic meters of soil and three trillion liters of groundwater have been contaminated by leaking radioactive waste generated in the United States during the Cold War. A cleanup technology is being developed based on the extremely radiation resistant bacterium Deinococcus radiodurans. Our recent isolation and characterization of D. radiodurans from a variety of DOE environments, including highly radioactive sediments beneath one of the leaking tanks (SX-108) at the Hanford Site in south-central Washington state, underscores the potential for this species to survive in such extreme environments. Research aimed at developing D. radiodurans for metal remediation in radioactive waste sites was started by this group in September 1997 with support from DOE NABIR grant DE-FG02-97ER62492. Our grant was renewed for the period 2000-2003, which includes work on the thermophilic radiation resistant bacterium Deinococcus geothermalis. Work funded by the existing grant contributed to 18 papers in the period 1997-2004 on the fundamental biology of D. radiodurans and its design for bioremediation of radioactive waste environments. Our progress since September

  11. Regulation of MntH by a dual Mn(II- and Fe(II-dependent transcriptional repressor (DR2539 in Deinococcus radiodurans.

    Directory of Open Access Journals (Sweden)

    Hongxing Sun

    Full Text Available The high intracellular Mn/Fe ratio observed within the bacteria Deinococcus radiodurans may contribute to its remarkable resistance to environmental stresses. We isolated DR2539, a novel regulator of intracellular Mn/Fe homeostasis in D. radiodurans. Electrophoretic gel mobility shift assays (EMSAs revealed that DR2539 binds specifically to the promoter of the manganese acquisition transporter (MntH gene, and that DR0865, the only Fur homologue in D. radiodurans, cannot bind to the promoter of mntH, but it can bind to the promoter of another manganese acquisition transporter, MntABC. β-galactosidase expression analysis indicated that DR2539 acts as a manganese- and iron-dependent transcriptional repressor. Further sequence alignment analysis revealed that DR2539 has evolved some special characteristics. Site-directed mutagenesis suggested that His98 plays an important role in the activities of DR2539, and further protein-DNA binding activity assays showed that the activity of H98Y mutants decreased dramatically relative to wild type DR2539. Our study suggests that D. radiodurans has evolved a very efficient manganese regulation mechanism that involves its high intracellular Mn/Fe ratio and permits resistance to extreme conditions.

  12. THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

    International Nuclear Information System (INIS)

    Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

    2004-01-01

    Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

  13. THE ROLE OF IRON IN Deinococcus radiodurans ENGINEERED FOR GROWTH ON TOLUENE AND THE ROLE OF MANGANESE IN THE EXTREME RADIATION RESISTANCE PHENOTYPE

    Energy Technology Data Exchange (ETDEWEB)

    Hassan Brim; Elena K. Gaidamakova; Vera Y. Matrosova; Min Zhai; Amudhan Venkateswaran; Marina Omelchenko; Kira S. Makarova; Lawrence P. Wackett; James K. Fredrickson; Michael J. Daly

    2004-03-17

    Toluene and other fuel hydrocarbons are commonly found in association with radionuclides at numerous Department of Energy (DOE) sites, frequently occurring together with Cr(VI) and other heavy metals. In this study, the extremely radiation resistant bacterium Deinococcus radiodurans was engineered for complete toluene mineralization by cloned expression of tod and xyl genes of Pseudomonas putida. The recombinant Tod/Xyl strain showed significant incorporation of carbon from the toluene aromatic ring into cellular macromolecules and carbon dioxide, in the absence or presence of chronic radiation. We have shown that intracellular iron concentrations in wild-type D. radiodurans in minimal medium are exceptionally low and not sufficient to support growth on toluene using Fe-dependent oxygenases cloned from P. putida. Introducing the fur mutation into D. radiodurans increased intracellular Fe levels, and imparted on the engineered strain the ability to grow on meta-toluate as the sole carbon and energy source. The organism's native Cr(VI) reduction capabilities were facilitated by toluene when present as the sole carbon and energy source in natural sediment analogues of DOE contaminated environments. The engineered bacteria were able to oxidize toluene under both minimal and complex nutrient conditions, which is important since both conditions have environmental equivalents in the context of bioremediation processes. As such, the Tod/Xyl strain is providing a model for understanding the role of Fe and reduction of metals coupled to organic contaminant oxidation in aerobic radionuclide contaminated sediments. We have shown that D. radiodurans contains high intracellular manganese levels, and that Mn restriction sensitizes cells to irradiation. We propose that the unusually high Mn/Fe ratio of D. radiodurans facilitates survival by quenching oxidative stress during recovery.

  14. PprM is necessary for up-regulation of katE1, encoding the major catalase of Deinococcus radiodurans, under unstressed culture conditions.

    Science.gov (United States)

    Jeong, Sun-Wook; Seo, Ho Seong; Kim, Min-Kyu; Choi, Jong-Il; Lim, Heon-Man; Lim, Sangyong

    2016-06-01

    Deinococcus radiodurans is a poly-extremophilic organism, capable of tolerating a wide variety of different stresses, such as gamma/ultraviolet radiation, desiccation, and oxidative stress. PprM, a cold shock protein homolog, is involved in the radiation resistance of D. radiodurans, but its role in the oxidative stress response has not been investigated. In this study, we investigated the effect of pprM mutation on catalase gene expression. pprM disruption decreased the mRNA and protein levels of KatE1, which is the major catalase in D. radiodurans, under normal culture conditions. A pprM mutant strain (pprM MT) exhibited decreased catalase activity, and its resistance to hydrogen peroxide (H2O2) decreased accordingly compared with that of the wild-type strain. We confirmed that RecG helicase negatively regulates katE1 under normal culture conditions. Among katE1 transcriptional regulators, the positive regulator drRRA was not altered in pprM (-), while the negative regulators perR, dtxR, and recG were activated more than 2.5-fold in pprM MT. These findings suggest that PprM is necessary for KatE1 production under normal culture conditions by down-regulation of katE1 negative regulators.

  15. Engineering Deinococcus geothermailis for Bioremediation of High-Temperature Radioactive Waste Environments

    International Nuclear Information System (INIS)

    Brim, Hassan; Venkateswaran, Amudhan; Kostandarithes, Heather M.; Fredrickson, Jim K.; Daly, Michael J.

    2003-01-01

    Deinococcus geothermalis is an extremely radiation-resistant thermophilic bacterium closely related to the mesophile Deinococcus radiodurans, which is being engineered for in situ bioremediation of radioactive wastes

  16. Comparative analyses reveal different consequences of two oxidative stress inducers, gamma irradiation and potassium tellurite, in the extremophile Deinococcus radiodurans

    International Nuclear Information System (INIS)

    Narasimha, Anaganti; Basu, Bhakti; Apte, Shree Kumar

    2014-01-01

    Proteomic and mass spectrometric analyses revealed differential responses of D. radiodurans to two oxidative stressors. While both elicited oxidative stress alleviation response, major divergence was observed at the level of DNA repair, metabolic pathways and protein homeostasis. Response to gamma irradiation was focused on DNA repair and ROS scavenging but supported metabolism as well as protein homeostasis. Tellurite, induced oxidative stress alleviation but decreased reducing affected and adversely affected metabolism and protein homeostasis

  17. Isolation and properties of strains of Micrococcus (Deinococcus) radiodurans unable to excise ultraviolet light-induced pyrimidine dimers from DNA: evidence for two excision pathways

    International Nuclear Information System (INIS)

    Moseley, B.E.B.; Evans, D.M.

    1983-01-01

    A mutant of Deinococcus (formerly Micrococcus) radiodurans sensitive to both the lethal effect of mitomycin C and the mutagenic effect of simple alkylating agents, but having wild-type resistance to UV light, was treated with the mutagen N-methyl-N'-nitro-N-nitrosoguanidine. Three strains were isolated that were UV-sensitive, but had wild-type resistance to the lethal effect of methyl methanesulphonate and all were shown to be unable to excise pyrimidine dimers. The three strains UVS9, UVS25 and UVS78 had, in addition to the mutation in mtcA, mutations in loci designated uvsC, uvsD and uvsE, respectively. When the mutant mtcA gene was replaced by its wild-type allele in all three strains they became UV- and mitomycin C-resistant. On incubating the double mutants UVS9, UVS25 and UVS78 with wild-type DNA about 50% of the transformants selected for UV resistance were mitomycin C-sensitive and about 50% resistant depending on whether the mutant mtcA or the uvsC, D or E genes had been replaced by their wild-type alleles. Although strains mutant singly in uvsC, D or E were UV-resistant the rates of excision of pyrimidine dimers differed between them and was slower in all of them than in the wild-type and strain 302. (author)

  18. Inhibition of peptide bond formation by pleuromutilins: the structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin.

    Science.gov (United States)

    Schlünzen, Frank; Pyetan, Erez; Fucini, Paola; Yonath, Ada; Harms, Jörg M

    2004-12-01

    Tiamulin, a prominent member of the pleuromutilin class of antibiotics, is a potent inhibitor of protein synthesis in bacteria. Up to now the effect of pleuromutilins on the ribosome has not been determined on a molecular level. The 3.5 A structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin provides for the first time a detailed picture of its interactions with the 23S rRNA, thus explaining the molecular mechanism of the antimicrobial activity of the pleuromutilin class of antibiotics. Our results show that tiamulin is located within the peptidyl transferase center (PTC) of the 50S ribosomal subunit with its tricyclic mutilin core positioned in a tight pocket at the A-tRNA binding site. Also, the extension, which protrudes from its mutilin core, partially overlaps with the P-tRNA binding site. Thereby, tiamulin directly inhibits peptide bond formation. Comparison of the tiamulin binding site with other PTC targeting drugs, like chloramphenicol, clindamycin and streptogramins, may facilitate the design of modified or hybridized drugs that extend the applicability of this class of antibiotics.

  19. Design and construction of deinococcus radiodurans for biodegradation of organic toxins at radioactive DOE waste sites. 1998 annual progress report

    International Nuclear Information System (INIS)

    Daly, M.J.; Minton, K.W.; Wackett, L.P.

    1998-01-01

    'A 1992 survey of DOE waste sites indicates that about 32% of soils and 45% of groundwaters at these sites contain radionuclides and metals plus an organic toxin class. The most commonly reported combinations of these hazardous compounds being radionuclides and metals (e.g., U, Pu, Cs, Pb, Cr, As) plus chlorinated hydrocarbons (e.g., trichloroethylene), fuel hydrocarbons (e.g., toluene), or polychlorinated biphenyls (e.g., Arochlor 1248). These wastes are some of the most hazardous pollutants and pose an increasing risk to human health as they leach into the environment. The objective of this research is to develop novel organisms, that are highly resistant to radiation and the toxic effects of metals and radionuclides, for in-situ bioremediation of organic toxins. Few organisms exist that are able to remediate such environmental organic pollutants, and among those that can, the bacteria belonging to the genus Pseudomonas are the most characterized. Unfortunately, these bacteria are very radiation sensitive. For example, Pseudomonas spp. is even more sensitive than Escherichia coli and, thus, is not suitable as a bioremediation host in environments subjected to radiation. By contrast, D. radiodurans, a natural soil bacterium, is the most radiation resistant organism yet discovered; it is several thousand times more resistant to ionizing radiation than Pseudomonas. The sophisticated gene transfer and expression systems the authors have developed for D. radiodurans over the last eight years make this organism an ideal candidate for high-level expression of genes that degrade organic toxins, in radioactive environments. The authors ultimate aim is to develop organisms and approaches that will be useful for remediating the large variety of toxic organic compounds found in DOE waste sites that are too radioactive to support other bioremediation organisms. This report summarizes work after the first 6 months of a 3-year project.'

  20. Expression and purification of PprI protein from D.radiodurans R1 in escherichia coli

    International Nuclear Information System (INIS)

    Zhang Yongqin; Zhou Hui; Chen Jie; Yang Zhanshan

    2011-01-01

    In order to express and purify PprI protein from D.radiodurans R1 in E. coli, the full length of pprI gene was gained by PCR amplification using pCMV-HA-pprI as a template. The gene segment was inserted into vector pET-28a after digested by two restriction endonucleases Nco I and EcoR I. Then the recombinant vector pET-28a-His-pprI was transfected into E. coli BL21(DE3) RP. The PprI protein expression was induced by IPTG and the fusion protein was confirmed by SDS-PAGE and Western blotting. The expressive conditions of the protein such as E. coli' A 600 , concentration of IPTG, time and temperature of culture, were optimized. Finally the fusion protein was purified by Ni-NTA His Bind Resins and molecule boult. The experimental results show the fusion protein confirmed by Western blotting is 6 x His-PprI and its molecular weight is 37 kDa. The ladders of PprI protein at molecular weight 37 kDa were different due to difference of the PprI protein expression conditions if E. coli. The PprI protein exists both in supernatant and precipitation. The concentration of purified protein is about 0.15 mg/mL which was measured by BCA method. It is concluded that the recombinant plasmid pET-28a-His-pprI is constructed and the PprI fusion protein is expressed and purified. The results lay a solid foundation for studying the radio-resistance and immunity of PprI protein. (authors)

  1. Single Strand Annealing Plays a Major Role in RecA-Independent Recombination between Repeated Sequences in the Radioresistant Deinococcus radiodurans Bacterium.

    Directory of Open Access Journals (Sweden)

    Solenne Ithurbide

    2015-10-01

    Full Text Available The bacterium Deinococcus radiodurans is one of the most radioresistant organisms known. It is able to reconstruct a functional genome from hundreds of radiation-induced chromosomal fragments. Our work aims to highlight the genes involved in recombination between 438 bp direct repeats separated by intervening sequences of various lengths ranging from 1,479 bp to 10,500 bp to restore a functional tetA gene in the presence or absence of radiation-induced DNA double strand breaks. The frequency of spontaneous deletion events between the chromosomal direct repeats were the same in recA+ and in ΔrecA, ΔrecF, and ΔrecO bacteria, whereas recombination between chromosomal and plasmid DNA was shown to be strictly dependent on the RecA and RecF proteins. The presence of mutations in one of the repeated sequence reduced, in a MutS-dependent manner, the frequency of the deletion events. The distance between the repeats did not influence the frequencies of deletion events in recA+ as well in ΔrecA bacteria. The absence of the UvrD protein stimulated the recombination between the direct repeats whereas the absence of the DdrB protein, previously shown to be involved in DNA double strand break repair through a single strand annealing (SSA pathway, strongly reduces the frequency of RecA- (and RecO- independent deletions events. The absence of the DdrB protein also increased the lethal sectoring of cells devoid of RecA or RecO protein. γ-irradiation of recA+ cells increased about 10-fold the frequencies of the deletion events, but at a lesser extend in cells devoid of the DdrB protein. Altogether, our results suggest a major role of single strand annealing in DNA repeat deletion events in bacteria devoid of the RecA protein, and also in recA+ bacteria exposed to ionizing radiation.

  2. Intrinsically disordered regions may lower the hydration free energy in proteins: a case study of nudix hydrolase in the bacterium Deinococcus radiodurans.

    Directory of Open Access Journals (Sweden)

    Omar Awile

    Full Text Available The proteome of the radiation- and desiccation-resistant bacterium D. radiodurans features a group of proteins that contain significant intrinsically disordered regions that are not present in non-extremophile homologues. Interestingly, this group includes a number of housekeeping and repair proteins such as DNA polymerase III, nudix hydrolase and rotamase. Here, we focus on a member of the nudix hydrolase family from D. radiodurans possessing low-complexity N- and C-terminal tails, which exhibit sequence signatures of intrinsic disorder and have unknown function. The enzyme catalyzes the hydrolysis of oxidatively damaged and mutagenic nucleotides, and it is thought to play an important role in D. radiodurans during the recovery phase after exposure to ionizing radiation or desiccation. We use molecular dynamics simulations to study the dynamics of the protein, and study its hydration free energy using the GB/SA formalism. We show that the presence of disordered tails significantly decreases the hydration free energy of the whole protein. We hypothesize that the tails increase the chances of the protein to be located in the remaining water patches in the desiccated cell, where it is protected from the desiccation effects and can function normally. We extrapolate this to other intrinsically disordered regions in proteins, and propose a novel function for them: intrinsically disordered regions increase the "surface-properties" of the folded domains they are attached to, making them on the whole more hydrophilic and potentially influencing, in this way, their localization and cellular activity.

  3. Deinococcus geothermalis: The Pool of Extreme Radiation Resistance Genes Shrinks

    Energy Technology Data Exchange (ETDEWEB)

    Makarova, Kira S.; Omelchenko, Marina V.; Gaidamakova, Elena K.; Matrosova, Vera Y.; Vasilenko, Alexander; Zhai, Min; Lapidus, Alla; Copeland, Alex; Kim, Edwin; Land, Miriam; Mavrommatis, Konstantinos; Pitluck, Samuel; Richardson, Paul M.; Detter, Chris; Brettin, Thomas; Saunders, Elizabeth; Lai, Barry; Ravel, Bruce; Kemner, Kenneth M.; Wolf, Yuri I.; Sorokin, Alexander; Gerasimova, Anna V.; Gelfand, Mikhail S.; Fredrickson, James K.; Koonin, Eugene V.; Daly, Michael J.

    2007-07-24

    Bacteria of the genus Deinococcus are extremely resistant to ionizing radiation (IR), ultraviolet light (UV) and desiccation. The mesophile Deinococcus radiodurans was the first member of this group whose genome was completely sequenced. Analysis of the genome sequence of D. radiodurans, however, failed to identify unique DNA repair systems. To further delineate the genes underlying the resistance phenotypes, we report the whole-genome sequence of a second Deinococcus species, the thermophile Deinococcus geothermalis, which at itsoptimal growth temperature is as resistant to IR, UV and desiccation as D. radiodurans, and a comparative analysis of the two Deinococcus genomes. Many D. radiodurans genes previously implicated in resistance, but for which no sensitive phenotype was observed upon disruption, are absent in D. geothermalis. In contrast, most D. radiodurans genes whose mutants displayed a radiation-sensitive phenotype in D. radiodurans are conserved in D. geothermalis. Supporting the existence of a Deinococcus radiation response regulon, a common palindromic DNA motif was identified in a conserved set of genes associated with resistance, and a dedicated transcriptional regulator was predicted. We present the case that these two species evolved essentially the same diverse set of gene families, and that the extreme stress-resistance phenotypes of the Deinococcus lineage emerged progressively by amassing cell-cleaning systems from different sources, but not by acquisition of novel DNA repair systems. Our reconstruction of the genomic evolution of the Deinococcus-Thermus phylum indicates that the corresponding set of enzymes proliferated mainly in the common ancestor of Deinococcus. Results of the comparative analysis weaken the arguments for a role of higher-order chromosome alignment structures in resistance; more clearly define and substantially revise downward the number of uncharacterized genes that might participate in DNA repair and contribute to

  4. Deinococcus antarcticus sp. nov., isolated from soil.

    Science.gov (United States)

    Dong, Ning; Li, Hui-Rong; Yuan, Meng; Zhang, Xiao-Hua; Yu, Yong

    2015-02-01

    A pink-pigmented, non-motile, coccoid bacterial strain, designated G3-6-20(T), was isolated from a soil sample collected in the Grove Mountains, East Antarctica. This strain was resistant to UV irradiation (810 J m(-2)) and slightly more sensitive to desiccation as compared with Deinococcus radiodurans. Phylogenetic analyses based on the 16S rRNA gene sequence of the isolate indicated that the organism belongs to the genus Deinococcus. Highest sequence similarities were with Deinococcus ficus CC-FR2-10(T) (93.5 %), Deinococcus xinjiangensis X-82(T) (92.8 %), Deinococcus indicus Wt/1a(T) (92.5 %), Deinococcus daejeonensis MJ27(T) (92.3 %), Deinococcus wulumuqiensis R-12(T) (92.3 %), Deinococcus aquaticus PB314(T) (92.2 %) and Deinococcus radiodurans DSM 20539(T) (92.2 %). Major fatty acids were C18 : 1ω7c, summed feature 3 (C16 : 1ω7c and/or C16 : 1ω6c), anteiso-C15 : 0 and C16 : 0. The G+C content of the genomic DNA of strain G3-6-20(T) was 63.1 mol%. Menaquinone 8 (MK-8) was the predominant respiratory quinone. Based on its phylogenetic position, and chemotaxonomic and phenotypic characteristics, strain G3-6-20(T) represents a novel species of the genus Deinococcus, for which the name Deinococcus antarcticus sp. nov. is proposed. The type strain is G3-6-20(T) ( = DSM 27864(T) = CCTCC AB 2013263(T)). © 2015 IUMS.

  5. Topoisomerase IB of Deinococcus radiodurans resolves guanine ...

    Indian Academy of Sciences (India)

    2015-11-28

    Nov 28, 2015 ... All the oligonucleotides men- tioned here were ... further reactions with DraTopoIB were carried out at 37°C ... of G4 DNA moves faster than unfolded and intermolecular .... for its action on intramolecular G4 DNA structure was.

  6. RNA-Seq analysis of D. radiodurans find non coding RNAs expressed in response to radiation stress

    International Nuclear Information System (INIS)

    Gadewal, Nikhil; Mukhopadhyaya, Rita

    2015-01-01

    In bacteria discovery of functional RNA molecules that are not translated into protein, noncoding RNAs, became possible with advent of Next Generation Sequencing technology. Bacterial non coding RNAs are typically 50-300 nucleotides long and work as internal signals controlling various levels of gene expression. Deep sequencing of total cellular RNA captures all coding and noncoding transcripts with their differential levels of expression in the transcriptome. It provides a powerful approach to study bacterial gene expression and mechanisms of gene regulation. We subjected the 3 h transcriptome of Deinococcus radiodurans R1 cells post exposure to 6 KGy gamma radiation to 100 x 2 cycles of deep sequencing on the Illumina HiSeq 2000 to look for ncRNA transcripts. Bioinformatics pipeline for analysis and interpretation of RNA Seq data was done in house using Softwares available in public domains. Our sequence data aligned with 21 putative ncRNAs expressed in the intergenic regions of annotated genome of D radiodurans. Verification of 2 ncRNA candidates and 3 transcription factor genes by Real Time PCR confirmed presence of these transcripts in the 3 h transcriptome sequenced by us. Any relationship between ncRNAs and control of radiation induced gene expression in D radiodurans can be proved only after specific gene knock outs in future. (author)

  7. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Daly, Michael J.

    2007-07-23

    Progress is briefly summarized in these areas: ionizing radiation resistance in bacteria; a hypothesis regarding ionizing radiation resistance emerging for bacterial cells; transcriptome analysis of irradiated D. radiodurans and Shewanella oneidensis; the role of metal reduction in Mn-dependnet Deinococcal species; and engineered Deinococcus strains as models for bioremediation. Key findings are also reported regarding protein oxidation as a possible key to bacterial desiccation resistance, and the whole-genome sequence of the thermophile Deinococcus geothermalis.

  8. Deinococcus frigens sp. nov., Deinococcus saxicola sp. nov., and Deinococcus marmoris sp. nov., low temperature and draught-tolerating, UV-resistant bacteria from continental Antarctica.

    Science.gov (United States)

    Hirsch, Peter; Gallikowski, Claudia A; Siebert, Jörg; Peissl, Klaus; Kroppenstedt, Reiner; Schumann, Peter; Stackebrandt, Erko; Anderson, Robert

    2004-11-01

    Six Gram-positive, non-motile, UV- and draught-tolerant bacteria were isolated from antarctic soil and rock samples. The pink to orange cocci grew well on oligotrophic medium PYGV (pH 7.5) at 9-18 degrees C. They tolerated 0-10% NaCl, were aerobic to facultatively anaerobic and contained ornithine in their cell wall (type A3beta, Orn-Gly2). The lipid profiles of four strains were found to be typical for those of D. radiodurans. Major fatty acids were 16:1cis9, 15:1cis9, 17:1cis9 and i17:1cis9, the respiratory quinone of three strains was MK-8. Comparative 16S rDNA gene sequencing revealed phylogenetic relationships to the Deinococcus clade, especially to D. radiopugnans. The levels of 16S rRNA gene sequence similarity and DNA-DNA hybridisation data showed the six isolates represented new taxa. Phenotypic properties supported the description of three new species which were different from the eight known Deinococcus species and particularly from D. radiopugnans. Soil isolate AA-692T (DSM 12807T) is the type strain of Deinococcus frigens sp. nov., with AA-752 (DSM 15993) and AA-829 (DSM 15994) as additional strains from soil. The endolithic isolate AA-1444T, Deinococcus saxicola sp. nov., (DSM 15974T) came from antarctic sandstone, and Deinococcus marmoris sp. nov. (isolate AA-63T [DSM 12784T]) as well as AA-69 (DSM 15951) were isolated from antarctic marble.

  9. Small-Molecule Antioxidant Proteome-Shields in Deinococcus Radiodurans

    Science.gov (United States)

    2010-09-01

    family of proteases [14] which appear to be activated by irradiation (Figure 4B). At least 10 complete open reading frames with considerable sequence...the experiments: MJD EKG VYM JGK RF DYL NBW GAV BSB RLL. Performed the experiments: MJD EKG VYM JGK RF DYL NBW GAV BSB RLL. Analyzed the data: MJD... EKG VYM JGK RF DYL NBW GAV BSB RLL. Wrote the paper: MJD RLL. References 1. Daly MJ, Gaidamakova EK, Matrosova VY, Vasilenko A, Zhai M, et al. (2007

  10. A New Perspective on Radiation Resistance Based on Deinococcus radiodurans

    Science.gov (United States)

    2009-03-01

    tolerate 3,000–5000 Gy, but are rendered sterile. As a haploid, the basidiomycete fungus Ustilago maydis carries a single set of chromosomes per...salinarum NRC-1. Environ. Microbiol. 5 Jan 2009 (doi:10.1111/j.1462-2920.2008.01828.x). 21. Chan, H. L. et al. Proteomic analysis of UVC irradiation

  11. Comparative proteomics reveals key proteins recruited at the nucleoid of Deinococcus after irradiation-induced DNA damage

    International Nuclear Information System (INIS)

    Bouthier de la Tour, Claire; Passot, Fanny Marie; Toueille, Magali; Servant, Pascale; Sommer, Suzanne; Mirabella, Boris; Blanchard, Laurence; Groot, Arjan de; Guerin, Philippe; Armengaud, Jean

    2013-01-01

    The nucleoids of radiation-resistant Deinococcus species show a high degree of compaction maintained after ionizing irradiation. We identified proteins recruited after irradiation in nucleoids of Deinococcus radiodurans and Deinococcus deserti by means of comparative proteomics. Proteins in nucleoid-enriched fractions from unirradiated and irradiated Deinococcus were identified and semi quantified by shotgun proteomics. The ssDNA-binding protein SSB, DNA gyrase subunits GyrA and GyrB, DNA topoisomerase I, RecA recombinase, UvrA excinuclease, RecQ helicase, DdrA, DdrB, and DdrD proteins were found in significantly higher amounts in irradiated nucleoids of both Deinococcus species. We observed, by immunofluorescence microscopy, the subcellular localization of these proteins in D. radiodurans, showing for the first time the recruitment of the DdrD protein into the D. radiodurans nucleoid. We specifically followed the kinetics of recruitment of RecA, DdrA, and DdrD to the nucleoid after irradiation. Remarkably, RecA proteins formed irregular filament-like structures 1 h after irradiation, before being redistributed throughout the cells by 3 h post-irradiation. Comparable dynamics of DdrD localization were observed, suggesting a possible functional interaction between RecA and DdrD. Several proteins involved in nucleotide synthesis were also seen in higher quantities in the nucleoids of irradiated cells, indicative of the existence of a mechanism for orchestrating the presence of proteins involved in DNA metabolism in nucleoids in response to massive DNA damage. All MS data have been deposited in the ProteomeXchange with identifier PXD00196. (authors)

  12. Proteomics of post-irradiation recovery in D. radiodurans

    International Nuclear Information System (INIS)

    Basu, Bhakti; Apte, Shree Kumar

    2012-01-01

    An extremophile Deinococcus radiodurans is bestowed with an extraordinary DNA repair ability that renders it virtually resistant to all known forms of DNA damage caused by ionizing radiations (10 kGy of gamma rays), UV (1 kJ/m 2 ) or weeks of desiccation etc. The genome of D. radiodurans encodes a unique combination of DNA repair pathways such as prokaryotic type RecFOR mediated homologous recombination (HR) and nucleotide/base excision repair along with eukaryotic type strand annealing (SA) and non-homologous end joining (NHEJ), but is devoid of universal prokaryotic DNA repair pathways such as RecBCD mediated HR, photo-reactivation and SOS response. Collective evidence obtained so far from multiple approaches, have indicated (i) that all genes essential for DNA repair are not necessarily induced following radiation stress (ii) early RecA independent DNA assembly occurs, and (iii) absolute necessity of RecA dependent HR for final genome restitution. The 6 kGy gamma irradiation inducible proteome dynamics were mapped during the post-irradiation growth arrest phase by 2D protein electrophoresis coupled with mass spectrometry. Radiation inducible expression of at least 33 proteins was evident in the first 1h of post irradiation recovery

  13. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available | ... protease I [Deinococcus radiodurans R1] ... Length = 173 ... Query: 10 ... KKIAILAADGVEEIELTSP...RAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS 69 ... KKIAILAADGVEEIELTSPRAAIEA...AGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS Sbjct: 1 ... KKIAILAADGVEEIELTSPRAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVS

  14. Antibiotic Sensitivity of Micrococcus radiodurans

    Science.gov (United States)

    Hawiger, J.; Jeljaszewicz, J.

    1967-01-01

    A wild-type strain of Micrococcus radiodurans and its nonpigmented mutant W1 were tested for sensitivity to 10 antibiotics selected from the standpoint of their mechanism of action. Representatives of groups of antibiotics inhibiting deoxyribonucleic acid (DNA) synthesis, DNA-dependent ribonucleic acid synthesis, protein synthesis, and cell wall synthesis were selected. M. radiodurans and its mutant exhibited full susceptibility to all antibiotics tested (mitomycin C, actinomycin D, chloramphenicol, dihydrostreptomycin, erythromycin, neomycin, kanamycin, benzylpenicillin, bacitracin, and vancomycin), the degree of susceptibility being of the same order as that of a standard strain of Staphylococcus aureus 209 P, with the exception of dihydrostreptomycin. PMID:4166078

  15. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    International Nuclear Information System (INIS)

    Daly, Michael J.

    2006-01-01

    Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR

  16. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    International Nuclear Information System (INIS)

    Fredrickson, Jim K.; Daly, Michael J.

    2006-01-01

    Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus and Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella and Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf)

  17. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Fredrickson, Jim K.; Daly, Michael J.

    2006-06-01

    Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR), desiccation, and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR (http://cfyn.ifas.ufl.edu/radiation.pdf).

  18. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Daly, Michael J.

    2006-05-01

    Ionizing Radiation (IR) Resistance in Bacteria. Until recently, there have been no clear physiologic predictors of a cell's ability to recover from ionizing radiation (IR) and other DOE-relevant oxidative stress conditions. In general, the most resistant bacteria have been Gram-positive (e.g., Deinococcus, Arthrobacter, Lactobacillus & Enterococcus spp.) and the most sensitive have been Gram-negative (e.g., Pseudomonas, Shewanella & Neisseria spp.). However, there are several reported exceptions to this paradigm, the Gram-negative cyanobacterium Chroococcidiopsis is extremely resistant to IR, whereas the Gram-positive Micrococcus luteus is sensitive. We have identified biomolecular signatures for radiation sensitivity and resistance which are independent of phylogeny, where very high and very low intracellular Mn/Fe concentration ratios correlated with very high and very low resistances, respectively; and restricting Mn(II) in the famously resistant Deinococcus radiodurans sensitized this eubacterium to IR.

  19. Inactivation of the Radiation-Resistant Spoilage Bacterium Micrococcus radiodurans

    Science.gov (United States)

    Duggan, D. E.; Anderson, A. W.; Elliker, P. R.

    1963-01-01

    A simplified technique permitting the pipetting of raw puréed meats for quantitative bacteriological study is described for use in determining survival of these non-sporing bacteria, which are exceptionally resistant to radiation. Survival curves, using gamma radiation as the sterilizing agent, were determined in raw beef with four strains of Micrococcus radiodurans. Survival curves of the R1 strain in other meat substrates showed that survival was significantly greater in raw beef and raw chicken than in raw fish or in cooked beef. Resistance was lowest in the buffer. Cells grown in broth (an artificial growth medium) and resuspended in beef did not differ in resistance from cells that had been grown and irradiated in beef. Survival rate was statistically independent of the initial cell concentration, even though there appeared to be a correlation between lower death rate and lower initial cell concentrations. The initial viable count of this culture of the domesticated R1 strain in beef was reduced by a factor of about 10-5 by 3.0 megarad, and 4.0 megarad reduced the initial count by a factor of more than 10-9. Data suggest that M. radiodurans R1 is more resistant to radiation than spore-forming spoilage bacteria for which inactivation rates have been published. PMID:14063780

  20. Study of resistance of D. radiodurans to the combined action of ionizing radiation with an electric or magnetic fields exogenous

    International Nuclear Information System (INIS)

    Prado, Georgia Reis

    2011-01-01

    The key goal in radiotherapy is to maximize damages in a tumor while minimizing them in nearby health tissues. Several strategies have been worked out toward the enhancement of cellular radiosensitivity, as the use of exogenous fields. It is studied in this work the resistance of Deinococcus radiodurans to the combined action of conventional and non conventional radiations, with external agents (electric and magnetic fields). D. radiodurans is a bacterium having an extraordinary ability to cope with lethal and mutagenic agents harmful to the DNA, particularly ionizing radiations as gammas and UV. Given its high radioresistance and fast growing, D. radiodurans has been used as solid tumors simulators. Peculiarities associated with radioresistance at the exponential and stationary phases were delineated from growing curves. By measuring survival curves information on radiosensitivity was obtained. In gamma irradiation D. radiodurans exhibited repairing shoulders of 2 and 8 kGy at the exponential and stationary phases, respectively. When gamma irradiations were combined with expositions to the electric field the repairing shoulders were reduced to 1 and 4 kGy at the exponential and stationary phases, respectively. Radioresistance was similar in both growing phases when the number of cells were approximately equalized in these two processes. On the other hand, when gamma irradiations were combined with expositions to the magnetic field the repairing shoulders were reduced to 4 and 6 kGy at the exponential and stationary phases, respectively. In irradiations with electron beams the repairing shoulder at the exponential phase was totally depleted, while at the stationary phase it was only 1 kGy. The findings of this work revealed new and important information on the radioresistance of D. radiodurans, while providing hints to the improvement of radiotherapy protocols in association with exogenous physical agents. (author)

  1. Identification and Characterization of uvrA, a DNA Repair Gene of Deinococcus radiodurans

    Science.gov (United States)

    1996-01-01

    alkylating agents , such as methyl-N-nitro~N~nitrosoguanidine(MNNG), N-methyl-N~ nitrosourea (MNU), and to a lesser extent methyl methanesulfonate (MMS...6,4) Photoproduct 17 c. Thymine Glycols and Cross-links 17 3. Ionizing Radiation Damage " 17 4. Chemical Damage 20 a. Alkylating Agents .20 b. Cross...Examples of base damage induced by ionizing radiation 19 6. Nucleotide centers in DNA that are most reactive to alkylating agents 21 7. Schematic

  2. DNA damage response in a radiation resistant bacterium Deinococcus radiodurans: a paradigm shift

    International Nuclear Information System (INIS)

    Misra, H.S.

    2015-01-01

    Deinococcusradiodurans is best known for its extraordinary resistance to gamma radiation with its D 10 12kGy, and several other DNA damaging agents including desiccation to less than 5% humidity and chemical xenotoxicants. An efficient DNA double strand break (DSB) repair and its ability to protect biomolecules from oxidative damage are a few mechanisms attributed to these phenotypes in this bacterium. Although it regulates its proteome and transcriptome in response to DNA damage for its growth and survival, it lacks LexA mediated classical SOS response mechanism. Since LexA mediated damages response mechanism is highly and perhaps only, characterized DNA damage response processes in prokaryotes, this bacterium keeps us guessing how it responds to extreme doses of DNA damage. Interestingly, this bacterium encodes a large number of eukaryotic type serine threonine/tyrosine protein kinases (eST/YPK), phosphatases and response regulators and roles of eST/YPKs in cellular response to DNA damage and cell cycle regulations are well established in eukaryotes. Here, we characterized an antioxidant and DNA damage inducible eST/YPK (RqkA) and established its role in extraordinary radioresistance and DSB repair in this bacterium. We identified native phosphoprotein substrates for this kinase and demonstrated the involvement of some of these proteins phosphorylation in the regulation of DSB repair and growth under radiation stress. Findings suggesting the possible existence of eST/YPK mediated DNA damage response mechanism as an alternate to classical SOS response in this prokaryote would be discussed. (author)

  3. Radiation and desiccation response motif mediates radiation induced gene expression in D. radiodurans

    International Nuclear Information System (INIS)

    Anaganti, Narasimha; Basu, Bhakti; Apte, Shree Kumar

    2015-01-01

    Deinococcus radiodurans is an extremophile that withstands lethal doses of several DNA damaging agents such as gamma irradiation, UV rays, desiccation and chemical mutagens. The organism responds to DNA damage by inducing expression of several DNA repair genes. At least 25 radiation inducible gene promoters harbour a 17 bp palindromic sequence known as radiation and desiccation response motif (RDRM) implicated in gamma radiation inducible gene expression. However, mechanistic details of gamma radiation-responsive up-regulation in gene expression remain enigmatic. The promoters of highly radiation induced genes ddrB (DR0070), gyrB (DR0906), gyrA (DR1913), a hypothetical gene (DR1143) and recA (DR2338) from D. radiodurans were cloned in a green fluorescence protein (GFP)-based promoter probe shuttle vector pKG and their promoter activity was assessed in both E. coli as well as in D. radiodurans. The gyrA, gyrB and DR1143 gene promoters were active in E. coli although ddrB and recA promoters showed very weak activity. In D. radiodurans, all the five promoters were induced several fold following 6 kGy gamma irradiation. Highest induction was observed for ddrB promoter (25 fold), followed by DR1143 promoter (15 fold). The induction in the activity of gyrB, gyrA and recA promoters was 5, 3 and 2 fold, respectively. To assess the role of RDRM, the 17 bp palindromic sequence was deleted from these promoters. The promoters devoid of RDRM sequence displayed increase in the basal expression activity, but the radiation-responsive induction in promoter activity was completely lost. The substitution of two conserved bases of RDRM sequence yielded decreased radiation induction of PDR0070 promoter. Deletion of 5 bases from 5'-end of PDR0070 RDRM increased basal promoter activity, but radiation induction was completely abolished. Replacement of RDRM with non specific sequence of PDR0070 resulted in loss of basal expression and radiation induction. The results demonstrate that

  4. The study of the extreme radiation tolerance mechanisms of the bacterium Deinococcus deserti by a functional genomics approach

    International Nuclear Information System (INIS)

    Dulermo, R.

    2009-12-01

    The genome of Deinococcus deserti, a highly radiation-tolerant bacterium, was analyzed and compared to those of D. radiodurans and D. geothermalis. About 230 proteins are specifically conserved in these 3 species, including IrrE, a regulator protein essential for radio tolerance. D.deserti has several supplementary DNA repair genes, like imuY and dnaE2 (trans-lesion DNA polymerases). Moreover, D. deserti has 3 recA that code for 2 different RecA proteins (RecAC et RecAP). To study these genes, genetic tools were developed for D. deserti. Different results suggest that IrrE, required for the induction of several genes after irradiation, has peptidase activity. The 2 RecA proteins are functional for DNA repair. D. deserti is mutable by UV, which requires ImuY, DnaE2 and RecAC, but not RecAP. (author)

  5. Extracellular proteolytic activity of Deinococcus geothermalis ...

    African Journals Online (AJOL)

    Nonionic detergents like Triton X-100 and Tween 80 did not affect catalytic properties. It suggested that the enzyme produced by D. geothermalis could be used as a component of detergents. Keywords: Deinococcus geothermalis, alkaline protease, detergents, thermostability. African Journal of Biotechnology Vol. 12(25) ...

  6. The mechanisms of Micrococcus radiodurans radioresistance

    International Nuclear Information System (INIS)

    Samojlenko, I.I.

    1983-01-01

    Modern representations on molecular mechanisms of Micrococcus radiodurans viability under the effect of ionizing radiation have been considered. Factors conditioning a high level of micrococcus cell radiostability have been analyzed: peculiarities of structure of a cell wall, DNA, membranes; excess of genetic information; multiplicity of DNA implantation points to a membrane; high level of antioxidation and antiradical systems. It has been shown that on efficiency of accurate, properly balanced system of DNA repair combined with above Micrococcus radiodurant properties provide a high microorganism radioresistance

  7. ORF Alignment: NC_001263 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001263 gi|15805432 >1bplA 2 169 309 525 3e-10 ... gb|AAF09983.1| alpha-dextran end...o-1,6-alpha-glucosidase [Deinococcus radiodurans] ... pir||D75524 alpha-dextran endo-1,6-alpha-glucos...idase - ... Deinococcus radiodurans (strain R1) ref|NP_294128.1| ... alpha-dextran endo-1,6-al

  8. The deoxyribonucleic acid of Micrococcus radiodurans

    Science.gov (United States)

    Schein, Arnold H.

    1966-01-01

    The DNA of Micrococcus radiodurans was prepared by three methods. Although the recovery of DNA varied considerably, the percentage molar base ratios of the DNA from the three preparations were essentially the same: guanine, 33±2; adenine, 18±1; cytosine, 33±2; thymine, 17±1. Base compositions calculated from Tm values and from density in caesium chloride gradients also yielded guanine+cytosine contents of 66 and 68% of total bases respectively. No unusual bases were observed. The S20,w values were characteristic of high-molecular-weight DNA. Electron microscopy showed the purified DNA in long strands; occasionally these were coiled. Images(a)(b)(c)(d)(e)Fig. 1. PMID:16742439

  9. Major soluble proteome changes in Deinococcus deserti over the earliest stages following gamma-ray irradiation

    International Nuclear Information System (INIS)

    Dedieu, Alain; Sahinovic, Elodie; Guerin, Philippe; Armengaud, Jean; Blanchard, Laurence; Fochesato, Sylvain; Groot, Arjan de; Meunier, Bruno

    2013-01-01

    Deinococcus deserti VCD115 has been isolated from Sahara surface sand. This radio-tolerant bacterium represents an experimental model of choice to understand adaptation to harsh conditions encountered in hot arid deserts. We analysed the soluble proteome dynamics in this environmentally relevant model after exposure to 3 kGy gamma radiation, a non-lethal dose that generates massive DNA damages. For this, cells were harvested at different time lapses after irradiation and their soluble proteome contents have been analysed by 2-DE and mass spectrometry. In the first stage of the time course we observed accumulation of DNA damage response protein DdrB (that shows the highest fold change ∼11), SSB, and two different RecA proteins (RecAP and RecAC). Induction of DNA repair protein PprA, DNA damage response protein DdrD and the two gyrase subunits (GyrA and GyrB) was also detected. A response regulator of the SarP family, a type II site-specific deoxyribonuclease and a putative N-acetyltransferase are three new proteins found to be induced. In a more delayed stage, we observed accumulation of several proteins related to central metabolism and protein turn-over, as well as helicase UvrD and novel forms of both gyrase subunits differing in terms of isoelectric point and molecular weight. Conclusions: Post-translational modifications of GyrA (N-terminal methionine removal and acetylation) have been evidenced and their significance discussed. We found that the Deide-02842 restriction enzyme, which is specifically found in D. deserti, is a new potential member of the radiation/desiccation response regulon, highlighting the specificities of D. deserti compared to the D. radiodurans model. (authors)

  10. Repair of double-strand breaks in Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Burrell, A.D.; Dean, C.J.

    1975-01-01

    Micrococcus radiodurans has been shown to sustain double-strand breaks in its DNA after exposure to x-radiation. Following sublethal doses of x-rays (200 krad in oxygen or less), the cells were able to repair these breaks, and an intermediate fast-sedimenting DNA component seemed to be involved in the repair process

  11. Effects of Deinococcus spp. supplement on egg quality traits in laying hens.

    Science.gov (United States)

    Li, I-Chen; Wu, Szu-Yin; Liou, Jenn-Fa; Liu, Hsiao-Hui; Chen, Jiau-Hua; Chen, Chin-Chu

    2018-01-01

    To counter the ill effects of synthetic dyes, bacterial pigment production as an alternative is now one of the promising and emerging fields of research. This study was conducted to evaluate the applicability of Deinococcus genus on the egg quality traits in laying hens. In study I, 24 single comb White Leghorn layers were fed with various 1 wt % Deinococcus bacterial strains for 10 d. In study II, 84 brown Hendrix layers were fed with one of 4 diets containing 0, 0.2, 1, or 5 wt % Deinococcus sp. GKB-Aid 1995 powder for 12 wk. In study III, 60 White Leghorn laying hens were fed either with or without 1 wt % Deinococcus sp. GKB-Aid 1995 powder, 1 wt % Deinococcus sp. GKB-Aid 1995 granules, or 1 wt % Deinococcus sp. GKB-Aid 1995 oily granules for 10 successive d. In all of the experiments, feeding Deinococcus powder did not affect egg quality traits except for the yolk color. In particular, supplementation with all Deinococcus powder treatments changed the yolk color (P 1995. Moreover, longer supplementation of Deinococcus sp. GKB-Aid 1995 in study II had a significant effect on feed conversion ratio. With these findings under consideration, the present study suggests that the Deinococcus species, especially Deinococcus sp. GKB-Aid 1995, can be an excellent candidate for improving egg yolk color in laying hens. © 2017 Poultry Science Association Inc.

  12. γ-irradiated ribosomes from Micrococcus radiodurans in a cell-free protein synthesizing system

    International Nuclear Information System (INIS)

    Suessmuth, R.; Widmann, A.

    1979-01-01

    γ-irradiation inactivation of isolated ribosomes of Micrococcus radiodurans was studied by examining poly U directed synthesis of polyphenylalanine. Ribosomes of M. radiodurans did not show significant γ-radiation sensitivity up to a dose of approx. 11.6 k Gy. Cells of M. radiodurans take up more magnesium than E. coli cells under the same conditions. The magnesium content of ribosomes of M. radiodurans was 18% higher than that of E.coli ribosomes. A possible relation between Mg 2+ -content and γ-resistance is discussed. (orig.) [de

  13. Separation of DNA-dependent polymerate activities in Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Kitayama, S.; Matsuyama, A.

    1977-01-01

    DNA polymerase activities in Micrococcus radiodurans were separated into two fractions after purification more than 2000 fold. They differ in pH optimum and residual activities in the absence of a full deoxyribonucleoside triphosphates complement. NAD partly inhibited one of the activities. Both activities were eluted as a single peak on gel filtration and sedimented at the same rate on glycerol gradient centrifugation. Molecular weight 140000 was calculated from Stokes radius and sedimentation constant. Deoxyribonuclease activity was detected on one of the polymerase activities which preferentially degraded double-stranded DNA. Priming activity of nicked DNA was reduced by γ-radiation. These results have been related to the possible roles in repair synthesis in vivo or DNA synthesis in permeable cells of M. radiodurans

  14. Separation of DNA-dependent polymerase activities in Micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Kitayama, S; Matsuyama, A [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1977-03-02

    DNA polymerase activities in Micrococcus radiodurans were separated into two fractions after purification more than 2000 fold. They differ in pH optimum and residual activities in the absence of a full deoxyribonucleoside triphosphates complement. NAD partly inhibited one of the activities. Both activities were eluted as a single peak on gel filtration and sedimented at the same rate on glycerol gradient centrifugation. Molecular weight 140000 was calculated from Stokes radius and sedimentation constant. Deoxyribonuclease activity was detected on one of the polymerase activities which preferentially degraded double-stranded DNA. Priming activity of nicked DNA was reduced by ..gamma.. radiation. These results have been related to the possible roles in repair synthesis in vivo or DNA synthesis in permeable cells of M. radiodurans.

  15. Deinococcus metallilatus sp. nov. and Deinococcus carri sp. nov., isolated from a car air-conditioning system.

    Science.gov (United States)

    Kim, Dong-Uk; Lee, Hyosun; Lee, Ji-Hyeong; Ahn, Jae-Hyung; Lim, Sangyong; Jeong, Sunwook; Park, So Yoon; Seong, Chi Nam; Ka, Jong-Ok

    2015-09-01

    Two bacterial strains, designated MA1002(T) and MA1003(T), were isolated from the air-conditioning system of a car. Cells of both strains were Gram-reaction-positive, non-motile, non-spore-forming coccoids, catalase- and oxidase-positive and UV-radiation resistant. The major fatty acids of strain MA1002(T) were iso-C17 : 0 and iso-C15 : 0 and those of strain MA1003(T) were iso-C16 : 0 and iso-C16 : 1 H. The polar lipid profile of MA1002(T) contained phosphatidylethanolamine, two unidentified phosphoglycolipids, an unidentified phospholipid, an unidentified aminophospholipid, an unidentified aminolipid and an unidentified lipid. MA1003(T) had three unidentified phosphoglycolipids, six unidentified phospholipids, two unidentified glycolipids and two unidentified polar lipids as the polar lipids. The G+C contents of the genomic DNA of MA1002(T) and MA1003(T) were 70.5 and 76.0 mol%, respectively. MK-8 was the predominant respiratory quinone for both strains. 16S rRNA gene sequence analysis showed that strain MA1002(T) was phylogenetically related to Deinococcus apachensis DSM 19763(T), D. geothermalis DSM 11300(T), D. aerius TR0125(T) and D. aetherius ST0316(T) (92.9, 92.6, 92.0 and 91.9% sequence similarity, respectively), and MA1003(T) showed the highest sequence similarity to Deinococcus hopiensis KR-140(T) (92.9%) and D. xinjiangensis X-82(T) (91.4%). The results of genotypic and phenotypic characterizations showed that both strains could be distinguished from phylogenetically related species, and that the strains represented novel species within the genus Deinococcus, for which we propose the names Deinococcus metallilatus sp. nov. (type strain MA1002(T) = KACC 17964(T) = NBRC 110141(T)) and Deinococcus carri sp. nov. (type strain is MA1003(T) = KACC 17965(T) = NBRC 110142(T)).

  16. Loss of characteristic radiation resistance by mutation of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Kitayama, S.; Matusyama, A.

    1975-01-01

    The exceptional radioresistance of M. radiodurans was lost by a mutation, and the isolated mutant, KH840, had almost the same radiosensitivity as E. coli K12 AB1157 or B/r. DNA-strand scissions in this mutant were rejoined partly during post-irradiation incubation. Reduced DNA polymerizing activity and extensive degradation of the product was observed in vitro in the crude extract from the sensitive strain. The lower repair capability is not accompanied by the reduced transformation frequency

  17. Loss of characteristic radiation resistance by mutation of Micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Kitayama, S; Matusyama, A [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1975-09-01

    The exceptional radioresistance of M. radiodurans was lost by a mutation, and the isolated mutant, KH840, had almost the same radiosensitivity as E. coli K12 AB1157 or B/r. DNA-strand scissions in this mutant were rejoined partly during post-irradiation incubation. Reduced DNA polymerizing activity and extensive degradation of the product was observed in vitro in the crude extract from the sensitive strain. The lower repair capability is not accompanied by the reduced transformation frequency.

  18. Radioprotection in E. coli by an agent from M. radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, L S; Gersten, D M; Bruce, A K [State Univ. of New York, Buffalo (USA). Dept. of Biology

    1978-10-01

    An agent extracted from the radioresistant bacterium M. radiodurans was found to protect several strains of E. coli from X-radiation. Optimal radioprotection was observed when the repair-proficient B/r strain was irradiated in the presence of the agent under hypoxic conditions. It is proposed that this agent acts to modify damage incurred in the presence of reduced oxygen concentrations so that this damage might be subsequently repaired.

  19. Deinococcus Mn2+-peptide complex: A novel approach to alphavirus vaccine development.

    Science.gov (United States)

    Gayen, Manoshi; Gupta, Paridhi; Morazzani, Elaine M; Gaidamakova, Elena K; Knollmann-Ritschel, Barbara; Daly, Michael J; Glass, Pamela J; Maheshwari, Radha K

    2017-06-22

    Over the last ten years, Chikungunya virus (CHIKV), an Old World alphavirus has caused numerous outbreaks in Asian and European countries and the Americas, making it an emerging pathogen of great global health importance. Venezuelan equine encephalitis virus (VEEV), a New World alphavirus, on the other hand, has been developed as a bioweapon in the past due to its ease of preparation, aerosol dispersion and high lethality in aerosolized form. Currently, there are no FDA approved vaccines against these viruses. In this study, we used a novel approach to develop inactivated vaccines for VEEV and CHIKV by applying gamma-radiation together with a synthetic Mn-decapeptide-phosphate complex (MnDpPi), based on manganous-peptide-orthophosphate antioxidants accumulated in the extremely radiation-resistant bacterium Deinococcus radiodurans. Classical gamma-irradiated vaccine development approaches are limited by immunogenicity-loss due to oxidative damage to the surface proteins at the high doses of radiation required for complete virus-inactivation. However, addition of MnDpPi during irradiation process selectively protects proteins, but not the nucleic acids, from the radiation-induced oxidative damage, as required for safe and efficacious vaccine development. Previously, this approach was used to develop a bacterial vaccine. In the present study, we show that this approach can successfully be applied to protecting mice against viral infections. Irradiation of VEEV and CHIKV in the presence of MnDpPi resulted in substantial epitope preservation even at supra-lethal doses of gamma-rays (50,000Gy). Irradiated viruses were found to be completely inactivated and safe in vivo (neonatal mice). Upon immunization, VEEV inactivated in the presence of MnDpPi resulted in drastically improved protective efficacy. Thus, the MnDpPi-based gamma-inactivation approach described here can readily be applied to developing vaccines against any pathogen of interest in a fast and cost

  20. The resistance of Micrococcus radiodurans to killing and mutation by agents which damage DNA

    International Nuclear Information System (INIS)

    Sweet, D.M.; Moseley, B.E.B.

    1976-01-01

    The resistance of Micrococcus radiodurans to the lethal and mutagenic action of ultraviolet (UV) light, ionising (γ) radiation, mitomycin C (MTC), nitrous acid (NA), hydroxylamine (HA), N-methyl-N'-nitro-N-nitrosoguanidine (NG), ethylmethanesulphonate (EMS) and β-propiolactone (βPL) has been compared with that of Escherichia coli B/r. M. radiodurans was much more resistant than E. coli B/r to the lethal effects of UV light (by a factor of 33), γ-radiation (55), NG (15) and NA (62), showed intermediate resistance to MTC (4) and HA (7), but was sensitive to EMS (1) and βPL (2). M. radiodurans was very resistant to mutagens producing damage which can be repaired by a recombination system, indicating that it possesses an extremely efficient recombination repair mechanism. Both species were equally sensitive to mutation to trimethoprim resistance by NG, but M. radiodurans was more resistant than E. coli B/r to the other mutagens tested, being non-mutable by UV light, γ-radiation, MTC and HA, and only slightly sensitive to mutation by NA, EMS, and βPL. The resistance of M. radiodurans to mutation by UV light, γ-radiation and MTC is consistent with an hypothesis that recombination repair in M. radiodurans is accurate since these mutagens may depend on an 'error-prone' recombination system for their mutagenic effect in E. coli B/r. However, because M. radiodurans is also resistant to mutagens such as HA and EMS, which are mutagenic in E. coli in the absence of an 'error-prone' system, we propose that all the mutagens tested may have a common mode of action in E. coli B/r, but that this mutagenic pathway is missing in M. radiodurans

  1. Resistance of Micrococcus radiodurans to killing and mutation by agents which damage DNA

    Energy Technology Data Exchange (ETDEWEB)

    Sweet, D M; Moseley, B E.B. [Edinburgh Univ. (UK). School of Agriculture

    1976-02-01

    The resistance of Micrococcus radiodurans to the lethal and mutagenic action of ultraviolet (UV) light, ionising (..gamma..) radiation, mitomycin C (MTC), nitrous acid (NA), hydroxylamine (HA), N-methyl-N'-nitro-N-nitrosoguanidine (NG), ethylmethanesulphonate (EMS) and ..beta..-propiolactone (..beta..PL) has been compared with that of Escherichia coli B/r. M. radiodurans was much more resistant than E. coli B/r to the lethal effects of UV light (by a factor of 33), ..gamma..-radiation (55), NG (15) and NA (62), showed intermediate resistance to MTC (4) and HA (7), but was sensitive to EMS (1) and ..beta..PL (2). M. radiodurans was very resistant to mutagens producing damage which can be repaired by a recombination system, indicating that it possesses an extremely efficient recombination repair mechanism. Both species were equally sensitive to mutation to trimethoprim resistance by NG, but M. radiodurans was more resistant than E. coli B/r to the other mutagens tested, being non-mutable by UV light, ..gamma..-radiation, MTC and HA, and only slightly sensitive to mutation by NA, EMS, and ..beta..PL. The resistance of M. radiodurans to mutation by UV light, ..gamma.. radiation and MTC is consistent with an hypothesis that recombination repair in M. radiodurans is accurate since these mutagens may depend on an 'error-prone' recombination system for their mutagenic effect in E. coli B/r. However, because M. radiodurans is also resistant to mutagens such as HA and EMS, which are mutagenic in E. coli in the absence of an 'error-prone' system, we propose that all the mutagens tested may have a common mode of action in E. coli B/r, but that this mutagenic pathway is missing in M. radiodurans.

  2. Deinococcus multiflagellatus sp. nov., isolated from a car air-conditioning system.

    Science.gov (United States)

    Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

    2018-04-01

    A gamma radiation-resistant and pink-to-red pigmented bacterial strain, designated ID1504 T , was isolated from a car air-conditioning system sampled in Korea. The cells were observed to be Gram-stain negative, aerobic, motile with peritrichous flagella and short rod-shaped. Phylogenetically, the strain groups with the members of the genus Deinococcus and exhibits high 16S rRNA gene sequence similarities with Deinococcus arenae SA1 T (94.0%), Deinococcus actinosclerus BM2 T (93.9%) and Deinococcus soli N5 T (93.5%). The predominant fatty acids were identified as C 17:0 , C 16:0 , summed feature 3 (C 16:1 ω7c and/or C 16:1 ω6c) and iso-C 17:0 . The major respiratory quinone was identified as MK-8. The polar lipids were found to be comprised of unidentified phospholipids, unidentified glycolipids, an unidentified aminophospholipid and an unidentified lipid. The DNA G+C content of the strain was determined to be 68.3 mol%. On the basis of the phenotypic, genotypic and chemotaxonomic characteristics, strain ID1504 T should be classified in a novel species in the genus Deinococcus, for which the name Deinococcus multiflagellatus sp. nov. (= KACC 19287 T  = NBRC 112888 T ) is proposed.

  3. Role of manganese in the resistance of Micrococcus radiodurans to ionizing radiation

    International Nuclear Information System (INIS)

    Wierowski, J.V.

    1980-01-01

    Micrococcus radiodurans possesses a very high level of intracellular manganese compared to other organisms. This manganese content has previously been shown to participate in the exceptional ulraviolet radiation resistance of M. radiodurans. This study was undertaken to determine the role of manganese in the ionizing radiation resistant of M. radiodurans. The results indicate that manganese is essential for DNA degradation to occur during irradiation. Manganese has also proven essential for the second phase of post-irradiation thymine base damage removal. These factors work together to increase the rate of recovery from radiation damage, which is reflected in a larger Dq, D 37 and exponential portion of the survival curve of high Mn-grown cells

  4. Effects of oxygen during γ-irradiation of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Myers, D.K.; Johnson, L.D.

    1977-01-01

    A study has been made of the effects of oxygen on the yield of double strand breaks in the DNA of Micrococcus radiodurans, and of the relation of these effects to cell death. The o.e.r. values for cell survival were considerably smaller than those for the yield of double strand breaks, although they showed similar trends after irradiation in different media. The o.e.r. values for the inhibition of post-irradiation enzymatic repair were similar to those for cell survival. The o.e.r. for radiation-induced breaks in DNA therefore seems to depend on radiochemical reactions that are occurring during irradiation rather than on a preferential enzymatic repair of those strand breaks that are produced by anoxic irradiation. Cell survival depends less on the number of double strand breaks produced than on the ability of the cell to repair the double strand breaks. The maximum yield of double strand breaks after oxic γ-irradiation was approximately 1.7 breaks/krad/10 10 Daltons, corresponding to 1 break per 610 eV. (U.K.)

  5. Effects of oxygen during. gamma. irradiation of Micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Myers, D K; Johnson, L D [Atomic Energy of Canada Ltd., Chalk River, Ontario. Chalk River Nuclear Labs.

    1977-09-01

    A study has been made of the effects of oxygen on the yield of double strand breaks in the DNA of Micrococcus radiodurans, and of the relation of these effects to cell death. The OER values for cell survival were considerably smaller than those for the yield of double strand breaks, although they showed similar trends after irradiation in different media. The OER values for the inhibition of post-irradiation enzymatic repair were similar to those for cell survival. The OER for radiation-induced breaks in DNA therefore seems to depend on radiochemical reactions that are occurring during irradiation rather than on a preferential enzymatic repair of those strand breaks that are produced by anoxic irradiation. Cell survival depends less on the number of double strand breaks produced than on the ability of the cell to repair the double strand breaks. The maximum yield of double strand breaks after oxic ..gamma.. irradiation was approximately 1.7 breaks/krad/10/sup 10/Daltons, corresponding to 1 break per 610 eV.

  6. Genetic control over the processes of postirradiation recovery of a compact chromosome in micrococcus radiodurans

    International Nuclear Information System (INIS)

    Kudryashova, N.Yu.; Groshev, V.V.; Shestakov, S.V.

    1984-01-01

    X-irradiation of Micrococcus radiodurans cells with sublethal doses caused disturbances in the structure of a membrane-bound compact chromosome. Recovery of the compact chromosome occurred during the postirradiation incubation of the wild type cells and cells of the UVS-17 mutant deficient in DNA-polymerase. This process was blocked in cells of rec-30 mutant with the impaired system of genetic recombination: this is indicative of an important role played by rec-30 gene product in the postirradiation recovery of the compact chromosome in M. radiodurans cells

  7. Four Proteins Synthesized in Response to Deoxyribonucleic Acid Damage in Micrococcus Radiodurans

    DEFF Research Database (Denmark)

    Hansen, M. T.

    1980-01-01

    Four proteins, alpha beta, gamma, and delta, preferentially synthesized in ultraviolet light-treated cells of Micrococcus radiodurans, were characterized in terms of their molecular weights and isoelectric points. Within the sublethal-dose range, the differential rate of synthesis for these prote......Four proteins, alpha beta, gamma, and delta, preferentially synthesized in ultraviolet light-treated cells of Micrococcus radiodurans, were characterized in terms of their molecular weights and isoelectric points. Within the sublethal-dose range, the differential rate of synthesis...

  8. Deinococcus daejeonensis sp. nov., isolated from sludge in a sewage disposal plant.

    Science.gov (United States)

    Srinivasan, Sathiyaraj; Kim, Myung Kyum; Lim, Sangyong; Joe, Minho; Lee, Myungjin

    2012-06-01

    A Gram-stain-positive, strictly aerobic, spherical, non-motile red-pigmented bacterial strain, designated MJ27(T), was isolated from a sludge sample of the Daejeon sewage disposal plant in South Korea. A polyphasic approach was used to study the taxonomic position of strain MJ27(T). Strain MJ27(T) shared highest 16S rRNA gene sequence similarity with Deinococcus grandis DSM 3963(T) (98.8 %), Deinococcus caeni Ho-08(T) (97.5 %) and Deinococcus aquaticus PB314(T) (96.6 %.); levels of sequence similarity with the type strains of other Deinococcus species were less than 96.0 %. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain MJ27(T) belonged to the clade formed by members of the genus Deinococcus in the family Deinococcaceae. The G+C content of the genomic DNA of strain MJ27(T) was 67.6 mol%. The chemotaxonomic characteristics of strain MJ27(T) were typical of members of the genus Deinococcus, with MK-8 as the predominant respiratory quinone, C(16:1)ω7c, C(15:1)ω6c, C(16:0) and C(15:0) as major fatty acids (>12 %), ornithine as the diamino acid in the cell-wall peptidoglycan and resistance to gamma radiation [D(10) (dose required to reduce the bacterial population by tenfold) >9 kGy]. The low levels of DNA-DNA relatedness reported here (5.3±1.5-29.2±2.3 %) indicate that strain MJ27(T) represents a species that is separate from its closest relatives in the genus Deinococcus. On the basis of phylogenetic inference, fatty acid profile and other phenotypic properties, strain MJ27(T) is considered to represent a novel species of the genus Deinococcus, for which the name Deinococcus daejeonensis sp. nov. is proposed. The type strain is MJ27(T) ( = KCTC 13751(T) = JCM 16918(T)).

  9. Studies on Post-Irradiation DNA Degradation in Micrococcus Radiodurans, Strain RII51

    DEFF Research Database (Denmark)

    Auda, H.; Emborg, C.

    1973-01-01

    The influence of irradiation condition on post-irradiation DNA degradation was studied in a radiation resistant mutant of M. radiodurans, strain ${\\rm R}_{{\\rm II}}5$. After irradiation with 1 Mrad or higher more DNA is degraded in cells irradiated in wet condition than in cells irradiated with t...

  10. Biofilms and planktonic cells of Deinococcus geothermalis in extreme environments

    Science.gov (United States)

    Panitz, Corinna; Reitz, Guenther; Rabbow, Elke; Rettberg, Petra; Flemming, Hans-Curt; Wingender, Jost; Froesler, Jan

    In addition to the several extreme environments on Earth, Space can be considered as just another exceptional environment with a unique mixture of stress factors comprising UV radiation, vacuum, desiccation, temperature, ionizing radiation and microgravity. Life that processes in these environments can depend on the life forms and their state of living. The question is whether there are different strategies for individual microorganisms compared to communities of the same organisms to cope with the different factors of their surroundings. Comparative studies of the survi-val of these communities called biofilms and planktonic cell samples of Deinococcus geothermalis stand at the focal point of the presented investigations. A biofilm is a structured community of microorganisms that live encapsulated in a matrix of extracellular polymeric substances on a surface. Microorganisms living in a biofilm usually have significantly different properties to cooperate than individually living microorganisms of the same species. An advantage of the biofilm is increased resistance to various chemical and physical effects, while the dense extracellular matrix and the outer layer of the cells protect the interior of the microbial consortium. The space experiment BOSS (Biofilm organisms surfing Space) as part the ESA experimental unit EXPOSE R-2 with a planned launch date in July 2014 will be subsequently mounted on the Russian Svesda module outside the ISS. An international team of scientists coordinated by Dr. P. Rettberg will investigate the hypothesis whether microorganisms organized as biofilm outmatch the same microorganisms exposed individually in the long-term survival of the harsh environmental conditions as they occur in space and on Mars. Another protective function in the samples could be dust par-ticles for instance Mars regolith simulant contained inside the biofilms or mixed with the planktonic cells, as additional shelter especially against the extraterrestrial UV

  11. Quorum sensing circuit and reactive oxygen species resistance in Deinococcus sp.

    Science.gov (United States)

    Fernandez-Bunster, G; Gonzalez, C; Barros, J; Martinez, M

    2012-12-01

    Genus Deinococcus is characterized by an increased resistance toward reactive oxygen species (ROS). The chromosome of five strains belonging to this genus has been sequenced and the presence of a luxS-like gene was deduced from their genome sequences. The aim of this study was to assess if a complete QS circuit is present in Deinococcus sp. and if this QS is associated with ROS. Primers for searching luxS-like gene and the putative receptor gene, namely ai2R, were designed. AI-2 signal production was evaluated by luminescence analysis using Vibrio harveyi BB170 as reporter strain. AI-2 signal was also evaluated by competitive assays using cinnamaldehyde, ascorbic acid, and 3-mercaptopropionic acid as interfering molecules. Potassium tellurite and metronidazole were used as oxidative stressors. A luxS-like gene as well as an ai2R gene was detected in strain UDEC-P1 by PCR. Cell-free supernatant of strain UDEC-P1 culture induced luminescence in V. harveyi BB170, and this property was inhibited with the three interfering molecules. The oxidative stressors metronidazole and potassium tellurite decreased Deinococcus sp. viability, but increased luminescence of the reporter strain. The results demonstrate that both a functional luxS-like gene and a putative receptor for AI-2 signal are present in Deinococcus sp. strain UDEC-P1. This finding also suggests that a complete QS circuit is present in this genus, which could be related to oxidative stress.

  12. The in vivo association of manganese with the chromosome of Micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Leibowitz, P J; Schwartzberg, L S; Bruce, A K [State Univ. of New York, Buffalo (USA). Dept. of Biology

    1976-01-01

    Extremely high levels of paramagnetic manganese (Mn/sup 2 +/) which quench phosphorescent reactions have been found to inhibit the formation of thymine-containing dimers in M. radiodurans. Lowering the concentration of Mn/sup 2 +/ in the culture medium resulted in a lower intracellular concentration of Mn/sup 2 +/, an increase in the uv-sensitivity of this bacterium, and a larger photochemical yield of thymine-containing dimers. High levels of paramagnetic Mn/sup 2 +/ were not found in other test organisms which are more sensitive to uv-irradiation. One interpretation of this data is that in Micrococcus radiodurans Mn2/sup +/+ may bind to the chromosome and thereby reduce the photochemical yield of thymine-containing dimers.

  13. Excision repair of 5,6-dihydroxydihydrothymine from the DNA of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Targovnik, H.S.; Hariharan, P.V.

    1980-01-01

    One of the major ionizing radiation products, 5,6-dihydroxydihydrothymine (thymine glycol), was measured in the DNA of Micrococcus radiodurans following exposure of cells to 6.8-MeV electrons or 254-nm ultraviolet light. Removal of 5,6-dihydroxydihydrothymine was measured in both an ionizing radiation-sensitive strain (262) and a highly radioresistant strain (the wild type W + ) of Micrococcus radiodurans. Within 30 min of incubation (33 0 C) following exposure to ultraviolet light (2400 J/m 2 ) approximately 60% of the thymine glycols were excised, whereas in the case of ionizing radiation (250 krad) only 35% were removed from the cellular DNA of the wild-type strain. In contrast less than 50% of the thymine glycols were excised from the sensitive strain. The amount of DNA degradation induced by radiation was less than 10% in both strains. The results suggest a possible correlation between reduced excision repair of base damage and increased radiation sensitivity

  14. Multiplicity of genome equivalents in the radiation-resistant bacterium Micrococcus radiodurans.

    Science.gov (United States)

    Hansen, M T

    1978-01-01

    The complexity of the genome of Micrococcus radiodurans was determined to be (2.0 +/- 0.3) X 10(9) daltons by DNA renaturation kinetics. The number of genome equivalents of DNA per cell was calculated from the complexity and the content of DNA. A lower limit of four genome equivalents per cell was approached with decreasing growth rate. Thus, no haploid stage appeared to be realized in this organism. The replication time was estimated from the kinetics and amount of residual DNA synthesis after inhibiting initiation of new rounds of replication. From this, the redundancy of terminal genetic markers was calculated to vary with growth rate from four to approximately eight copies per cell. All genetic material, including the least abundant, is thus multiply represented in each cell. The potential significance of the maintenance in each cell of multiple gene copies is discussed in relation to the extreme radiation resistance of M. radiodurans. PMID:649572

  15. The in vivo association of manganese with the chromosome of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Leibowitz, P.J.; Schwartzberg, L.S.; Bruce, A.K.

    1976-01-01

    Extremely high levels of paramagnetic manganese (Mn 2+ ) which quench phosphorescent reactions have been found to inhibit the formation of thymine-containing dimers in M. radiodurans. Lowering the concentration of Mn 2+ in the culture medium resulted in a lower intracellular concentration of Mn 2+ , an increase in the UV-sensitivity of this bacterium, and a larger photochemical yield of thymine-containing dimers. High levels of paramagnetic Mn 2+ were not found in other test organisms which are more sensitive to UV-irradiation. One interpretation of this data is that in Micrococcus radiodurans Mn2 + + may bind to the chromosome and thereby reduce the photochemical yield of thymine-containing dimers. (author)

  16. Deinococcus aluminii sp. nov., isolated from an automobile air conditioning system.

    Science.gov (United States)

    Kim, Dong-Uk; Lee, Hyosun; Lee, Suyeon; Park, Sooyeon; Yoon, Jung-Hoon; Zhao, Lei; Kim, Min-Kyu; Ahn, Jae-Hyung; Ka, Jong-Ok

    2018-01-16

    A Gram-stain-positive and pale pink-pigmented bacterial strain, designated ID0501 T , was isolated from an automobile evaporator core collected in the Republic of Korea. The cells were aerobic and coccoidal. The strain grew at 15-40 ˚C (optimum, 37 ˚C), at pH 6.0-7.0 (optimum, pH 6.5), and in the presence of 0-1.5 % (w/v) NaCl. Phylogenetically, the strain was related to members of the genus Deinococcus and showed the highest sequence similarity, of 96.9 %, with Deinococcus metallilatus MA1002 T . The major fatty acids of the strain were iso-C17 : 0, iso-C15 : 0 and iso-C13 : 0. The predominant respiratory quinone was MK-8. The polar lipids profile revealed the presence of phosphatidylethanolamine, phosphatidylglycerol, phosphatidylcholine, diphosphatidylglycerol, unidentified phospholipids, an unidentified aminolipid and unidentified glycolipids. The DNA G+C content of the strain was 68.3 mol%. On the basis of phenotypic, genotypic and chemotaxonomic data, strain ID0501 T represents a novel species of the genus Deinococcus, for which the name Deinococcusaluminii sp. nov. (=KACC 19286 T =NBRC 112889 T ) is proposed.

  17. Characterization and safety evaluation of a Deinococcus member as feed additive for hens.

    Science.gov (United States)

    Wu, Szu-Yin; Li, I-Chen; Lin, Yi-Chin; Chen, Chin-Chu

    2016-04-01

    As previous studies mainly focus on understanding the mechanisms of radioresistance in Deinococcus bacteria, the present study aimed at characterizing and verifying the safety use of the GKB-Aid 1995 strain, a member of the radiation-resistant bacterial genus Deinococcus, as an ingredient in feed supplements. Using Vitek 2 system and 16S rRNA gene sequencing, GKB-Aid 1995 most resembles Deinococcus grandis. The Ames test, in vitro chromosomal test, in vivo micronucleus test and acute toxicity test were performed subsequently for its safety evaluation. As there is a possibility that the pigment of GKB-Aid 1995 can pass from feed to eggs intended for human consumption, an acute toxicity test was also carried out in pigmented egg yolk. The results confirmed that GKB-Aid 1995 was non-genotoxic in three genotoxicity experiments, and the LD50 of GKB-Aid 1995 and the pigmented egg yolk in ICR mice was greater than 10 and 12 g kg(-1) body weight, respectively. Overall, these data indicate that GKB-Aid 1995 is a non-toxic substance with no genotoxicity and is therefore safe to be used as a feed supplement or feed additive. This study suggests there is potential in developing GKB-Aid 1995 as an animal feed additive intended to enhance yolk coloration to meet the demand of consumers. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Decommissioning and decontrolling the R1-reactor

    International Nuclear Information System (INIS)

    Bergman, C.; Holmberg, B.T.

    1985-01-01

    Sweden's first nuclear reactor - the research reactor R1 - situated in bedrock under the Royal Technical Institute of Stockholm, has in the period 1981-1983 been subject to a complete decommissioning. The National Institute for Radiation Protection has followed the work in detail, and has after the completion of the decommissioning performed measurements of radioactivity on site. The report gives an account of the work the Institute has done in preparation for- and during decommissioning and specifically report on the measurements for classification of the local as free for non-nuclear use. (aa)

  19. Origin of cell surface proteins released from Micrococcus radiodurans by ionizing radiation

    International Nuclear Information System (INIS)

    Mitchel, R.E.J.

    1975-01-01

    The exposure of Micrococcus radiodurans to sublethal doses of ionizing radiation causes the release of certain proteins into the surrounding medium. As estimated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, these proteins range from approximately 20,000 to 125,000 daltons. At least some of the proteins, including an exonuclease, have a surface location and appear to originate from the lipid-rich midwall layer. The exonuclease has two functionally distinct locations, one with its active site available to external substrate and a second with the active site masked from the exterior. Ionizing radiation releases both the masked and unmasked activity into the surrounding medium

  20. Rescue of Mitomycin C- or Psoralen-Inactivated Micrococcus Radiodurans by Additional Exposure to Radiation or Alkylating Agents

    DEFF Research Database (Denmark)

    Hansen, M. Trier

    1982-01-01

    The processing of damaged DNA was altered in a mitomycin C-sensitive mutant (mtcA) of Micrococcus radiodurans. Even though the mutant retained resistance to 254-nm UV radiation, it did not, in contrast to the wild-type strain, show any excessive DNA degradation or cell death when incubated...

  1. Studies on the Mechanism of Radiation Resistance in Micrococcus Radiodurans and its Sensitization

    Energy Technology Data Exchange (ETDEWEB)

    Kitayama, S.; Matsuyama, A. [Radiobiology Laboratory, Institute of Physical and Chemical Research, Wako-shi, Saitama-ken (Japan)

    1978-06-15

    Efficient and accurate repair of radiation-induced lesions in M. radiodurans was investigated as to the cause of its extreme radioresistance. The cells were made permeable to deoxyribonucleoside triphosphate by treatment with non-ionic detergent, Triton X-100. After irradiation with 2 krad gamma rays more than 80% of the single-strand scissions were rejoined in the permeable cells within 10 min at 37 Degree-Sign C. This fast repair process requires the presence of deoxyribonucleoside triphosphates and NAD. However, rejoining of DNA strand scission was incomplete after prolonged incubation in the permeable cells. This suggests that alternate repair reaction(s) is necessary for complete recovery. The other type of radiation lesion was found by postirradiation incubation at non-permissive temperature, which markedly sensitizes this bacterium to radiation. Postincubation at this temperature also sensitizes the cells to chemicals that damage DNA. The extreme radioresistance of this bacterium was also lost by mutation and an isolated radiosensitive mutant showed almost the same radiosensitivity as E. coli K12 or B/r. These results are discussed in connection with the extreme radioresistance of M. radiodurans. (author)

  2. Studies on the mechanism of radiation resistance in Micrococcus radiodurans and its sensitization

    International Nuclear Information System (INIS)

    Kitayama, S.; Matsuyama, A.

    1978-01-01

    Efficient and accurate repair of radiation-induced lesions in M. radiodurans was investigated as to the cause of its extreme radioresistance. The cells were made permeable to deoxyribonucleoside triphosphate by treatment with non-ionic detergent, Triton X-100. After irradiation with 2 krad gamma rays more than 80% of the single-strand scissions were rejoined in the permeable cells within 10 min at 37 0 C. This fast repair process requires the presence of deoxyribonucleoside triphosphates and NAD. However, rejoining of DNA strand scission was incomplete after prolonged incubation in the permeable cells. This suggests that alternate repair reaction(s) is necessary for complete recovery. The other type of radiation lesion was found by post-irradiation incubation at non-permissive temperature, which markedly sensitizes this bacterium to radiation. Postincubation at this temperature also sensitizes the cells to chemicals that damage DNA. The extreme radioresistance of this bacterium was also lost by mutation and an isolated radiosensitive mutant showed almost the same radiosensitivity as E. coli K12 or B/r. These results are discussed in connection with the extreme radioresistance of M. radiodurans. (author)

  3. Deinococcus hibisci sp. nov., isolated from rhizosphere of Hibiscus syriacus L. (mugunghwa flower).

    Science.gov (United States)

    Moya, Gabriela; Yan, Zheng-Fei; Chu, Dong-Hun; Won, KyungHwa; Yang, Jung-Eun; Wang, Qi-Jun; Kook, Moo-Chang; Yi, Tae-Hoo

    2018-01-01

    A Gram-stain-positive, pink-pigmented, coccus-shaped, strictly aerobic, non-motile bacterium, strain THG-AG1.5 T , was isolated from rhizosphere of Hibiscus syriacus L. (Mugunghwa flower) located in Kyung Hee University, Yongin, Gyeonggi, Republic of Korea. The isolated strain grew optimally at 25-30 °C, at pH 6.0-7.5 and in the presence of additional 0-1.5 % (w/v) NaCl. Strain THG-AG1.5 T exhibited tolerance to UV radiation (>1500 J m -2 ) and to gamma radiation (>12 kGy). Based on 16S rRNA gene sequence comparisons, strain THG-AG1.5 T was closely related to Deinococcus daejeonensis MJ27 T (98.03 %), Deinococcus radiotolerans C1 T (97.61 %) and Deinococcus grandis DSM 3963 T (97.32 %). The genomic DNA G+C content of strain THG-AG1.5 T was 74.8 mol%. The DNA-DNA hybridization values between strain THG-AG1.5 T and its closest phylogenetically neighbours were below 63.0 %. The peptidoglycan amino acids were alanine, valine, glutamic acid, glycine, ornithine, lysine and aspartic acid. Strain THG-AG1.5 T contained ribose, mannose and glucose as whole-cell-wall sugars and menaquinone-8 (MK-8) as the only isoprenoid quinone. The major component in the polyamine pattern was spermidine. The major polar lipids of strain THG-AG1.5 T were a phosphoglycolipid, six unidentified glycolipids and an unidentified aminophospholipid. The major fatty acids were identified as iso-C15 : 0, C15 : 1ω6c, C16 : 0, iso-C17 : 0, C17 : 0, C18 : 0 and summed feature 3. On the basis of our polyphasic taxonomy study, strain THG-AG1.5 T represents a novel species within the genus Deinococcus, for which the name Deinococcushibisci sp. nov. is proposed. The type strain is THG-AG1.5 T (=KACC 18850 T =CCTCC AB 2016078 T ).

  4. Repair of the double-strand breaks produced by /sup 125/I disintegrations in the DNA of micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Myers, D K [Atomic Energy of Canada Ltd., Chalk River, Ontario. Chalk River Nuclear Labs.

    1978-01-01

    Wild-type M. radiodurans and two radiosensitive mutants were used to study the lethal effects of /sup 125/I disintegrations in their DNA. The relative sensitivities of these three strains to inactivation by ..gamma..-radiation were reflected in their relative sensitivities to inactivation by /sup 125/I decay. The number of double-strand (ds) breaks in the DNA appeared to be similar at levels of ..gamma..-radiation and of /sup 125/I decay that reduced survival to 10%. All three strains of M. radiodurans rapidly repaired ds breaks produced in their DNA by either ..gamma..-radiation or /sup 125/I disintegrations. If one ds break per cell is a lethal event (Krisch. et al., 1975), cells of the three strains tested would die when they had left unrepaired one ds break out of an initial 45, 600 or 1800 ds breaks per single cell.

  5. DNA-membrane complex restoration in Micrococcus radiodurans after X-irradiation: relation to repair, DNA synthesis and DNA degradation

    Energy Technology Data Exchange (ETDEWEB)

    Dardalhon-Samsonoff, M; Averbeck, D [Institut du Radium, 75 - Paris (France). Lab. Curie

    1980-07-01

    The DNA-membrane complex in Micrococcus radiodurans was shown to be essentially constituted of proteins, lipids and DNA. The complex was dissociated immediately after X-irradiation of cells and restored during post-incubation in complete medium. In X-irradiated protoplasts some DNA remained associated with the complex. Restoration of the complex during post-incubation was only seen in a medium favouring DNA polymerase and ligase activities. Under this condition no DNA synthesis occurred, suggesting that complex restoration may involve ligase activity. The complex restoration in the wild type and the X-ray sensitive mutant UV17 of M. radiodurans was strictly dependent on the X-ray dose. It was correlated with survival and DNA degradation but always preceded the onset of DNA synthesis after X-irradiation. At the same dose the complex restoration was about 2 fold lower in mutant than in wild type cells indicating that the restoration of the complex is related to repair capacity. The results are consistent with the idea that the complex protects X-irradiated DNA of M. radiodurans from further breakdown and, subsequently, permits DNA synthesis and repair to occur.

  6. Initial mass function in R-associations CMaR1, Mon R1 and Mon R2 from radiodata

    International Nuclear Information System (INIS)

    Pyatunina, T.B.

    1985-01-01

    Results of search for compact radiosources in R-associations CMa R1 and Mon R1 carried out with the radiotelescope RATAN-600 at the 7.6-cm wavelength are given. The number of sources found in the association Mon R1 is approximately equal to the expected number of background extragalactic radiosources. In the association CMa R1 seven radiosources of small angular diameter with the flux greater than 30 mJy are found, two of which probably are background sources. A comparison of optical and radiodata on the association CMa R1 and previously published data on the association Mon R2 make it possible to estimate the initial mass function for associations under study: xi(M) infinity Msup(-2.7+-0.7) for stars with M approximately 10Msub(Sun)

  7. Radiation-induced enhancement of enzymatic cell lysis of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Watanabe, H.; Takehisa, M.; Iizuka, H.

    1981-01-01

    The intact cells of M. radiodurans were rendered sensitive to the action of lytic enzyme (P2-2 enzyme) by irradiation. The radiation-induced enhancement of cell lysis with P2-2 enzyme was completely prevented by the addition of t-butanol and irradiation at liquid nitrogen temperature. These results indicate that the enhancement is due to indirect action resulting from OH radicals. Cell lysis by lysozyme was enhanced only when the cells were irradiated under N 2 O. The enhancement of cell lysis with lysozyme was also prevented by adding alcohols. On the other hand, when lipid components in cells were removed by extraction with n-butanol, the radiation-induced enhancement of cell lysis with P2-2 enzyme and lysozyme was not observed. From these results it is concluded that the enhancement of enzymatic cell lysis by irradiation is attributable to alteration in the lipid-rich layer of the cell wall caused by OH radicals

  8. Radiation-induced enhancement of enzymatic cell lysis of Micrococcus radiodurans

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, H.; Takehisa, M. [Japan Atomic Energy Research Inst., Takasaki, Gunma, Takasaki Radiation Chemistry Research Establishment (Japan); Iizuka, H.

    1981-10-15

    The intact cells of M. radiodurans were rendered sensitive to the action of lytic enzyme (P2-2 enzyme) by irradiation. The radiation-induced enhancement of cell lysis with P2-2 enzyme was completely prevented by the addition of t-butanol and irradiation at liquid nitrogen temperature. These results indicate that the enhancement is due to indirect action resulting from OH radicals. Cell lysis by lysozyme was enhanced only when the cells were irradiated under N{sub 2}O. The enhancement of cell lysis with lysozyme was also prevented by adding alcohols. On the other hand, when lipid components in cells were removed by extraction with n-butanol, the radiation-induced enhancement of cell lysis with P2-2 enzyme and lysozyme was not observed. From these results it is concluded that the enhancement of enzymatic cell lysis by irradiation is attributable to alteration in the lipid-rich layer of the cell wall caused by OH radicals.

  9. Ionizing radiation damage in Micrococcus radiodurans cell wall: release of polysaccharide

    International Nuclear Information System (INIS)

    Mitchel, R.E.J.

    1976-01-01

    Sublethal 60 Co γ-irradiation of the bacterium Micrococcus radiodurans in aqueous suspension results in a loss of up to 6 percent of its cellular dry weight and 30 percent of its wet weight. In the process some specific cell wall polysaccharides, including a polymer of glucose and N-acylated glucosamine, are released into the surrounding medium. These polysaccharides appear to originate from a hydrophobic site in the middle, lipid-rich, cell wall layer. The damage to this layer which results in the release of these and other polymers may be due to a disruption of this hydrophobic site. The polysaccharide containing glucose and N-acylated glucosamine exists as a high molecular weight polymer in unirradiated cells, but irradiation causes some degradation prior to release. In a free state this polysaccharide is considerably less sensitive to radiolytic degradation than in a bound state. Free radicals generated from surrounding water by ionizing radiation initiate the release, hydroxyl radicals being the most important species. Oxygen protects the cell wall against loss of the polysaccharides, apparently by a mechanism which does not depend on the ability of O 2 to scavenge hydrogen atoms and aqueous electrons

  10. Effect of cordycepin(3'-deoxyadenosine) on excision repair of 5,6-dihydroxy-dihydrothymine-type products from the DNA of Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Patil, M.S.; Tundo, V.J.; Locher, S.E.; Hariharan, P.V.

    1983-01-01

    Cordycepin(3'-deoxyadenosine), a nucleoside analog, has been shown to enhance radiation-induced cell killing. In an effort to elucidate the possible mechanism for enhancement of cell killing, the effect of cordycepin on the excision repair of radiation-induced 5,6-dihydroxy-dihydrothymine-type (t') products from the DNA of wild type Micrococcus radiodurans was investigated. The capacity of M. radiodurans to excise nondimeric (t') products from its DNA was significantly impaired after cordycepin treatment. The results suggest that the increased radiation sensitivity of cordycepin-treated cells could be due to alterations in cellular processes that repair DNA damage

  11. Involvement of hydroxyl radicals in the release by ionizing radiation of a cell surface nuclease from Micorcoccus radiodurans

    International Nuclear Information System (INIS)

    Mitchel, R.E.J.

    1975-01-01

    The ionizing radiation-induced release of a surface exonuclease from Micrococcus radiodurans is to a large extent inhibited by the removal of water. Irradiation of a cell suspension saturated with O 2 (an effective aqueous electron and hydrogen atom scavenger) allows the same release as irradiation in the presence of N 2 . Ethanol (a good hydroxyl radical scavenger) protects the enzyme from release. These data suggest that hydroxyl radicals produced by the radiolysis of water are important releasing agents. Hydroxyl radicals produced by the ultraviolet decomposition of H 2 O 2 were effective in releasing the enzyme

  12. Deinococcus gobiensis cold shock protein improves salt stress tolerance of escherichia coli

    International Nuclear Information System (INIS)

    Jiang Shijie; Wang Jin; Yang Mingkun; Chen Ming; Zhang Wei; Luo Xuegang

    2013-01-01

    The Deinococcus gobiensis I-0, an extremely radiation-resistant bacterium, isolated from the Gobi, has superior resistance to abiotic stress (e.g radiation, oxidation, dehydration and so on). The two cold-shock proteins encoded by csp1 (Dgo_CA1136) and csp2 (Dgo_PA0041) were identified in the complete genome sequence of D. gobiensis. In this study, we showed that D. gobiensis Csp1 protected Escherichia coli cells against cold shock and other abiotic stresses such as salt and osmotic shocks. The quantitative real-time PCR assay shows that the expression of trehalose synthase (otsA, otsB) was up-regulated remarkably under salt stress in the csp1-expressing strain, while no difference in the expression of the genes involved in trehalose degradation (treB and treC). The results suggested that Csp1 caused the accumulation of the trehalose was a major feature for improving tolerance to salt stress in E. coli. (authors)

  13. Micrococcus radiodurans surface exonuclease. Dimer to monomer conversion by ionizing radiation-generated aqueous free radicals

    Energy Technology Data Exchange (ETDEWEB)

    Mitchel, R E.J.

    1980-01-01

    Micrococcus radiodurans possesses an exonuclease firmly bound to a middle cell wall membrane layer. Aqueous OH/sup -/ radicals generated chemically or by ionizing radiation cause the immediate release of this enzyme into the surrounding medium. The enzyme is located in a hydrophobic site and can also be released by aqueous n-butanol. When extracted by this solvent it is a non-covalently linked dimer and has a molecular weight of 260,000 as determined by gel filtration. When released by radiation generated OH/sup -/ radicals, the enzyme initially appears in solution as the dimer but is rapidly split by further aqueous radical attack into two 130,000 molecular weight subunits. Hydroxyl radicals are most effective but reducing radicals are also able to monomerize the enzyme. Only the released dimer enzyme is subject to free radical monomerization. Bound dimer enzyme is not split prior to release. No detectable loss of activity or change in catalytic properties accompanies the free radical cleavage of the enzyme. Both subunits of the dimer enzyme possess a tightly bound metal ion (probably Ca/sup 2 +/) required for activity. The monomer but not the dimer enzyme will bind to an anion exchanger. The monomer is susceptible to loss of its metal ion, and consequent inactivation, when exposed to the exchanger in the absence of Ca/sup 2 +/. Besides providing information on some of the immediate non-lethal effects of ionizing radiation, the behavior of this enzyme system demonstrates a potential cellular mechanism by which internally or externally generated free radicals could be utilized by the cell to control various enzymic reactions.

  14. Oracle BAM 11gR1 Handbook

    CERN Document Server

    Wang, Pete

    2012-01-01

    "Oracle BAM 11gR1 Handbook" is a practical best practices tutorial focused entirely on Oracle Business Activity Monitoring. An intermediate-to-advanced guide, step-by-step instructions and an accompanying demo project will help SOA report developers through application development and producing dashboards and reports. If you are a developer/report developer or SOA Architect who wants to learn valuable Oracle BAM best practices for monitoring your operations in real time, then "Oracle BAM 11gR1 Handbook" is for you. Administrators will also find the book useful. You should already be comfortabl

  15. Irradiation routine in the IPR-R1 Triga reactor

    International Nuclear Information System (INIS)

    Maretti Junior, F.

    1980-01-01

    Information about irradiations in the IPR-R1 TRIGA reactor and procedures necessary for radioisotope solicitation are presented All procedures necessary for asking irradiation in the reactor, shielding types, norms of terrestrial and aerial expeditions, payment conditions, and catalogue of disposable isotopes with their respective saturation activities are described. (M.C.K.)

  16. IEA-R1 reactor - Spent fuel management

    International Nuclear Information System (INIS)

    Mattos, J.R.L. De

    1996-01-01

    Brazil currently has one Swimming Pool Research Reactor (IEA-R1) at the Instituto de Pesquisas Energeticas e Nucleares - Sao Paulo. The spent fuel produced is stored both at the Reactor Pool Storage Compartment and at the Dry Well System. The present situation and future plans for spent fuel storage are described. (author). 3 refs, 2 figs, 2 tabs

  17. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Daly, Michael J.

    2005-06-01

    Natural selection in highly radioactive waste sites may yield bacteria with favorable bioremediating characteristics. However, until recently the microbial ecology of such environments has remained unexplored because of the high costs and technical complexities associated with extracting and characterizing samples from such sites. We have examined the bacterial ecology within radioactive sediments from a high-level nuclear waste plume in the vadose zone on the DOE?s Hanford Site in south-central Washington state (Fredrickson et al, 2004). Manganese-dependent, radiation resistant bacteria have been isolated from this contaminated site including the highly Mn-dependent Deinococcus and Arthrobacter spp.

  18. Dormancy in Deinococcus sp. UDEC-P1 as a survival strategy to escape from deleterious effects of carbon starvation and temperature.

    Science.gov (United States)

    Guerra, Matías; González, Karina; González, Carlos; Parra, Boris; Martínez, Miguel

    2015-09-01

    Dormancy is characterized by low metabolism and absence of protein synthesis and cellular division enabling bacterial cells to survive under stress. The aim was to determine if carbon starvation and low temperature are factors that modify the proportion of dormant/active cells in Deinococcus sp. UDEC-P1. By flow cytometry, RedoxSensor Green (RSG) was used to quantify metabolic activity and Propidium Iodide (PI) to evaluate membrane integrity in order to determine the percentage of dormant cells. Cell size and morphology were determined using scanning electronic microscopy. Under carbon starvation at 30°C, Deinococcus sp. UDEC-P1 increased its proportion of dormant cells from 0.1% to 20%, decreased the count of culturable cells and average cell volume decreased 7.1 times. At 4°C, however, the proportion of dormant cells increased only to 6%, without a change in the count of culturable cells and an average cellular volume decrease of 4.1 times and 3% of the dormant cells were able to be awakened. Results indicate a greater proportion of dormant Deinococcus sp. UDEC-P1 cells at 30ºC and it suggests that carbon starvation is more deleterious condition at 30ºC than 4ºC. For this reason Deinococcus sp. UDEC-P1 cells are more likely to enter into dormancy at higher temperature as a strategy to survive. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

  19. Electrical system regulations of the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Mello, Jose Roberto de; Madi Filho, Tufic

    2013-01-01

    The IEA-R1 reactor of the Nuclear and Energy Research Institute (IPEN-CNEN/SP), is a research reactor open pool type, designed and built by the U.S. firm Babcock and Wilcox, having, as coolant and moderator, deionized light water and beryllium and graphite, as reflectors. Until about 1988, the reactor safety systems received power from only one source of energy. As an example, it may be cited the control desk that was powered only by the vital electrical system 220V, which, in case the electricity fails, is powered by the generator group: no-break 220V. In the years 1989 and 1990, a reform of the electrical system upgrading to increase the reactor power and, also, to meet the technical standards of the ABNT (Associacao Brasileira de Normas Tecnicas) was carried out. This work has the objective of showing the relationship between the electric power system and the IEA-R1 reactor security. Also, it demonstrates that, should some electrical power interruption occur, during the reactor operation, this occurrence would not start an accident event. (author)

  20. IPR-R1 TRIGA research reactor decommissioning plan

    International Nuclear Information System (INIS)

    Andrade Grossi, Pablo; Oliveira de Tello, Cledola Cassia; Mesquita, Amir Zacarias

    2008-01-01

    The International Atomic Energy Agency (IAEA) is concerning to establish or adopt standards of safety for the protection of health, life and property in the development and application of nuclear energy for peaceful purposes. In this way the IAEA recommends that decommissioning planning should be part of all radioactive installation licensing process. There are over 200 research reactors that have either not operated for a considerable period of time and may never return to operation or, are close to permanent shutdown. Many countries do not have a decommissioning policy, and like Brazil not all installations have their decommissioning plan as part of the licensing documentation. Brazil is signatory of Joint Convention on the safety of spent fuel management and on the safety of radioactive waste management, but until now there is no decommissioning policy, and specifically for research reactor there is no decommissioning guidelines in the standards. The Nuclear Technology Development Centre (CDTN/CNEN) has a TRIGA Mark I Research Reactor IPR-R1 in operation for 47 years with 3.6% average fuel burn-up. The original power was 100 k W and it is being licensed for 250 k W, and it needs the decommissioning plan as part of the licensing requirements. In the paper it is presented the basis of decommissioning plan, an overview and the end state / final goal of decommissioning activities for the IPR-R1, and the Brazilian ongoing activities about this subject. (author)

  1. Catalyst of D. radiodurans LexA protein and its induced catalysis at alkaline pH activated by RecA

    International Nuclear Information System (INIS)

    Kong Xiangrong; Liu Fenju; Su Liaoyuan

    2003-01-01

    It is to study the catalytic reaction of LexA at alkaline pH. It has been observed that reaction has taken place under two conditions of D. radiodurans and LexA. Methods: The method of SDS polypropylene amine was adopted to make dyeing with R-250. Results: The result showed that there were no reactions when LexA protein turned to be at pH 7.0 and pH 8.0, the entire LexA protein was decreased a little at pH 9.0, while at pH 10.0, LexA protein started to decompose greatly, the fractions of protein can be seen obviously in the electrophoresis belt. Conclusion: The D. radiodurans and LexA protein will automatically drop at 37 degree C when D radiodurans LexA is at higher pH value, and its dependence on alkaline pH conditions reflects that the catalytic needs to be activated by the reaction of de- pH indicator of LexA protein ionization

  2. The Deinococcus-Thermus phylum and the effect of rRNA composition on phylogenetic tree construction

    Science.gov (United States)

    Weisburg, W. G.; Giovannoni, S. J.; Woese, C. R.

    1989-01-01

    Through comparative analysis of 16S ribosomal RNA sequences, it can be shown that two seemingly dissimilar types of eubacteria Deinococcus and the ubiquitous hot spring organism Thermus are distantly but specifically related to one another. This confirms an earlier report based upon 16S rRNA oligonucleotide cataloging studies (Hensel et al., 1986). Their two lineages form a distinctive grouping within the eubacteria that deserved the taxonomic status of a phylum. The (partial) sequence of T. aquaticus rRNA appears relatively close to those of other thermophilic eubacteria. e.g. Thermotoga maritima and Thermomicrobium roseum. However, this closeness does not reflect a true evolutionary closeness; rather it is due to a "thermophilic convergence", the result of unusually high G+C composition in the rRNAs of thermophilic bacteria. Unless such compositional biases are taken into account, the branching order and root of phylogenetic trees can be incorrectly inferred.

  3. Synthesis of Hyperbranched Glycoconjugates by the Combined Action of Potato Phosphorylase and Glycogen Branching Enzyme from Deinococcus geothermalis

    Directory of Open Access Journals (Sweden)

    Katja Loos

    2012-02-01

    Full Text Available Potato phosphorylase is able to synthesize linear polyglucans from maltoheptaose primers. By coupling maltoheptaose to butane diamine, tris(2-aminoethylamine and amine functionalized amine functionalized poly ethyleneglycol (PEG, new primer molecules became available. The resulting di-, tri- and macro-primers were incubated with potato phosphorylase and glycogen branching enzyme from Deinococcus geothermalis. Due to the action of both enzymes, hyperbranched polyglucan arms were grown from the maltoheptaose derivatives with a maximum degree of branching of 11%. The size of the synthesized hyperbranched polyglucans could be controlled by the ratio monomer over primer. About 60%–80% of the monomers were incorporated in the glycoconjugates. The resulting hyperbranched glycoconjugates were subjected to Dynamic Light Scattering (DLS measurements in order to determine the hydrodynamic radius and it became obvious that the structures formed agglomerates in the range of 14–32 nm.

  4. Performance and management of IPR-R1 fuel elements

    International Nuclear Information System (INIS)

    Stasiulevicius, R.; Maretti Junior, F.

    1983-01-01

    The performance of fuel elements during the 23 years of the reactor operation, is presented aiming to introduce improvements in the fuel load distribution and consequent increase of the reactivity. A computer code CORE was developed aiming to calculate the individual burnup of the fuel elements and the value of the reactivity for several core configurations, establishing a routine to control the nuclear material in the IPR-R1. The values calculated were compared with the experimental results. Some alternatives to augment the reactivity of the present core are presented foreseeing the fuel load availability for operation with 100Km and, for angmenting the power reaction in a next stage. (E.G.) [pt

  5. Molecular characterization of the Jatropha curcas JcR1MYB1 gene encoding a putative R1-MYB transcription factor

    Directory of Open Access Journals (Sweden)

    Hui-Liang Li

    2014-09-01

    Full Text Available The cDNA encoding the R1-MYB transcription factor, designated as JcR1MYB1, was isolated from Jatropha curcas using rapid amplification of cDNA ends. JcR1MYB1 contains a 951 bp open reading frame that encodes 316 amino acids. The deduced JcR1MYB1 protein was predicted to possess the conserved, 56-amino acid-long DNA-binding domain, which consists of a single helix-turn-helix module and usually occurs in R1-MYBs. JcR1MYB1 is a member of the R1-MYB transcription factor subfamily. A subcellular localization study confirmed the nuclear localization of JcR1MYB1. Expression analysis showed that JcR1MYB1 transcripts accumulated in various examined tissues, with high expression levels in the root and low levels in the stem. JcR1MYB1 transcription was up-regulated by polyethylene glycol, NaCl, and cold treatments, as well as by abscisic acid, jasmonic acid, and ethylene treatment. Analysis of transgenic tobacco plants over-expressing JcR1MYB1 indicates an inportant function for this gene in salt stress.

  6. Neutron radiography in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Pugliesi, R.; Moraes, A.P.V. de; Yamazaki, I.M.; Freitas Acosta, C. de.

    1988-08-01

    Neutronradiography of several materials have been obtained at the IEA-R1 Nuclear Research Reactor (IPEN-CNEN/SP), by means of two conversion techniques: a) (n, α) at the beam-hole n 0 3 where a collimated thermal neutron beam, exposure area 4 cm x 8cm and flux at the sample 10 5 n/s cm 2 is obtained. The film used was the CN-85 cellulose nitrate coated with lithium tetraborate (conversor). The time irradiation of the film was 15 minutes and in following was eteched during 30 minutes in a NaOH(10%) aqueous solution at a constant temperature of 60 0 C.; b) (n,γ) by using an experimental arrangement installed in the botton of the pool of the reactor. The flux of the collimated neutron beam is 10 5 n/s/cm 2 at the sample and the conversion is made by means of a dysprozium sheet. The film used was Kodak T-5. The irradiation and the transfering time was 2 hours and 20 hours respectively. (author) [pt

  7. Mechanical response of shock conditioned HPNS-5 (R-1) grout

    International Nuclear Information System (INIS)

    Plannerer, H.N.

    1997-01-01

    HPNS-5 (R-1) grout is a portland cement formulated mix designed for use as a rigid containment plug in vertical boreholes at the Nevada Test Site. Coincident with field testing of this grout in 1991 and 1992 , two arums of the grout mix were collected and positioned in the by pass drift of the DISTANT ZENITH event to expose the grout to passage of a nuclear driven stress wave. The drums were later retrieved to determine the mechanical behavior of the shock conditioned grout. Sealed hollow tubes positioned within the grout-filled drums to detect ductile flow on passage of the stress wave were found partially to completely filled with HPNS-5 grout following the experiment. Static mechanical tests support the evidence for ductile flow and place the transition from brittle fracture failure to ductile behavior in the shock conditioned grout at a confining stress between ambient and 5 MPa (725 psi). Uniaxial and triaxial tests delineated a stress-strain field for interstice collapse that interposes between the mechanics of linear elastic deformation and dilatancy. Hydrostatic stress loading between 25 MPa (3.6 ksi) and 60 MPa (8.7 ksi) results in a significant change of permanent set from 1% to greater than 15% volume strain

  8. New burnup calculation of TRIGA IPR-R1 reactor

    International Nuclear Information System (INIS)

    Meireles, Sincler P. de; Campolina, Daniel de A.M.; Santos, Andre A. Campagnole dos; Menezes, Maria A.B.C.; Mesquita, Amir Z.

    2015-01-01

    The IPR-R1 TRIGA Mark I research reactor, located at the Nuclear Technology Development Center - CDTN, Belo Horizonte, Brazil, operates since 1960.The reactor is operating for more than fifty years and has a long history of operation. Determining the current composition of the fuel is very important to calculate various parameters. The reactor burnup calculation has been performed before, however, new techniques, methods, software and increase of the processing capacity of the new computers motivates new investigations to be performed. This work presents the evolution of effective multiplication constant and the results of burnup. This new model has a more detailed geometry with the introduction of the new devices, like the control rods and the samarium discs. This increase of materials in the simulation in burnup calculation was very important for results. For these series of simulations a more recently cross section library, ENDF/B-VII, was used. To perform the calculations two Monte Carlo particle transport code were used: Serpent and MCNPX. The results obtained from two codes are presented and compared with previous studies in the literature. (author)

  9. Microarray analysis in the archaeon Halobacterium salinarum strain R1.

    Directory of Open Access Journals (Sweden)

    Jens Twellmeyer

    Full Text Available BACKGROUND: Phototrophy of the extremely halophilic archaeon Halobacterium salinarum was explored for decades. The research was mainly focused on the expression of bacteriorhodopsin and its functional properties. In contrast, less is known about genome wide transcriptional changes and their impact on the physiological adaptation to phototrophy. The tool of choice to record transcriptional profiles is the DNA microarray technique. However, the technique is still rarely used for transcriptome analysis in archaea. METHODOLOGY/PRINCIPAL FINDINGS: We developed a whole-genome DNA microarray based on our sequence data of the Hbt. salinarum strain R1 genome. The potential of our tool is exemplified by the comparison of cells growing under aerobic and phototrophic conditions, respectively. We processed the raw fluorescence data by several stringent filtering steps and a subsequent MAANOVA analysis. The study revealed a lot of transcriptional differences between the two cell states. We found that the transcriptional changes were relatively weak, though significant. Finally, the DNA microarray data were independently verified by a real-time PCR analysis. CONCLUSION/SIGNIFICANCE: This is the first DNA microarray analysis of Hbt. salinarum cells that were actually grown under phototrophic conditions. By comparing the transcriptomics data with current knowledge we could show that our DNA microarray tool is well applicable for transcriptome analysis in the extremely halophilic archaeon Hbt. salinarum. The reliability of our tool is based on both the high-quality array of DNA probes and the stringent data handling including MAANOVA analysis. Among the regulated genes more than 50% had unknown functions. This underlines the fact that haloarchaeal phototrophy is still far away from being completely understood. Hence, the data recorded in this study will be subject to future systems biology analysis.

  10. Modification of the IAN-R1 reactor

    International Nuclear Information System (INIS)

    Jaime, J.; Ahumada, S.; Spin, R.A.

    1990-01-01

    The IAN-R1 reactor is the only nuclear reactor operating in Colombia; it is installed at the Institute of Nuclear Affairs (AIN) in Bogota, which is an official body coming under the Ministry of Mining and Energy. This reactor started operation in January 1965 with a rated power of 10 kW and was modified a year later to operate at 20 kW, which has been its rated power up to the present. Given its importance for the application of nuclear technology in Columbia for various purposes, principally in the areas of neutron activation analysis, determination of uranium content in minerals using the delayed neutron counting method, production of certain radioisotopes such as 198 Au and 82 Br for engineering applications, and production of radioactive material for teaching and research purposes, research has been in progress for some years into ways of increasing its power. The study on experimental requirements and on the demand for locally produced radioisotopes came to the conclusion that its power should be increased to 1000 kW, which would allow the facility to remain on the same site. The modification includes conversion of the core to low-enriched fuel, operation up to 1 MW, modification of the shielding, renovation of instrumentation and installation of a radioisotope processing plant. When the reactor is modified we will be able to produce other radioisotopes for applications in nuclear medicine, industry and engineering; at the same time, the safety of the facility will be optimized and the experimental facilities improved

  11. Current activities at the FiR 1 TRIGA reactor

    International Nuclear Information System (INIS)

    Salmenhaara, Seppo

    2002-01-01

    The FiR 1 -reactor, a 250 kW Triga reactor, has been in operation since 1962. The main purpose to run the reactor is now the Boron Neutron Capture Therapy (BNCT). The epithermal neutrons needed for the irradiation of brain tumor patients are produced from the fast fission neutrons by a moderator block consisting of Al+AlF 3 (FLUENTAL), which showed to be the optimum material for this purpose. Twenty-one patients have been treated since May 1999, when the license for patient treatment was granted to the responsible BNCT treatment organization. The treatment organization has a close connection to the Helsinki University Central Hospital. The BNCT work dominates the current utilization of the reactor: three days per week for BNCT purposes and only two days per week for other purposes such as the neutron activation analysis and isotope production. In the near future the back end solutions of the spent fuel management will have a very important role in our activities. The Finnish Parliament ratified in May 2001 the Decision in Principle on the final disposal facility for spent fuel in Olkiluoto, on the western coast of Finland. There is a special condition in our operating license. We have now about two years' time to achieve a binding agreement between VTT and the Nuclear Power Plant Companies about the possibility to use the final disposal facility of the Nuclear Power Plants for our spent fuel. If this will not happen, we have to make the agreement with the USDOE with the well-known time limits. At the moment it seems to be reasonable to prepare for both spent fuel management possibilities: the domestic final disposal and the return to the USA offered by USDOE. Because the cost estimates of the both possibilities are on the same order of magnitude, the future of the reactor itself will determine, which of the spent fuel policies will be obeyed. In a couple of years' time it will be seen, if the funding of the reactor and the incomes from the BNC treatments will cover

  12. Data of evolutionary structure change: 1R1YC-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1R1YC-2ZLWD 1R1Y 2ZLW C D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ex> 2ZLW D 2ZLWD WDK

  13. Radio evidence for the initial stellar mass function in the R associations CMa R1, Mon R1, Mon R2

    International Nuclear Information System (INIS)

    Pyatunina, T.B.

    1985-01-01

    The R associations CMa R1 and Mon R1 have been searched for compact 7.6-cm sources with the RATAN-600 radio telescope. The Mon R1 region shows only about the expected number of background radio galaxies; in CMa R1 seven sources of small angular size with S> or =30 mJy have been found, two of them probably background objects. Comparison with optical data for CMa R1, together with previous RATAN-600 data for Mon R2, yields an initial mass function xi(M)proportionalM/sup -2.7plus-or-minus0.7/ for the rather massive (Mroughly-equal10 M/sub sun/) stars in these associations

  14. 26 CFR 1.414(r)-1 - Requirements applicable to qualified separate lines of business.

    Science.gov (United States)

    2010-04-01

    ... lines of business. 1.414(r)-1 Section 1.414(r)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Plans, Etc. § 1.414(r)-1 Requirements applicable to qualified separate lines of business. (a) In general. Section 414(r) prescribes the conditions under which an employer is treated as operating qualified...

  15. Review of anticancer and antioxidant activities of radioresistant ...

    African Journals Online (AJOL)

    Prof. Ogunji

    mechanism underlying the tolerance of these organisms to ionizing radiation. ... radiation dose environment, drastic temperature variations and high salinity ... extremophile like Deinococcus radiodurans for instance, is highly dependent on.

  16. Inactivation of bacterial spores by combination processes: ultraviolet plus gamma radiation. [Streptococcus faecium, micrococcus radiodurans, clostridium botulinum

    Energy Technology Data Exchange (ETDEWEB)

    Grecz, N; Durban, E

    1973-01-01

    Bacterial spores, viruses and some vegetative bacteria such as Streptococcus faecium and Micrococcus radiodurans are distinguished by high radiation resistance. In order to lay a theoretical basis for biomedical sterilization applications, we have investigated the combined action of uv and gamma rays. Spores of two strains of C. botulinum were selected, a highly radiation resistant strain, 33A having a D/sub 10/-value of 0.32 Mrad, and a relatively radiation sensitive strain, 51B having a D/sub 10/-value of 0.12 Mrad. Strain 33A exhibits an extensive initial ''shoulder'' in its uv as well as gamma ray survival curves; strain 51B shows only a slight shoulder. The shoulder in the gamma ray survival curve of spores of strain 33A could be reduced or completely eliminated by preirradiation with uv. Simultaneously the D/sub 10/-value for gamma inactivation of spores of 33A was reduced substantially. For example, the gamma resistance was reduced almost to half of its original D/sub 10/-value by uv-preirradiation for only one minute under an 8 watt GE germicidal lamp. The effect of uv-preirradiation on the radiation sensitive strain 51B was less pronounced. In fact, there was about seven fold higher positive interaction (synergism) between uv and gamma radiation in 33A spores than in 51B spores. The experiments suggest that interference with DNA repair enzymes in the radiation resistant strain are responsible for lethal synergism between uv and gamma radiation. A hypothesis is developed attempting to explain the combined effect of these two radiations in terms of a special summation of known DNA lesions in the cell. These observations emphasize the potential practical advantages of combining uv and gamma rays for effective sterilization of certain biomedical devices, drugs and biologicals.

  17. Benchmarking circumferential resection margin (R1) resection rate for rectal cancer in the neoadjuvant era.

    Science.gov (United States)

    Chambers, W; Collins, G; Warren, B; Cunningham, C; Mortensen, N; Lindsey, I

    2010-09-01

    Circumferential resection margin (CRM) involvement (R1) is used to audit rectal cancer surgical quality. However, when downsizing chemoradiation (dCRT) is used, CRM audits both dCRT and surgery, its use reflecting a high casemix of locally advanced tumours. We aimed to evaluate predictors of R1 and benchmark R1 rates in the dCRT era, and to assess the influence of failure of steps in the multidisciplinary team (MDT) process to CRM involvement. A retrospective analysis of prospectively collected rectal cancer data was undertaken. Patients were classified according to CRM status. Uni- and multivariate analysis was undertaken of risk factors for R1 resection. The contribution of the steps of the MDT process to CRM involvement was assessed. Two hundred and ten rectal cancers were evaluated (68% T3 or T4 on preoperative staging). R1 (microscopic) and R2 (macroscopic) resections occurred in 20 (10%) and 6 patients (3%), respectively. Of several factors associated with R1 resections on univariate analysis, only total mesorectal excision (TME) specimen defects and threatened/involved CRM on preoperative imaging remained as independent predictors of R1 resections on multivariate analysis. Causes of R1 failure by MDT step classification found that less than half were associated with and only 15% solely attributable to a suboptimal TME specimen. Total mesorectal excision specimen defects and staging-predicted threatened or involved CRM are independent strong predictors of R1 resections. In most R1 resections, the TME specimen was intact. It is important to remember the contribution of both the local staging casemix and dCRT failure when using R1 rates to assess purely surgical competence.

  18. Haplo-insufficiency of both BubR1 and SGO1 accelerates cellular senescence

    Directory of Open Access Journals (Sweden)

    Sung-Hyun Park

    2016-02-01

    Full Text Available Abstract Background Spindle assembly checkpoint components BubR1 and Sgo1 play a key role in the maintenance of chromosomal instability during cell division. These proteins function to block the anaphase entry until all condensed chromosomes have been attached by the microtubules emanating from both spindle poles. Haplo-insufficiency of either BubR1 or SGO1 results in enhanced chromosomal instability and tumor development in the intestine. Recent studies show that spindle checkpoint proteins also have a role in slowing down the ageing process. Therefore, we want to study whether haplo-insufficiency of both BubR1 and SGO1 accelerates cellular senescence in mice. Methods We took advantage of the availability of BubR1 and SGO1 knockout mice and generated primary murine embryonic fibroblasts (MEFs with mutations in either BubR1, SGO1, or both and analyzed cellular senescence of the MEFs of various genetic backgrounds. Results We observed that BubR1 +/− SGO +/− MEFs had an accelerated cellular senescence characterized by morphological changes and expressed senescence-associated β-galactosidase. In addition, compared with wild-type MEFs or MEFs with a single gene deficiency, BubR1 +/− SGO1 +/− MEFs expressed enhanced levels of p21 but not p16. Conclusions Taken together, our observations suggest that combined deficiency of BubR1 and Sgo1 accelerates cellular senescence.

  19. Thermal hydraulic analysis of the IPR-R1 TRIGA reactor; Analise termo-hidraulica do reator TRIGA IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Veloso, Marcelo Antonio [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil); Fortini, Maria Auxiliadora [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear

    2002-07-01

    The subchannel approach, normally employed for the analysis of power reactor cores that work under forced convection, have been used for the thermal hydraulic evaluation of a TRIGA Mark I reactor, named IPR-R1, at 250 kW power level. This was accomplished by using the PANTERA-1P subchannel code, which has been conveniently adapted to the characteristics of natural convection of TRIGA reactors. The analysis of results indicates that the steady state operation of IPR-R1 at 250 kW do not imply risks to installations, workers and public. (author)

  20. Loss of covalently linked lipid as the mechanism for radiation-induced release of membrane-bound polysaccharide and exonuclease from Micrococcus radiodurans

    International Nuclear Information System (INIS)

    Mitchel, R.E.J.

    1981-01-01

    The mechanism of γ-radiation-induced release of polysaccharide and exonuclease from the midwall membrane of Micrococcus radiodurans has been examined. These two components appear to be released independently, but by very similar processes. Direct analysis of radiation-released polysaccharide indicated the absence of an alkali-labile neutral lipid normally present in the native material. Radiation-induced release therefore probably results from the radiolytic cleavage of a covalently linked lipid which normally serves to anchor these substances to the membrane. The absence of a natural membrane-bound carotenoid had no effect on the rate of release of these components. Likewise, the absence of exonuclease in an exonuclease minus mutant did not influence the release of polysaccharide. It is suggested that the major pathway of radical transfer from the initiating .OH and culminating in the cleavage of the neutral lipid anchor may not be via the membrane

  1. Intelligence and Information-Sharing Elements of S.4 and H.R. 1

    National Research Council Canada - National Science Library

    Masse, Todd

    2007-01-01

    Title I of S.4 and Title VII of H.R. 1 include corresponding measures related to enhancing information and intelligence sharing, both horizontally within the Federal Government and vertically between the Federal Government and state...

  2. Measurement of β/Λ ratio in IEA-R1 reactor using noise technique

    International Nuclear Information System (INIS)

    Moreira, J.M.L.; Kassar, E.

    1986-01-01

    The ratio β/Λ for the IEA-R1 reactor is obtained experimentally through the noise analysis technique. This technique is based on the determination of the power spectral density of the reactor neutron population, with the reactor in a subcritical state driven by a 'white' neutron source. A ratio β/Λ of 43,5 s -1 is estimated from the break frequency of the measured transfer function of the IEA-R1 reactor. (Author) [pt

  3. Mammalian ChlR1 has a role in heterochromatin organization

    International Nuclear Information System (INIS)

    Inoue, Akira; Hyle, Judith; Lechner, Mark S.; Lahti, Jill M.

    2011-01-01

    The ChlR1 DNA helicase, encoded by DDX11 gene, which is responsible for Warsaw breakage syndrome (WABS), has a role in sister-chromatid cohesion. In this study, we show that human ChlR1 deficient cells exhibit abnormal heterochromatin organization. While constitutive heterochromatin is discretely localized at perinuclear and perinucleolar regions in control HeLa cells, ChlR1-depleted cells showed dispersed localization of constitutive heterochromatin accompanied by disrupted centromere clustering. Cells isolated from Ddx11 -/- embryos also exhibited diffuse localization of centromeres and heterochromatin foci. Similar abnormalities were found in HeLa cells depleted of combinations of HP1α and HP1β. Immunofluorescence and chromatin immunoprecipitation showed a decreased level of HP1α at pericentric regions in ChlR1-depleted cells. Trimethyl-histone H3 at lysine 9 (H3K9-me3) was also modestly decreased at pericentric sequences. The abnormality in pericentric heterochromatin was further supported by decreased DNA methylation within major satellite repeats of Ddx11 -/- embryos. Furthermore, micrococcal nuclease (MNase) assay revealed a decreased chromatin density at the telomeres. These data suggest that in addition to a role in sister-chromatid cohesion, ChlR1 is also involved in the proper formation of heterochromatin, which in turn contributes to global nuclear organization and pleiotropic effects. -- Highlights: → New role for ChlR1 (DDX11), a cohesinopathy gene, in heterochromatin organization. → Loss of ChlR1 altered heterochromatin localization and centromere clustering. → Reduced ChlR1 levels also reduced HP1α and H3K9-me3 binding to pericentric DNA. → Decreased DNA methylation was found in pericentric repeats of Ddx11 -/- embryos. → These findings will aid in understanding the pathogenesis of Warsaw breakage syndrome.

  4. Irradiation experience of IPEN fuel at IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Perrotta, Jose A.; Neto, Adolfo; Durazzo, Michelangelo; Souza, Jose A.B. de; Frajndlich, Roberto

    1998-01-01

    IPEN/CNEN-SP produces, for its IEA-R1 Research Reactor, MTR fuel assemblies based on U 3 O 8 -Al dispersion fuel type. Since 1985 a qualification program on these fuel assemblies has been performed. Average 235 U burnup of 30% and peak burnup of 50% was already achieved by these fuel assemblies. This paper presents some results acquire, by these fuel assemblies, under irradiation at IEA-R1 Research Reactor. (author)

  5. Manumycin A Is a Potent Inhibitor of Mammalian Thioredoxin Reductase-1 (TrxR-1).

    Science.gov (United States)

    Tuladhar, Anupama; Rein, Kathleen S

    2018-04-12

    The anticancer effect of manumycin A (Man A) has been attributed to the inhibition of farnesyl transferase (FTase), an enzyme that is responsible for post-translational modification of Ras proteins. However, we have discovered that Man A inhibits mammalian cytosolic thioredoxin reductase 1 (TrxR-1) in a time-dependent manner, with an IC 50 of 272 nM with preincubation and 1586 nM without preincubation. The inhibition of TrxR-1 by Man A is irreversible and is the result of a covalent interaction between Man A and TrxR-1. Evidence presented herein demonstrates that Man A forms a Michael adduct with the selenocysteine residue, which is located in the C-terminal redox center of TrxR-1. Inhibitors of TrxR-1, which act through this mechanism, convert TrxR-1 into a SecTRAP, which utilizes NADPH to reduce oxygen to superoxide radical anion (O 2 -• ).

  6. NEW DERIVATIVES OF 2-R1-N-(5-R-1,3,4-THIADIAZOL-2-YL-BENZOLSULFONAMIDES: SYNTHESIS, PHYSICOCHEMICAL PROPERTIES AND BIOLOGICAL ACTIVITY PREDICTION

    Directory of Open Access Journals (Sweden)

    Sych I.V.

    2015-12-01

    Full Text Available Introduction: The analysis of modern literature, including overseas one, showed that a lot of the scientific researches is devoted to finding and creating biologically active compounds on base 1,3,4-thiadiazole. Derivatives of 1,3,4-thiadiazole are the large group of heterocyclic compounds with high rates of antimicrobial, antituberculosis, antidiabetic, antineoplastic and anticonvulsant activity. Material and methods: The purpose of this study was the expansion of sulfone derivatives substituted nitrogen-containing heterocyclic systems through the synthesis of 2-R1-N (5-R-1,3,4-thiadiazol-2-ilbenzolsulfonamides and prediction their pharmacological activity for future planning pharmacological screening. Synthesis of semi-products 2-amino-5-R-1,3,4-thiadiazoles was carried out by cyclization thiosemicarbazide and substituted derivatives of carboxylic acids in the presence of concentrated sulfuric acid. The synthesis of target compounds 2-R1-N(5-R-1,3,4-thiadiazol-2-ylbenzolsulfon-amides was carried out by N-acylation of 2-amino-5R-1,3,4-thiadiazole substituted benzolsul-fochlorides in the presence of anhydrous pyridine. The reaction proceeds by the classic SN2-mechanism. The resulting compounds are white crystalline substances, soluble in alcohol, chloroform and acetone, difficult to dissolve in water. Yields of obtained compounds was satisfactory (76-84%. The purity of the obtained compounds was determined by TLC. The structure of the obtained compounds was proved by elemental analysis, IR methods and 1H NMR spectroscopy. NMR 1H spectra were recorded at Bruker WM spectrometer (200 MHz; solvent DMSO-d6; chemical shifts were in ppm, internal standard (TMS (tetramethylsilane was used. The prognosis of biological activity for obtained compounds were carried out using the program PASS (Prediction of Activity Spectra for Substances in order to plan the further pharmacological screening. The program PASS predicts more than 500 kinds of biological

  7. Alterations in CD200-CD200R1 System during EAE Already Manifest at Presymptomatic Stages

    Directory of Open Access Journals (Sweden)

    Tony Valente

    2017-05-01

    Full Text Available In the brain of patients with multiple sclerosis, activated microglia/macrophages appear in active lesions and in normal appearing white matter. However, whether they play a beneficial or a detrimental role in the development of the pathology remains a controversial issue. The production of pro-inflammatory molecules by chronically activated microglial cells is suggested to contribute to the progression of neurodegenerative processes in neurological disease. In the healthy brain, neurons control glial activation through several inhibitory mechanisms, such as the CD200-CD200R1 interaction. Therefore, we studied whether alterations in the CD200-CD200R1 system might underlie the neuroinflammation in an experimental autoimmune encephalomyelitis (EAE model of multiple sclerosis. We determined the time course of CD200 and CD200R1 expression in the brain and spinal cord of an EAE mouse model from presymptomatic to late symptomatic stages. We also assessed the correlation with associated glial activation, inflammatory response and EAE severity. Alterations in CD200 and CD200R1 expression were mainly observed in spinal cord regions in the EAE model, mostly a decrease in CD200 and an increase in CD200R1 expression. A decrease in the expression of the mRNA encoding a full CD200 protein was detected before the onset of clinical signs, and remained thereafter. A decrease in CD200 protein expression was observed from the onset of clinical signs. By contrast, CD200R1 expression increased at EAE onset, when a glial reaction associated with the production of pro- and anti-inflammatory markers occurred, and continued to be elevated during the pathology. Moreover, the magnitude of the alterations correlated with severity of the EAE mainly in spinal cord. These results suggest that neuronal-microglial communication through CD200-CD200R1 interaction is compromised in EAE. The early decreases in CD200 expression in EAE suggest that this downregulation might also

  8. Inhibition of CD200R1 expression by C/EBP beta in reactive microglial cells

    Directory of Open Access Journals (Sweden)

    Dentesano Guido

    2012-07-01

    Full Text Available Abstract Background In physiological conditions, it is postulated that neurons control microglial reactivity through a series of inhibitory mechanisms, involving either cell contact-dependent, soluble-factor-dependent or neurotransmitter-associated pathways. In the current study, we focus on CD200R1, a microglial receptor involved in one of these cell contact-dependent mechanisms. CD200R1 activation by its ligand, CD200 (mainly expressed by neurons in the central nervous system,is postulated to inhibit the pro-inflammatory phenotype of microglial cells, while alterations in CD200-CD200R1 signalling potentiate this phenotype. Little is known about the regulation of CD200R1 expression in microglia or possible alterations in the presence of pro-inflammatory stimuli. Methods Murine primary microglial cultures, mixed glial cultures from wild-type and CCAAT/enhancer binding protein β (C/EBPβ-deficient mice, and the BV2 murine cell line overexpressing C/EBPβ were used to study the involvement of C/EBPβ transcription factor in the regulation of CD200R1 expression in response to a proinflammatory stimulus (lipopolysaccharide (LPS. Binding of C/EBPβ to the CD200R1 promoter was determined by quantitative chromatin immunoprecipitation (qChIP. The involvement of histone deacetylase 1 in the control of CD200R1 expression by C/EBPβ was also determined by co-immunoprecipitation and qChIP. Results LPS treatment induced a decrease in CD200R1 mRNA and protein expression in microglial cells, an effect that was not observed in the absence of C/EBPβ. C/EBPβ overexpression in BV2 cells resulted in a decrease in basal CD200R1 mRNA and protein expression. In addition, C/EBPβ binding to the CD200R1 promoter was observed in LPS-treated but not in control glial cells, and also in control BV2 cells overexpressing C/EBPβ. Finally, we observed that histone deacetylase 1 co-immunoprecipitated with C/EBPβ and showed binding to a C/EBPβ consensus sequence of the CD

  9. C3a Enhances the Formation of Intestinal Organoids through C3aR1

    Directory of Open Access Journals (Sweden)

    Naoya Matsumoto

    2017-09-01

    Full Text Available C3a is important in the regulation of the immune response as well as in the development of organ inflammation and injury. Furthermore, C3a contributes to liver regeneration but its role in intestinal stem cell function has not been studied. We hypothesized that C3a is important for intestinal repair and regeneration. Intestinal organoid formation, a measure of stem cell capacity, was significantly limited in C3-deficient and C3a receptor (C3aR 1-deficient mice while C3a promoted the growth of organoids from normal mice by supporting Wnt-signaling but not from C3aR1-deficient mice. Similarly, the presence of C3a in media enhanced the expression of the intestinal stem cell marker leucine-rich repeat G-protein-coupled receptor 5 (Lgr5 and of the cell proliferation marker Ki67 in organoids formed from C3-deficient but not from C3aR1-deficient mice. Using Lgr5.egfp mice we showed significant expression of C3 in Lgr5+ intestinal stem cells whereas C3aR1 was expressed on the surface of various intestinal cells. C3 and C3aR1 expression was induced in intestinal crypts in response to ischemia/reperfusion injury. Finally, C3aR1-deficient mice displayed ischemia/reperfusion injury comparable to control mice. These data suggest that C3a through interaction with C3aR1 enhances stem cell expansion and organoid formation and as such may have a role in intestinal regeneration.

  10. Structure of IL-22 Bound to Its High-Affinity IL-22R1 Chain

    Energy Technology Data Exchange (ETDEWEB)

    Jones, B.C.; Logsdon, N.J.; Walter, M.R. (UAB)

    2008-09-29

    IL-22 is an IL-10 family cytokine that initiates innate immune responses against bacterial pathogens and contributes to immune disease. IL-22 biological activity is initiated by binding to a cell-surface complex composed of IL-22R1 and IL-10R2 receptor chains and further regulated by interactions with a soluble binding protein, IL-22BP, which shares sequence similarity with an extracellular region of IL-22R1 (sIL-22R1). IL-22R1 also pairs with the IL-20R2 chain to induce IL-20 and IL-24 signaling. To define the molecular basis of these diverse interactions, we have determined the structure of the IL-22/sIL-22R1 complex. The structure, combined with homology modeling and surface plasmon resonance studies, defines the molecular basis for the distinct affinities and specificities of IL-22 and IL-10 receptor chains that regulate cellular targeting and signal transduction to elicit effective immune responses.

  11. Protein-Nanocrystal Conjugates Support a Single Filament Polymerization Model in R1 Plasmid Segregation

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Charina L.; Claridge, Shelley A.; Garner, Ethan C.; Alivisatos, A. Paul; Mullins, R. Dyche

    2008-07-15

    To ensure inheritance by daughter cells, many low-copy number bacterial plasmids, including the R1 drug-resistance plasmid, encode their own DNA segregation systems. The par operon of plasmid R1 directs construction of a simple spindle structure that converts free energy of polymerization of an actin-like protein, ParM, into work required to move sister plasmids to opposite poles of rod-shaped cells. The structures of individual components have been solved, but little is known about the ultrastructure of the R1 spindle. To determine the number of ParM filaments in a minimal R1 spindle, we used DNA-gold nanocrystal conjugates as mimics of the R1 plasmid. Wefound that each end of a single polar ParM filament binds to a single ParR/parC-gold complex, consistent with the idea that ParM filaments bind in the hollow core of the ParR/parC ring complex. Our results further suggest that multifilament spindles observed in vivo are associated with clusters of plasmidssegregating as a unit.

  12. Hematopoietic stem cell gene therapy for IFNγR1 deficiency protects mice from mycobacterial infections.

    Science.gov (United States)

    Hetzel, Miriam; Mucci, Adele; Blank, Patrick; Nguyen, Ariane Hai Ha; Schiller, Jan; Halle, Olga; Kühnel, Mark-Philipp; Billig, Sandra; Meineke, Robert; Brand, Daniel; Herder, Vanessa; Baumgärtner, Wolfgang; Bange, Franz-Christoph; Goethe, Ralph; Jonigk, Danny; Förster, Reinhold; Gentner, Bernhard; Casanova, Jean-Laurent; Bustamante, Jacinta; Schambach, Axel; Kalinke, Ulrich; Lachmann, Nico

    2018-02-01

    Mendelian susceptibility to mycobacterial disease is a rare primary immunodeficiency characterized by severe infections caused by weakly virulent mycobacteria. Biallelic null mutations in genes encoding interferon gamma receptor 1 or 2 ( IFNGR1 or IFNGR2 ) result in a life-threatening disease phenotype in early childhood. Recombinant interferon γ (IFN-γ) therapy is inefficient, and hematopoietic stem cell transplantation has a poor prognosis. Thus, we developed a hematopoietic stem cell (HSC) gene therapy approach using lentiviral vectors that express Ifnγr1 either constitutively or myeloid specifically. Transduction of mouse Ifnγr1 -/- HSCs led to stable IFNγR1 expression on macrophages, which rescued their cellular responses to IFN-γ. As a consequence, genetically corrected HSC-derived macrophages were able to suppress T-cell activation and showed restored antimycobacterial activity against Mycobacterium avium and Mycobacterium bovis Bacille Calmette-Guérin (BCG) in vitro. Transplantation of genetically corrected HSCs into Ifnγr1 -/- mice before BCG infection prevented manifestations of severe BCG disease and maintained lung and spleen organ integrity, which was accompanied by a reduced mycobacterial burden in lung and spleen and a prolonged overall survival in animals that received a transplant. In summary, we demonstrate an HSC-based gene therapy approach for IFNγR1 deficiency, which protects mice from severe mycobacterial infections, thereby laying the foundation for a new therapeutic intervention in corresponding human patients. © 2018 by The American Society of Hematology.

  13. A Significant Role of the Truncated Ghrelin Receptor GHS-R1b in Ghrelin-induced Signaling in Neurons.

    Science.gov (United States)

    Navarro, Gemma; Aguinaga, David; Angelats, Edgar; Medrano, Mireia; Moreno, Estefanía; Mallol, Josefa; Cortés, Antonio; Canela, Enric I; Casadó, Vicent; McCormick, Peter J; Lluís, Carme; Ferré, Sergi

    2016-06-17

    The truncated non-signaling ghrelin receptor growth hormone secretagogue R1b (GHS-R1b) has been suggested to simply exert a dominant negative role in the trafficking and signaling of the full and functional ghrelin receptor GHS-R1a. Here we reveal a more complex modulatory role of GHS-R1b. Differential co-expression of GHS-R1a and GHS-R1b, both in HEK-293T cells and in striatal and hippocampal neurons in culture, demonstrates that GHS-R1b acts as a dual modulator of GHS-R1a function: low relative GHS-R1b expression potentiates and high relative GHS-R1b expression inhibits GHS-R1a function by facilitating GHS-R1a trafficking to the plasma membrane and by exerting a negative allosteric effect on GHS-R1a signaling, respectively. We found a preferential Gi/o coupling of the GHS-R1a-GHS-R1b complex in HEK-293T cells and, unexpectedly, a preferential Gs/olf coupling in both striatal and hippocampal neurons in culture. A dopamine D1 receptor (D1R) antagonist blocked ghrelin-induced cAMP accumulation in striatal but not hippocampal neurons, indicating the involvement of D1R in the striatal GHS-R1a-Gs/olf coupling. Experiments in HEK-293T cells demonstrated that D1R co-expression promotes a switch in GHS-R1a-G protein coupling from Gi/o to Gs/olf, but only upon co-expression of GHS-R1b. Furthermore, resonance energy transfer experiments showed that D1R interacts with GHS-R1a, but only in the presence of GHS-R1b. Therefore, GHS-R1b not only determines the efficacy of ghrelin-induced GHS-R1a-mediated signaling but also determines the ability of GHS-R1a to form oligomeric complexes with other receptors, promoting profound qualitative changes in ghrelin-induced signaling. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. A Significant Role of the Truncated Ghrelin Receptor GHS-R1b in Ghrelin-induced Signaling in Neurons*

    Science.gov (United States)

    Navarro, Gemma; Aguinaga, David; Angelats, Edgar; Medrano, Mireia; Moreno, Estefanía; Mallol, Josefa; Cortés, Antonio; Canela, Enric I.; Casadó, Vicent; McCormick, Peter J.; Lluís, Carme; Ferré, Sergi

    2016-01-01

    The truncated non-signaling ghrelin receptor growth hormone secretagogue R1b (GHS-R1b) has been suggested to simply exert a dominant negative role in the trafficking and signaling of the full and functional ghrelin receptor GHS-R1a. Here we reveal a more complex modulatory role of GHS-R1b. Differential co-expression of GHS-R1a and GHS-R1b, both in HEK-293T cells and in striatal and hippocampal neurons in culture, demonstrates that GHS-R1b acts as a dual modulator of GHS-R1a function: low relative GHS-R1b expression potentiates and high relative GHS-R1b expression inhibits GHS-R1a function by facilitating GHS-R1a trafficking to the plasma membrane and by exerting a negative allosteric effect on GHS-R1a signaling, respectively. We found a preferential Gi/o coupling of the GHS-R1a-GHS-R1b complex in HEK-293T cells and, unexpectedly, a preferential Gs/olf coupling in both striatal and hippocampal neurons in culture. A dopamine D1 receptor (D1R) antagonist blocked ghrelin-induced cAMP accumulation in striatal but not hippocampal neurons, indicating the involvement of D1R in the striatal GHS-R1a-Gs/olf coupling. Experiments in HEK-293T cells demonstrated that D1R co-expression promotes a switch in GHS-R1a-G protein coupling from Gi/o to Gs/olf, but only upon co-expression of GHS-R1b. Furthermore, resonance energy transfer experiments showed that D1R interacts with GHS-R1a, but only in the presence of GHS-R1b. Therefore, GHS-R1b not only determines the efficacy of ghrelin-induced GHS-R1a-mediated signaling but also determines the ability of GHS-R1a to form oligomeric complexes with other receptors, promoting profound qualitative changes in ghrelin-induced signaling. PMID:27129257

  15. IEA-R1 renewed primary coolant piping system stress analysis

    International Nuclear Information System (INIS)

    Fainer, Gerson; Faloppa, Altair A.; Oliveira, Carlos A. de; Mattar Neto, Miguel

    2015-01-01

    A partial replacement of the IEA-R1 piping system was conducted in 2014. The aim of this work is to perform the stress analysis of the renewed primary piping system of the IEA-R1, taking into account the as built conditions and the pipe modifications. The nuclear research reactor IEA-R1 is a pool type reactor designed by Babcox-Willcox, which is operated by IPEN since 1957. The primary coolant system is responsible for removing the residual heat of the Reactor core. As a part of the life management, a regular inspection detected some degradation in the primary piping system. In consequence, part of the piping system was replaced. The partial renewing of the primary piping system did not imply in major piping layout modifications. However, the stress condition of the piping systems had to be reanalyzed. The structural stress analysis of the primary piping systems is now presented and the final results are discussed. (author)

  16. The effect of anaesthesia on the radiosensitivity of rat intestine, foot skin and R-1 tumours

    International Nuclear Information System (INIS)

    Kal, H.B.; Gaiser, J.F.

    1980-01-01

    A comparison has been made of the effects of Nembutal (sodium pentobarbital) and Ethrane (2-chloro-1,1,2-trifluoroethyldifluoromethyl ether) anaesthesia on the radiation responses of rat intestine, foot skin and R-1 rhabdomyosarcoma. Single-dose experiments under Nembutal or short-lasting Ethrane anaesthesia resulted in equivalent radiosensitivities for the R-1 sarcoma and foot skin, whereas Ethrane induced radiosensitization in the intestine. In the Ethrane anaesthesia lasting 3 hours, and in the split-dose experiments, Ethrane inhibited repair of radiation-induced damage in the R-1 sarcoma and in the foot skin. It is therefore recommended that the use of Ethrane as an anaesthetic should be avoided in experiments designed to investigate repair of damage in fractionated studies or during protracted irradiation treatments. (UK)

  17. IEA-R1 reactor core simulation with RELAP5 code

    International Nuclear Information System (INIS)

    Rocha, Ricardo Takeshi Vieira da; Belchior Junior, Antonio; Andrade, Delvonei Alves de; Sabundjian, Gaiane; Umbehaum, Pedro Ernesto; Torres, Walmir Maximo

    2005-01-01

    This paper presents a preliminary RELAP5 model for the IEA-R1 core. The power distribution is supplied by the neutronic code, CITATION. The main objective is to model the IEA-R1 core and validate the model through the comparison of the results to the ones from COBRA and PARET, which were used in the Final Safety Analysis Report (FSAR) for this plant. Preliminary calculations regarding some simulations are presented. Boundary conditions are simulated through time dependent components. Results obtained are compared to those available for the IEA-R1. This study will be continued considering a model for the whole plant. Important transient and accidents will be analysed in order to verify the Emergency Core Cooling System - ECCS efficiency to hold its function as projected to preserve the integrity of the reactor core and guarantee its cooling. (author)

  18. Commissioning of the new heat exchanger for the research nuclear reactor IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Alfredo Jose Alvim de; Cassiano, Douglas Alves; Umbehaun, Pedro Ernesto; Carvalho, Marcos Rodrigues de; Frajndlich, Roberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mails: ajcastro@ipen.br; docass@gmail.com.br; umbehaun@ipen.br; carvalho@ipen.br; frajndli@ipen.br

    2008-07-01

    The Research Reactor IEA-R1 placed at IPEN/CNEN-SP is of the swimming pool type, light water moderated and with graphite reflectors, and was build and designed by Babcock and Wilcox Co. Start up operation was in September the 16{sup th}, 1957, being the first criticality for South Hemisphere. Although designed to operate at 5 MW, the IEA-R1 was operated until 2001 with 2 MW and was suitable for use in basic and applied research as well as the production of medical radioisotopes, industry and natural sciences applications. Due to a recent demand increase on radioisotopes in Brazil for medical diagnoses and therapies applications, IPEN /CNEN updated the IEA-R1 power to 5 MW and to work at continuous operation regime. Studies on the Ageing Management for the Research Reactor IEA-R1 were conducted according to IAEA procedures. As result of these studies critical components within the Ageing Management Program were identified. Also were made recommendations on the implementation of test scheduling and standardization procedures to organize data and documents. One of the main results was the need of monitoring the two heat exchangers, the two primary circuit pumps and the data acquisition system. During monitoring procedures, issues were observed on the IEA-R1 operation at 5 MW mainly due to the ageing of the Babcox and Wilcox TCA heat exchanger, and excessive vibrations at high flow rates on CBC's TCB heat exchanger. So, from 2005 on, it was decided to work with 3,5 MW and provide a new IESA heat exchanger with 5 MW capacity, to substitute the TCA heat exchanger. This work presents results on the commissioning of the new heat exchanger and compares against the values calculated in the IESA project. The results show that the IEA-R1 Reactor can be operated more safety and continuously at 5 MW with the new IESA heat exchanger. (author)

  19. Calculation of neutronic parameters of IEA-R1 reactor and purpose of a new configuration

    International Nuclear Information System (INIS)

    Kosaka, N.; Fanaro, L.C.C.B.; Yamaguchi, M.

    1989-01-01

    The program for reducing the fuel enrichment of the IEA-R1 reactor considers fuel plates containing U308-AL with 19,9% of U-235. The geometry of the new 18 fuel plate fuel elements has been kept the same. This work describes the calculation methods utilized at IPEN-CNEN/SP and some neutronic parameters of the present configuration of IEA-R1 as well as for a new configuration porposed with a new LEU fuel element are shown. (author) [pt

  20. Monitoring conformational dynamics with solid-state R1ρ experiments

    International Nuclear Information System (INIS)

    Quinn, Caitlin M.; McDermott, Ann E.

    2009-01-01

    A new application of solid-state rotating frame (R 1ρ ) relaxation experiments to observe conformational dynamics is presented. Studies on a model compound, dimethyl sulfone (DMS), show that R 1ρ relaxation due to reorientation of a chemical shift anisotropy (CSA) tensor undergoing chemical exchange can be used to monitor slow-to-intermediate timescale conformational exchange processes. Control experiments used d 6 -DMS and alanine to confirm that the technique is monitoring reorientation of the CSA tensor rather than dipolar interactions or methyl group rotation. The application of this method to proteins could represent a new site-specific probe of conformational dynamics

  1. Thermal hydraulic analysis of the IPR-R1 TRIGA reactor

    International Nuclear Information System (INIS)

    Veloso, Marcelo Antonio; Fortini, Maria Auxiliadora

    2002-01-01

    The subchannel approach, normally employed for the analysis of power reactor cores that work under forced convection, have been used for the thermal hydraulic evaluation of a TRIGA Mark I reactor, named IPR-R1, at 250 kW power level. This was accomplished by using the PANTERA-1P subchannel code, which has been conveniently adapted to the characteristics of natural convection of TRIGA reactors. The analysis of results indicates that the steady state operation of IPR-R1 at 250 kW do not imply risks to installations, workers and public. (author)

  2. Neutron flux determination at the IPR-R1 Triga Mark I neutron beam extractor

    International Nuclear Information System (INIS)

    Zangirolami, Dante Marco; Maretti Junior, Fausto; Ferreira, Andrea Vidal

    2009-01-01

    The IPR-R1 Triga Mark I Reactor located at the CDTN/CNEN, Belo Horizonte, Brazil, has been operating since November of 1960. In this work, measurements of thermal and epithermal neutron flux along the IPR-R1 neutron beam extractor were performed by neutron activation of reference materials using the two foils method. The obtained results were compared with results from two previous works: an experimental measurement done in a previous reactor core configuration and a numerical work made by Monte Carlo simulation using the actual reactor core configuration. The main purpose of this work is to update the measured data to the actual reactor core configuration. (author)

  3. 26 CFR 31.3402(r)-1 - Withholding on distributions of Indian gaming profits to tribal members.

    Science.gov (United States)

    2010-04-01

    ... profits to tribal members. 31.3402(r)-1 Section 31.3402(r)-1 Internal Revenue INTERNAL REVENUE SERVICE... TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3402(r)-1 Withholding on distributions of Indian gaming profits to tribal members. (a) (1) General rule. Section 3402(r...

  4. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    In this article, the objective was to investigate variations in goat TAS1R1 gene and their associations with growth traits in 317 goats by PCR-SSCP and DNA sequencing methods. The results showed two novel single nucleotide polymorphisms (SNPs): HM449123:g. [T3974C, C4037T]. In detail, two different alleles, A and B, ...

  5. Caracemide, a site-specific irreversible inhibitor of protein R1 of Escherichia coli ribonucleotide reductase

    DEFF Research Database (Denmark)

    Larsen, I. K.; Cornett, Claus; Karlsson, M.

    1992-01-01

    The anticancer drug caracemide, N-acetyl-N,O-di(methylcarbamoyl)hydroxylamine, and one of its degradation products, N-acetyl-O-methylcarbamoyl-hydroxylamine, were found to inhibit the enzyme ribonucleotide reductase of Escherichia coli by specific interaction with its larger component protein R1....

  6. Exact method for the simulation of Coulombic systems by spherically truncated, pairwise r-1 summation

    International Nuclear Information System (INIS)

    Wolf, D.; Keblinski, P.; Phillpot, S.R.; Eggebrecht, J.

    1999-01-01

    Based on a recent result showing that the net Coulomb potential in condensed ionic systems is rather short ranged, an exact and physically transparent method permitting the evaluation of the Coulomb potential by direct summation over the r -1 Coulomb pair potential is presented. The key observation is that the problems encountered in determining the Coulomb energy by pairwise, spherically truncated r -1 summation are a direct consequence of the fact that the system summed over is practically never neutral. A simple method is developed that achieves charge neutralization wherever the r -1 pair potential is truncated. This enables the extraction of the Coulomb energy, forces, and stresses from a spherically truncated, usually charged environment in a manner that is independent of the grouping of the pair terms. The close connection of our approach with the Ewald method is demonstrated and exploited, providing an efficient method for the simulation of even highly disordered ionic systems by direct, pairwise r -1 summation with spherical truncation at rather short range, i.e., a method which fully exploits the short-ranged nature of the interactions in ionic systems. The method is validated by simulations of crystals, liquids, and interfacial systems, such as free surfaces and grain boundaries. copyright 1999 American Institute of Physics

  7. R1 Resection by Necessity for Colorectal Liver Metastases Is It Still a Contraindication to Surgery?

    NARCIS (Netherlands)

    de Haas, Robbert J.; Wicherts, Dennis A.; Flores, Eduardo; Azoulay, Daniel; Castaing, Denis; Adam, Rene

    2008-01-01

    Objective: To compare long-term outcome of R0 (negative margins) and R1 (positive margins) liver resections for colorectal liver metastases (CLM) treated by an aggressive approach combining chemotherapy and repeat surgery. Summary Background Data: Complete macroscopic resection with negative margins

  8. Structural and functional analysis of the kid toxin protein from E. coli Plasmid R1

    NARCIS (Netherlands)

    Hargreaves, D.; Santos-Sierra, S.; Giraldo, R.; Sabariegos-Jareño, R.; de la Cueva-Méndez, G.; Boelens, R.|info:eu-repo/dai/nl/070151407; Díaz-Orejas, R.; Rafferty, J.B.

    2002-01-01

    We have determined the structure of Kid toxin protein from E. coli plasmid R1 involved in stable plasmid inheritance by postsegregational killing of plasmid-less daughter cells. Kid forms a two-component system with its antagonist, Kis antitoxin. Our 1.4 Å crystal structure of Kid reveals a 2-fold

  9. Measurements and calculations of reactivity for the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Ferreira, P.S.B.; Maiorino, J.R.; Yamaguchi, M.

    1988-01-01

    This work shows a measurement of reactivity parameters, such as integral and diferential control rod worth, local void coefficient, and moderator temperature coefficient for the research reactor IEA-R1. The measured values were compared with those calculated through HAMMER-CITATION codes, having shown good agreement. (author) [pt

  10. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    Jane

    2011-10-10

    Oct 10, 2011 ... 1Institute of Cellular and Molecular Biology, College of Life Science, Xuzhou Normal University, ... TAS1R1 and TAS1R3 form an L-amino acid sensor, ... 0.5 × TBE buffer (89 mM tris–borate, 2 mM EDTA, pH 8.3) for 2 h at.

  11. New digital control system for the operation of the Colombian research reactor IAN-R1

    International Nuclear Information System (INIS)

    Celis del A, L.; Rivero, T.; Bucio, F.; Ramirez, R.; Segovia, A.; Palacios, J.

    2015-09-01

    En 2011, Mexico won the Colombian international tender for the renewal of instrumentation and control of the IAN-R1 Reactor, to Argentina and the United States. This paper presents the design criteria and the development made for the new digital control system installed in the Colombian nuclear reactor IAN-R1, which is based on a redundant and diverse architecture, which provides increased availability, reliability and safety in the reactor operation. This control system and associated instrumentation met all national export requirements, with the safety requirements established by the IAEA as well as the requirements demanded by the Colombian Regulatory Body in nuclear matter. On August 20, 2012, the Colombian IAN-R1 reactor reached its first criticality controlled with the new system developed at Instituto Nacional de Investigaciones Nucleares (ININ). On September 14, 2012, the new control system of the Colombian IAN-R1 reactor was officially handed over to the Colombian authorities, this being the first time that Mexico exported nuclear technology through the ININ. Currently the reactor is operating successfully with the new control system, and has an operating license for 5 years. (Author)

  12. Applications of neutron activation analysis technique in the IPR-R1 research reactor

    International Nuclear Information System (INIS)

    Sabino, C.V.S.; Mansur, N.

    1986-01-01

    A review is made of the neutron activation analysis technique used in the IPR-R1 reactor of the Centro de Desenvolvimento da Tecnologia Nuclear - NUCLEBRAS. Some characteristics of the method are described, types of samples and elements analyzed are also mentioned. (Author) [pt

  13. Nuclear material control at IEA-R1 nuclear research reactor

    International Nuclear Information System (INIS)

    1988-01-01

    The control measurements system and verification of physical inventory for fuel elements used in the operation of IEA-R1 nuclear research reactor are described. The computer code used for burn-up calculation are shown. (E.G.) [pt

  14. Modifications done in the IPR-R1 reactor and their auxiliary systems

    International Nuclear Information System (INIS)

    Maretti Junior, F.; Amorim, V.A. de; Coura, J.G.

    1986-01-01

    The improvements done in the IPR-R1 reactor for adequateness of operation conditions and increase of irradiation sample capability. The cooling systems, reactor pool, system of control rods were substituted. The optimization of transfer pneumatic system was done. (M.C.K.) [pt

  15. Calculation of radiation heat generation on a graphite reflector side of IAN-R1 Reactor

    International Nuclear Information System (INIS)

    Duque O, J.; Velez A, L.H.

    1987-01-01

    Calculation methods for radiation heat generation in nuclear reactor, based on the point kernel approach are revisited and applied to the graphite reflector of IAN-R1 reactor. A Fortran computer program was written for the determination of total heat generation in the reflector, taking 1155 point in it

  16. Borated stainless steel storage project to the spent fuel of the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Rodrigues, Antonio Carlos Iglesias; Madi Filho, Tufic; Ricci Filho, Walter

    2013-01-01

    The IEA-R1 research reactor operates in a regimen of 64h weekly, at the power of 4.5 MW. In these conditions, the racks to the spent fuel elements have less than half of its initial capacity. Thus, maintaining these operating circumstances, the storage will have capacity for approximately six years. Whereas the estimated useful life of the IEA-R1 is around twenty years, it will be necessary to increase the storage capacity for the spent fuel. Dr. Henrik Grahn, expert of the International Atomic Energy Agency on wet storage, visiting the IEA-R1 Reactor (September/2012) made some recommendations: among them, the design and installation of racks made with borated stainless steel and internally coated with an aluminum film, so that corrosion of the fuel elements would not occur. This work objective is the project of high capacity storage for spent fuel elements, using borated stainless steel, to answer the Reactor IEA-R1 demand and the security requirements of the International Atomic Energy Agency. (author)

  17. FiR 1 reactor in service for boron neutron capture therapy (BNCT) and isotope production

    International Nuclear Information System (INIS)

    Auterinen, I.; Salmenhaara, S.E.J. . Author

    2004-01-01

    The FiR 1 reactor, a 250 kW Triga reactor, has been in operation since 1962. The main purpose for the existence of the reactor is now the Boron Neutron Capture Therapy (BNCT), but FiR 1 has also an important national role in providing local enterprises and research institutions in the fields of industrial measurements, pharmaceuticals, electronics etc. with isotope production and activation analysis services. In the 1990's a BNCT treatment facility was built at the FiR 1 reactor located at Technical Research Centre of Finland. A special new neutron moderator material Fluental TM (Al+AlF3+Li) developed at VTT ensures the superior quality of the neutron beam. Also the treatment environment is of world top quality after a major renovation of the whole reactor building in 1997. Recently the lithiated polyethylene neutron shielding of the beam aperture was modified to ease the positioning of the patient close to the beam aperture. Increasing the reactor power to 500 kW would allow positioning of the patient further away from the beam aperture. Possibilities to accomplish a safety analysis for this is currently under considerations. Over thirty patients have been treated at FiR 1 since May 1999, when the license for patient treatment was granted to the responsible BNCT treatment organization, Boneca Corporation. Currently three clinical trial protocols for tumours in the brain as well as in the head and neck region are recruiting patients. (author)

  18. Retailing. Instructor's Guide Sheets and Instructor's Package, Modules R 1-45. Competency-Based Education.

    Science.gov (United States)

    Kentucky State Dept. of Education, Frankfort.

    This package contains instructor's guide sheets and student task assignment sheets for Modules R 1-45 of the competency-based curriculum in retailing developed for use in secondary and postsecondary schools in Kentucky. Some of the topics covered in the modules include the following: retailing--past, present, and future; retailing occupations;…

  19. Design of a new wet storage rack for spent fuels from IEA-R1 reactor

    International Nuclear Information System (INIS)

    Rodrigues, Antonio C.I.; Madi Filho, Tufic; Siqueira, Paulo T.D.; Ricci Filho, Walter

    2015-01-01

    The IEA-R1 research reactor operates in a regimen of 64h weekly, at the power of 4.5 MW. In these conditions, the racks of the spent fuel elements have less than half of its initial capacity. Thus, maintaining these operating conditions, the storage will have capacity for about six years. Since the estimated useful life of the IEA-R1 is about another 20 years, it will be necessary to increase the storage capacity of spent fuel. Dr. Henrik Grahn, expert of the International Atomic Energy Agency on wet storage, visiting the IEA-R1 Reactor (September/2012) made some recommendations: among them, the design and installation of racks made with borated stainless steel and internally coated with an aluminum film, so that corrosion of the fuel elements would not occur. After an extensive literature review of material options given for this type of application we got to Boral® manufactured by 3M due to numerous advantages. This paper presents studies on the analysis of criticality using the computer code MCNP 5, demonstrating the possibility of doubling the storage capacity of current racks to attend the demand of the IEA-R1 reactor while attending the safety requirements the International Atomic Energy Agency. (author)

  20. Design of a new wet storage rack for spent fuels from IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Antonio C.I.; Madi Filho, Tufic; Siqueira, Paulo T.D.; Ricci Filho, Walter, E-mail: acirodri@ipen.br, E-mail: tmfilho@ipen.br, E-mail: ptsiquei@ipen.br, E-mail: wricci@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    The IEA-R1 research reactor operates in a regimen of 64h weekly, at the power of 4.5 MW. In these conditions, the racks of the spent fuel elements have less than half of its initial capacity. Thus, maintaining these operating conditions, the storage will have capacity for about six years. Since the estimated useful life of the IEA-R1 is about another 20 years, it will be necessary to increase the storage capacity of spent fuel. Dr. Henrik Grahn, expert of the International Atomic Energy Agency on wet storage, visiting the IEA-R1 Reactor (September/2012) made some recommendations: among them, the design and installation of racks made with borated stainless steel and internally coated with an aluminum film, so that corrosion of the fuel elements would not occur. After an extensive literature review of material options given for this type of application we got to Boral® manufactured by 3M due to numerous advantages. This paper presents studies on the analysis of criticality using the computer code MCNP 5, demonstrating the possibility of doubling the storage capacity of current racks to attend the demand of the IEA-R1 reactor while attending the safety requirements the International Atomic Energy Agency. (author)

  1. Borated stainless steel storage project to the spent fuel of the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Antonio Carlos Iglesias; Madi Filho, Tufic; Ricci Filho, Walter, E-mail: acirodri@ipen.br, E-mail: tmfilho@ipen.br, E-mail: wricci@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    The IEA-R1 research reactor operates in a regimen of 64h weekly, at the power of 4.5 MW. In these conditions, the racks to the spent fuel elements have less than half of its initial capacity. Thus, maintaining these operating circumstances, the storage will have capacity for approximately six years. Whereas the estimated useful life of the IEA-R1 is around twenty years, it will be necessary to increase the storage capacity for the spent fuel. Dr. Henrik Grahn, expert of the International Atomic Energy Agency on wet storage, visiting the IEA-R1 Reactor (September/2012) made some recommendations: among them, the design and installation of racks made with borated stainless steel and internally coated with an aluminum film, so that corrosion of the fuel elements would not occur. This work objective is the project of high capacity storage for spent fuel elements, using borated stainless steel, to answer the Reactor IEA-R1 demand and the security requirements of the International Atomic Energy Agency. (author)

  2. 25th birthday of the first criticality of IPR-R1 nuclear research reactor

    International Nuclear Information System (INIS)

    Tofani, P.C.; Stasiulevicius, R.; Roedel, G.

    1988-01-01

    The historical evolution of IPR-R1 research reactor of Instituto de Pesquisas Radioativas-Nuclebras, since the data of its first criticality, is presented. The modifications and the main activities carried out, are presented. (M.C.K.) [pt

  3. Study of IPR-R1 dynamics by reactivity random excitations

    International Nuclear Information System (INIS)

    Roedel, G.

    1983-01-01

    To demonstrate the viability of the utilization of analitical techniques of neutronic noise, a dynamic model for IPR-R1 reactor from CDTN was developed. This model allows reactivity feedback due to variations of temperature in fuel and coolant [pt

  4. Measurement of thermal neutron flux spatial distribution in the IEA-R1 reactor core

    International Nuclear Information System (INIS)

    D'Utra Bitelli, U.

    1993-01-01

    This work presents the spatial thermal neutron flux in IEA-R1 reactor obtained by activation foils methods. These measurements were made in 27 fuel elements of the reactor core (165 B configuration). The results are important to compare with theoretical values, power calibration and safety analysis. (author)

  5. Coordinated movement of cytoplasmic and transmembrane domains of RyR1 upon gating.

    Directory of Open Access Journals (Sweden)

    Montserrat Samsó

    2009-04-01

    Full Text Available Ryanodine receptor type 1 (RyR1 produces spatially and temporally defined Ca2+ signals in several cell types. How signals received in the cytoplasmic domain are transmitted to the ion gate and how the channel gates are unknown. We used EGTA or neuroactive PCB 95 to stabilize the full closed or open states of RyR1. Single-channel measurements in the presence of FKBP12 indicate that PCB 95 inverts the thermodynamic stability of RyR1 and locks it in a long-lived open state whose unitary current is indistinguishable from the native open state. We analyzed two datasets of 15,625 and 18,527 frozen-hydrated RyR1-FKBP12 particles in the closed and open conformations, respectively, by cryo-electron microscopy. Their corresponding three-dimensional structures at 10.2 A resolution refine the structure surrounding the ion pathway previously identified in the closed conformation: two right-handed bundles emerging from the putative ion gate (the cytoplasmic "inner branches" and the transmembrane "inner helices". Furthermore, six of the identifiable transmembrane segments of RyR1 have similar organization to those of the mammalian Kv1.2 potassium channel. Upon gating, the distal cytoplasmic domains move towards the transmembrane domain while the central cytoplasmic domains move away from it, and also away from the 4-fold axis. Along the ion pathway, precise relocation of the inner helices and inner branches results in an approximately 4 A diameter increase of the ion gate. Whereas the inner helices of the K+ channels and of the RyR1 channel cross-correlate best with their corresponding open/closed states, the cytoplasmic inner branches, which are not observed in the K+ channels, appear to have at least as important a role as the inner helices for RyR1 gating. We propose a theoretical model whereby the inner helices, the inner branches, and the h1 densities together create an efficient novel gating mechanism for channel opening by relaxing two right

  6. CYP2R1 mutations causing vitamin D-deficiency rickets.

    Science.gov (United States)

    Thacher, Tom D; Levine, Michael A

    2017-10-01

    CYP2R1 is the principal hepatic 25-hydroxylase responsible for the hydroxylation of parent vitamin D to 25-hydroxyvitamin D [25(OH)D]. Serum concentrations of 25(OH)D reflect vitamin D status, because 25(OH)D is the major circulating metabolite of vitamin D. The 1α-hydroxylation of 25(OH)D in the kidney by CYP27B1 generates the fully active vitamin D metabolite, 1,25-dihydroxyvitamin D (1,25(OH) 2 D). The human CYP2R1 gene, located at 11p15.2, has five exons, coding for an enzyme with 501 amino acids. In Cyp2r1-/- knockout mice, serum 25(OH)D levels were reduced by more than 50% compared wild-type mice. Genetic polymorphisms of CYP2R1 account for some of the individual variability of circulating 25(OH)D values in the population. We review the evidence that inactivating mutations in CYP2R1 can lead to a novel form of vitamin D-deficiency rickets resulting from impaired 25-hydroxylation of vitamin D. We sequenced the promoter, exons and intron-exon flanking regions of the CYP2R1 gene in members of 12 Nigerian families with rickets in more than one family member. We found missense mutations (L99P and K242N) in affected members of 2 of 12 families. The L99P mutation had previously been reported as a homozygous defect in an unrelated child of Nigerian origin with rickets. In silico analyses predicted impaired CYP2R1 folding or reduced interaction with substrate vitamin D by L99P and K242N mutations, respectively. In vitro studies of the mutant CYP2R1 proteins in HEK293 cells confirmed normal expression levels but completely absent or markedly reduced 25-hydroxylase activity by the L99P and K242N mutations, respectively. Heterozygous subjects had more moderate biochemical and clinical features of vitamin D deficiency than homozygous subjects. After an oral bolus dose of 50,000 IU of vitamin D 2 or vitamin D 3 , heterozygous subjects had lower increases in serum 25(OH)D than control subjects, and homozygous subjects had minimal increases, supporting a semidominant

  7. Transport of UF6 in compliance with TS-R-1

    International Nuclear Information System (INIS)

    Dekker, B.G.

    2004-01-01

    The IAEA Regulations TS-R-1 (ST-1, Revised) 1996 Edition include requirements for packages containing uranium hexafluoride (UF6); these are the first and only substance-specific requirements in the IAEA regulations. These requirements have already particularly affected, and will further affect, the transport of non-fissile and fissile excepted UF 6 and the packages used for these transports. Non-fissile and fissile excepted UF6 (ASTM C 787) has been transported worldwide for decades in a safe and reliable manner, using internationally standardised packages. Under the auspices of the World Nuclear Transport Institute (WNTI), an industry working group has been evaluating the existing packages against the requirements in TS-R-1. As new requirements came into effect, there were new challenges for the use of these standard packages, including the free drop test and the thermal requirements. In close cooperation with the WNTI HEXT Industry Working Group, a consortium of UF6 producers/users has worked together on the design and development, testing and certification of technical solutions for modification and optimisation of the existing packages to comply with TS-R-1. This paper reviews the existing standard packages against the requirements in TS-R-1. An update is also given describing the enhancements to the standard packages that have been designed and developed recently. The paper also describes how these solutions have been tested and certified, as well as the status of implementation. Finally, a review is made of the options that are available internationally to transport UF6 in compliance with TS-R-1. (author)

  8. Ghrelin receptor (GHS-R1A) agonists show potential as interventive agents during aging.

    Science.gov (United States)

    Smith, Roy G; Sun, Yuxiang; Jiang, Hong; Albarran-Zeckler, Rosie; Timchenko, Nikolai

    2007-11-01

    Administration of an orally active agonist (MK-0677) of the growth hormone secretagogue receptor (GHS-R1a) to elderly subjects restored the amplitude of endogenous episodic growth hormone (GH) release to that of young adults. Functional benefits include increased lean mass and bone density and modest improvements in strength. In old mice, a similar agonist partially restored function to the thymus and reduced tumor cell growth and metastasis. Treatment of old mice with the endogenous GHS-R1a agonist ghrelin restored a young liver phenotype. The mechanism involves inhibition of cyclin D3:cdk4/cdk6 activity and increased protein phosphatase-2A (PP2A) activity in liver nuclei, which stabilizes the dephosphorylated form of the transcription factor C/EBPalpha preventing the age-dependent formation of the C/EBPalpha-Rb-E2F4-Brm nuclear complex. By inhibiting formation of this complex, repression of E2F target genes is de-repressed and C/EBPalpha regulated expression of Pepck, a regulator of gluconeogenesis, is normalized, thereby restoring a young liver phenotype. In the brain, aging is associated with decline in dopamine function. We investigated the potential neuromodulatory role of GHS-R1a on dopamine action. Neurons were identified in the hippocampus, cortex, substantia nigra, and ventral tegmental areas that coexpressed GHS-R1a and dopamine receptor subtype-1 (D1R). Cell culture studies showed that, in the presence of ghrelin and dopamine, GHS-R and D1R form heterodimers, which modified G-protein signal transduction resulting in amplification of dopamine signaling. We speculate that aging is associated with deficient endogenous ghrelin signaling that can be rescued by intervention with GHS-R1a agonists to improve quality of life and maintain independence.

  9. Neutrons characterization of the nuclear reactor Ian-R1 of Colombia; Caracterizacion de los neutrones del reactor nuclear IAN-R1 de Colombia

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez P, L. X.; Martinez O, S. A. [Universidad Pedagogica y Tecnologica de Colombia, Grupo de Fisica Nuclear Aplicada y Simulacion, Carretera Central del Norte Km. 1, Via Paipa, 150003 Tunja, Boyaca (Colombia); Vega C, H. R., E-mail: s.agustin.martinez@uptc.edu.co [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-08-15

    By means of Monte Carlo methods, with the code MCNPX, the neutron characteristics of the research nuclear reactor Ian-R1 of Colombia, in power off but with the neutrons source in their start position, have been valued. The neutrons spectra, the total flow and their average power were calculated in the irradiation spaces inside the graphite reflector, as well as in the cells with air. Also the spectra, the total flow and the absorbed dose were calculated in several places distributed along the radial shaft inside the water moderator. The neutrons total flow was also considered to the long of the axial shaft. The characteristics of the neutrons spectra vary depending on their position regarding the source and the material that surrounds to the cell where the calculation was made. (Author)

  10. Comparative studies on the effect of ionizing and nonionizing radiations on the kinetics of DNA synthesis and postirradiation degradation in Micrococcus radiodurans R/sub 11/5

    Energy Technology Data Exchange (ETDEWEB)

    Auda, H; Khalef, Z [Nuclear Centre Tuwaitha, Baghdad (Iraq)

    1982-06-01

    The kinetics of degradation and synthesis of DNA and the nature of radioactive substances released from M. radiodurans R/sub 11/5 labeled with thymidine-methyl-/sup 3/H after UV and gamma irradiations were investigated. The release of labeled material from the DNA began immediately upon incubation and terminated in due time 90 min and 180 min for UV and gamma irradiations, respectively. When acriflavine was added to the medium, post-irradiation degradation process did not terminate even after 9 h in the case of UV exposure. However, it terminated after 6 h in the case of gamma irradiation. In the presence of acriflavine, DNA synthesis resumed after termination of DNA degradation in the case of gamma irradiation and this was not observed in the case of UV irradiation. Degradation products were chromatographed and it was found that they were located in one major radioactive peak. However their locations were different for UV and gamma radiations. For UV irradiation, the peak fell in the thymine region, while for gamma irradiation it fell in the thymidine region.

  11. Comparative studies on the effect of ionizing and nonionizing radiations on the kinetics of DNA synthesis and postirradiation degradation in Micrococcus radiodurans R115

    International Nuclear Information System (INIS)

    Auda, H.; Khalef, Z.

    1982-01-01

    The kinetics of degradation and synthesis of DNA and the nature of radioactive substances released from M. radiodurans R 11 5 labeled with thymidine-methyl- 3 H after UV and gamma irradiations were investigated. The release of labeled material from the DNA began immediately upon incubation and terminated in due time 90 min and 180 min for UV and gamma irradiations, respectively. When acriflavine was added to the medium, post-irradiation degradation process did not terminate even after 9 h in the case of UV exposure. However, it terminated after 6 h in the case of gamma irradiation. In the presence of acriflavine, DNA synthesis resumed after termination of DNA degradation in the case of gamma irradiation and this was not observed in the case of UV irradiation. Degradation products were chromatographed and it was found that they were located in one major radioactive peak. However their locations were different for UV and gamma radiations. For UV irradiation, the peak fell in the thymine region, while for gamma irradiation it fell in the thymidine region. (author)

  12. Description of Deinococcus oregonensis sp. nov., from biological soil crusts in the Southwestern arid lands of the United States of America.

    Science.gov (United States)

    Gundlapally, Sathyanarayana Reddy; Garcia-Pichel, Ferran

    2017-01-01

    Biological soil crusts are distinct habitats, harbor unique prokaryotic diversity and gave an impetus to isolate novel species. In the present study, a pink-pigmented bacterium, (OR316-6 T ), was isolated from biological soil crusts using oligotrophic BG11-PGY medium. Strain OR316-6 T was Gram-positive, short rods, non-motile and non-spore forming. Cells were positive for catalase, oxidase and β-galactosidase and negative for most of the enzymatic activities. The major fatty acids present were C 16:0 , C 17:0 , and C 16:1 ω7c and contained MK-8 and MK-10 as the predominant menaquinones. The cell wall peptidoglycan was of A3β variant with L-ornithine as the diamino acid. Based on the above characteristics, strain OR316-6 T was assigned to the genus Deinococcus. The phylogenetic analysis indicated that strain OR316-6 T was closely related to D. aquatilis DSM 23025 T with a 16S rRNA gene similarity of 99.3 % and clustered with a bootstrap value of 100 %. DNA-DNA similarity between strain OR316-6 T and D. aquatilis DSM 23025 T was 37.0 % indicating that strain OR316-6 T was a novel species. Further, DNA fingerprinting of stains OR316-6 T and D. aquatilis DSM 23035 T demonstrated that both strains were related to each other with a similarity coefficient of only 0.32 and supported the species status to strain OR316-6 T . In addition, phenotypic characteristics distinguished strain OR316-6 T from D. aquatilis DSM 23025 T . Based on the cumulative differences, strain OR316-16 T exhibited with its closely related species, it was identified as a novel species and proposed the name Deinococcus oregonensis sp. nov. The type strain is D. oregonensis sp. nov. (OR316-6 T  = JCM 13503 T  = DSM 17762 T ).

  13. Modernization of control instrumentation and security of reactor IAN - R1

    International Nuclear Information System (INIS)

    Gonzalez, J. M.

    1993-01-01

    The program to modernize IAN-R1 research reactor control and safety instrumentation has been carried out considering two main aspects: updating safety philosophy requirements and acquiring the newest reactor control instrumentation controlled by computer, following the present criteria internationally recognized, for safety and reliable reactor operations and the latest developments of nuclear electronic technology. The new IAN-R1 reactor instrumentation consist of two wide range neutron monitoring channels, commanded by microprocessor a data acquisition system and reactor control, (controlled by computers). The reactor control desk is providing through two displays; all safety and control signals to the reactor operators; furthermore some signals like reactor power, safety and period signals are also showed on digital bar graphics, which are hard wired directly from the neutron monitoring channels

  14. Nonlinear integral equations for thermodynamics of the sl(r + 1) Uimin-Sutherland model

    International Nuclear Information System (INIS)

    Tsuboi, Zengo

    2003-01-01

    We derive traditional thermodynamic Bethe ansatz (TBA) equations for the sl(r+1) Uimin-Sutherland model from the T-system of the quantum transfer matrix. These TBA equations are identical to the those from the string hypothesis. Next we derive a new family of nonlinear integral equations (NLIEs). In particular, a subset of these NLIEs forms a system of NLIEs which contains only a finite number of unknown functions. For r=1, this subset of NLIEs reduces to Takahashi's NLIE for the XXX spin chain. A relation between the traditional TBA equations and our new NLIEs is clarified. Based on our new NLIEs, we also calculate the high-temperature expansion of the free energy

  15. Stability Analysis of Landslide on the R1 Expressway by Limit Equilibrium and Finite Element Methods

    Science.gov (United States)

    Janták, Viktor

    2017-12-01

    The most difficult problem by designing the superior infrastructure is tracing the expressways and higways in an environment of Quaternary and Neogene complexes of finegrained cohesive and non-cohesive soils. At the last time the typical examples are stability problems on the R1 Nitra - Tekovské Nemce Expressway. The article is focused on the description of reasons of stability loss in the deep earth cut in the 79,000 km of expressway R1, the course of the landslide, slide correction and especially slope-stability assessment before and after the occurrence of slope failures by limit equilibrium and finite elements methods by comparing the behaviour of the slope in the various model situations.

  16. JESS-D-16-00343 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00343 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  17. Aspects of the Iea-R1 research reactor seismic evaluation

    International Nuclear Information System (INIS)

    Mattar Neto, Miguel

    1996-01-01

    Codes and standards for the seismic evaluation of the research reactor IEA-R1 are presented. An approach to define the design basis earthquake based on the local seismic map and on simplified analysis methods is proposed. The site seismic evaluation indicates that the design earthquake intensity is IV MM. Therefore, according to the used codes and standards, no buildings, systems, and components seismic analysis are required. (author)

  18. JESS-D-16-00608 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00608 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  19. JESS-D-16-00592 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00592 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  20. JESS-D-16-00539 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00539 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  1. JESS-D-16-00583 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00583 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  2. JESS-D-16-00331R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00331R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  3. JESS-D-16-00216R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00216R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  4. JESS-D-16-00462 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00462 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  5. JESS-D-16-00615 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00615 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  6. JESS-D-16-00069 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00069 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  7. JESS-D-16-00237 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00237 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  8. JESS-D-16-00379 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00379 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  9. JESS-D-16-00205R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00205R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  10. JESS-D-16-00023 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00023 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  11. JESS-D-16-00602 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00602 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  12. JESS-D-16-00528 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00528 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  13. JESS-D-16-00272 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00272 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  14. JESS-D-16-00313 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00313 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  15. JESS-D-16-00432 R1.pdf;Structural | forthcoming | jess | Volumes ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00432 R1.pdf;Structural. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th ...

  16. JESS-D-16-00446 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00446 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  17. JESS-D-16-00496 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00496 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  18. JESS-D-16-00399R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00399R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  19. JESS-D-17-00004 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-17-00004 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  20. JESS-D-16-00451R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00451R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  1. Core calculations for the upgrading of the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Santos, Adimir dos; Perrotta, Jose A.; Bastos, Jose Luis F.; Yamaguchi, Mitsuo; Umbehaun, Pedro E.

    1998-01-01

    The IEA-R1 Research Reactor is a multipurpose reactor. It has been used for basic and applied research in the nuclear area, training and radioisotopes production since 1957. In 1995, the Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) took the decision to modernize and upgrade the power from 2 to 5 MW and increase the operational cycle. This work presents the design requirements and the calculations effectuated to reach this goal. (author)

  2. JESS-D-16-00170 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00170 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  3. New instrumentation for the IPR-R1 reactor of CDTN

    International Nuclear Information System (INIS)

    Carvalho, P.V.R. de.

    1992-01-01

    The Nuclear Engineering Institute reactor instrumentation area has developed systems and equipment for reactor operation and safety. In such way, the new I and C for IEN Argonauta reactor and the nuclear instrumentation for IPEN critical facility were built. This paper describes our real work, the new I and C systems for IPR-R1, a Triga type reactor, located at CDTN (Belo Horizonte - MG). (author)

  4. JESS-D-16-00500 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00500 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  5. JESS-D-16-00199 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00199 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  6. JESS-D-16-00508 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00508 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  7. JESS-D-16-00457 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00457 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  8. JESS-D-16-00571 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00571 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  9. NBR ISO 9001 Certification for activities carried out in IEA-R1 reactor

    International Nuclear Information System (INIS)

    Paiva, Rosemeire P.; Salvetti, Tereza C.

    2005-01-01

    Since its inauguration in 1957, the IEA-R1 research reactor has been used mainly for research, development and teaching by scientific community. In the last years, with the increase of the commercial radiopharmaceutical production by Radiopharmacy Center of IPEN, the IEA-R1 reactor was recognized as a service supplier for that center and has received a treatment more commercial from IPEN Management. In 1999 the radiopharmaceutical production obtained the NBR ISO 9002 Certification, since that the IPEN Management considered convenient to invest in the certification of its internal suppliers. In this context, in 2001 the Research Reactor Center (CRPq) began the implantation of a Quality Management System (QMS) based on NBR 9001: 2000 standard, for activities related to the operation and maintenance of the IEA-R1 research reactor and irradiation services. This QMS was structured to incorporate tools already implemented in order to complain the requirements related to nuclear and radiological safe for a nuclear installation established by the regulatory organism. The QMS is supported by a documentation system composed of approximately 150 documents including quality manual, business and action plans, operational procedures and work instruction. Carlos Alberto Vanzolini Foundation (FCAV), an INMETRO certified organism, certified the 'Operation and Maintenance of the IEA-R1 Research Reactor and Irradiation Services' in December 2002. In 2003 and 2004, the QMS was audited by FCAV that determined the maintenance of the certification. This work presents the main steps of the QMS implementation, including the difficulties found and results obtained in the process. (author)

  10. JESS-D-16-00396 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00396 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  11. JESS-D-16-00266R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00266R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  12. JESS-D-16-00432 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00432 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  13. Feasibility studies of producing 99 Mo by capture in the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Concilio, Roberta; Mendonca, Arlindo Gilson; Maiorino, Jose Rubens

    1998-01-01

    Everyday the production of 99 Mo for 99m Tc generators, becomes more necessary, whose properties are ideal for medical diagnosis. This works presents a description and an analysis of the production of 99 Mo by radioactive capture at 98 Mo using the research reactor IEA-R1 in 5 MW and operating 5 days a week, referring to the use of targets, separation methods, total and specific activity attained and its limitations. (author)

  14. JESS-D-16-00405 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00405 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  15. JESS-D-16-00485 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00485 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  16. JESS-D-16-00428 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00428 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  17. JESS-D-16-00082 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00082 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  18. JESS-D-16-00657 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00657 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  19. Design, fabrication, and testing of the PIACE-R1 machine

    International Nuclear Information System (INIS)

    Goto, S.; Uyama, T.; Yokota, T.; Takano, H.; Ohsaki, O.; Masuda, K.; Koyanagi, E.; Sanada, Y.

    1979-01-01

    The design, fabrication and testing of the coil and collector system for the PIACE-R1 (Plasma Injection and Compression Experiments-Race Track 1) are described in this paper. In particular, the eddy current analysis, collector insulation, and stress analysis for determining the coil configuration and arrangement are presented in detail. The purpose of the machine is to obtain thermonuclear plasmas. 5 refs

  20. JESS-D-16-00154R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00154R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  1. JESS-D-16-00162 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00162 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  2. DIP1 modulates stem cell homeostasis in Drosophila through regulation of sisR-1.

    Science.gov (United States)

    Wong, Jing Ting; Akhbar, Farzanah; Ng, Amanda Yunn Ee; Tay, Mandy Li-Ian; Loi, Gladys Jing En; Pek, Jun Wei

    2017-10-02

    Stable intronic sequence RNAs (sisRNAs) are by-products of splicing and regulate gene expression. How sisRNAs are regulated is unclear. Here we report that a double-stranded RNA binding protein, Disco-interacting protein 1 (DIP1) regulates sisRNAs in Drosophila. DIP1 negatively regulates the abundance of sisR-1 and INE-1 sisRNAs. Fine-tuning of sisR-1 by DIP1 is important to maintain female germline stem cell homeostasis by modulating germline stem cell differentiation and niche adhesion. Drosophila DIP1 localizes to a nuclear body (satellite body) and associates with the fourth chromosome, which contains a very high density of INE-1 transposable element sequences that are processed into sisRNAs. DIP1 presumably acts outside the satellite bodies to regulate sisR-1, which is not on the fourth chromosome. Thus, our study identifies DIP1 as a sisRNA regulatory protein that controls germline stem cell self-renewal in Drosophila.Stable intronic sequence RNAs (sisRNAs) are by-products of splicing from introns with roles in embryonic development in Drosophila. Here, the authors show that the RNA binding protein DIP1 regulates sisRNAs in Drosophila, which is necessary for germline stem cell homeostasis.

  3. Experimental study of the IPR-R1 TRIGA reactor power channels responses

    International Nuclear Information System (INIS)

    Mesquita, Henrique F.A.; Ferreira, Andrea V.

    2015-01-01

    The IPR-R1 nuclear reactor installed at Centro de Desenvolvimento da Tecnologia Nuclear CDTN/CNEN, Belo Horizonte, Brazil, is a Mark I TRIGA reactor (Training, Research, Isotopes, General Atomics) and became operational on November of 1960. The reactor has four irradiation devices: a rotary specimen rack with 40 irradiation channels, the central tube, and two pneumatic transfer tubes. The nuclear reactor is operated in a power range between zero and 100 kW. The instrumentation for IPR-R1 operation is mainly composed of four neutronic channels for power measurements. The aim of this work is to investigate the responses of neutronic channels of IPR-R1, Linear, Log N and Percent Power channels, and to check their linearity. Gold foils were activated at low powers (0.125-1.000 kW), and cobalt foils were activated at high powers (10-100kW). For each sample irradiated at rotary specimen rack, another one was irradiated at the same time at the pneumatic transfer tube-2. The obtained results allowed evaluating the linearity of the neutronic channels responses. (author)

  4. AHR prevents human IL-1R1hi ILC3 differentiation to natural killer cells

    Science.gov (United States)

    Hughes, Tiffany; Briercheck, Edward L.; Freud, Aharon G.; Trotta, Rossana; McClory, Susan; Scoville, Steven D.; Keller, Karen; Deng, Youcai; Cole, Jordan; Harrison, Nicholas; Mao, Charlene; Zhang, Jianying; Benson, Don M.; Yu, Jianhua; Caligiuri, Michael A.

    2014-01-01

    SUMMARY Accumulating evidence indicates that human natural killer (NK) cells develop in secondary lymphoid tissue (SLT) through a so-called “stage 3” developmental intermediate minimally characterized by a CD34-CD117+CD94- immunophenotype that lacks mature NK cell function. This stage 3 population is heterogeneous, potentially composed of functionally distinct innate lymphoid cell (ILC) types that includes interleukin-1 receptor (IL-1R1) positive, IL-22-producing ILC3s. Whether human ILC3s are developmentally related to NK cells is a subject of ongoing investigation. Here we show that antagonism of the aryl hydrocarbon receptor (AHR) or silencing of AHR gene expression promotes differentiation of tonsillar IL-22-producing IL-1R1hi human ILC3s to CD56brightCD94+ IFN-gamma-producing cytolytic mature NK cells expressing eomesodermin (EOMES) and T-Box Protein 21 (TBX21 or TBET). Hence, AHR is a transcription factor that prevents human IL-1R1hi ILC3s from differentiating into NK cells. PMID:24953655

  5. Thermotolerance and thermosensitization in CHO and R1H cells: a comparative study

    International Nuclear Information System (INIS)

    Dikomey, E.; Eickhoff, J.; Jung, H.

    1984-01-01

    In CHO and R1H cells thermotolerance was induced by a pre-incubation at 40 0 C, by an acute heat shock at 43 0 C followed by a time interval at 37 0 C, and during continuous heating at 42 0 C. Thermotolerance, which was tested at 43 0 , primarily causes an increase in D 0 of the heat-response curve. The degree of maximum thermotolerance was found to be generally more pronounced in CHO than in R1H cells, but the time interval at 37 0 C, as well as at 40 0 C, to reach this maximum level was the same in both cell lines. CHO and R1H cells could be sensitized to 40 0 C by a pre-treatment at 43 0 C. When compared for the same survival rate after pre-treatment at 43 0 C alone the degree of thermosensitization was about the same in both cell lines. In either cell line thermosensitization was found to be suppressed when cells were made thermotolerant by a previous incubation at 40 0 C for 16 hours. (author)

  6. Measurement of the thermal flux distribution in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Tangari, C.M.; Moreira, J.M.L.; Jerez, R.

    1986-01-01

    The knowledge of the neutron flux distribution in research reactors is important because it gives the power distribution over the core, and it provides better conditions to perform experiments and sample irradiations. The measured neutron flux distribution can also be of interest as a means of comparison for the calculational methods of reactor analysis currently in use at this institute. The thermal neutron flux distribution of the IEA-R1 reactor has been measured with the miniature chamber WL-23292. For carrying out the measurements, it was buit a guide system that permit the insertion of the mini-chamber i between the fuel of the fuel elements. It can be introduced in two diferent positions a fuel element and in each it spans 26 axial positions. With this guide system the thermal neutron flux distribution of the IEA-R1 nuclear reactor can be obtained in a fast and efficient manner. The element measured flux distribution shows clearly the effects of control rods and reflectors in the IEA-R1 reactor. The difficulties encountered during the measurements are mentioned with detail as well as the procedures adopteed to overcome them. (Author) [pt

  7. The Indian origin of paternal haplogroup R1a1* substantiates the autochthonous origin of Brahmins and the caste system.

    Science.gov (United States)

    Sharma, Swarkar; Rai, Ekta; Sharma, Prithviraj; Jena, Mamata; Singh, Shweta; Darvishi, Katayoon; Bhat, Audesh K; Bhanwer, A J S; Tiwari, Pramod Kumar; Bamezai, Rameshwar N K

    2009-01-01

    Many major rival models of the origin of the Hindu caste system co-exist despite extensive studies, each with associated genetic evidences. One of the major factors that has still kept the origin of the Indian caste system obscure is the unresolved question of the origin of Y-haplogroup R1a1*, at times associated with a male-mediated major genetic influx from Central Asia or Eurasia, which has contributed to the higher castes in India. Y-haplogroup R1a1* has a widespread distribution and high frequency across Eurasia, Central Asia and the Indian subcontinent, with scanty reports of its ancestral (R*, R1* and R1a*) and derived lineages (R1a1a, R1a1b and R1a1c). To resolve these issues, we screened 621 Y-chromosomes (of Brahmins occupying the upper-most caste position and schedule castes/tribals occupying the lower-most positions) with 55 Y-chromosomal binary markers and seven Y-microsatellite markers and compiled an extensive dataset of 2809 Y-chromosomes (681 Brahmins, and 2128 tribals and schedule castes) for conclusions. A peculiar observation of the highest frequency (up to 72.22%) of Y-haplogroup R1a1* in Brahmins hinted at its presence as a founder lineage for this caste group. Further, observation of R1a1* in different tribal population groups, existence of Y-haplogroup R1a* in ancestors and extended phylogenetic analyses of the pooled dataset of 530 Indians, 224 Pakistanis and 276 Central Asians and Eurasians bearing the R1a1* haplogroup supported the autochthonous origin of R1a1 lineage in India and a tribal link to Indian Brahmins. However, it is important to discover novel Y-chromosomal binary marker(s) for a higher resolution of R1a1* and confirm the present conclusions.

  8. Genetic engineering of a radiation-resistant bacterium for biodegradation of mixed wastes. 1998 annual progress report

    International Nuclear Information System (INIS)

    Lidstrom, M.E.

    1998-01-01

    'Because of their tolerance to very high levels of ionizing radiation, members of the genus Deinococcus have received considerable attention over the past years. The type species of the genus, Deinococcus radiodurans, has been studied extensively in several labs. Although researchers are only beginning to understand the mechanisms by which this Gram-positive bacterium is able to repair massive DNA damage after radiation dosages as high as 5 Mrad, it has become evident that its recombination machinery has several unique characteristics (1--4). The aim of the present studies is to engineer D. radiodurans into a detoxifier for bioremediation of complex waste mixtures, containing heavy metals, halo-organics and radionuclides, making use of its ability to be biologically active in environments where they will be exposed to high levels of radiation. For that purpose, the authors aim to clone and express several broad spectrum oxygenases and heavy metal resistance determinants, and test survival and activities of these strains in artificial mixtures of contaminants, designed to simulate DOE mixed waste streams. This report summarizes work after 0.5 year of a 3-year project. The initial studies have focused on the development of an insertional expression system for D. radiodurans R1. This effort has involved two parts, namely: (1) promoter analysis, and (2) development of insertion systems. Several studies have shown that the expression signals used by D. radiodurans differ considerably from those found in other bacteria. Although D. radiodurans contains a typical eubacterial RNA polymerase core enzyme (based on TBLASTN searches on the genome sequence), Escherichia coli promoters are not recognized in D. radiodurans and vice versa (5). To expand the basic understanding of the requirements for transcription, and to optimize expression of (heterologous) genes, they will follow two strategies. First, a promoter-probe vector is being developed for the selection of promoter

  9. Study of neutronic flux in IPR-R1 reactor with MCNPX; Estudo do fluxo neutronico no reator IPR-R1 com o MCNPX

    Energy Technology Data Exchange (ETDEWEB)

    Melo, J.A.S.; Castrillo, L.S., E-mail: julio.angelo@poli.br, E-mail: lazara@poli.br [Universidade de Pernambuco (UPE), Recife, PE (Brazil). Escola Politecnica; Oliveira, R.M.B.M., E-mail: romero.matias@educacao.pe.gov.br [Secretaria Executiva de Educacao do Estado de Pernambuco (SEE), Recife, PE (Brazil)

    2016-11-01

    MCNPX computer code, one of the latest versions of code MCNP transport were used to study the flux distribution and its neutronic fluence as a function of energy in two research reactor irradiation IPR-R1. The model developed was validated with research conducted by Dalle (2005). Initially, in the simulation is considered fresh fuel whose core configuration contained three neutron rods control, being two of them 100% ejected while the other inserted 3,1 x 10{sup -1} m deep, as adopted in the literature situation. The neutron source used was the critical type, through KSRC card. The results of the neutron flow and neutronic fluence were obtained in the central tube and the turntable on a range of energy spectrum that ranged from 1.0 x 10{sup -9} MeV to 10 MeV, showing good correlations with the model used in validation. Finally, a hypothetical situation wherein the three reactor control rods are ejected simultaneously was simulated. The simulation results showed an increase in the neutron flux of 7% in the central tube and 5% on the turntable.

  10. CD200R1 supports HSV-1 viral replication and licenses pro-inflammatory signaling functions of TLR2.

    Directory of Open Access Journals (Sweden)

    Roy J Soberman

    Full Text Available The CD200R1:CD200 axis is traditionally considered to limit tissue inflammation by down-regulating pro-inflammatory signaling in myeloid cells bearing the receptor. We generated CD200R1(-/- mice and employed them to explore both the role of CD200R1 in regulating macrophage signaling via TLR2 as well as the host response to an in vivo, TLR2-dependent model, herpes simplex virus 1 (HSV-1 infection. CD200R1(-/- peritoneal macrophages demonstrated a 70-75% decrease in the generation of IL-6 and CCL5 (Rantes in response to the TLR2 agonist Pam(2CSK(4 and to HSV-1. CD200R1(-/- macrophages could neither up-regulate the expression of TLR2, nor assemble a functional inflammasome in response to HSV-1. CD200R1(-/- mice were protected from HSV-1 infection and exhibited dysfunctional TLR2 signaling. Finally, both CD200R1(-/- mice and CD200R1(-/- fibroblasts and macrophages showed a markedly reduced ability to support HSV-1 replication. In summary, our data demonstrate an unanticipated and novel requirement for CD200R1 in "licensing" pro-inflammatory functions of TLR2 and in limiting viral replication that are supported by ex vivo and in vivo evidence.

  11. Modernization of the CDTN IPR-R1 TRIGA reactor instrumentation and control

    International Nuclear Information System (INIS)

    Mesquita, A.Z.; Costa, A.C.L.; Souza, R.M.G.P.

    2009-01-01

    The control system of the IPR-R1 was changed in 1995. Although since the year's 80 was generalized the use of microprocessor technology and video monitors for visual interface, in the IPR-R1 control room it was used analogical system by relay-based logic, and were maintained the mechanical strip chart recorders (ink-pen drive) to measure, monitor and store the operational parameters. It was maintained the measure and the control of, practically, the same variables of the original system, although the reactor power already have been upgraded to 100 kW and began the studies to increase it to 250 kW, which is the current core configuration. For 250 kW operations the fuel heat transfer becomes important and new parameters should be used as safety operational limits. A state-of-the-art instrumentation and control system using microprocessor technology is proposed to replace the present analogical systems. The new system can eliminates most manual data logging, provides automatic or manual reactor operation modes, provides complete real-time operator display, replays historical operating data on monitor or printer, eliminates spare parts replacement problems and meets all applicable international standards as NRC and IEE specifications. This paper describes the research project in process in CDTN that has as objective the modernization of the IPR-R1 TRIGA reactor instrumentation and control of the operational variables. The project also will improve the accomplishment of neutronic and thermal-hydraulic experiments, foreseen in the CDTN research program. (author)

  12. A CFD model for the IEA-R1 reactor neat exchanger inlet nozzle flow

    International Nuclear Information System (INIS)

    Andrade, Delvonei A.; Angelo, Gabriel; Gainer, Gerson; Angelo, Edvaldo; Umbehaun, Pedro E.; Torres, Walmir M.; Sabundjian, Gaiane; Macedo, Luiz A.; Belchior Junior, Antonio; Conti, Thadeu N.; Watanabe, Bruno C.; Sakai, Caio C.

    2011-01-01

    A previous preliminary model of the IEA-R1 heat exchanger inlet nozzle flow was developed and published in the International Nuclear Atlantic Conference-INAC-2009. A new model was created based on the preliminary one. It was improved concerning the actual heat exchanger tube bundle geometry. This became a very special issue. Difficulties with the size of the numerical mesh came out pointing to our computational system limits. New CFD calculations with this improved model were performed using ANSYS-CFX. In this paper, we present this model and discuss the results. (author)

  13. Nonlinear stochastic heat equations with cubic nonlinearities and additive Q-regular noise in R^1

    Directory of Open Access Journals (Sweden)

    Henri Schurz

    2010-09-01

    Full Text Available Semilinear stochastic heat equations perturbed by cubic-type nonlinearities and additive space-time noise with homogeneous boundary conditions are discussed in R^1. The space-time noise is supposed to be Gaussian in time and possesses a Fourier expansion in space along the eigenfunctions of underlying Lapace operators. We follow the concept of approximate strong (classical Fourier solutions. The existence of unique continuous L^2-bounded solutions is proved. Furthermore, we present a procedure for its numerical approximation based on nonstandard methods (linear-implicit and justify their stability and consistency. The behavior of related total energy functional turns out to be crucial in the presented analysis.

  14. Experiment on continuous operation of the Brazilian IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Freitas Pintaud, M. de

    1994-01-01

    In order to increase the radioisotope production in the IEA-R1 research reactor at IPEN/CNEN-SP, it has been proposed a change in its operation regime from 8 hours per day and 5 days per week to continuous 48 hours per week. The necessary reactor parameters for this new operation regime were obtained through an experiment in which the reactor was for the first time operated in the new regime. This work presents the principal results from this experiment: xenon reactivity, new shutdown margins, and reactivity loss due to fuel burnup in the new operation regime. (author)

  15. A practical method to calculate the R1 index of waste-to-energy facilities.

    Science.gov (United States)

    Viganò, Federico

    2018-03-01

    According to Directive 98/2008/EC, the operation carried out by an incinerator of Municipal Solid Waste (MSW) is classified either as energy recovery (R1) or as disposal (D10) depending on the result achieved by the application of the R1 formula. In 2011 the DG Environment of the European Commission (EC) issued some non-binding guidelines on the interpretation of such a formula that clarified many aspects related to its application. A point not fully clarified by the EC guidelines is the determination of the energy contained in the treated waste (E W ). For this term of the formula, reference is made to the indirect method for the calculation of boiler thermal efficiency, as defined by the norm EN 12952-15. However, the application of such a norm to an entire year of operation of a Waste-to-Energy (WtE) boiler is not immediate. Therefore, a practical method for the calculation of the E W term has been developed in the framework of a collaboration between the MatER Study Centre and the Lombardy Region (Italy). The method is based on: (i) the identification of the most reliable data available from the Distributed Control System (DCS) of the plant; (ii) the definition of a control volume around the boiler(s) also based on the availability of data; (iii) the closure of the mass balance for such a control volume; (iv) the energy balance of the same control volume that gives, thus, the E W term of the R1 formula. The method has been applied in 2015-2016 to nine plants, generating a number of interesting data reported and discussed in this work, such as R1 index values, Lower Heating Values (LHV) of the treated wastes, main sources of energy losses in WtE boilers, etc. For one case study, discussed in detail in this work, the law of propagation of uncertainties has been applied according to the ISO/IEC Guide 98-3, leading to the assessment of the accuracy of the method, which resulted in ±2.4% with a confidence level of circa 95%. Copyright © 2017 Elsevier Ltd. All

  16. A CFD model for the IEA-R1 reactor neat exchanger inlet nozzle flow

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Delvonei A.; Angelo, Gabriel; Gainer, Gerson; Angelo, Edvaldo; Umbehaun, Pedro E.; Torres, Walmir M.; Sabundjian, Gaiane; Macedo, Luiz A.; Belchior Junior, Antonio; Conti, Thadeu N.; Watanabe, Bruno C.; Sakai, Caio C., E-mail: delvonei@ipen.b, E-mail: gfainer@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    A previous preliminary model of the IEA-R1 heat exchanger inlet nozzle flow was developed and published in the International Nuclear Atlantic Conference-INAC-2009. A new model was created based on the preliminary one. It was improved concerning the actual heat exchanger tube bundle geometry. This became a very special issue. Difficulties with the size of the numerical mesh came out pointing to our computational system limits. New CFD calculations with this improved model were performed using ANSYS-CFX. In this paper, we present this model and discuss the results. (author)

  17. Naringenin degradation by the endophytic diazotroph Herbaspirillum seropedicae SmR1.

    Science.gov (United States)

    Marin, A M; Souza, E M; Pedrosa, F O; Souza, L M; Sassaki, G L; Baura, V A; Yates, M G; Wassem, R; Monteiro, R A

    2013-01-01

    Several bacteria are able to degrade flavonoids either to use them as carbon sources or as a detoxification mechanism. Degradation pathways have been proposed for several bacteria, but the genes responsible are not known. We identified in the genome of the endophyte Herbaspirillum seropedicae SmR1 an operon potentially associated with the degradation of aromatic compounds. We show that this operon is involved in naringenin degradation and that its expression is induced by naringenin and chrysin, two closely related flavonoids. Mutation of fdeA, the first gene of the operon, and fdeR, its transcriptional activator, abolished the ability of H. seropedicae to degrade naringenin.

  18. Auxiliary control system of the safety parameters for IPR-R1 reactor

    International Nuclear Information System (INIS)

    Coura, J.G.

    1986-01-01

    This paper deals with the description for the control of three cooling water parameters (conductivity, temperature and the maximum and minimum water levels) as well as the percent power fraction of the nuclear research reactor IPR-R1. In order to keep the reactor in good operation conditions, one permanent and accurate control of the cooling water is needed. The double monitoring of a fourth parameter, part of the original design, the percent power fraction, is obtained through the control of the uncompensated ion chamber current and aims to avoid the operation of the reactor without running the cooling system. (Author) [pt

  19. Calculation of the main neutron parameters of the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Ojima, Mario Katsuhiko

    1977-01-01

    The main neutron parameters of the research reactor IEA-R1 were calculated using computer programs to generate cross sections and criticality calculations. A calculation procedure based on the programs available in the Processing Center Data of IEA was established and centered in the HAMMER and CITATION system. A study was done in order to verify the validity and accuracy of the calculation method comparing the results with experimental data. Some operating parameters of the reactor, namely the distribution of neutron flux, the critical mass, the variation of the reactivity with the burning of fuel, and the dead time of the reactor were determined

  20. Study of the IPR-R1 dynamics by means of reactivity pseudo-aleatory excitations

    International Nuclear Information System (INIS)

    Roedel, G.

    1983-01-01

    Aiming to demonstrate the feasibility of using the reactor noise neutronic analysis tecniques a dynamic model was developed for the IPR-R1 reactor at CDTN. This model allows reactivity feedback, due to the variations of fuel and coolant temperature. The system was excited by the variations of reactivity modulated by a pseudo aleatory binary sequence and its answer was measured by means of the fluctuactions dround the stationary power. The model developed and the technique used was tested, and the values of the system parameters obtained from the adjustment of the theoretical and experimental transfer function were compared to another, obtained from independent process. (E.G.) [pt

  1. Calculations and selection of a TRIGA core for the Nuclear Reactor IAN-R1

    International Nuclear Information System (INIS)

    Castiblanco, L.A.; Sarta, J.A.

    1997-01-01

    The Reactor Group used the code WIMS reduced to five groups of energy, together with the code CITATION, and evaluated four configurations for a core, according to the grid actually installed. The four configurations were taken from the two proposals presented to the Instituto de Ciencias Nucleares y Energias Alternativas by General Atomics Company. In this paper, the Authors selected the best configuration according to the performance of flux distribution and excess reactivity, for a TRIGA core to be installed in the Nuclear Reactor IAN-R1

  2. The Q Motif Is Involved in DNA Binding but Not ATP Binding in ChlR1 Helicase.

    Directory of Open Access Journals (Sweden)

    Hao Ding

    Full Text Available Helicases are molecular motors that couple the energy of ATP hydrolysis to the unwinding of structured DNA or RNA and chromatin remodeling. The conversion of energy derived from ATP hydrolysis into unwinding and remodeling is coordinated by seven sequence motifs (I, Ia, II, III, IV, V, and VI. The Q motif, consisting of nine amino acids (GFXXPXPIQ with an invariant glutamine (Q residue, has been identified in some, but not all helicases. Compared to the seven well-recognized conserved helicase motifs, the role of the Q motif is less acknowledged. Mutations in the human ChlR1 (DDX11 gene are associated with a unique genetic disorder known as Warsaw Breakage Syndrome, which is characterized by cellular defects in genome maintenance. To examine the roles of the Q motif in ChlR1 helicase, we performed site directed mutagenesis of glutamine to alanine at residue 23 in the Q motif of ChlR1. ChlR1 recombinant protein was overexpressed and purified from HEK293T cells. ChlR1-Q23A mutant abolished the helicase activity of ChlR1 and displayed reduced DNA binding ability. The mutant showed impaired ATPase activity but normal ATP binding. A thermal shift assay revealed that ChlR1-Q23A has a melting point value similar to ChlR1-WT. Partial proteolysis mapping demonstrated that ChlR1-WT and Q23A have a similar globular structure, although some subtle conformational differences in these two proteins are evident. Finally, we found ChlR1 exists and functions as a monomer in solution, which is different from FANCJ, in which the Q motif is involved in protein dimerization. Taken together, our results suggest that the Q motif is involved in DNA binding but not ATP binding in ChlR1 helicase.

  3. Structural evaluation of IEA-R1 primary system pump nozzles

    Energy Technology Data Exchange (ETDEWEB)

    Fainer, Gerson; Faloppa, Altair A.; Oliveira, Carlos A. de; Mattar Neto, Miguel, E-mail: gfainer@ipen.br, E-mail: afaloppa@ipen.br, E-mail: calberto@ipen.br, E-mail: mmattar@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2017-11-01

    The IEA-R1 pumps of the primary coolant system may be required to withstand design and operational conditions. IEA-R1 nuclear research reactor is an open pool type reactor operated by IPEN since 1957. The reactor can be operated up to 5MW heating power since it was upgraded in a modernization program conducted by IPEN. The primary coolant system is composed by the piping system, decay tank, two heat pumps and two heat exchangers. In the latest arrangement upgrade of the primary system, conducted in 2014 as part of an aging management program, a partial replacement of the coolant piping and total replacement of piping and pump supports were done. As consequence, reviewed loads in the pump nozzles were obtained demanding a new evaluation of them. The aim of this report is to present the structural evaluation of the pump nozzles, considering the new loads coming from the new piping layout, according to: API 610 code verification, Supplier loads and structural analysis applying finite element method, by using the ANSYS computer program, regarding ASME VIII Div 1 & 2 recommendations. (author)

  4. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  5. Measurements and calculation of reactivity in the IEA-R1 nuclear reactor

    International Nuclear Information System (INIS)

    Ferreira, P.S.B.

    1988-01-01

    Techniques and experimentals procedures utilized in the measurement of some nuclear parameters related to reactivity are presented. Measurements of reactivity coefficients, such as void, temperature and power, and control rod worth were made in the IEA-R1 Research Reactor. The techniques used to perform the measurements were: i) stable period (control rod calibration), ii) inverse kinetics (digital reactivity meter), iii) aluminium slab insertion in the fuel element coolant channels (void reactivity), iv) nuclear reactor core temperature changes by means of the changes in the coolant systems of reactor core (isothermal reactivity coefficient) and v) by making perturbation in the core through the control rod motions (power reactivity coefficient and control rod calibration). By using the computer codes HAMMER, HAMMER-TECHNION and CITATION, the experiments realized in the IEA-R1 reactor were simulated. From this simulation, the theoretical reactivity parameters were estimated and compared with the respective experimental results. Furthermore, in the second fuel load of Angra-1 Nuclear Power Station, the IPEN-CNEN/SP digital reactivity - meter were used in the lower power test with the aim to assess the equipment performance. Among several tests, the reacticity-meter were used in parallel with a Westinghouse analogic reativimeter-meter) to measure the heat additiona point, critical boron concentration, control rod calibration, isothermal and moderator reactivity coefficient. These tests, and the results obtained by the digital reactivity-meter are described. The results were compared with those obtained by Westinghouse analogic reactivity meter, showing excellent agreement. (author) [pt

  6. Evaluation of the physical protection system of the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Vaz, Antonio C.A.; Conti, Thadeu das N.

    2013-01-01

    The '09/11' in New York and the accident at the Fukushima power plant are two events that served as worldwide reference to review some aspects of the Physical Protection System (PPS) in nuclear areas. The nuclear research reactor IEA-R1 has followed this new world order and improved the protection systems that are directly related to detection (CCTV, sensors, alarms, etc), delay (turnstile, gates, barriers, etc) and response (communication systems, response force, etc), for operation against malicious act, seeking always to avoid or minimize any possibility of threat, theft and sabotage. These actions were performed to prevent and to mitigate the consequence on the environment, economy and society from damages caused by natural hazard, as well. This study evaluates the PPS of the IEA-R1 regarding the weaknesses, strengths,and impacts of the changes resulting from the system implanted. The analyses were based on methodology developed by security experts from SANDIA National Laboratories in Texas - U.S.A, allowing the evaluation of the system through probabilistic and hypothetical analysis. (author)

  7. Observational evidence for supernova-induced star formation: Canis Major R1

    International Nuclear Information System (INIS)

    Herbst, W.; Assousa, G.E.

    1977-01-01

    The R association CMa R1, which contains two classical Herbig emission stars (Z CMa and HD 53367) and several other extremely young stellar objects, is found to lie at the edge of a large-scale ring of emission nebulosity. The form of the ring, which is also seen at radio wavelengths, and the absence of luminous stellar objects at its center suggest that it may be a relatively old supernova remnant (SNR). This suggestion is greatly strengthened by the discovery of an expanding H I shell coincident with the optical feature and the discovery of a runaway star, HD 54662, in CMa OB1. An age of order 5 x 10 5 years is derived for the SNR by comparing its properties with theoretical expectation based on models of SNRs evolving in a uniform medium. The close agreement between the likely ages of the stars and the age of the SNR, as well as the location of the recently formed objects with respect to the supernova shell, strongly support the hypothesis that a supernova event triggered star formation in CMa R1. Several other cases where evidence exists for supernova-induced star formation are briefly discussed, the most interesting being the Orion region where the hypothesis may provide a simple explanation for such diverse features as the runaway stars, Barnard's loop, and the gas kinematics and recent star formation in the Trapezium region

  8. [Activation of nucleolar organizers during in vitro cultivation of mouse R1 embryonic stem cells].

    Science.gov (United States)

    Kunafina, E R; Chaplina, M V; Filiasova, E I; Gibanova, N V; Khodarovich, Iu M; Larionov, O A; Zatsepina, O V

    2005-01-01

    We studies the activities of ribosomal genes (nucleolus forming regions of chromosomes) at successive stages of cultivation of the mouse R1 embryonic stem cells. The total number and number of active nucleolar organizers were estimated by means of in situ hybridization with mouse rDNA probes and argentophilic staining of nucleolus forming chromosomes regions from the 16th until the 32nd passages. The data we obtained suggest that the total number of nucleolar organizers per metaphase plate was constant (as a rule, eight), while the mean number of active nucleolar organizers progressively increased from the early (16th) to the late (32nd) passages: 5.2 +/- 0.4 versus 7.4 +/- 0.9 argentophilic organizers per cell. Cell heterogeneity by the number of active nucleolar organizers also increased during the late passages. Taken together, these data suggest activation of DNA transcription and synthesis of ribosomes during cultivation of mouse R1 embryonic stem cells. Based on the experimental and published data, it has been proposed that activation of ribosomal genes correlates in time with a decreased capacity of embryonic stem cells for pluripotent differentiation.

  9. IEA-R1 research reactor: operational life extension and considerations regarding future decommissioning

    International Nuclear Information System (INIS)

    Frajndlich, Roberto

    2009-01-01

    The IEA-R1 reactor is a pool type research reactor moderated and cooled by light water and uses graphite and beryllium reflectors. The reactor is located at the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), in the city of Sao Paulo, Brazil. It is the oldest research reactor in the southern hemisphere and one of the oldest of this kind in the world. The first criticality of the reactor was obtained on September 16, 1957. Given the fact that Brazil does not have yet a definitive radioactive waste repository and a national policy establishing rules for the spent fuel storage, the institutions which operate the research reactors for more than 50 years in the country have searched internal solutions for continued operation. This paper describes the spent fuel assemblies and radioactive waste management process for the IEA-R1 reactor and the refurbishment and modernization program adopted to extend its lifetime. Some considerations about the future decommissioning of the reactor are also discussed which, in my opinion, might help the operating organization to make decisions about financial, legal and technical aspects of the decommissioning procedures in a time frame of 10-15 years(author)

  10. Thermal hydraulic and neutron kinetic coupled simulation of the IPR-R1 Triga reactor

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Patricia A.L.; Costa, Antonella L.; Pereira, Claubia; Silva, Clarysson A.M. da; Veloso, Maria Auxiliadora F.; Soares, Humbero V., E-mail: patricialire@yahoo.com.br, E-mail: antonella@nuclear.ufmg.br, E-mail: claubia@nuclear.ufmg.br, E-mail: clarysson@nuclear.ufmg.br, E-mail: dora@nuclear.ufmg.br, E-mail: betovitor@ig.com.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Instituto Nacional de Ciencias e Tecnologia de Reatores Nucleares Inovadores (INCT/CNPq Rede), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    The nuclear industry and the scientific community have turned the attention for the development of coupled 3D neutron kinetics (NK) and thermal-hydraulic (TH) system codes to investigate specific nuclear reactor transients. Improving in theoretical investigations of complex phenomena in nuclear reactor technology have been increased thanks to numerical methods and computational resources incorporated in nuclear codes. This paper presents a model for the IPR-R1 TRIGA research reactor using the RELAP5-3D 3.0 code. The development and the assessment of the thermal-hydraulic RELAP5 code model for the IPR-R1 have been validated for steady state and transient situations and the results were published in preceding works. Results of RELAP5-3D steady state and a transient case presented in this paper show good agreement with experimental data, validating then this model for point kinetic calculations. To supply adequate cross sections to the NK code, the WIMSD5 is being used. First results of steady state calculation using the 3D neutron modeling are being presented in this paper. (author)

  11. Assessment of a RELAP5 model for the IPR-R1 TRIGA research reactor

    International Nuclear Information System (INIS)

    Reis, Patricia A.L.; Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Mesquita, Amir Z.; Soares, Humberto V.

    2010-01-01

    RELAP5 code was developed at the Idaho National Environmental and Engineering Laboratory and it is widely used for thermal hydraulic studies of commercial nuclear power plants and, currently, it has been also applied for thermal hydraulic analysis of nuclear research systems with good predictions. This work is a contribution to the assessment of RELAP5/3.3 code for research reactors analysis. It presents steady-state and transient calculation results performed using a RELAP5 model to simulate the IPR-R1 TRIGA research reactor conditions operating at 50 and 100 kW. The reactor is located at the Nuclear Technology Development Centre (CDTN), Brazil. The development and the assessment of a RELAP5 model for the IPR-R1 TRIGA are presented. Experimental data were considered in the process of code-to-data validation. The RELAP5 results were also compared with calculation performed using the STHIRP-1 (Research Reactors Thermal Hydraulic Simulation) code. The use of a cross flow model has been essential to improve results in the transient condition respect to preceding investigations.

  12. Experimental distribution of coolant in the IPR-R1 Triga nuclear reactor core

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Z., E-mail: amir@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Tecnologia de Reatores; Palma, Daniel A.P., E-mail: dapalma@cnen.gov.b [Comissao Nacional de Energia Nuclear (CNEN/RJ), Rio de Janeiro, RJ (Brazil); Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Reis, Patricia A.L., E-mail: claubia@nuclear.ufmg.b, E-mail: dora@nuclear.ufmg.b [Universidade Federal de Minas Gerais (DEN/UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear

    2011-07-01

    The IPR-R1 is a typical TRIGA Mark I light-water and open pool type reactor. The core has an annular configuration of six rings and is cooled by natural circulation. The core coolant channels extend from the bottom grid plate to the top grid plate. The cooling water flows through the holes in the bottom grid plate, passes through the lower unheated region of the element, flows upwards through the active region, passes through the upper unheated region, and finally leaves the channel through the differential area between a triangular spacer block on the top of the fuel element and a round hole in the grid. Direct measurement of the flow rate in a coolant channel is difficult because of the bulky size and low accuracy of flow meters. The flow rate through the channel may be determined indirectly from the heat balance across the channel using measurements of the water inlet and outlet temperatures. This paper presents the experiments performed in the IPR-R1 reactor to monitoring some thermo-hydraulic parameters in the core coolant channels, such as: the radial and axial temperature profile, temperature, velocity, mass flow rate, mass flux and Reynolds's number. Some results were compared with theoretical predictions, as it was expected the variables follow the power distribution (or neutron flux) in the core. (author)

  13. IEA-R1 primary and secondary coolant piping systems coupled stress analysis

    International Nuclear Information System (INIS)

    Fainer, Gerson; Faloppa, Altair A.; Oliveira, Carlos A.; Mattar Neto, Miguel

    2013-01-01

    The aim of this work is to perform the stress analysis of a coupled primary and secondary piping system of the IEA-R1 based on tridimensional model, taking into account the as built conditions. The nuclear research reactor IEA-R1 is a pool type reactor projected by Babcox-Willcox, which is operated by IPEN since 1957. The operation to 5 MW power limit was only possible after the conduction of life management and modernization programs in the last two decades. In these programs the components of the coolant systems, which are responsible for the water circulation into the reactor core to remove the heat generated inside it, were almost totally refurbished. The changes in the primary and secondary systems, mainly the replacement of pump and heat-exchanger, implied in piping layout modifications, and, therefore, the stress condition of the piping systems had to be reanalyzed. In this paper the structural stress assessment of the coupled primary and secondary piping systems is presented and the final results are discussed. (author)

  14. Development of a training simulator to operators of the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Carvalho, Ricardo Pinto de

    2006-01-01

    This work reports the development of a Simulator for the IEA-R1 Research Reactor. The Simulator was developed with Visual C++ in two stages: construction of the mathematics models and development and configuration of graphics interfaces in a Windows XP executable. A simplified modeling was used for main physics phenomena, using a point kinetics model for the nuclear process and the energy and mass conservation laws in the average channel of the reactor for the thermal hydraulic process. The dynamics differential equations were solved by using finite differences through the 4th order Runge- Kutta method. The reactivity control, reactor cooling, and reactor protection systems were also modeled. The process variables are stored in ASCII files. The Simulator allows navigating by screens of the systems and monitoring tendencies of the operational transients, being an interactive tool for teaching and training of IEA-R1 operators. It also can be used by students, professors, and researchers in teaching activities in reactor and thermal hydraulics theory. The Simulator allows simulations of operations of start up, power maneuver, and shut down. (author)

  15. Experimental distribution of coolant in the IPR-R1 Triga nuclear reactor core

    International Nuclear Information System (INIS)

    Mesquita, Amir Z.; Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Reis, Patricia A.L.

    2011-01-01

    The IPR-R1 is a typical TRIGA Mark I light-water and open pool type reactor. The core has an annular configuration of six rings and is cooled by natural circulation. The core coolant channels extend from the bottom grid plate to the top grid plate. The cooling water flows through the holes in the bottom grid plate, passes through the lower unheated region of the element, flows upwards through the active region, passes through the upper unheated region, and finally leaves the channel through the differential area between a triangular spacer block on the top of the fuel element and a round hole in the grid. Direct measurement of the flow rate in a coolant channel is difficult because of the bulky size and low accuracy of flow meters. The flow rate through the channel may be determined indirectly from the heat balance across the channel using measurements of the water inlet and outlet temperatures. This paper presents the experiments performed in the IPR-R1 reactor to monitoring some thermo-hydraulic parameters in the core coolant channels, such as: the radial and axial temperature profile, temperature, velocity, mass flow rate, mass flux and Reynolds's number. Some results were compared with theoretical predictions, as it was expected the variables follow the power distribution (or neutron flux) in the core. (author)

  16. Experience and research with the IEA-R1 Brazilian reactor

    International Nuclear Information System (INIS)

    Fulfaro, R.; Sousa, J.A. de; Nastasi, M.J.C.; Vinhas, L.A.; Lima, F.W.

    1982-06-01

    The IEA-R1 reactor of the Instituto de Pesquisas Energeticas e Nucleares, IPEN, of Sao Paulo, Brazil, a lightwater moderated swimming-pool research reactor of MTR type, went critical for the first time on September 16, 1957. In a general way, in these twenty four years the reactor was utilized without interruption by users of IPEN and other institutions, for the accomplishment of work in the field of applied and basic research, for master and doctoral thesis and for technical development. Some works performed and the renewal programme established for the IEA-R1 research reactor in which several improvements and changes were made. Recent activities in terms of production of radioisotopes and some current research programm in the field of Radiochemistry are described, mainly studies and research on chemical reactions and processes using radioactive tracers and development of radioanalytical methods, such as neutron activation and isotopic dilution. The research programmes of the Nuclear Physics Division of IPEN, which includes: nuclear spectroscopy studies and electromagnetic hyperfine interactions; neutron diffraction; neutron inelastic scattering studies in condensed matter; development and application of the technique of fission track register in solid state detectors; neutron radioactive capture with prompt gamma detection and, finally, research in the field of nuclear metrology, are presented. (Author) [pt

  17. Experience and research with the IEA-R1 Brazilian reactor

    International Nuclear Information System (INIS)

    Fulfaro, R.; Sousa, J.A. de; Nastasi, M.J.C.; Vinhas, L.A.; Lima, F.W. de.

    1982-06-01

    The IEA-R1 reactor of the Instituto de Pesquisas Energeticas e Nucleares, IPEN, of Sao Paulo, Brazil, a lighwater moderated swimming-pool research reactor of MTR type, went critical for the first time on September 16, 1957. In a general way, in these twenty four years the reactor was utilized without interruption by users of IPEN and other institutions, for the accomplishment of work in the field of applied and basic research, for master and doctoral thesis and for technical development. Some works performed and the renewal programme established for the IEA-R1 research reactor in which several improvements and changes were made. Recent activities in terms of production of radioisotopes and some current research programm in the field of Radiochemistry are described, mainly studies and research on chemical reactions and processes using radioactive tracers and development of radioanalytical methods, such as neutron activation and isotopic dilution. It is also presented the research programmes of the Nuclear Physics Division of IPEN, which includes: nuclear spectroscopy studies and electromagnetic hyperfine interactions; neutron diffraction; neutron inelastic scattering studies in condensed matter; development and application of the technique of fission track register in solid state detectors; neutron radioactive capture with prompt gamma detection and, finally, research in the field of nuclear metrology. (Author) [pt

  18. Evaluation of the physical protection system of the IEA-R1 research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Vaz, Antonio C.A.; Conti, Thadeu das N., E-mail: acavaz@ipen.br, E-mail: tnconti@yahoo.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    The '09/11' in New York and the accident at the Fukushima power plant are two events that served as worldwide reference to review some aspects of the Physical Protection System (PPS) in nuclear areas. The nuclear research reactor IEA-R1 has followed this new world order and improved the protection systems that are directly related to detection (CCTV, sensors, alarms, etc), delay (turnstile, gates, barriers, etc) and response (communication systems, response force, etc), for operation against malicious act, seeking always to avoid or minimize any possibility of threat, theft and sabotage. These actions were performed to prevent and to mitigate the consequence on the environment, economy and society from damages caused by natural hazard, as well. This study evaluates the PPS of the IEA-R1 regarding the weaknesses, strengths,and impacts of the changes resulting from the system implanted. The analyses were based on methodology developed by security experts from SANDIA National Laboratories in Texas - U.S.A, allowing the evaluation of the system through probabilistic and hypothetical analysis. (author)

  19. Verification of the linearity of the IPR-R1 TRIGA reactor power channels

    International Nuclear Information System (INIS)

    Souza, Rose Mary Gomes do Prado; Campolina, Daniel de Almeida Magalhaes

    2013-01-01

    The aim of this paper is to verify the linearity of the three power channels of the IPR-R1 TRIGA reactor. Located at Nuclear Technology Development Center-CDTN in Belo Horizonte, the IPR-R1 reactor is a typical 100 kW Mark I light-water reactor cooled by natural convection. When the experiments were performed, the reactor core had 59 fuel elements, containing 8% by weight of uranium enriched to 20% in 235 U. The core has cylindrical configuration with an annular graphite reflector. The responses of the detectors of the Linear, Log N and Percent Power channels were compared with the responses of detectors which only depend on the overall neutron flux within the reactor. Gold and cobalt foils were activated at low and high powers, respectively, and the specific count results were compared with measurements performed, simultaneously, with a fission chamber, and with the power registered by the three channels. The results show that the Linear channel responds linearly up to 100 kW, and the Log N channel responses are linear at low powers. In the range of high power, the Log N and the Percent Power channels exhibit linearity only from 10 kW to 50 kW. (author)

  20. Drosophila Polo regulates the spindle assembly checkpoint through Mps1-dependent BubR1 phosphorylation.

    Science.gov (United States)

    Conde, Carlos; Osswald, Mariana; Barbosa, João; Moutinho-Santos, Tatiana; Pinheiro, Diana; Guimarães, Sofia; Matos, Irina; Maiato, Helder; Sunkel, Claudio E

    2013-06-12

    Maintenance of genomic stability during eukaryotic cell division relies on the spindle assembly checkpoint (SAC) that prevents mitotic exit until all chromosomes are properly attached to the spindle. Polo is a mitotic kinase proposed to be involved in SAC function, but its role has remained elusive. We demonstrate that Polo and Aurora B functional interdependency comprises a positive feedback loop that promotes Mps1 kinetochore localization and activity. Expression of constitutively active Polo restores normal Mps1 kinetochore levels even after Aurora B inhibition, highlighting a role for Polo in Mps1 recruitment to unattached kinetochores downstream of Aurora B. We also show that Mps1 kinetochore localization is required for BubR1 hyperphosphorylation and formation of the 3F3/2 phosphoepitope. This is essential to allow recruitment of Cdc20 to unattached kinetochores and the assembly of anaphase-promoting complex/cyclosome-inhibitory complexes to levels that ensure long-term SAC activity. We propose a model in which Polo controls Mps1-dependent BubR1 phosphorylation to promote Cdc20 kinetochore recruitment and sustained SAC function.

  1. Structural evaluation of IEA-R1 primary system pump nozzles

    International Nuclear Information System (INIS)

    Fainer, Gerson; Faloppa, Altair A.; Oliveira, Carlos A. de; Mattar Neto, Miguel

    2017-01-01

    The IEA-R1 pumps of the primary coolant system may be required to withstand design and operational conditions. IEA-R1 nuclear research reactor is an open pool type reactor operated by IPEN since 1957. The reactor can be operated up to 5MW heating power since it was upgraded in a modernization program conducted by IPEN. The primary coolant system is composed by the piping system, decay tank, two heat pumps and two heat exchangers. In the latest arrangement upgrade of the primary system, conducted in 2014 as part of an aging management program, a partial replacement of the coolant piping and total replacement of piping and pump supports were done. As consequence, reviewed loads in the pump nozzles were obtained demanding a new evaluation of them. The aim of this report is to present the structural evaluation of the pump nozzles, considering the new loads coming from the new piping layout, according to: API 610 code verification, Supplier loads and structural analysis applying finite element method, by using the ANSYS computer program, regarding ASME VIII Div 1 & 2 recommendations. (author)

  2. The PLA2R1-JAK2 pathway upregulates ERRα and its mitochondrial program to exert tumor-suppressive action.

    Science.gov (United States)

    Griveau, A; Devailly, G; Eberst, L; Navaratnam, N; Le Calvé, B; Ferrand, M; Faull, P; Augert, A; Dante, R; Vanacker, J M; Vindrieux, D; Bernard, D

    2016-09-22

    Little is known about the biological role of the phospholipase A2 receptor (PLA2R1) transmembrane protein. In recent years, PLA2R1 has been shown to have an important role in regulating tumor-suppressive responses via JAK2 activation, but the underlying mechanisms are largely undeciphered. In this study, we observed that PLA2R1 increases the mitochondrial content, judged by increased levels of numerous mitochondrial proteins, of the mitochondrial structural component cardiolipin, of the mitochondrial DNA content, and of the mitochondrial DNA replication and transcription factor TFAM. This effect of PLA2R1 relies on a transcriptional program controlled by the estrogen-related receptor alpha1 (ERRα) mitochondrial master regulator. Expression of ERRα and of its nucleus-encoded mitochondrial targets is upregulated upon PLA2R1 ectopic expression, and this effect is mediated by JAK2. Conversely, downregulation of PLA2R1 decreases the level of ERRα and of its nucleus-encoded mitochondrial targets. Finally, blocking the ERRα-controlled mitochondrial program largely inhibits the PLA2R1-induced tumor-suppressive response. Together, our data document ERRα and its mitochondrial program as downstream effectors of the PLA2R1-JAK2 pathway leading to oncosuppression.

  3. Neutron flux measurement and thermal power calibration of the IAN-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Sarta Fuentes, Jose A.; Castiblanco Bohorquez, Luis A

    2008-10-29

    The IAN-R1 TRIGA reactor in Colombia was initially fueled with MTR-HEU enriched to 93% U-235, operated since 1965 at 10 kW, and was upgraded to 30 kW in 1980. General Atomics achieved in 1997 the conversion of HEU fuel to LEU fuel TRIGA type, and upgraded the reactor power to 100 kW. Since the IAN-R1 TRIGA reactor was in an extended shutdown during seven years, it was necessary to repeat some results of the commissioning test conducted in 1997. The thermal power calibration was carried out using the calorimetric method. The reactor was operated approximately at 20 kW during 3.5 hours, with manual power corrections since the automatic control system failed and with the forced refrigeration off. During the calorimetric experiment, the pool temperature was measured with a RTD which is installed near to the core. The dates were collected in intervals of 30 minutes. For establishing thermal power reactor, the water temperature versus the running were registered. For a calculated tank volume of 16 m{sup 3}, the tank constant calculated for the IAN-R1 TRIGA reactor is 0.0539 C/kW-hr. The reactor power determined was 19 kW. The core configuration is a rectangular grid plate that holds a combination of 4-rod and 3-rod clusters. The core contains 50 fuel rods with LEU fuel TRIGA (UZr H1.6) type enriched to 19.7%. The radial reflector consists of twenty graphite elements six of which are used for isotope production. The top an bottom reflectors are the cylindrical graphite end reflectors which are installed above and below of the active fuel section in each fuel rod. The spatial dependence of thermal neutron flux was measured axially in the 3-rod clusters 4C, 3D, 5E and in the 4F graphite element. The spatial distribution of the thermal neutron was determined using a self-powered detector and the absolute value of thermal neutron flux was determined by a gold activation detector. The (n, b- ) reaction is applied to determine the relative spatial distribution of thermal

  4. Current utilization and long term strategy of the Finnish TRIGA research reactor FiR 1

    International Nuclear Information System (INIS)

    Auterinen, Iiro; Salmenhaara, Seppo

    2008-01-01

    FiR 1 (TRIGA Mark II, 250 kW) has an important international role in the development of boron neutron capture therapy (BNCT) for cancer. The safety and efficacy of BNCT is studied for several different cancers: - primary glioblastoma, a highly malignant brain tumour (since 1999); - recurrent glioblastoma or anaplastic astrocytoma (since 2001); - recurrent inoperable head and neck carcinoma (since 2003). It is one of the few facilities in the world providing this kind of treatments. The successes in the BNCT development have now created a demand for these treatments, although they are given on an experimental basis. Well over 100 patients treated now since May 1999: - at least 1 patient irradiation / week, often 2 (Tuesday and Thursday) - patients are referred to BNCT-treatments from several hospitals, also outside research protocols; - the hospitals pay for the treatment. The FiR 1 reactor has proven to be a reliable neutron source for the BNCT treatments; no patient irradiations have been cancelled because of a failure of the reactor. The BNCT facility has become a center of extensive academic research especially in medical physics. Nuclear education and training continue to play also a role at FiR 1 in the form of university courses and training of nuclear industry personnel. FiR 1 is one of the two sources in Scandinavia for short lived radioisotopes used in tracer studies in industry. The main isotope produced is Br-82 in the form of either KBr or ethylene bromide. Other typical isotopes are Na-24, Ar-41, La-140. The isotopes are used mainly in tracer studies in industry (Indmeas Inc., Finland). Typical activity of one irradiated Br-sample is 20 - 80 GBq; total activity produced in one year is over 3 TBq; the reactor operating time needed for the isotope production is one or two days per week. Accelerator based neutron sources are developed for BNCT. The prospect is that when BNCT will achieve a status of a fully accepted and efficient treatment modality for

  5. Dansyl chloride labeling of Pseudomonas aeruginosa treated with pyocin R1: change in permeability of the cell envelope.

    Science.gov (United States)

    Uratani, Y

    1982-01-01

    Pyocin R1, a bacteriocin of Pseudomonas aeruginosa, caused an increase in binding of fluorescent label, 1-dimethylaminonaphthalene-5-sulfonyl chloride (dansyl chloride), to sensitive cells. In pyocin R1-treated cells, cytoplasmic soluble proteins and crude ribosomes as well as cell envelopes were labeled by dansyl chloride. The amount of bound dye was proportional to the multiplicity of pyocin R1 and reached a maximal level at high multiplicity. In addition, pyocin R1 rapidly caused an increase in fluorescence intensity of the hydrophobic probes N-phenyl-1-naphthylamine, pyrene, and perylene, which were mixed with cells. These results show that pyocin R1 damages locally a cell envelope barrier to hydrophobic solutes and allows dyes to penetrate into the intracellular space across the barrier. PMID:6799489

  6. Experimental study of the temperature distribution in the TRIGA IPR-R1 Brazilian research reactor

    International Nuclear Information System (INIS)

    Mesquita, Amir Zacarias

    2005-01-01

    The TRIGA-IPR-R1 Research Nuclear Reactor has completed 44 years in operation in November 2004. Its initial nominal thermal power was 30 kW. In 1979 its power was increased to 100 kW by adding new fuel elements to the reactor. Recently some more fuel elements were added to the core increasing the power to 250 kW. The TRIGA-IPR-R1 is a pool type reactor with a natural circulation core cooling system. Although the large number of experiments had been carried out with this reactor, mainly on neutron activation analysis, there is not many data on its thermal-hydraulics processes, whether experimental or theoretical. So a number of experiments were carried out with the measurement of the temperature inside the fuel element, in the reactor core and along the reactor pool. During these experiments the reactor was set in many different power levels. These experiments are part of the CDTN/CNEN research program, and have the main objective of commissioning the TRIGA-IPR-R1 reactor for routine operation at 250 kW. This work presents the experimental and theoretical analyses to determine the temperature distribution in the reactor. A methodology for the calibration and monitoring the reactor thermal power was also developed. This methodology allowed adding others power measuring channels to the reactor by using thermal processes. The fuel thermal conductivity and the heat transfer coefficient from the cladding to the coolant were also experimentally valued. lt was also presented a correlation for the gap conductance between the fuel and the cladding. The experimental results were compared with theoretical calculations and with data obtained from technical literature. A data acquisition and processing system and a software were developed to help the investigation. This system allows on line monitoring and registration of the main reactor operational parameters. The experiments have given better comprehension of the reactor thermal-fluid dynamics and helped to develop numerical

  7. Digital Systems Implemented at the IPEN Nuclear Research Reactor (IEA-R1): Results and Necessities

    International Nuclear Information System (INIS)

    Nahuel-Cardenas, Jose-Patricio; Madi-Filho, Tufic; Ricci-Filho, Walter; Rodrigues-de-Carvalho, Marcos; Lima-Benevenuti, Erion-de; Gomes-Neto, Jose

    2013-06-01

    (Nuclear and Energy Research Institute) was founded in 1956 with the main purpose of doing research and development in the field of nuclear energy and its applications. It is located at the campus of University of Sao Paulo (USP), in the city of Sao Paulo, in an area of nearly 500, 000 m2. It has over 1.000 employees and 40% of them have qualification at master or doctor level The institute is recognized as a national leader institution in research and development (R and D) in the areas of radiopharmaceuticals, industrial applications of radiation, basic nuclear research, nuclear reactor operation and nuclear applications, materials science and technology, laser technology and applications. Along with the R and D, it has a strong educational activity, having a graduate program in Nuclear Technology, in association with the University of Sao Paulo, ranked as the best university in the country. The Federal Government Evaluation institution CAPES, granted to this course grade 6, considering it a program of Excellence. This program started at 1976 and has awarded 458 Ph.D. degrees and 937 master degrees since them. The actual graduate enrollment is around 400 students. One of major nuclear installation at IPEN is the IEA-R1 research reactor; it is the only Brazilian research reactor with substantial power level suitable for its utilization in researches concerning physics, chemistry, biology and engineering as well as for producing some useful radioisotopes for medical and other applications. IEA-R1 reactor is a swimming pool type reactor moderated and cooled by light water and uses graphite and beryllium as reflectors. The first criticality was achieved on September 16, 1957. The reactor is currently operating at 4.5 MW power level with an operational schedule of continuous 64 hours a week. In 1996 a Modernization Program was started to establish recommendations in order to mitigate equipment and structures ageing effects in the reactor components, detect and evaluate

  8. Nuclear research reactor IEA-R1 heat exchanger inlet nozzle flow - a preliminary study

    International Nuclear Information System (INIS)

    Angelo, Gabriel; Andrade, Delvonei Alves de; Fainer, Gerson; Angelo, Edvaldo

    2009-01-01

    As a computational fluid mechanics training task, a preliminary model was developed. ANSYS-CFX R code was used in order to study the flow at the inlet nozzle of the heat exchanger of the primary circuit of the nuclear research reactor IEA-R1. The geometry of the inlet nozzle is basically compounded by a cylinder and two radial rings which are welded on the shell. When doing so there is an offset between the holes through the shell and the inlet nozzle. Since it is not standardized by TEMA, the inlet nozzle was chosen for a preliminary study of the flow. Results for the proposed model are presented and discussed. (author)

  9. Use of self powered neutron detectors in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Galo Rocha, F. del.

    1989-01-01

    A survey of self-powered neutron detectors, SPND, which are used as part of the in-core instrumentation of nuclear reactors is presented. Measurements with Co and Er SPND's were made in the IEA-R1 reactor for determining the neutron flux distribution and the integral reactor power. Due to the size of the available detectors, the neutron flux distribution could not be obtained with accuracy. The results obtained in the reactor power measurements demonstrate that the SPND have the linearity and the quick response necessary for a reactor power channel. This work also presents a proposed design of a SPND using Pt as wire emissor. This proposed design is based in the experience gained in building two prototypes. The greatest difficulties encountered include materials and technology to perform the delicate weldings. (author)

  10. Triga IPR-R1 neutron beam: increasing the thematic of applications in CDTN

    International Nuclear Information System (INIS)

    Sebastiao, Rita de C.O.; Rodrigues, Rogerio R.; Leal, Alexandre S.

    2007-01-01

    The neutron flux in a research reactor can be used in several applications such as the neutron activation analysis, the radioisotopes production, study of DNA and protein structures, doping of silicon and neutron radiography. The enhancement of the nuclear research reactor utilization with the introduction of new applications would be possible with the availability of a neutron beam and with the neutron energy spectra completely characterized. This work evaluates the use of TRIGA reactor of CDTN/CNEN as a source of neutron beam. The readiness of a neutron beam with appropriate intensity and energy spectrum would make possible the increasing of the thematic of applications and researches in this reactor. The main contribution to this theme is to evaluate the thermal and epithermal neutron flux in the vertical extractor of the TRIGA IPR-R1. The simulation was performed in this work using the MCNP code. (author)

  11. Absorption and Flux Density Measurements in an Iron Plug in R1

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Ragnar; Braun, Josef

    1958-11-15

    Thermal, epithermal and fast neutron fluxes have been measured in a 60 cm long, 'sliced' iron plug, which has been placed in the lower iron lid of the Swedish reactor R1. Au foils, Cu foils, Mn foils, P packets, Cu wires and small Fe cylinders have been used. The gamma flux has been determined with film dosimeters. The measurements have shown that only in the first centimeters of the iron is the activation determined by the thermal flux, which decreases with a relaxation length {lambda}= (1.51 {+-} 0.02) cm. The epithermal flux is entirely predominant already after 10 cm ( {lambda} = 16 cm). The epithermal neutron flux decreases even more slowly than the fast flux ({lambda} = 6.2 cm)

  12. Upper Campanian-Maastrichtian chronostratigraphy of the Skælskør-1 core, Denmark

    DEFF Research Database (Denmark)

    Thibault, Nicolas Rudolph; Anderskouv, Kresten; Bjerager, Morten

    2015-01-01

    The lithostratigraphy, calcareous nannofossil biostratigraphy, carbon- and oxygen-isotope stratigraphy and gamma-ray profile are presented for the Skælskør-1 core, eastern Denmark. The correlation of carbon isotopes to Gubbio (Italy) and ODP Site 762C (Indian Ocean) provides...... the chronostratigrahical framework of the core through a tie to magnetostratigraphy. Two new carbon-isotope excursions are defined for the uppermost Maastrichtian of the core and prove useful for long-distance correlation. Twenty stratigraphic tie-points are used for correlation of the upper Campanian......-Maastrichtian interval by combining carbon-isotope and gamma-ray variations. Significant dissimilarities in the gamma-ray profiles of the Danish Basin cores preclude the sole use of this tool for basin-scale correlations. Bulk oxygen-isotopes and semi-quantitative abundance changes in the warm-water calcareous...

  13. Absorption and Flux Density Measurements in an Iron Plug in R1

    International Nuclear Information System (INIS)

    Nilsson, Ragnar; Braun, Josef

    1958-11-01

    Thermal, epithermal and fast neutron fluxes have been measured in a 60 cm long, 'sliced' iron plug, which has been placed in the lower iron lid of the Swedish reactor R1. Au foils, Cu foils, Mn foils, P packets, Cu wires and small Fe cylinders have been used. The gamma flux has been determined with film dosimeters. The measurements have shown that only in the first centimeters of the iron is the activation determined by the thermal flux, which decreases with a relaxation length λ= (1.51 ± 0.02) cm. The epithermal flux is entirely predominant already after 10 cm ( λ = 16 cm). The epithermal neutron flux decreases even more slowly than the fast flux (λ = 6.2 cm)

  14. An improved slow neutron spectrometer at nuclear research reactor et-r r-1. Vol. 2

    Energy Technology Data Exchange (ETDEWEB)

    Abu El-Ela, M A [Reactor and Neutron Physics, Nuclear Research Center, AEA, Cairo (Egypt)

    1996-03-01

    An improved slow neutron selector has been aligned at channel number 6 of the nuclear research reactor ET-R R-1 Inshas. The flight path is 4 meter. The collimator-rotor-collimator system has the dimensions 0.3 x 2.5 x 70 cm with the rotor diameter 16 cm and 3 slits of 0.3 x 2.5 cm cross section. The rotor rotation rate varies between 600 r.p.m. the counting system has one of the best modern high electronic advanced technology time analyzer with minimum dwell time 2 sec, 8192 channels and a double detector inputs of TTL and NEG NIM standard pulses. The analyzer external triggering signals are of TTL standard type. A special design {sup 3} He detector for time of flight spectrometry has been used in the SNS. The reactor bare thermal neutron spectrum has been successfully measured, to show good agreement with the previous data. 6 figs.

  15. Temperature dependence of the chromium(III) R1 linewidth in emerald

    Science.gov (United States)

    Carceller-Pastor, Ivana; Hutchison, Wayne D.; Riesen, Hans

    2013-03-01

    The temperature dependent contribution to the R1 (2E ← 4A2) linewidth in emerald, Be3Al2Si6O18:Cr3, has been measured by employing spectral hole-burning, fluorescence line narrowing and conventional luminescence experiments. The contribution varies from 0.6 MHz at 6.5 K to ˜420 GHz at 240 K and the line red-shifts by ˜570 GHz. Above 60 K, the dependence is well described by a non-perturbative formalism for two-phonon Raman scattering. Below this temperature the direct one-phonon process between the levels of the split 2E excited state dominates. However, it appears that a localized low-energy phonon leads to a deviation from the standard pattern at lowest temperatures.

  16. CFD simulation of IPR-R1 Triga subchannels fluid flow

    International Nuclear Information System (INIS)

    Silva, Vitor V.; Santos, A.; Mesquita, Amir Z.; Silva, P.S. da; Pereira, C.

    2013-01-01

    Computational fluid dynamics (CFD) codes have been extensively used in engineering problems, with increasing use in nuclear engineering. One of these computer codes is OpenFOAM. It is freely distributed with source code and offers a great flexibility in simulating particular conditions like those found in many problems in nuclear reactor analysis. The aim of this work is to simulate fluid flow and heat flux in three different configurations of subchannels of IPR-R1 TRIGA reactor using OpenFOAM. The data will be then validated against real experimental data obtained during the operation of the reactor at 100kW. This validation process is fundamental to allow the use of the software and associated model to simulate reactor's operation at different conditions, namely different power e fluid flow velocities. (author)

  17. CFD simulation of IPR-R1 Triga subchannels fluid flow

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Vitor V.; Santos, A.; Mesquita, Amir Z.; Silva, P.S. da, E-mail: vitors@cdtn.br, E-mail: aacs@cdtn.br, E-mail: amir@cdtn.br, E-mail: psblsg@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN - MG), Belo Horizonte, MG (Brazil); Pereira, C., E-mail: claubia@nuclear.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear

    2013-07-01

    Computational fluid dynamics (CFD) codes have been extensively used in engineering problems, with increasing use in nuclear engineering. One of these computer codes is OpenFOAM. It is freely distributed with source code and offers a great flexibility in simulating particular conditions like those found in many problems in nuclear reactor analysis. The aim of this work is to simulate fluid flow and heat flux in three different configurations of subchannels of IPR-R1 TRIGA reactor using OpenFOAM. The data will be then validated against real experimental data obtained during the operation of the reactor at 100kW. This validation process is fundamental to allow the use of the software and associated model to simulate reactor's operation at different conditions, namely different power e fluid flow velocities. (author)

  18. Structure determination of the neutral exopolysaccharide produced by Lactobacillus delbrueckii subsp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Van Calsteren, Marie-Rose; Gagnon, Fleur; Nishimura, Junko; Makino, Seiya

    2015-09-02

    The neutral exopolysaccharide (NPS) of Lactobacillus delbrueckii subsp. bulgaricus strain OLL1073R-1 was purified and characterized. The molecular mass was 5.0×10(6) g/mol. Sugar and absolute configuration analyses gave the following composition: d-Glc, 1; d-Gal, 1.5. The NPS was also submitted to periodate oxidation followed by borohydride reduction and Smith degradation. Sugar and methylation analyses, (1)H and (13)C nuclear magnetic resonance, and mass spectrometry of the NPS or of its specifically modified products allowed determining the repeating unit sequence: {2)Glc(α1-3)Glc(β1-3)[Gal(β1-4)]Gal(β1-4)Gal(α1-}n. The structure is compared to that of exopolysaccharides produced by other Lactobacillus bulgaricus strains. Copyright © 2015. Published by Elsevier Ltd.

  19. Neutrons characterization of the nuclear reactor Ian-R1 of Colombia

    International Nuclear Information System (INIS)

    Gonzalez P, L. X.; Martinez O, S. A.; Vega C, H. R.

    2014-08-01

    By means of Monte Carlo methods, with the code MCNPX, the neutron characteristics of the research nuclear reactor Ian-R1 of Colombia, in power off but with the neutrons source in their start position, have been valued. The neutrons spectra, the total flow and their average power were calculated in the irradiation spaces inside the graphite reflector, as well as in the cells with air. Also the spectra, the total flow and the absorbed dose were calculated in several places distributed along the radial shaft inside the water moderator. The neutrons total flow was also considered to the long of the axial shaft. The characteristics of the neutrons spectra vary depending on their position regarding the source and the material that surrounds to the cell where the calculation was made. (Author)

  20. How the nuclear safety team conducts emergency exercises at the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Vaz, Antonio C.A.; Silva, Davilson G.; Toyoda, Eduardo Y.; Santia, Paulo S.; Conti, Thadeu N.; Semmler, Renato; Carvalho, Ricardo N.

    2015-01-01

    This work introduces the Diagram of Emergency Exercise Coordination designed by the Nuclear Safety Team for better Emergency Exercise coordination. The Nuclear Safety Team was created with the mission of avoiding, preventing and mitigating the causes and effects of accidents at the IEA-R1. The facility where we conduct our work is located in an area of a huge population, what increases the responsibility of our mission: conducting exercises and training are part of our daily activities. During the Emergency Exercise, accidents ranked 0-4 on INES (International Nuclear Events Scale) are simulated and involve: Police Department, Fire Department, workers, people from the community, and others. In the last exercise held in June 2014, the scenario contemplated a terrorist organization action that infiltrated in a group of students who were visiting the IEA-R1, tried to steal fresh fuel element to fabricate a dirty bomb. Emergency procedures and plans, timeline and metrics of the actions were applied to the Emergency Exercise evaluation. The next exercise will be held in November, with the simulation of the piping of the primary cooling circuit rupture, causing the emptying of the pool and the lack of cooling of the fuel elements in the reactor core: this will be the scenario. The skills acquired and the systems improvement have been very important tools for the reactor operation safety and the Nuclear Safety Team is making technical efforts so that these Emergency Exercises may be applied to other nuclear and radiological facilities. Equally important for the process of improving nuclear safety is the emphasis placed on implementing quality improvements to the human factor in the nuclear safety area, a crucial element that is often not considered by those outside the nuclear sector. Surely, the Diagram of Emergency Exercise Coordination application will improve and facilitate the organization, coordination and evaluation tasks. (author)

  1. High-resolution spectra of comet C/2013 R1 (Lovejoy)

    Science.gov (United States)

    Rousselot, P.; Decock, A.; Korsun, P. P.; Jehin, E.; Kulyk, I.; Manfroid, J.; Hutsemékers, D.

    2015-08-01

    Context. High-resolution spectra of comets permit deriving the physical properties of the coma. In the optical range, relative production rates can be computed, and information about isotopic ratios and the origin of oxygen atoms can be obtained. Aims: The main objective of the work presented here was to obtain information about the chemical composition of comet C/2013 R1 (Lovejoy), a bright and long-period comet that passed perihelion (0.81 au) on 22 December 2013. Methods: We used the HARPS-North echelle spectrograph at the 3.5 m telescope TNG to obtain high-resolution spectra of comet C/2013 R1 (Lovejoy) in the optical range immediately after its perihelion passage during four consecutive nights in the period December 23 to 26, 2013. Results: Our results demonstrate the ability of HARPS-North to efficiently obtain cometary spectra. Very faint emission lines, such as those of 15NH2, have been detected, leading to a rough estimate of the 14N/15N ratio in NH2. The 12C/13C ratio was measured in the C2 lines and is equal to 80 ± 30. The oxygen lines were studied as well (green to red line intensity ratios and widths), confirming that H2O is the main parent molecule that photodissociates to produce oxygen atoms. This suggests that this comet has a high CO2 abundance. Relative production rates for C2 and NH2 were computed, but we found no significant deviation from a typical NH2/C2 ratio. Based on observations made with the Italian Telescopio Nazionale Galileo (TNG) operated on the island of La Palma by the Fundación Galileo Galilei of the INAF (Istituto Nazionale di Astrofisica) at the Spanish Observatorio del Roque de los Muchachos of the Instituto de Astrofisica de Canarias.

  2. Solving the scalability issue in quantum-based refinement: Q|R#1.

    Science.gov (United States)

    Zheng, Min; Moriarty, Nigel W; Xu, Yanting; Reimers, Jeffrey R; Afonine, Pavel V; Waller, Mark P

    2017-12-01

    Accurately refining biomacromolecules using a quantum-chemical method is challenging because the cost of a quantum-chemical calculation scales approximately as n m , where n is the number of atoms and m (≥3) is based on the quantum method of choice. This fundamental problem means that quantum-chemical calculations become intractable when the size of the system requires more computational resources than are available. In the development of the software package called Q|R, this issue is referred to as Q|R#1. A divide-and-conquer approach has been developed that fragments the atomic model into small manageable pieces in order to solve Q|R#1. Firstly, the atomic model of a crystal structure is analyzed to detect noncovalent interactions between residues, and the results of the analysis are represented as an interaction graph. Secondly, a graph-clustering algorithm is used to partition the interaction graph into a set of clusters in such a way as to minimize disruption to the noncovalent interaction network. Thirdly, the environment surrounding each individual cluster is analyzed and any residue that is interacting with a particular cluster is assigned to the buffer region of that particular cluster. A fragment is defined as a cluster plus its buffer region. The gradients for all atoms from each of the fragments are computed, and only the gradients from each cluster are combined to create the total gradients. A quantum-based refinement is carried out using the total gradients as chemical restraints. In order to validate this interaction graph-based fragmentation approach in Q|R, the entire atomic model of an amyloid cross-β spine crystal structure (PDB entry 2oNA) was refined.

  3. How the nuclear safety team conducts emergency exercises at the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Vaz, Antonio C.A.; Silva, Davilson G.; Toyoda, Eduardo Y.; Santia, Paulo S.; Conti, Thadeu N.; Semmler, Renato; Carvalho, Ricardo N., E-mail: acavaz@ipen.br, E-mail: dgsilva@ipen.br, E-mail: eytoyoda@ipen.br, E-mail: psantia@ipen.br, E-mail: tnconti@ipen.br, E-mail: rsemmler@ipen.b, E-mail: rncarval@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    This work introduces the Diagram of Emergency Exercise Coordination designed by the Nuclear Safety Team for better Emergency Exercise coordination. The Nuclear Safety Team was created with the mission of avoiding, preventing and mitigating the causes and effects of accidents at the IEA-R1. The facility where we conduct our work is located in an area of a huge population, what increases the responsibility of our mission: conducting exercises and training are part of our daily activities. During the Emergency Exercise, accidents ranked 0-4 on INES (International Nuclear Events Scale) are simulated and involve: Police Department, Fire Department, workers, people from the community, and others. In the last exercise held in June 2014, the scenario contemplated a terrorist organization action that infiltrated in a group of students who were visiting the IEA-R1, tried to steal fresh fuel element to fabricate a dirty bomb. Emergency procedures and plans, timeline and metrics of the actions were applied to the Emergency Exercise evaluation. The next exercise will be held in November, with the simulation of the piping of the primary cooling circuit rupture, causing the emptying of the pool and the lack of cooling of the fuel elements in the reactor core: this will be the scenario. The skills acquired and the systems improvement have been very important tools for the reactor operation safety and the Nuclear Safety Team is making technical efforts so that these Emergency Exercises may be applied to other nuclear and radiological facilities. Equally important for the process of improving nuclear safety is the emphasis placed on implementing quality improvements to the human factor in the nuclear safety area, a crucial element that is often not considered by those outside the nuclear sector. Surely, the Diagram of Emergency Exercise Coordination application will improve and facilitate the organization, coordination and evaluation tasks. (author)

  4. Characterization of cartridge filters from the IEA-R1 Nuclear Reactor

    International Nuclear Information System (INIS)

    2015-01-01

    The management of radioactive waste ensures safety to human health and the environment nowadays and for the future, without overwhelming the upcoming generations. The primary characterization of radioactive waste is one of the main steps in the management of radioactive waste. This step permits to choose the best treatment for the radioactive waste before forwarding it to its final disposal. The aim of the present work is the primary characterization of cartridge filters from the IEA-R1 nuclear reactor utilizing gamma-ray spectrometry, and the method of Monte Carlo for calibration. The IEA-R1 is located in the Nuclear and Energy Research Institute (IPEN - CNEN) in the city of Sao Paulo, Brazil. Cartridge filters are used for purification of the cooling water that is pumped through the core of the pool type nuclear research reactors. Once worn out, these filters are replaced and then become radioactive waste. Determination of the radioactive inventory is of paramount importance in the management of such radioactive waste, and one of the main methods for doing so is the gamma-ray spectrometry, which can identify and quantify high energy photon emitters. The technique chosen for the characterization of radioactive waste in the present work is the gamma-ray spectrometry with High purity Germanium (HPGe) detectors. From the energy identified in the experimental spectrum, three radioisotopes were identified in the cartridge filter: 108m Ag, 110m Ag, 60 Co. For the estimated activity of the filter, the calibration in efficiency was made utilizing the MCNP4C code of the Monte Carlo method. Such method was chosen because there is no standard source available in the same geometry of the cartridge filter, therefore a simulation had to be developed in order to reach a calibration equation, necessary to estimate the activity of the radioactive waste. The results presented an activity value in the order of MBq for all radioisotopes. (authors)

  5. Characterization of cartridge filters from the IEA-R1 Nuclear Reactor

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-07-01

    The management of radioactive waste ensures safety to human health and the environment nowadays and for the future, without overwhelming the upcoming generations. The primary characterization of radioactive waste is one of the main steps in the management of radioactive waste. This step permits to choose the best treatment for the radioactive waste before forwarding it to its final disposal. The aim of the present work is the primary characterization of cartridge filters from the IEA-R1 nuclear reactor utilizing gamma-ray spectrometry, and the method of Monte Carlo for calibration. The IEA-R1 is located in the Nuclear and Energy Research Institute (IPEN - CNEN) in the city of Sao Paulo, Brazil. Cartridge filters are used for purification of the cooling water that is pumped through the core of the pool type nuclear research reactors. Once worn out, these filters are replaced and then become radioactive waste. Determination of the radioactive inventory is of paramount importance in the management of such radioactive waste, and one of the main methods for doing so is the gamma-ray spectrometry, which can identify and quantify high energy photon emitters. The technique chosen for the characterization of radioactive waste in the present work is the gamma-ray spectrometry with High purity Germanium (HPGe) detectors. From the energy identified in the experimental spectrum, three radioisotopes were identified in the cartridge filter: {sup 108m}Ag, {sup 110m}Ag, {sup 60}Co. For the estimated activity of the filter, the calibration in efficiency was made utilizing the MCNP4C code of the Monte Carlo method. Such method was chosen because there is no standard source available in the same geometry of the cartridge filter, therefore a simulation had to be developed in order to reach a calibration equation, necessary to estimate the activity of the radioactive waste. The results presented an activity value in the order of MBq for all radioisotopes. (authors)

  6. A structural model of the pore-forming region of the skeletal muscle ryanodine receptor (RyR1.

    Directory of Open Access Journals (Sweden)

    Srinivas Ramachandran

    2009-04-01

    Full Text Available Ryanodine receptors (RyRs are ion channels that regulate muscle contraction by releasing calcium ions from intracellular stores into the cytoplasm. Mutations in skeletal muscle RyR (RyR1 give rise to congenital diseases such as central core disease. The absence of high-resolution structures of RyR1 has limited our understanding of channel function and disease mechanisms at the molecular level. Here, we report a structural model of the pore-forming region of RyR1. Molecular dynamics simulations show high ion binding to putative pore residues D4899, E4900, D4938, and D4945, which are experimentally known to be critical for channel conductance and selectivity. We also observe preferential localization of Ca(2+ over K(+ in the selectivity filter of RyR1. Simulations of RyR1-D4899Q mutant show a loss of preference to Ca(2+ in the selectivity filter as seen experimentally. Electrophysiological experiments on a central core disease mutant, RyR1-G4898R, show constitutively open channels that conduct K(+ but not Ca(2+. Our simulations with G4898R likewise show a decrease in the preference of Ca(2+ over K(+ in the selectivity filter. Together, the computational and experimental results shed light on ion conductance and selectivity of RyR1 at an atomistic level.

  7. Unexpected dependence of RyR1 splice variant expression in human lower limb muscles on fiber-type composition.

    Science.gov (United States)

    Willemse, Hermia; Theodoratos, Angelo; Smith, Paul N; Dulhunty, Angela F

    2016-02-01

    The skeletal muscle ryanodine receptor Ca(2+) release channel (RyR1), essential for excitation-contraction (EC) coupling, demonstrates a known developmentally regulated alternative splicing in the ASI region. We now find unexpectedly that the expression of the splice variants is closely related to fiber type in adult human lower limb muscles. We examined the distribution of myosin heavy chain isoforms and ASI splice variants in gluteus minimus, gluteus medius and vastus medialis from patients aged 45 to 85 years. There was a strong positive correlation between ASI(+)RyR1 and the percentage of type 2 fibers in the muscles (r = 0.725), and a correspondingly strong negative correlation between the percentages of ASI(+)RyR1 and percentage of type 1 fibers. When the type 2 fiber data were separated into type 2X and type 2A, the correlation with ASI(+)RyR1 was stronger in type 2X fibers (r = 0.781) than in type 2A fibers (r = 0.461). There was no significant correlation between age and either fiber-type composition or ASI(+)RyR1/ASI(-)RyR1 ratio. The results suggest that the reduced expression of ASI(-)RyR1 during development may reflect a reduction in type 1 fibers during development. Preferential expression of ASI(-) RyR1, having a higher gain of in Ca(2+) release during EC coupling than ASI(+)RyR1, may compensate for the reduced terminal cisternae volume, fewer junctional contacts and reduced charge movement in type 1 fibers.

  8. A Saccharomyces cerevisiae Assay System to Investigate Ligand/AdipoR1 Interactions That Lead to Cellular Signaling

    KAUST Repository

    Aouida, Mustapha; Kim, Kangchang; Shaikh, Abdul Rajjak; Pardo, Jose M.; Eppinger, Jö rg; Yun, Dae-Jin; Bressan, Ray A.; Narasimhan, Meena L.

    2013-01-01

    Adiponectin is a mammalian hormone that exerts anti-diabetic, anti-cancer and cardioprotective effects through interaction with its major ubiquitously expressed plasma membrane localized receptors, AdipoR1 and AdipoR2. Here, we report a

  9. Modernization of Safety and Control Instrumentation of the IEA-R1 Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    De Carvalho, P.V., E-mail: paulov@ien.gov.br [Institute of Nuclear Engineering (IEN), National Nuclear Energy Commission (CNEN), Rio de Janeiro (Brazil)

    2014-08-15

    The research reactor IEA-R1 located in the Institute of Energy and Nuclear Research (IPEN), São Paulo, Brazil, obtained its first criticality on 16 September 1957 and since then has served the scientific and medical community in the performance of experiments in applied nuclear physics, as well as the provision of radioisotopes for production of radiopharmaceuticals. The reactor produces radioisotopes {sup 82}Br and {sup 41}Ar for special processes in industrial inspection and {sup 192}Ir and {sup 198}Au as sources of radiation used in brachytherapy, {sup 153}Sm for pain relief in patients with bone metastasis, and calibrated sources of {sup 133}Ba, {sup 137}Cs, {sup 57}Co, {sup 60}Co, {sup 241}Am and {sup 152}Eu used in medical clinics and hospitals practicing nuclear medicine and research laboratories. Services are offered in regular non-destructive testing by neutron radiography, neutron irradiation of silicon for phosphorous doping and other various irradiations with neutrons. The reactor is responsible for producing approximately 70% of radiopharmaceutical {sup 131}I used in Brazil, which saves about US$ 800 000 annually for the country. After more than 50 years of use, most of its equipment and systems have been modernized, and recently the reactor power was increased to 5 MW in order to enhance radioisotope production capability. However, the control room and nuclear instrumentation system used for reactor safety have operated more than 30 years and require constant maintenance. Many equipment and electronic components are obsolete, and replacements are not available in the market. The modernization of the nuclear safety and control instrumentation systems of IEA-R1 is being carried out with consideration for the internationally recognized criteria for safety and reliable reactor operations and the latest developments in nuclear electronic technology. The project for the new reactor instrumentation system specifies three wide range neutron monitoring

  10. Defining the molecular basis of BubR1 kinetochore interactions and APC/C-CDC20 inhibition.

    Science.gov (United States)

    D'Arcy, Sheena; Davies, Owen R; Blundell, Tom L; Bolanos-Garcia, Victor M

    2010-05-07

    BubR1 is essential for the mitotic checkpoint that prevents aneuploidy in cellular progeny by triggering anaphase delay in response to kinetochores incorrectly/not attached to the mitotic spindle. Here, we define the molecular architecture of the functionally significant N-terminal region of human BubR1 and present the 1.8 A crystal structure of its tetratricopeptide repeat (TPR) domain. The structure reveals divergence from the classical TPR fold and is highly similar to the TPR domain of budding yeast Bub1. Shared distinctive features include a disordered loop insertion, a 3(10)-helix, a tight turn involving glycine positive Phi angles, and noncanonical packing of and between the TPR motifs. We also define the molecular determinants of the interaction between BubR1 and kinetochore protein Blinkin. We identify a shallow groove on the concave surface of the BubR1 TPR domain that forms multiple discrete and potentially cooperative interactions with Blinkin. Finally, we present evidence for a direct interaction between BubR1 and Bub1 mediated by regions C-terminal to their TPR domains. This interaction provides a mechanism for Bub1-dependent kinetochore recruitment of BubR1. We thus present novel molecular insights into the structure of BubR1 and its interactions at the kinetochore-microtubule interface. Our studies pave the way for future structure-directed engineering aimed at dissecting the roles of kinetochore-bound and other pools of BubR1 in vivo.

  11. R1 correction in amide proton transfer imaging: indication of the influence of transcytolemmal water exchange on CEST measurements.

    Science.gov (United States)

    Li, Hua; Li, Ke; Zhang, Xiao-Yong; Jiang, Xiaoyu; Zu, Zhongliang; Zaiss, Moritz; Gochberg, Daniel F; Gore, John C; Xu, Junzhong

    2015-12-01

    Amide proton transfer (APT) imaging may potentially detect mobile proteins/peptides non-invasively in vivo, but its specificity may be reduced by contamination from other confounding effects such as asymmetry of non-specific magnetization transfer (MT) effects and spin-lattice relaxation with rate R1 (=1/T1). Previously reported spillover, MT and R1 correction methods were based on a two-pool model, in which the existence of multiple water compartments with heterogeneous relaxation properties in real tissues was ignored. Such simple models may not adequately represent real tissues, and thus such corrections may be unreliable. The current study investigated the effectiveness and accuracy of correcting for R1 in APT imaging via simulations and in vivo experiments using tumor-bearing rats subjected to serial injections of Gd-DTPA that produced different tissue R1 values in regions of blood-brain-barrier breakdown. The results suggest that conventional measurements of APT contrast (such as APT* and MTRasym ) may be significantly contaminated by R1 variations, while the R1 -corrected metric AREX* was found to be relatively unaffected by R1 changes over a broad range (0.4-1 Hz). Our results confirm the importance of correcting for spin-lattice relaxation effects in quantitative APT imaging, and demonstrate the reliability of using the observed tissue R1 for corrections to obtain more specific and accurate measurements of APT contrast in vivo. The results also indicate that, due to relatively fast transcytolemmal water exchange, the influence of intra- and extracellular water compartments on CEST measurements with seconds long saturation time may be ignored in tumors. Copyright © 2015 John Wiley & Sons, Ltd.

  12. Impaired associative fear learning in mice with complete loss or haploinsufficiency of AMPA GluR1 receptors

    Directory of Open Access Journals (Sweden)

    Michael Feyder

    2007-12-01

    Full Text Available There is compelling evidence that L-alpha-amino-3-hydroxy-5-methylisoxazole-4-propionate (AMPA glutamate receptors containing the GluR1 subunit contribute to the molecular mechanisms associated with learning. AMPA GluR1 glutamate receptor knockout mice (KO exhibit abnormal hippocampal and amygdala plasticity, and deficits on various assays for cognition including Pavlovian fear conditioning. Here we examined associative fear learning in mice with complete absence (KO or partial loss (heterozygous mutant, HET of GluR1 on multiple fear conditioning paradigms. After multi-trial delay or trace conditioning, KO displayed impaired tone and context fear recall relative to WT, whereas HET were normal. After one-trial delay conditioning, both KO and HET showed impaired tone and context recall. HET and KO showed normal nociceptive sensitivity in the hot plate and tail flick tests. These data demonstrate that the complete absence of GluR1 subunit-containing receptors prevents the formation of associative fear memories, while GluR1 haploinsufficiency is sufficient to impair one-trial fear learning. These findings support growing evidence of a major role for GluR1-containing AMPA receptors in amygdalamediated forms of learning and memory.

  13. UV-dependent production of 25-hydroxyvitamin D2 in the recombinant yeast cells expressing human CYP2R1

    International Nuclear Information System (INIS)

    Yasuda, Kaori; Endo, Mariko; Ikushiro, Shinichi; Kamakura, Masaki; Ohta, Miho; Sakaki, Toshiyuki

    2013-01-01

    Highlights: •We produce 25-hydroxyvitamin D in the recombinant yeast expressing human CYP2R1. •Vitamin D2 is produced in yeast from endogenous ergosterol with UV irradiation. •We produce 25-hydroxyvitamin D2 in the recombinant yeast without added substrate. -- Abstract: CYP2R1 is known to be a physiologically important vitamin D 25-hydroxylase. We have successfully expressed human CYP2R1 in Saccharomyces cerevisiae to reveal its enzymatic properties. In this study, we examined production of 25-hydroxylated vitamin D using whole recombinant yeast cells that expressed CYP2R1. When vitamin D 3 or vitamin D 2 was added to the cell suspension of CYP2R1-expressing yeast cells in a buffer containing glucose and β-cyclodextrin, the vitamins were converted into their 25-hydroxylated products. Next, we irradiated the cell suspension with UVB and incubated at 37 °C. Surprisingly, the 25-hydroxy vitamin D 2 was produced without additional vitamin D 2 . Endogenous ergosterol was likely converted into vitamin D 2 by UV irradiation and thermal isomerization, and then the resulting vitamin D 2 was converted to 25-hydroxyvitamin D 2 by CYP2R1. This novel method for producing 25-hydroxyvitamin D 2 without a substrate could be useful for practical purposes

  14. Measured and calculated effective delayed neutron fraction of the IPR-R1 Triga reactor

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Rose Mary G.P.; Dalle, Hugo M.; Campolina, Daniel A.M., E-mail: souzarm@cdtn.b, E-mail: dallehm@cdtn.b, E-mail: campolina@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    The effective delayed neutron fraction, {beta}{sub eff}, one of the most important parameter in reactor kinetics, was measured for the 100 kW IPR-R1 TRIGA Mark I research reactor, located at the Nuclear Technology Development Center - CDTN, Belo Horizonte, Brazil. The current reactor core has 63 fuel elements, containing about 8.5% and 8% by weight of uranium enriched to 20% in U{sup 235}. The core has cylindrical configuration with an annular graphite reflector. Since the first criticality of the reactor in November 1960, the core configuration and the number of fuel elements have been changed several times. At that time, the reactor power was 30 kW, there were 56 fuel elements in the core, and the {beta}{sub eff} value for the reactor recommended by General Atomic (manufacturer of TRIGA) was 790 pcm. The current {beta}{sub eff} parameter was determined from experimental methods based on inhour equation and on the control rod drops. The estimated values obtained were (774 {+-} 38) pcm and (744 {+-} 20) pcm, respectively. The {beta}{sub eff} was calculated by Monte Carlo transport code MCNP5 and it was obtained 747 pcm. The calculated and measured values are in good agreement, and the relative percentage error is -3.6% for the first case, and 0.4% for the second one. (author)

  15. Operational parameters study of IPR-R1 TRIGA research reactor using virtual instruments

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, Antonio Juscelino; Mesquita, Amir Zacarias; Lameiras, Fernando Soares, E-mail: ajp@cdtn.br, E-mail: amir@cdtn.br, E-mail: fsl@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    The instrumentation of nuclear reactors is designed with the principle of reliability, redundancy and diversification of control systems. Reliable monitoring of the parameters involved in the chain reaction is of great importance regarding efficiency and operational safety of the installation. The main goal of the simulation system in this proposed paper is to provide the study and improvement in understanding how these operational variables are interrelated and their behavior especially those related to neutronic and thermohydraulics. The work will be developed using the software LabVIEW ® (Laboratory Virtual Instruments Engineering Workbench). The program will enable the study of the variables involved in the operation of the installation throughout its operating range, for instance, a few mW up to 250 kW. The IPR-R1 TRIGA is a research nuclear reactor placed in open pool and cooled by light water with natural circulation. It is located at the Nuclear Technology Development Center (CDTN), in Belo Horizonte Brazil. The developing system employs the modern concept of virtual instruments (VIs), using microprocessors and visual interface on video monitors. LabVIEW ® breaks the paradigm of text-based programming language, for programming based on icons. The system will enable the use of this reactor in training and personnel training in the nuclear field. The work follows the recommendations of the International Atomic Energy Agency (IAEA), which has encouraged its members to develop strategic plans in order to use their research reactors. (author)

  16. Spent fuel management - two alternatives at the FiR 1 reactor

    International Nuclear Information System (INIS)

    Salmenhaara, S.E.J.

    2001-01-01

    The FiR 1 -reactor, a 250 kW Triga reactor, has been in operation since 1962. The reactor with its subsystems has experienced a large renovation work in 1996-97. The main purpose of the upgrading was to install the new Boron Neutron Capture Therapy (BNCT) irradiation facility. The BNCT work dominates the current utilization of the reactor: four days per week for BNCT purposes and only one day per week for neutron activation analysis and isotope production. The Council of State (government) granted for the reactor a new operating license for twelve years starting from the beginning of the year 2000. There is however a special condition in the new license. We have to achieve a binding agreement between our Research Centre and the domestic Nuclear Power Plant Companies about the possibility to use the final disposal facility of the Nuclear Power Plants for our spent fuel, if we want to continue the reactor operation beyond the year 2006. In addition to the choosing of one of the spent fuel management alternatives the future of the reactor will also depend strongly on the development of the BNCT irradiations. If the number of patients per year increases fast enough and the irradiations of the patients will be economically justified, the operation of the reactor will continue independently of the closing of the USDOE alternative in 2006. Otherwise, if the number of patients will be low, the funding of the reactor will be probably stopped and the reactor will be shut down. (author)

  17. Optimization of the irradiation beam in the BNCT research facility at IEA-R1 reactor

    International Nuclear Information System (INIS)

    Castro, Vinicius Alexandre de

    2014-01-01

    Boron Neutron Capture Therapy (BNCT) is a radiotherapeutic technique for the treatment of some types of cancer whose useful energy comes from a nuclear reaction that occurs when thermal neutron impinges upon a Boron-10 atom. In Brazil there is a research facility built along the beam hole number 3 of the IEA-R1 research reactor at IPEN, which was designed to perform BNCT research experiments. For a good performance of the technique, the irradiation beam should be mostly composed of thermal neutrons with a minimum as possible gamma and above thermal neutron components. This work aims to monitor and evaluate the irradiation beam on the sample irradiation position through the use of activation detectors (activation foils) and also to propose, through simulation using the radiation transport code, MCNP, new sets of moderators and filters which shall deliver better irradiation fields at the irradiation sample position In this work, a simulation methodology, based on a MCNP card, known as wwg (weight window generation) was studied, and the neutron energy spectrum has been experimentally discriminated at 5 energy ranges by using a new set o activation foils. It also has been concluded that the BNCT research facility has the required thermal neutron flux to perform studies in the area and it has a great potential for improvement for tailoring the irradiation field. (author)

  18. Operational parameters study of IPR-R1 TRIGA research reactor using virtual instruments

    International Nuclear Information System (INIS)

    Pinto, Antonio Juscelino; Mesquita, Amir Zacarias; Lameiras, Fernando Soares

    2013-01-01

    The instrumentation of nuclear reactors is designed with the principle of reliability, redundancy and diversification of control systems. Reliable monitoring of the parameters involved in the chain reaction is of great importance regarding efficiency and operational safety of the installation. The main goal of the simulation system in this proposed paper is to provide the study and improvement in understanding how these operational variables are interrelated and their behavior especially those related to neutronic and thermohydraulics. The work will be developed using the software LabVIEW ® (Laboratory Virtual Instruments Engineering Workbench). The program will enable the study of the variables involved in the operation of the installation throughout its operating range, for instance, a few mW up to 250 kW. The IPR-R1 TRIGA is a research nuclear reactor placed in open pool and cooled by light water with natural circulation. It is located at the Nuclear Technology Development Center (CDTN), in Belo Horizonte Brazil. The developing system employs the modern concept of virtual instruments (VIs), using microprocessors and visual interface on video monitors. LabVIEW ® breaks the paradigm of text-based programming language, for programming based on icons. The system will enable the use of this reactor in training and personnel training in the nuclear field. The work follows the recommendations of the International Atomic Energy Agency (IAEA), which has encouraged its members to develop strategic plans in order to use their research reactors. (author)

  19. The IPR-R1 TRIGA Mark I Reactor in 39 years: Operations and general improvements

    International Nuclear Information System (INIS)

    Maretti Junior, Fausto; Prado Fernandes, Marcio; Oliveira, Paulo Fernando; Alves de Amorim, Valter

    1999-01-01

    The nuclear IPR-R1 TRIGA Mark I Reactor operating in the Nuclear Technology Development Center, originally Institute for Radioactive Research in Minas Gerais, Brazil, was dedicated in November 11, 1960. Initially operating for the production of radioisotopes for different uses, it started later to be used in large scale for neutron activation analysis and training of operators for nuclear power plants. Many improvements have been made throughout these years to provide a better performance in its operation and safety conditions. A new cooling system to operate until 300 kW, a new control rod mechanism, an aluminum tank for the reactor pool, an optimization in the pneumatic system, a new reactor control console and a general remodeling of the reactor laboratory were some of the improvements added. To prevent and mitigate the ageing effects, the reactor operation personnel is starting a program to minimize future operation problems. This paper describes the improvements made, the results obtained during the past 39 years, and the precautions taken to ensure future safe operation of the reactor to give operators better conditions of safe work. (author)

  20. Ageing Management Programme for the IEA-R1 Reactor in São Paulo, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Ramanathan, L. V. [Institute of Energy and Nuclear Research (IPEN), National Nuclear Energy Commission (CNEN), São Paulo (Brazil)

    2014-08-15

    IEA-R1 is a swimming pool type reactor. It is moderated and cooled by light water and uses graphite and beryllium as reflector elements. First criticality was achieved on 16 September 1957, and the reactor is currently operating at 4.0 MW on a 64 h per week cycle. In 1996, a reactor ageing study was established to determine general deterioration of systems and components such as cooling towers, secondary cooling system, piping, pumps, specimen irradiation devices, radiation monitoring system, fuel elements, rod drive mechanisms, nuclear and process instrumentation, and safety system. The basic structure of the reactor from the original design has been maintained, but several improvements and modifications have been made over the years to various components, systems and structures. During the period 1996–2005 the reactor power was increased from 2 MW to 5 MW and the operational cycle from 8 h per day for 5 days a week to 120 h continuous per week, mainly to increase production of {sup 99}Mo. Prior to increasing reactor power, several modifications were made to the reactor system and its components. Simultaneously, a vigorous ageing management, inspection and modernization programme was put in place.

  1. Real-time neutron radiography at the Iea-R1 m nuclear research reactor

    International Nuclear Information System (INIS)

    Menezes, M.O. de; Pugliesi, R.; Pereira, M.A.S.; Andrade, M.L.G.

    2003-01-01

    A LIXI (Light Intensifier X-ray Image) device has been employed in a real-time neutron radiography system. The LIXI is coupled to a video camera and the real-time images can be observed in a TV monitor, and processed in a computer. In order to get the real-time system operational, the neutron radiography facility installed at the IEA-R1 m nuclear research reactor of the IPEN-CNEN/S P has been optimized. The most important improvements were the neutron/gamma ratio, the effective energy of the neutron beam, decrease of the scattered radiation at the irradiation position, and the additional shielding of the video camera. Several one-frame as well as computer processed images are presented. The overall Modulation Transfer Function for the real-time system was obtained from the resolution parameter p = 0:44 +- 0:04 mm; the system sensitivity, evaluated for a Perspex step wedge, was determined and the average value is 0:70 +- 0:09 mm. (author)

  2. Genome of Herbaspirillum seropedicae strain SmR1, a specialized diazotrophic endophyte of tropical grasses.

    Science.gov (United States)

    Pedrosa, Fábio O; Monteiro, Rose Adele; Wassem, Roseli; Cruz, Leonardo M; Ayub, Ricardo A; Colauto, Nelson B; Fernandez, Maria Aparecida; Fungaro, Maria Helena P; Grisard, Edmundo C; Hungria, Mariangela; Madeira, Humberto M F; Nodari, Rubens O; Osaku, Clarice A; Petzl-Erler, Maria Luiza; Terenzi, Hernán; Vieira, Luiz G E; Steffens, Maria Berenice R; Weiss, Vinicius A; Pereira, Luiz F P; Almeida, Marina I M; Alves, Lysangela R; Marin, Anelis; Araujo, Luiza Maria; Balsanelli, Eduardo; Baura, Valter A; Chubatsu, Leda S; Faoro, Helisson; Favetti, Augusto; Friedermann, Geraldo; Glienke, Chirlei; Karp, Susan; Kava-Cordeiro, Vanessa; Raittz, Roberto T; Ramos, Humberto J O; Ribeiro, Enilze Maria S F; Rigo, Liu Un; Rocha, Saul N; Schwab, Stefan; Silva, Anilda G; Souza, Eliel M; Tadra-Sfeir, Michelle Z; Torres, Rodrigo A; Dabul, Audrei N G; Soares, Maria Albertina M; Gasques, Luciano S; Gimenes, Ciela C T; Valle, Juliana S; Ciferri, Ricardo R; Correa, Luiz C; Murace, Norma K; Pamphile, João A; Patussi, Eliana Valéria; Prioli, Alberto J; Prioli, Sonia Maria A; Rocha, Carmem Lúcia M S C; Arantes, Olívia Márcia N; Furlaneto, Márcia Cristina; Godoy, Leandro P; Oliveira, Carlos E C; Satori, Daniele; Vilas-Boas, Laurival A; Watanabe, Maria Angélica E; Dambros, Bibiana Paula; Guerra, Miguel P; Mathioni, Sandra Marisa; Santos, Karine Louise; Steindel, Mario; Vernal, Javier; Barcellos, Fernando G; Campo, Rubens J; Chueire, Ligia Maria O; Nicolás, Marisa Fabiana; Pereira-Ferrari, Lilian; Silva, José L da Conceição; Gioppo, Nereida M R; Margarido, Vladimir P; Menck-Soares, Maria Amélia; Pinto, Fabiana Gisele S; Simão, Rita de Cássia G; Takahashi, Elizabete K; Yates, Marshall G; Souza, Emanuel M

    2011-05-01

    The molecular mechanisms of plant recognition, colonization, and nutrient exchange between diazotrophic endophytes and plants are scarcely known. Herbaspirillum seropedicae is an endophytic bacterium capable of colonizing intercellular spaces of grasses such as rice and sugar cane. The genome of H. seropedicae strain SmR1 was sequenced and annotated by The Paraná State Genome Programme--GENOPAR. The genome is composed of a circular chromosome of 5,513,887 bp and contains a total of 4,804 genes. The genome sequence revealed that H. seropedicae is a highly versatile microorganism with capacity to metabolize a wide range of carbon and nitrogen sources and with possession of four distinct terminal oxidases. The genome contains a multitude of protein secretion systems, including type I, type II, type III, type V, and type VI secretion systems, and type IV pili, suggesting a high potential to interact with host plants. H. seropedicae is able to synthesize indole acetic acid as reflected by the four IAA biosynthetic pathways present. A gene coding for ACC deaminase, which may be involved in modulating the associated plant ethylene-signaling pathway, is also present. Genes for hemagglutinins/hemolysins/adhesins were found and may play a role in plant cell surface adhesion. These features may endow H. seropedicae with the ability to establish an endophytic life-style in a large number of plant species.

  3. Genome of Herbaspirillum seropedicae strain SmR1, a specialized diazotrophic endophyte of tropical grasses.

    Directory of Open Access Journals (Sweden)

    Fábio O Pedrosa

    2011-05-01

    Full Text Available The molecular mechanisms of plant recognition, colonization, and nutrient exchange between diazotrophic endophytes and plants are scarcely known. Herbaspirillum seropedicae is an endophytic bacterium capable of colonizing intercellular spaces of grasses such as rice and sugar cane. The genome of H. seropedicae strain SmR1 was sequenced and annotated by The Paraná State Genome Programme--GENOPAR. The genome is composed of a circular chromosome of 5,513,887 bp and contains a total of 4,804 genes. The genome sequence revealed that H. seropedicae is a highly versatile microorganism with capacity to metabolize a wide range of carbon and nitrogen sources and with possession of four distinct terminal oxidases. The genome contains a multitude of protein secretion systems, including type I, type II, type III, type V, and type VI secretion systems, and type IV pili, suggesting a high potential to interact with host plants. H. seropedicae is able to synthesize indole acetic acid as reflected by the four IAA biosynthetic pathways present. A gene coding for ACC deaminase, which may be involved in modulating the associated plant ethylene-signaling pathway, is also present. Genes for hemagglutinins/hemolysins/adhesins were found and may play a role in plant cell surface adhesion. These features may endow H. seropedicae with the ability to establish an endophytic life-style in a large number of plant species.

  4. The future of the IPR-R1 TRIGA MARK I reactor after 48 years operation

    International Nuclear Information System (INIS)

    Maretti, Fausto Junior; Sette Camara, Luiz Otavio I.; Oliveira, Paulo Fernando

    2008-01-01

    The TRIGA Mark I IPR-R1 Reactor operates in the Nuclear Technology Development Center/ Brazilian Committion for Nuclear Energy (CDTN/CNEN), originally Institute of Radioactive Researches, in Belo Horizonte, Minas Gerais, since November 6, 1960. Initially it operated for isotope production for different uses, being later used in wide scale for another purposes as analyses for activation with neutrons and training of nuclear power plants operators. Dozens of degree theses were also developed with the use of the reactor. Along the years, several improvements were introduced in the reactor and its auxiliary systems, with the purpose to provide better use of the facilities and with the objective to increase the safety in the operation. The reactor is ready right now to operate at 250 kW, and for sure the nuclear applications programmed will be improved. The Operation Manual and the Safety Analysis report were already modified, as well as the Emergency Plan and the relative procedures to the same. After the tests at the end of 2008, the reactor will already be operating in the new power. This work presents a description of the several accomplishments of the last years and comments about the possibility of new uses for the reactor in the several areas of nuclear applications and some of the experiments and tests results during the upgrading program. (authors)

  5. Water chemical control of the TRIGA IPR-R1 reactor primary cooling system

    International Nuclear Information System (INIS)

    Auler, Lucia M.L.A; Chaves, Renata D.A.; Palmieri, Helena E.L.; Menezes, Maria Angela de B.C.; Oliveira, Paulo F.; Kastner, Geraldo F.; Damazio, Ilza; Fagundes, Oliene dos R.; Cintra, Maria Olivia C.; Andrade, Geraldo V. de; Amaral, Angela M.; Franco, Milton B.; Fortes, Flavio; Gomes, Nilton Carlos; Vidal, Andrea; Maretti Junior, Fausto; Knupp, Eliana A.N.; Souza, Wagner de; Guedes, Joao B.; Furtado, Renato C.S.

    2013-01-01

    The TRIGA Mark I IPR-R1 reactor located at CDTN/CNEN has been in operation and contributed to research and with services to society since 1960. Is has been used in several activities such as nuclear power plant operation, graduate and post-graduate training courses, isotope production, and as an analytical irradiation tool of different types of samples. Among the several structural and operational safety requirements is the chemical quality control of the primary circuit cooling water. The aim of this work was to check the cooling water quality from the pool reactor. A water sampling plan was proposed (May, 2011 - June, 2012) and presents the results obtained in this period. The natural radioactivity level as gross alpha and gross beta activity and other chemical parameters (pH and electric conductivity) of the samples were analyzed. Some instrumental techniques were used: potentiometric methods (pH), conductometric methods (electrical conductivity, EC) and gross α and gross β proportional counting system). (author)

  6. Experience on wet storage spent fuel sipping at IEA-R1 Brazilian research reactor

    International Nuclear Information System (INIS)

    Perrotta, J.A.; Terremoto, L.A.A.; Zeituni, C.A.

    1998-01-01

    The IEA-R1 research reactor of the Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) is a pool type reactor of B and W design, that has been operating since 1957 at a power of 2 MW. Irradiated (spent) fuels have been stored at the facility during the various years of operation. At present there are 40 spent fuel assemblies at dry storage, 79 spent fuel assemblies at wet storage and 30 fuel assemblies in the core. The oldest fuels are of United States origin, made with U-Al alloy, both of LEU and HEU MTR fuel type. Many of these fuel assemblies have corrosion pits along their lateral fuel plates. These pits originate by galvanic corrosion between the fuel plate and the stainless steel storage racks. As a consequence of the possibility of sending the irradiated old fuels back the U.S.A., sipping tests were performed with the spent fuel assemblies. The reason for this was to evaluate their 137 Cs leaking rate, if any. This work describes the procedure and methodology used to perform the sipping tests with the fuel assemblies at the storage pool, and presents the results obtained for the 137 Cs sipping water activity for each fuel assembly. A correlation is made between the corrosion pits and the activity values measured. A 137 Cs leaking rate is determined and compared to the criteria established for canning spent fuel assemblies before shipment

  7. Gene Expression Analysis of Four Radiation-resistant Bacteria

    OpenAIRE

    Gao, Na; Ma, Bin-Guang; Zhang, Yu-Sheng; Song, Qin; Chen, Ling-Ling; Zhang, Hong-Yu

    2009-01-01

    To investigate the general radiation-resistant mechanisms of bacteria, bioinformatic method was employed to predict highly expressed genes for four radiation-resistant bacteria, i.e. Deinococcus geothermalis (D. geo), Deinococcus radiodurans (D. rad), Kineococcus radiotolerans (K. rad) and Rubrobacter xylanophilus (R. xyl). It is revealed that most of the three reference gene sets, i.e. ribosomal proteins, transcription factors and major chaperones, are generally highly expressed in the four ...

  8. LTB-R1: an alternative to swine mycoplasmal pneumoniae control LTB-R1: uma alternativa para o controle da pneumonia micoplásmica suína

    Directory of Open Access Journals (Sweden)

    Fabrício Rochedo Conceição

    2003-11-01

    Full Text Available Mycoplasmal pneumoniae is the main respiratory disease in swine. The most efficient way to control it is through the use of vaccines (bacterins, whose production cost is high. The objective of this work was to develop a new alternative for controlling Swine Mycoplasmal Pneumoniae, based on a recombinant subunit vaccine containing the R1 region of P97 adhesin of Mycoplasma hyopneumoniae fused to the B subunit of the heat-labile enterotoxin of Escherichia coli (rLTB-R1. In this work we report the amplification of the genes, genetic fusion between LTB and R1 coding sequences, cloning, construction of the expression vector, as well as expression and purification of rLTB-R1 in E. coli.A Pneumonia Micoplásmica é a doença respiratória mais importante dos suínos. A forma mais eficaz de controlá-la é mediante a utilização de vacinas (bacterinas, cujo custo de produção é elevado. Uma nova alternativa para o controle desta doença, baseada em uma vacina de subunidade recombinante contendo a região R1 da adesina P97 de Mycoplasma hyopneumoniae fusionada a subunidade B da enterotoxina termolábel de Escherichia coli (rLTB-R1, foi o alvo deste trabalho. Nele abordou-se a amplificação dos genes, a fusão genética entre as seqüências codificadoras para LTB e R1, a clonagem, a construção do vetor de expressão, assim como a expressão em E. coli e purificação da rLTBR1.

  9. miR-1 is increased in pulmonary hypertension and downregulates Kv1.5 channels in rat pulmonary arteries.

    Science.gov (United States)

    Mondejar-Parreño, Gema; Callejo, María; Barreira, Bianca; Morales-Cano, Daniel; Esquivel-Ruiz, Sergio; Moreno, Laura; Cogolludo, Angel; Perez-Vizcaino, Francisco

    2018-05-02

    ■The expression of miR-1 is increased in lungs from the Hyp/Su5416 PAH rat model. ■PASMC from this animal model are more depolarised and show decreased expression and activity of Kv1.5. ■miR-1 directly targets Kv1.5 channels, reduces Kv1.5 activity and induces membrane depolarization. ■Antagomir-1 prevents Kv1.5 channel downregulation and the depolarization induced by hypoxia/Su5416 exposition. Impairment of voltage-dependent potassium channel (Kv) plays a central role in the development of cardiovascular diseases, including pulmonary arterial hypertension (PAH). MicroRNAs (miRNAs) are non-coding RNAs that regulate gene expression by binding to the 3'-UTR region of specific mRNAs. The aim of this study was to analyze the effects of miR-1 on Kv channel function in pulmonary arteries (PA). Kv channel activity was studied in PA from healthy animals transfected with miR-1 or scrambled-miR. Kv currents were studied using the whole-cell configuration of patch-clamp technique. The characterization of the Kv1.5 currents was performed with the selective inhibitor DPO-1. miR-1 expression was increased and Kv1.5 channels were decreased in lungs from a rat model of PAH induced by hypoxia and Su5416. miR-1 transfection increased cell capacitance, reduced Kv1.5 currents and induced membrane depolarization in isolated pulmonary artery smooth muscle cells (PASMCs). Luciferase reporter assay indicated that KCNA5, which encodes Kv1.5 channels, is a direct target gene of miR-1. Incubation of PA with Su5416 and hypoxia (3% O 2 ) increased miR-1 and induced a decline in Kv1.5 currents, which was prevented by antagomiR-1. In conclusion, these data indicate that miR-1 induces PASMC hypertrophy and reduces the activity and expression of Kv channels, suggesting a pathophysiological role in PAH. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  10. Growth hormone-releasing hormone as an agonist of the ghrelin receptor GHS-R1a.

    Science.gov (United States)

    Casanueva, Felipe F; Camiña, Jesus P; Carreira, Marcos C; Pazos, Yolanda; Varga, Jozsef L; Schally, Andrew V

    2008-12-23

    Ghrelin synergizes with growth hormone-releasing hormone (GHRH) to potentiate growth hormone (GH) response through a mechanism not yet fully characterized. This study was conducted to analyze the role of GHRH as a potential ligand of the ghrelin receptor, GHS-R1a. The results show that hGHRH(1-29)NH(2) (GHRH) induces a dose-dependent calcium mobilization in HEK 293 cells stably transfected with GHS-R1a an effect not observed in wild-type HEK 293 cells. This calcium rise is also observed using the GHRH receptor agonists JI-34 and JI-36. Radioligand binding and cross-linking studies revealed that calcium response to GHRH is mediated by the ghrelin receptor GHS-R1a. GHRH activates the signaling route of inositol phosphate and potentiates the maximal response to ghrelin measured in inositol phosphate turnover. The presence of GHRH increases the binding capacity of (125)I-ghrelin in a dose dependent-fashion showing a positive binding cooperativity. In addition, confocal microscopy in CHO cells transfected with GHS-R1a tagged with enhanced green fluorescent protein shows that GHRH activates the GHS-R1a endocytosis. Furthermore, the selective GHRH-R antagonists, JV-1-42 and JMR-132, act also as antagonists of the ghrelin receptor GHS-R1a. Our findings suggest that GHRH interacts with ghrelin receptor GHS-R1a, and, in consequence, modifies the ghrelin-associated intracellular signaling pathway. This interaction may represent a form of regulation, which could play a putative role in the physiology of GH regulation and appetite control.

  11. p53-dependent inhibition of TrxR1 contributes to the tumor-specific induction of apoptosis by RITA.

    Science.gov (United States)

    Hedström, Elisabeth; Eriksson, Sofi; Zawacka-Pankau, Joanna; Arnér, Elias S J; Selivanova, Galina

    2009-11-01

    Thioredoxin reductase 1 (TrxR1) is a key regulator in many redox-dependent cellular pathways, and is often overexpressed in cancer. Several studies have identified TrxR1 as a potentially important target for anticancer therapy. The low molecular weight compound RITA (NSC 652287) binds p53 and induces p53-dependent apoptosis. Here we found that RITA also targets TrxR1 by non-covalent binding, followed by inhibition of its activity in vitro and by inhibition of TrxR activity in cancer cells. Interestingly, a novel approximately 130 kDa form of TrxR1, presumably representing a stable covalently linked dimer, and an increased generation of reactive oxygen species (ROS) were induced by RITA in cancer cells in a p53-dependent manner. Similarly, the gold-based TrxR inhibitor auranofin induced apoptosis related to oxidative stress, but independently of p53 and without apparent induction of the approximately 130 kDa form of TrxR1. In contrast to the effects observed in cancer cells, RITA did not inhibit TrxR or ROS formation in normal fibroblasts (NHDF). The inhibition of TrxR1 can sensitize tumor cells to agents that induce oxidative stress and may directly trigger cell death. Thus, our results suggest that a unique p53-dependent effect of RITA on TrxR1 in cancer cells might synergize with p53-dependent induction of pro-apoptotic genes and oxidative stress, thereby leading to a robust induction of cancer cell death, without affecting non-transformed cells.

  12. Improvements at the biological shielding of BNCT research facility in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Souza, Gregorio Soares de

    2011-01-01

    The technique of neutron capture in boron is a promising technique in cancer treatment, it uses the high LET particles from the reaction 10 B (n, α) 7 Li to destroy cancer cells.The development of this technique began in the mid-'50s and even today it is the object of study and research in various centers around the world, Brazil has built a facility that aims to conduct research in BNCT, this facility is located next to irradiation channel number three at the research nuclear reactor IEA-R1 and has a biological shielding designed to meet the radiation protection standards. This biological shielding was developed to allow them to conduct experiments with the reactor at maximum power, so it is not necessary to turn on and off the reactor to irradiate samples. However, when the channel is opened for experiments the background radiation in the experiments salon increases and this background variation makes it impossible to perform measurements in a neutron diffraction research that utilizes the irradiation channel number six. This study aims to further improve the shielding in order to minimize the variation of background making it possible to perform the research facility in BNCT without interfering with the action of the research group of the irradiation channel number six. To reach this purpose, the code MCNP5, dosimeters and activation detectors were used to plan improvements in the biological shielding. It was calculated with the help of the code an improvement that can reduce the average heat flow in 71.2% ± 13 and verified experimentally a mean reduce of 70 ± 9% in dose due to thermal neutrons. (author)

  13. Improvement of Biodesulfurization Rate of Alginate Immobilized Rhodococcus erythropolis R1.

    Science.gov (United States)

    Derikvand, Peyman; Etemadifar, Zahra

    2014-03-01

    Sulfur oxides released from the burning of oil causes severe environmental pollution. The sulfur can be removed via the 4S pathway in biodesulfurization (BDS). Immobilization approaches have been developed to prevent cell contamination of oil during the BDS process. The encapsulation of Rhodococcus erythropolis R1 in calcium alginate beads was studied in order to enhance conversion of dibenzothiophene (DBT) to 2-hydroxy biphenyl (2-HBP) as the final product. Also the effect of different factors on the BDS process was investigated. Calcium alginate capsules were prepared using peristaltic pumps with different needle sizes to control the beads sizes. Scanning electron microscopy and flow cytometry methods were used to study the distribution and viability of encapsulated cells, respectively. Two non-ionic surfactants and also nano Ƴ-Al2O3were used with the ratio of 0.5% (v/v) and 1:5 (v/v) respectively to investigate their BDS efficiency. In addition, the effect of different bead sizes and different concentrations of sodium alginate in BDS activity was studied. The 2% (w/v) sodium alginate beads with 1.5mm size were found to be the optimum for beads stability and efficient 2-HBP production. The viability of encapsulated cells decreased by 12% after 20 h of desulfurization, compared to free cells. Adding the non-ionic surfactants markedly enhanced the rate of BDS, because of increasing mass transfer of DBT to the gel matrix. In addition, Span 80 was more effective than Tween 80. The nanoƳ-Al2O3 particles could increase BDS rate by up to two-folds greater than that of the control beads. The nano Ƴ-Al2O3 can improve the immobilized biocatalyst for excellent efficiency of DBT desulfurization. Also the BDS activity can be enhanced by setting the other explained factors at optimum levels.

  14. Spent fuel management plans for the FiR 1 Reactor

    International Nuclear Information System (INIS)

    Salmenhaara, S. E. J.

    2002-01-01

    The FiR 1-reactor, a 250 kW TRIGA reactor, has been in operation since 1962. The main purpose to run the reactor is now the Boron Neutron Capture Therapy (BNCT). The BNCT work dominates the current utilization of the reactor: three days per week for BNCT purposes and only two days per week for other purposes such as the neutron activation analysis and isotope production. The final disposal site is situated in Olkiluoto, on the western coast of Finland. Olkiluoto is also one of the two nuclear power plant sites in Finland. In the new operating license of our reactor there is a special condition. We have to achieve a binding agreement between our Research Centre and either the domestic Nuclear Power Companies about the possibility to use the Olkiluoto final disposal facility for our spent fuel or US DOE about the return of our spent fuel back to USA. If we want to continue the reactor operation beyond the year 2006. the domestic final disposal is the only possibility. At the moment it seems to be reasonable to prepare to both possibilities: the domestic final disposal and the return to the USA offered by US DOE. Because the cost estimates of the both possibilities are on the same order of magnitude, the future of the reactor itself will decide, which of the spent fuel policies will be obeyed. In a couple of years' time it will be seen, if the funding of the reactor and the incomes from the BNCT treatments will cover the costs. If the BNCT and other irradiations develop satisfactorily, the reactor can be kept in operation beyond the year 2006 and the domestic final disposal will be implemented. If, however, there is still lack of money, there is no reason to continue the operation of the reactor and the choice of US DOE alternative is natural. (author)

  15. CO (3 – 2) HIGH-RESOLUTION SURVEY OF THE GALACTIC PLANE: R1

    Energy Technology Data Exchange (ETDEWEB)

    Dempsey, J. T.; Thomas, H. S.; Currie, M. J., E-mail: j.dempsey@jach.hawaii.edu, E-mail: h.thomas@jach.hawaii.edu, E-mail: m.currie@jach.hawaii.edu [Joint Astronomy Centre, 660 N. Aohoku Place, Hilo, HI 96720 (United States)

    2013-11-01

    We present the first release (R1) of data from the CO High-Resolution Survey (COHRS), which maps a strip of the inner Galactic plane in {sup 12}CO (J = 3 → 2). The data are taken using the Heterodyne Array Receiver Programme on the James Clerk Maxwell Telescope (JCMT) in Hawaii, which has a 14 arcsec angular resolution at this frequency. When complete, this survey will cover |b| ≤ 0.°5 between 10° < l < 65°. This first release covers |b| ≤ 0.°5 between 10.°25 < l < 17.°5 and 50.°25 < l < 55.°25, and |b| ≤ 0.°25 between 17.°5 < l < 50.°25. The data are smoothed to a velocity resolution of 1 km s{sup –1}, a spatial resolution of 16 arcsec and achieve a mean rms of ∼1 K. COHRS data are available to the community online at http://dx.doi.org/10.11570/13.0002. In this paper we describe the data acquisition and reduction techniques used and present integrated intensity images and longitude-velocity maps. We also discuss the noise characteristics of the data. The high resolution is a powerful tool for morphological studies of bubbles and filaments while the velocity information shows the spiral arms and outflows. These data are intended to complement both existing and upcoming surveys, e.g., the Bolocam Galactic Plane Survey (BGPS), ATLASGAL, the Herschel Galactic Plane Survey (Hi-GAL) and the JCMT Galactic Plane Survey with SCUBA-2 (JPS)

  16. Improvement of Biodesulfurization Rate of Alginate Immobilized Rhodococcus erythropolis R1

    Science.gov (United States)

    Derikvand, Peyman; Etemadifar, Zahra

    2014-01-01

    Background: Sulfur oxides released from the burning of oil causes severe environmental pollution. The sulfur can be removed via the 4S pathway in biodesulfurization (BDS). Immobilization approaches have been developed to prevent cell contamination of oil during the BDS process. Objectives: The encapsulation of Rhodococcus erythropolis R1 in calcium alginate beads was studied in order to enhance conversion of dibenzothiophene (DBT) to 2-hydroxy biphenyl (2-HBP) as the final product. Also the effect of different factors on the BDS process was investigated. Materials and Methods: Calcium alginate capsules were prepared using peristaltic pumps with different needle sizes to control the beads sizes. Scanning electron microscopy and flow cytometry methods were used to study the distribution and viability of encapsulated cells, respectively. Two non-ionic surfactants and also nano Ƴ-Al2O3were used with the ratio of 0.5% (v/v) and 1:5 (v/v) respectively to investigate their BDS efficiency. In addition, the effect of different bead sizes and different concentrations of sodium alginate in BDS activity was studied. Results: The 2% (w/v) sodium alginate beads with 1.5mm size were found to be the optimum for beads stability and efficient 2-HBP production. The viability of encapsulated cells decreased by 12% after 20 h of desulfurization, compared to free cells. Adding the non-ionic surfactants markedly enhanced the rate of BDS, because of increasing mass transfer of DBT to the gel matrix. In addition, Span 80 was more effective than Tween 80. The nanoƳ-Al2O3 particles could increase BDS rate by up to two-folds greater than that of the control beads. Conclusions: The nano Ƴ-Al2O3 can improve the immobilized biocatalyst for excellent efficiency of DBT desulfurization. Also the BDS activity can be enhanced by setting the other explained factors at optimum levels. PMID:25147685

  17. Characterization of filter cartridges from the IEA-R1 reactor by radiochemical method

    International Nuclear Information System (INIS)

    Geraldo, Bianca; Vicente, Roberto; Ferreira, Robson J.; Goes, Marcos M.; Marumo, Julio T.

    2015-01-01

    The filter cartridges used in water purification system of research nuclear reactor IEA-R1 are considered radioactive wastes after their useful life. The characterization of these wastes is one of the stages of management, which aims to identify and quantify the radionuclides present, including those known as 'difficult to measure' (DTM) radionuclides. Establish a radiochemical analysis methodology for this type of waste is a difficult job, not only by the application of these techniques, but also by the amount of radionuclides that should be analyzed. In the waste produced in a nuclear reactor, the most important radionuclides are fission products, activation products and transuranic elements. Since these radionuclides emit gamma radiation not measurable in its decay process and consequently are difficult to measure, their concentrations can be estimated by indirect methods such as scale factors. This method is used to evaluate the DTM concentration, which is represented by alpha and beta nuclides using the correlation between them and the radionuclide key, a gamma emitter. The objective of this work is to describe a radiochemical analysis methodology for gamma emitter nuclides, present in the filter cartridges, evaluating the activity and concentrations by destructive assays. At the same time, two studies have been performed by non-destructive assays, the first one based on dose rates and the point kernel method to correlate the results and the second one based on calibration efficiency with Monte Carlo method. These studies belong to the radioactive waste characterization program that has been conducted at the Waste Management Laboratory of Nuclear and Energy Research Institute, IPEN-CNEN/SP. (author)

  18. Neutron field characterization in the installation for BNCT study in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Carneiro Junior, Valdeci

    2008-01-01

    This work aims to characterize the mixed neutron and gamma field, in the sample irradiation position, in a research installation for Boron Neutron Capture Therapy (BNCT), in the IPEN IEA-R1 reactor. The BNCT technique has been studied as a safe and selective option in the treatment of resistant cancerigenous tumors or considered non-curable by the conventional techniques, for example, the Glioblastoma Multiform - a brain cancerigenous tumor. Neutron flux measurements were carried out: thermal, resonance and fast, as well as neutron and gamma rays doses, in the sample position, using activation foils detectors and thermoluminescent dosimeters. For the determination of the neutron spectrum and intensity, a set of different threshold activation foils and gold foils covered and uncovered with cadmium irradiated in the installation was used, analyzed by a high Pure Germanium semiconductor detector, coupled to an electronic system suitable for gamma spectrometry. The results were processed with the SAND-BP code. The doses due to gamma and neutron rays were determined using thermoluminescent dosimeters TLD 400 and TLD 700 sensitive to gamma and TLD 600, sensitive to neutrons. The TLDs were selected and used for obtaining the calibration curves - dosimeter answer versus dose - from each of the TLD three types, which were necessary to calculate the doses due to neutron and gamma, in the sample position. The radiation field, in the sample irradiation position, was characterized flux for thermal neutrons of 1.39.10 8 ± 0,12.10 8 n/cm 2 s the doses due to thermal neutrons are three times higher than those due to gamma radiation and confirm the reproducibility and consistency of the experimental findings obtained. Considering these results, the neutron field and gamma radiation showed to be appropriated for research in BNCT. (author)

  19. Characterization of filter cartridges from the IEA-R1 reactor by radiochemical method

    Energy Technology Data Exchange (ETDEWEB)

    Geraldo, Bianca; Vicente, Roberto; Ferreira, Robson J.; Goes, Marcos M.; Marumo, Julio T., E-mail: bgeraldo@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    The filter cartridges used in water purification system of research nuclear reactor IEA-R1 are considered radioactive wastes after their useful life. The characterization of these wastes is one of the stages of management, which aims to identify and quantify the radionuclides present, including those known as 'difficult to measure' (DTM) radionuclides. Establish a radiochemical analysis methodology for this type of waste is a difficult job, not only by the application of these techniques, but also by the amount of radionuclides that should be analyzed. In the waste produced in a nuclear reactor, the most important radionuclides are fission products, activation products and transuranic elements. Since these radionuclides emit gamma radiation not measurable in its decay process and consequently are difficult to measure, their concentrations can be estimated by indirect methods such as scale factors. This method is used to evaluate the DTM concentration, which is represented by alpha and beta nuclides using the correlation between them and the radionuclide key, a gamma emitter. The objective of this work is to describe a radiochemical analysis methodology for gamma emitter nuclides, present in the filter cartridges, evaluating the activity and concentrations by destructive assays. At the same time, two studies have been performed by non-destructive assays, the first one based on dose rates and the point kernel method to correlate the results and the second one based on calibration efficiency with Monte Carlo method. These studies belong to the radioactive waste characterization program that has been conducted at the Waste Management Laboratory of Nuclear and Energy Research Institute, IPEN-CNEN/SP. (author)

  20. DNA Methylation of T1R1 Gene in the Vegetarian Adaptation of Grass Carp Ctenopharyngodon idella.

    Science.gov (United States)

    Cai, Wenjing; He, Shan; Liang, Xu-Fang; Yuan, Xiaochen

    2018-05-02

    Although previous studies have indicated importance of taste receptors in food habits formation in mammals, little is known about those in fish. Grass carp is an excellent model for studying vegetarian adaptation, as it shows food habit transition from carnivore to herbivore. In the present study, pseudogenization or frameshift mutations of the umami receptors that hypothesized related to dietary switch in vertebrates, were not found in grass carp, suggesting other mechanisms for vegetarian adaptation in grass carp. T1R1 and T1R3 strongly responded to L-Arg and L-Lys, differing from those of zebrafish and medaka, contributing to high species specificity in amino acid preferences and diet selection of grass carp. After food habit transition of grass carp, DNA methylation levels were higher in CPG1 and CPG3 islands of upstream control region of T1R1 gene. Luciferase activity assay of upstream regulatory region of T1R1 (-2500-0 bp) without CPG1 or CPG3 indicated that CPG1 and CPG3 might be involved in transcriptional regulation of T1R1 gene. Subsequently, high DNA methylation decreased expression of T1R1 in intestinal tract. It could be a new mechanism to explain, at least partially, the vegetarian adaptation of grass carp by regulation of expression of umami receptor via epigenetic modification.

  1. Inhibition of IL-1R1/MyD88 signalling promotes mesenchymal stem cell-driven tissue regeneration.

    Science.gov (United States)

    Martino, Mikaël M; Maruyama, Kenta; Kuhn, Gisela A; Satoh, Takashi; Takeuchi, Osamu; Müller, Ralph; Akira, Shizuo

    2016-03-22

    Tissue injury and the healing response lead to the release of endogenous danger signals including Toll-like receptor (TLR) and interleukin-1 receptor, type 1 (IL-1R1) ligands, which modulate the immune microenvironment. Because TLRs and IL-1R1 have been shown to influence the repair process of various tissues, we explored their role during bone regeneration, seeking to design regenerative strategies integrating a control of their signalling. Here we show that IL-1R1/MyD88 signalling negatively regulates bone regeneration, in the mouse. Furthermore, IL-1β which is released at the bone injury site, inhibits the regenerative capacities of mesenchymal stem cells (MSCs). Mechanistically, IL-1R1/MyD88 signalling impairs MSC proliferation, migration and differentiation by inhibiting the Akt/GSK-3β/β-catenin pathway. Lastly, as a proof of concept, we engineer a MSC delivery system integrating inhibitors of IL-1R1/MyD88 signalling. Using this strategy, we considerably improve MSC-based bone regeneration in the mouse, demonstrating that this approach may be useful in regenerative medicine applications.

  2. Feasibility study of application of Prompt Gamma Neutron Activation Analysis (PGNAA) method in TRIGA IPR-R1 reactor

    International Nuclear Information System (INIS)

    Guerra, Bruno Teixeira

    2016-01-01

    The TRIGA Mark I IPR-R1 research reactor is located at Nuclear Technology Development Centre (CDTN), Brazilian Commission for Nuclear Energy (CNEN), in Belo Horizonte, Brazil. The reactor operates at 100 kW but the core configuration allows the increasing of the power up to 250 kW. It has been applied research, training and radioisotopes production. The establishment of the Prompt Gamma Neutron Activation Analysis (PGNAA) method at the TRIGA IPR-R1 reactor will significantly increase the types of matrices analysed as well as the number of chemical elements. Additionally it will complement the neutron activation analysis. This work presents a proposed design of a PGNAA facility to be installed at the TRIGA IPR-R1. The proposed design is based on a tube as a neutron guide from the reactor core, inside the reactor pool, 6 m below the room’s level where shall be located the rack containing the set sample/detector/shielding. Thus, the aim of this study is to verify the feasibility to establish the PGNAA method in IPR-R1 through theoretical study applying the Monte Carlo code. The feasibility of establishing the PGAA method at the IPR-R1 installations was evaluated through of the calculations of neutron flux, radioactive capture reaction rates and detection limits for some isotopes. According to the obtained results, it can be concluded that is possible to establish the PGAA method at the IPR-R1 reactor, even with some restrictions in its theoretical design calculated by MCNP. (author)

  3. Enhanced natural killer cell activation by exopolysaccharides derived from yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Makino, Seiya; Sato, Asako; Goto, Ayako; Nakamura, Marie; Ogawa, Miho; Chiba, Yoshika; Hemmi, Jun; Kano, Hiroshi; Takeda, Kazuyoshi; Okumura, Ko; Asami, Yukio

    2016-02-01

    Yogurt is generally recognized as a beneficial food for our health, but research into its physiological effects has focused mainly on intestinal dysfunctions such as constipation and diarrhea. We previously found yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1 (hereafter OLL1073R-1) could reduce risks of catching the common cold and flu in human trials. It was assumed that immunostimulatory exopolysaccharide (EPS) produced from OLL1073R-1 play an important role in this context. However, few studies have examined the immunostimulatory effects of traditional Bulgarian yogurts fermented with different strains of lactobacilli and their metabolites. Therefore, we screened 139 L. delbrueckii ssp. bulgaricus strains and identified OLL1073R-1 as the most robust producer of EPS. This strain was also the only strain that induced the production of IFN-γ in vitro. Oral administration of the EPS or yogurt fermented with OLL1073R-1 and Streptococcus thermophilus OLS3059 (OLL1073R-1 yogurt) augmented natural killer (NK) cell activity and induced IFN-γ production in spleen cells in mice, whereas 2 other yogurts fermented with other strains had no effect on NK cell activity. Cellular preparations of the OLL1073R-1 strain also slightly augmented NK cell activity, but were less effective than EPS itself. The EPS-dependent stimulation of NK cell activity was abrogated in IFN-γ knockout mice and in myeloid differentiation factor 88 knockout mice. Furthermore, IFN-γ production from spleen cells stimulated with EPS was completely blocked with both anti-IL-12 and anti-IL-18 antibodies in vitro. These findings suggest that NK cell activation by OLL1073R-1 yogurt is EPS-dependent, occurs via IL-12- and IL-18-mediated IFN-γ production, and requires myeloid differentiation factor 88. We showed that traditional Bulgarian yogurt could exert immunostimulatory effects by selecting starter strains and part of the mechanisms depend on IFN-γ inducible EPS produced

  4. A Saccharomyces cerevisiae Assay System to Investigate Ligand/AdipoR1 Interactions That Lead to Cellular Signaling

    KAUST Repository

    Aouida, Mustapha

    2013-06-07

    Adiponectin is a mammalian hormone that exerts anti-diabetic, anti-cancer and cardioprotective effects through interaction with its major ubiquitously expressed plasma membrane localized receptors, AdipoR1 and AdipoR2. Here, we report a Saccharomyces cerevisiae based method for investigating agonist-AdipoR interactions that is amenable for high-throughput scale-up and can be used to study both AdipoRs separately. Agonist-AdipoR1 interactions are detected using a split firefly luciferase assay based on reconstitution of firefly luciferase (Luc) activity due to juxtaposition of its N- and C-terminal fragments, NLuc and CLuc, by ligand induced interaction of the chimeric proteins CLuc-AdipoR1 and APPL1-NLuc (adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain and leucine zipper motif 1-NLuc) in a S. cerevisiae strain lacking the yeast homolog of AdipoRs (Izh2p). The assay monitors the earliest known step in the adiponectin-AdipoR anti-diabetic signaling cascade. We demonstrate that reconstituted Luc activity can be detected in colonies or cells using a CCD camera and quantified in cell suspensions using a microplate reader. AdipoR1-APPL1 interaction occurs in absence of ligand but can be stimulated specifically by agonists such as adiponectin and the tobacco protein osmotin that was shown to have AdipoR-dependent adiponectin-like biological activity in mammalian cells. To further validate this assay, we have modeled the three dimensional structures of receptor-ligand complexes of membrane-embedded AdipoR1 with cyclic peptides derived from osmotin or osmotin-like plant proteins. We demonstrate that the calculated AdipoR1-peptide binding energies correlate with the peptides\\' ability to behave as AdipoR1 agonists in the split luciferase assay. Further, we demonstrate agonist-AdipoR dependent activation of protein kinase A (PKA) signaling and AMP activated protein kinase (AMPK) phosphorylation in S. cerevisiae, which are homologous to

  5. Oxygen-coupled Redox Regulation of the Skeletal Muscle Ryanodine Receptor/Ca2+ Release Channel (RyR1)

    Science.gov (United States)

    Sun, Qi-An; Wang, Benlian; Miyagi, Masaru; Hess, Douglas T.; Stamler, Jonathan S.

    2013-01-01

    In mammalian skeletal muscle, Ca2+ release from the sarcoplasmic reticulum (SR) through the ryanodine receptor/Ca2+-release channel RyR1 can be enhanced by S-oxidation or S-nitrosylation of separate Cys residues, which are allosterically linked. S-Oxidation of RyR1 is coupled to muscle oxygen tension (pO2) through O2-dependent production of hydrogen peroxide by SR-resident NADPH oxidase 4. In isolated SR (SR vesicles), an average of six to eight Cys thiols/RyR1 monomer are reversibly oxidized at high (21% O2) versus low pO2 (1% O2), but their identity among the 100 Cys residues/RyR1 monomer is unknown. Here we use isotope-coded affinity tag labeling and mass spectrometry (yielding 93% coverage of RyR1 Cys residues) to identify 13 Cys residues subject to pO2-coupled S-oxidation in SR vesicles. Eight additional Cys residues are oxidized at high versus low pO2 only when NADPH levels are supplemented to enhance NADPH oxidase 4 activity. pO2-sensitive Cys residues were largely non-overlapping with those identified previously as hyperreactive by administration of exogenous reagents (three of 21) or as S-nitrosylated. Cys residues subject to pO2-coupled oxidation are distributed widely within the cytoplasmic domain of RyR1 in multiple functional domains implicated in RyR1 activity-regulating interactions with the L-type Ca2+ channel (dihydropyridine receptor) and FK506-binding protein 12 as well as in “hot spot” regions containing sites of mutation implicated in malignant hyperthermia and central core disease. pO2-coupled disulfide formation was identified, whereas neither S-glutathionylated nor sulfenamide-modified Cys residues were observed. Thus, physiological redox regulation of RyR1 by endogenously generated hydrogen peroxide is exerted through dynamic disulfide formation involving multiple Cys residues. PMID:23798702

  6. Simulation of channel blockage for the IEA-R1 research reactor using RELAP/MOD 3

    International Nuclear Information System (INIS)

    Oliveira, Eduardo C.F. de; Castrillo, Lazara Silveira

    2015-01-01

    Research reactors have great importance in the area of nuclear technology, such as radioisotope production, research in nuclear physics, development of new technologies and staff training for reactor operation. The IEA-R1 is a Brazilian research reactor type pool, located at the IPEN (Instituto de Pesquisas Energeticas e Nucleares). In this work is simulated with computer code RELAP5 / MOD 3.3.2 gamma, the effect caused by partial and complete blockage of a channel in MTR fuel element of the IEA-R1 core, in order to analyzed the thermal hydraulic parameters on adjacent channels. (author)

  7. Responses of rat R-1 cells to low dose rate gamma radiation and multiple daily dose fractions

    International Nuclear Information System (INIS)

    Kal, H.B.; Bijman, J.Th.

    1981-01-01

    Multifraction irradiation may offer the same therapeutic gain as continuous irradiation. Therefore, a comparison of the efficacy of low dose rate irradiation and multifraction irradiation was the main objective of the experiments to be described. Both regimens were tested on rat rhabdomyosarcoma (R-1) cells in vitro and in vivo. Exponentially growing R-1 cells were treated in vitro by a multifraction irradiation procedure with dose fractions of 2 Gy gamma radiation and time intervals of 1 to 3 h. The dose rate was 1.3 Gy.min -1 . The results indicate that multifractionation of the total dose is more effective with respect to cell inactivation than continuous irradiation. (Auth.)

  8. Simulation of channel blockage for the IEA-R1 research reactor using RELAP/MOD 3

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Eduardo C.F. de; Castrillo, Lazara Silveira, E-mail: ecfoliveira@hotmail.com, E-mail: lazara.castrillo@upe.br [Universidade de Pernambuco (UPE), Recife, PE (Brazil). Escola Politecnica de Pernambuco

    2015-07-01

    Research reactors have great importance in the area of nuclear technology, such as radioisotope production, research in nuclear physics, development of new technologies and staff training for reactor operation. The IEA-R1 is a Brazilian research reactor type pool, located at the IPEN (Instituto de Pesquisas Energeticas e Nucleares). In this work is simulated with computer code RELAP5 / MOD 3.3.2 gamma, the effect caused by partial and complete blockage of a channel in MTR fuel element of the IEA-R1 core, in order to analyzed the thermal hydraulic parameters on adjacent channels. (author)

  9. A Saccharomyces cerevisiae assay system to investigate ligand/AdipoR1 interactions that lead to cellular signaling.

    Directory of Open Access Journals (Sweden)

    Mustapha Aouida

    Full Text Available Adiponectin is a mammalian hormone that exerts anti-diabetic, anti-cancer and cardioprotective effects through interaction with its major ubiquitously expressed plasma membrane localized receptors, AdipoR1 and AdipoR2. Here, we report a Saccharomyces cerevisiae based method for investigating agonist-AdipoR interactions that is amenable for high-throughput scale-up and can be used to study both AdipoRs separately. Agonist-AdipoR1 interactions are detected using a split firefly luciferase assay based on reconstitution of firefly luciferase (Luc activity due to juxtaposition of its N- and C-terminal fragments, NLuc and CLuc, by ligand induced interaction of the chimeric proteins CLuc-AdipoR1 and APPL1-NLuc (adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain and leucine zipper motif 1-NLuc in a S. cerevisiae strain lacking the yeast homolog of AdipoRs (Izh2p. The assay monitors the earliest known step in the adiponectin-AdipoR anti-diabetic signaling cascade. We demonstrate that reconstituted Luc activity can be detected in colonies or cells using a CCD camera and quantified in cell suspensions using a microplate reader. AdipoR1-APPL1 interaction occurs in absence of ligand but can be stimulated specifically by agonists such as adiponectin and the tobacco protein osmotin that was shown to have AdipoR-dependent adiponectin-like biological activity in mammalian cells. To further validate this assay, we have modeled the three dimensional structures of receptor-ligand complexes of membrane-embedded AdipoR1 with cyclic peptides derived from osmotin or osmotin-like plant proteins. We demonstrate that the calculated AdipoR1-peptide binding energies correlate with the peptides' ability to behave as AdipoR1 agonists in the split luciferase assay. Further, we demonstrate agonist-AdipoR dependent activation of protein kinase A (PKA signaling and AMP activated protein kinase (AMPK phosphorylation in S. cerevisiae, which are

  10. New digital control system for the operation of the Colombian research reactor IAN-R1; Nuevo sistema de control digital para la operacion del reactor de investigacion Colombiano IAN-R1

    Energy Technology Data Exchange (ETDEWEB)

    Celis del A, L.; Rivero, T.; Bucio, F.; Ramirez, R.; Segovia, A.; Palacios, J., E-mail: lina.celis@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2015-09-15

    En 2011, Mexico won the Colombian international tender for the renewal of instrumentation and control of the IAN-R1 Reactor, to Argentina and the United States. This paper presents the design criteria and the development made for the new digital control system installed in the Colombian nuclear reactor IAN-R1, which is based on a redundant and diverse architecture, which provides increased availability, reliability and safety in the reactor operation. This control system and associated instrumentation met all national export requirements, with the safety requirements established by the IAEA as well as the requirements demanded by the Colombian Regulatory Body in nuclear matter. On August 20, 2012, the Colombian IAN-R1 reactor reached its first criticality controlled with the new system developed at Instituto Nacional de Investigaciones Nucleares (ININ). On September 14, 2012, the new control system of the Colombian IAN-R1 reactor was officially handed over to the Colombian authorities, this being the first time that Mexico exported nuclear technology through the ININ. Currently the reactor is operating successfully with the new control system, and has an operating license for 5 years. (Author)

  11. Fuel element reactivity worth in different rings of the IPR-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Gomes do Prado Souza, Rose Mary

    2008-10-29

    The thermal power of the IPR-R1 TRIGA Reactor will be upgraded from 100 kW to 250 kW. Starting core: loaded with 59 aluminum cladded fuel elements; 1.34 $ excess reactivity; and 100 kW power. It is planned to go 2.5 times the power licensed, i.e., 250 kW. This forces to enlarge the reactivity level. Nuclear reactors must have sufficient excess reactivity to compensate the negative reactivity feedback effects caused by: the fuel temperature, fuel burnup, fission poisoning production, and to allow full power operation for predetermined period of time. To provide information for the calculation of the new core arrangement, the reactivity worth of some fuel elements in the core were measured as well as the determination of the core reactivity increase in the substitution of the original fuels, cladded with aluminium, for new ones, cladded with stainless steel. The reactivity worth of fuel element was measured from the difference in critical position of the control rods, calibrated by the positive period method, before and after the fuel element was withdrawn from the core. The magnitude of reactivity increase was determined when withdrawing the original Al-clad fuel (a little burned up) and the graphite elements, and inserting a fresh Al-clad fuel element, one by one. Experimental results indicated that to obtain enough reactivity excess to increase the rector power the addition of 4 new fuel elements in the core would be sufficient: - Substitution of 4 Al-clad fuel elements in ring C for fresh stainless steel clad fuel elements; - increase the reactivity {approx_equal} 4 x 6.5 = 26 cents; - The removed 4 Al-clad F. E. (a little burned up) put in the core periphery, ring F, replacing graphite elements; - add < 4 x 39 156 cents (39 cents was measured with a fresh F.E.). Neutron source was changed from position F7 to F8. Control and Safety rods were moved from ring D to C in order to increase their reactivity worth. Regulating rod was kept at the same position, F16. Four

  12. ORF Alignment: NC_001264 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available einococcus radiodurans (strain ... R1) ... Length = 233 ... Query: 7 ... TVEQAVRVLEYFDADHT...EWTLSDLARALALPTSTLHEQLSTLTASGLLRRTGRGRYQLGW 66 ... TVEQAVRVLEYFDADHTEWTLSDLARALALPT...STLHEQLSTLTASGLLRRTGRGRYQLGW Sbjct: 1 ... TVEQAVRVLEYFDADHTEWTLSDLARALALPTSTLHEQLSTLTASGLLRRTGRGRYQLGW 60 ... Que

  13. R-1 (C-620-A) and R-2 (C-620-B) air compressor control logic, computer software description. Revision 1

    International Nuclear Information System (INIS)

    Walter, K.E.

    1995-01-01

    This document provides an updated computer software description for the software used on the FFTF R-1 (C-620-A) and R-2 (C-620-B) air compressor programmable controllers. Logic software design changes were required to allow automatic starting of a compressor that had not been previously started

  14. Pharmacological properties of homomeric and heteromeric GluR1o and GluR3o receptors

    DEFF Research Database (Denmark)

    Nielsen, B S; Banke, T G; Schousboe, A

    1998-01-01

    Homomeric and heteromeric alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunits GluR1o and GluR3o were expressed in Spodoptera frugiperda (Sf9) insect cells. Membranes containing the recombinant receptors showed a doublet of bands of the expected size (99-109 kDa) after...

  15. On the Composition and Neutrix Composition of the Delta Function and the Function cosh^{-1}(|x|^{1/r}+1

    Directory of Open Access Journals (Sweden)

    Brian Fisher

    2017-03-01

    Full Text Available Let $F$ be a distribution in $\\mathcal{D'}$ and let $f$ be a locally summable function. The composition $F(f(x$ of $F$ and $f$ is said to exist and be equal to the distribution $h(x$ if the limit of the sequence $\\{ F_{n}(f(x\\}$ is equal to $h(x$, where $F_n(x =F(x*\\delta _n(x$ for $n=1,2, \\ldots$ and $\\{\\delta_n(x\\}$ is a certain regular sequence converging to the Dirac delta function. It is proved that the neutrix composition $ \\delta^{(s}[\\cosh^{-1} (x_+^{1/r}+1] $ exists and \\beqa \\delta^{(s}[\\cosh^{-1} (x_+^{1/r}+1] = - \\sum _{k=0} ^{M-1} \\sum_{i=0}^{kr+r} {k \\choose i}{(-1^{i+k}rc_{r,s,k} \\over (kr+rk!}\\delta ^{(k}(x, for $s =M-1,M, M+1,\\ldots$ and $r=1,2,\\ldots,$ where $$c_{r,s,k}=\\sum _{j=0}^{i} {i \\choose j}{ (-1^{kr+r-i}(2j-i^{s+1}\\over 2^{s+i+1} },$$ $M$ is the smallest integer for which $s-2r+1 < 2Mr$ and $r\\le s/(2M+2.$ Further results are also proved.

  16. Summary of IEA-R1 research a reactor licensing related to its power increase from 2 to 10 MW

    International Nuclear Information System (INIS)

    1989-04-01

    This work is a summary of IEA-R1 research reactor licensing related to its power increase from 2 to 10 MW. It reports also safety requirements, fuel elements, and reactor control modifications inherent to power increase. (A.C.A.S.)

  17. Modifications in the operational conditions of the IEA-R1 reactor under continuous 48 hours operation

    International Nuclear Information System (INIS)

    Moreira, Joao Manoel Losada; Frajndlich, Roberto

    1995-01-01

    This work shows the required changes in the IEA-R1 reactor for operation at 2 Mw, 48 hours continuously. The principal technical change regards the operating conditions of the reactor, namely, the required excess reactivity which now will amount to 4800 pcm in order to compensate the Xe poisoning at equilibrium at 2 Mw. (author). 6 refs, 1 fig, 1 tab

  18. Identification of potential small molecule allosteric modulator sites on IL-1R1 ectodomain using accelerated conformational sampling method.

    Directory of Open Access Journals (Sweden)

    Chao-Yie Yang

    Full Text Available The interleukin-1 receptor (IL-1R is the founding member of the interleukin 1 receptor family which activates innate immune response by its binding to cytokines. Reports showed dysregulation of cytokine production leads to aberrant immune cells activation which contributes to auto-inflammatory disorders and diseases. Current therapeutic strategies focus on utilizing antibodies or chimeric cytokine biologics. The large protein-protein interaction interface between cytokine receptor and cytokine poses a challenge in identifying binding sites for small molecule inhibitor development. Based on the significant conformational change of IL-1R type 1 (IL-1R1 ectodomain upon binding to different ligands observed in crystal structures, we hypothesized that transient small molecule binding sites may exist when IL-1R1 undergoes conformational transition and thus suitable for inhibitor development. Here, we employed accelerated molecular dynamics (MD simulation to efficiently sample conformational space of IL-1R1 ectodomain. Representative IL-1R1 ectodomain conformations determined from the hierarchy cluster analysis were analyzed by the SiteMap program which leads to identify small molecule binding sites at the protein-protein interaction interface and allosteric modulator locations. The cosolvent mapping analysis using phenol as the probe molecule further confirms the allosteric modulator site as a binding hotspot. Eight highest ranked fragment molecules identified from in silico screening at the modulator site were evaluated by MD simulations. Four of them restricted the IL-1R1 dynamical motion to inactive conformational space. The strategy from this study, subject to in vitro experimental validation, can be useful to identify small molecule compounds targeting the allosteric modulator sites of IL-1R and prevent IL-1R from binding to cytokine by trapping IL-1R in inactive conformations.

  19. Clipboard

    Indian Academy of Sciences (India)

    Unknown

    DNA Repair in Deinococcus radiodurans and in Germinating Bacterial Spores; J. Bacteriol. 186 5973–5977. Frenkiel-Krispin D, Levin-Zaidman S, Shimoni E, Wolf S G, Wachtel E J, Arad T, Finkel S E, Kolter R and. Minsky A 2001 Regulated phase transitions of bacterial chromatin: a non-enzymatic pathway for generic DNA.

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    In situ real-time evaluation of radiation-responsive promoters in the extremely radioresistant microbe Deinococcus radiodurans · Narasimha Anaganti Bhakti Basu Shree Kumar Apte · More Details Abstract Fulltext PDF. A third generation promoter probe shuttle vector pKG was constructed, using the green fluorescent ...

  1. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Effect of zinc and calcium ions on the rat kidney membrane-bound form of dipeptidyl ... ParA encoded on chromosome II of Deinococcus radiodurans binds to .... Repeated oral administration of capsaicin increases anxiety-like behaviours with ...

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    PprA, a pleiotropic protein for radioresistance, works through DNA gyrase and shows cellular dynamics during postirradiation recovery in Deinococcus radiodurans .... Gene interactions and genetics of blast resistance and yield attributes in rice (Oryza ... Molecular mapping of a stripe rust resistance gene in wheat line C51.

  3. Construction of a high affinity zinc binding site in the metabotropic glutamate receptor mGluR1

    DEFF Research Database (Denmark)

    Jensen, Anders A.; Sheppard, P O; Jensen, L B

    2001-01-01

    a molecular model of the ATD of mGluR1 based on a weak amino acid sequence similarity with a bacterial periplasmic binding protein. The ATD consists of two globular lobes, which are speculated to contract from an "open" to a "closed" conformation following agonist binding. In the present study, we have...... created a Zn(2+) binding site in mGluR1b by mutating the residue Lys(260) to a histidine. Zinc acts as a noncompetitive antagonist of agonist-induced IP accumulation on the K260H mutant with an IC(50) value of 2 microm. Alanine mutations of three potential "zinc coligands" in proximity to the introduced...

  4. Fission track dating method: I. Study of neutron flux uniformity in some irradiation positions of IEA-R1 reactor

    International Nuclear Information System (INIS)

    Osorio, A.M.; Hadler, J.C.; Iunes, P.J.; Paulo, S.R. de

    1993-06-01

    In order to use the fission track dating method the flux gradient was verified within the sample holder, in some irradiation positions of the IEA-R1 reactor at IPEN/CNEN, Sao Paulo. The fission track dating method considers only the thermal neutron fission tracks, to subtract the other contributions sample irradiations with a cadmium cover was performed. The neutron flux cadmium influence was studied. (author)

  5. IEA-R1 Nuclear Research Reactor: 58 Years of Operating Experience and Utilization for Research, Teaching and Radioisotopes Production

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Jose Patricio Nahuel; Filho, Tufic Madi; Saxena, Rajendra; Filho, Walter Ricci [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Instituto de Pesquisas Energeticas e Nucleares - IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242 Cid Universitaria CEP: 05508-000- Sao Paulo-SP (Brazil)

    2015-07-01

    IEA-R1 research reactor at the Instituto de Pesquisas Energeticas e Nucleares (Nuclear and Energy Research Institute) IPEN, Sao Paulo, Brazil is the largest power research reactor in Brazil, with a maximum power rating of 5 MWth. It is being used for basic and applied research in the nuclear and neutron related sciences, for the production of radioisotopes for medical and industrial applications, and for providing services of neutron activation analysis, real time neutron radiography, and neutron transmutation doping of silicon. IEA-R1 is a swimming pool reactor, with light water as the coolant and moderator, and graphite and beryllium as reflectors. The reactor was commissioned on September 16, 1957 and achieved its first criticality. It is currently operating at 4.5 MWth with a 60-hour cycle per week. In the early sixties, IPEN produced {sup 131}I, {sup 32}P, {sup 198}Au, {sup 24}Na, {sup 35}S, {sup 51}Cr and labeled compounds for medical use. During the past several years, a concerted effort has been made in order to upgrade the reactor power to 5 MWth through refurbishment and modernization programs. One of the reasons for this decision was to produce {sup 99}Mo at IPEN. The reactor cycle will be gradually increased to 120 hours per week continuous operation. It is anticipated that these programs will assure the safe and sustainable operation of the IEA-R1 reactor for several more years, to produce important primary radioisotopes {sup 99}Mo, {sup 125}I, {sup 131}I, {sup 153}Sm and {sup 192}Ir. Currently, all aspects of dealing with fuel element fabrication, fuel transportation, isotope processing, and spent fuel storage are handled by IPEN at the site. The reactor modernization program is slated for completion by 2015. This paper describes 58 years of operating experience and utilization of the IEA-R1 research reactor for research, teaching and radioisotopes production. (authors)

  6. Neutronic parameters characterization of the TRIGA IPR-R1 using scale 6.0 (KENO VI)

    International Nuclear Information System (INIS)

    Faria, Victor; Miro, Rafael; Verdu, Gumersindo; Barrachina, Teresa; Silva, Clarysson A. Mello da; Pereira, Claubia

    2011-01-01

    KENO-VI is a Monte Carlo based transport code used to obtain the criticality of a nuclear system. A model built using this code in the SCALE6.0 software system was developed for the characterization of neutronic parameters of the IPR-R1 TRIGA research reactor. A comparison with experimental values and those calculated with a MCNP code model could be then attained with the purpose to validate this methodology. (author)

  7. Amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole

    International Nuclear Information System (INIS)

    Saidov, D.K.; Rakhmonov, R.O.; Khodzhiboev, Yu.; Kukaniev, M.A.; Bandaev, S.

    2015-01-01

    Present article is devoted to amino methylation of 2-R-6-R_1-imidazo-[2.1-B]-1.3.4-thiadiazole. The reaction of new modifications of derivatives of imidazo-[2.1-B]-1.3.4-thiadiazoles-2-bromine-6-p-bromophenyl and 2-alkyl alkylene sulfonyl-6-phenyl imidazo--[2.1-B]-1.3.4-thiadiazole on Mannich with secondary and heterocyclic amines was studied.

  8. Studies review and exploration purpose of neutron radiography technique in the TRIGA IPR-R1 reactor at CDTN, Brazil

    International Nuclear Information System (INIS)

    Costa, Antonella Lombardi; Amorim, Valter Alves de; Stasiulevicius, Roberto; Rocha, Zildete

    2002-01-01

    Neutron Radiography - NR - consists of obtaining on a sensitive plate, the image produced by neutron flux after crossing an object. Through NR is possible to inspect plastics and explosives materials and organic composition. Is difficult to analyze these materials by the radiography technique. The neutron beam extractor was installed, in the TRIGA IPR-R1 reactor at the CDTN. This work presents preliminaries results of the NR researches in the past at CDTN, which are being retaken. (author)

  9. Neutronic parameters characterization of the TRIGA IPR-R1 using scale 6.0 (KENO VI)

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Victor; Miro, Rafael; Verdu, Gumersindo; Barrachina, Teresa [Institute for Industrial, Radiophysical and Environmental Safety (ISIRYM), Universitat Politecnica de València (Spain); Silva, Clarysson A. Mello da; Pereira, Claubia [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Dalle, Hugo Moura [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    KENO-VI is a Monte Carlo based transport code used to obtain the criticality of a nuclear system. A model built using this code in the SCALE6.0 software system was developed for the characterization of neutronic parameters of the IPR-R1 TRIGA research reactor. A comparison with experimental values and those calculated with a MCNP code model could be then attained with the purpose to validate this methodology. (author)

  10. Measurement of thermal, epithermal and fast neutrons fluxes by the activation foil method at IEA-R1 reactor

    International Nuclear Information System (INIS)

    Dias, M.S.; Koskinas, M.F.; Berretta, J.R.; Fratin, L.; Botelho, S.

    1990-01-01

    The thermal, epithermal and fast neutron fluxes have been determined experimentally by the activation foil method at position GI, located near the IEA-R1 reactor core. The reactions used were 197 Au (n,gamma) 198 Au, for thermal and epithermal neutrons and 27 Na (n,alpha) 24 Na, for fast neutrons. The activities were measured by the 4π(PC)β-γ coincidence method. (author)

  11. Simulation study of the photon quality correction factors of ionization chambers for FiR 1 epithermal neutron beam

    International Nuclear Information System (INIS)

    Koivunoro, H.; Uusi-Simola, J.; Savolainen, S.; Kotiluoto, P.; Auterinen, I.; Kosunen, A.

    2006-01-01

    At FiR 1 BNCT facility in Finland, neutron-insensitive Mg(Ar) ionization chambers are used for photon dose measurements in an epithermal neutron beam. Previously, photon sensitivity factors for the chamber for the measurements in a water phantom in FiR 1 beam have been determined experimentally from measurements in 60 Co gamma and in a 6 MV clinical accelerator photon beams. However, the response of the ionization chamber in a water phantom depends on energy spectrum and angle of the photons and the secondary electrons created inside the phantom and may differ depending on type of the irradiation source (accelerator vs. an epithermal neutron beam). Also, the experimental sensitivity factor does not take into account the possible perturbations in the photon production in phantom caused by the ionization chamber materials. Therefore, it is necessary to determine the photon quality correction factors (k Qγ ) for the Mg(Ar) chamber at the FiR 1 beam through computer simulations. In this study, the k Qγ factors have been determined for Mg(Ar) chamber from Monte Carlo calculations of absorbed photon dose at two depths in a water phantom using MCNP code. The k qγ factors obtained with this method are compared to the sensitivity factors determined with measurements in an accelerator photon beam and to the k Qγ factors published previously. (author)

  12. Effect of Formic Acid on Exopolysaccharide Production in Skim Milk Fermentation by Lactobacillus delbrueckii subsp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Nishimura, Junko; Kawai, Yasushi; Aritomo, Ryota; Ito, Yoshiyuki; Makino, Seiya; Ikegami, Shuji; Isogai, Emiko; Saito, Tadao

    2013-01-01

    In yogurt, the formation of formate by Streptococcus thermophilus stimulates the activity of Lactobacillus delbrueckii subsp. bulgaricus (L. bulgaricus). However, there have been no reports how formic acid acts on the exopolysaccharide (EPS) production of L. bulgaricus. Here, the effect of formate on the EPS production in skim milk by L. bulgaricus OLL1073R-1 was investigated. After incubation for 24 hr with 100 mg/l formate, cell proliferation and lactic acid production were accelerated. The viable and total cell numbers were increased about ten- and four-fold, respectively. The amount of EPS in culture with formate (~116 µg/ml) was also four-fold greater than that of the control (~27 µg/ml). Although elongation of cells was observed at 6 hr of cultivation in both cultures, cells cultivated with formate returned to a normal shape after incubation for 24 hr. The sensitivity to cell wall hydrolase and composition of surface layer proteins, as well as the cell membrane fatty acid composition of L. bulgaricus OLL1073R-1, were not influenced by formate. However, differences were observed in intracellular fatty acid compositions and sensitivity to antibiotics. Cell length and surface damage returned to normal in cultures with formate. These observations suggest that formic acid is necessary for normal cell growth of L. bulgaricus OLL1073R-1 and higher EPS production.

  13. Thermal hydraulic analysis of the IPR-R1 TRIGA research reactor using a RELAP5 model

    International Nuclear Information System (INIS)

    Costa, Antonella L.; Reis, Patricia Amelia L.; Pereira, Claubia; Veloso, Maria Auxiliadora F.; Mesquita, Amir Z.; Soares, Humberto V.

    2010-01-01

    The RELAP5 code is widely used for thermal hydraulic studies of commercial nuclear power plants. Current investigations and code adaptations have demonstrated that the RELAP5 code can be also applied for thermal hydraulic analysis of nuclear research reactors with good predictions. Therefore, as a contribution to the assessment of RELAP5/MOD3.3 for research reactors analysis, this work presents steady-state and transient calculation results performed using a RELAP5 model to simulate the IPR-R1 TRIGA research reactor at 50 kilowatts (kW) of power operation. The reactor is located in the Nuclear Technology Development Center (CDTN), Brazil. It is a 250 kW, light water moderated and cooled, graphite-reflected, open pool type research reactor. The development and the assessment of a RELAP5 model for the IPR-R1 TRIGA are presented. Experimental data were considered in the process of the RELAP5 model validation. The RELAP5 results were also compared with calculated data from the STHIRP-1 (Research Reactors Thermal Hydraulic Simulation) code. The results obtained have shown that the RELAP5 model for the IPR-R1 TRIGA reproduces the actual steady-state reactor behavior in good agreement with the available data.

  14. Impaired IFNγ-Signaling and Mycobacterial Clearance in IFNγR1-Deficient Human iPSC-Derived Macrophages

    Directory of Open Access Journals (Sweden)

    Anna-Lena Neehus

    2018-01-01

    Full Text Available Mendelian susceptibility to mycobacterial disease (MSMD is caused by inborn errors of interferon gamma (IFNγ immunity and is characterized by severe infections by weakly virulent mycobacteria. Although IFNγ is the macrophage-activating factor, macrophages from these patients have never been studied. We demonstrate the generation of heterozygous and compound heterozygous (iMSMD-cohet induced pluripotent stem cells (iPSCs from a single chimeric patient, who suffered from complete autosomal recessive IFNγR1 deficiency and received bone-marrow transplantation. Loss of IFNγR1 expression had no influence on the macrophage differentiation potential of patient-specific iPSCs. In contrast, lack of IFNγR1 in iMSMD-cohet macrophages abolished IFNγ-dependent phosphorylation of STAT1 and induction of IFNγ-downstream targets such as IRF-1, SOCS-3, and IDO. As a consequence, iMSMD-cohet macrophages show impaired upregulation of HLA-DR and reduced intracellular killing of Bacillus Calmette-Guérin. We provide a disease-modeling platform that might be suited to investigate novel treatment options for MSMD and to gain insights into IFNγ signaling in macrophages.

  15. Reliability database of IEA-R1 Brazilian research reactor: Applications to the improvement of installation safety

    International Nuclear Information System (INIS)

    Oliveira, P.S.P.; Tondin, J.B.M.; Martins, M.O.; Yovanovich, M.; Ricci Filho, W.

    2010-01-01

    In this paper the main features of the reliability database being developed at Ipen-Cnen/SP for IEA-R1 reactor are briefly described. Besides that, the process for collection and updating of data regarding operation, failure and maintenance of IEA-R1 reactor components is presented. These activities have been conducted by the reactor personnel under the supervision of specialists in Probabilistic Safety Analysis (PSA). The compilation of data and subsequent calculation are based on the procedures defined during an IAEA Coordinated Research Project which Brazil took part in the period from 2001 to 2004. In addition to component reliability data, the database stores data on accident initiating events and human errors. Furthermore, this work discusses the experience acquired through the development of the reliability database covering aspects like improvements in the reactor records as well as the application of the results to the optimization of operation and maintenance procedures and to the PSA carried out for IEA-R1 reactor. (author)

  16. Characterization of the water filters cartridges from the iea-r1 reactor using the Monte Carlo method

    International Nuclear Information System (INIS)

    Costa, Priscila; Potiens Junior, Ademar J.

    2015-01-01

    Filter cartridges are part of the primary water treatment system of the IEA-R1 Research Reactor and, when saturated, they are replaced and become radioactive waste. The IEA-R1 is located at the Nuclear and Energy Research Institute (IPEN), in Sao Paulo, Brazil. The primary characterization is the main step of the radioactive waste management in which the physical, chemical and radiological properties are determined. It is a very important step because the information obtained in this moment enables the choice of the appropriate management process and the definition of final disposal options. In this paper, it is presented a non-destructive method for primary characterization, using the Monte Carlo method associated with the gamma spectrometry. Gamma spectrometry allows the identification of radionuclides and their activity values. The detection efficiency is an important parameter, which is related to the photon energy, detector geometry and the matrix of the sample to be analyzed. Due to the difficult to obtain a standard source with the same geometry of the filter cartridge, another technique is necessary to calibrate the detector. The technique described in this paper uses the Monte Carlo method for primary characterization of the IEA-R1 filter cartridges. (author)

  17. Evaluation of power behavior during startup and shutdown procedures of the IPR-R1 Triga Reactor

    International Nuclear Information System (INIS)

    Zangirolami, Dante M.; Mesquita, Amir Z.; Ferreira, Andrea V.

    2009-01-01

    The IPR-R1 nuclear reactor of Centro de Desenvolvimento da Tecnologia Nuclear - CDTN/CNEN is a TRIGA Mark I pool type reactor cooled by natural circulation of light water. In the IPR-R1, the power is measured by four nuclear channels, neutron-sensitive chambers, which are mounted around the reactor core: the Startup Channel for power indication during reactor startup; the Logarithmic Wide Range Power Monitoring Channel; the Linear Multi-Range Power Monitoring Channel and the Percent Power Safety Channel. A data acquisition system automatically does the monitoring and storage of all the reactor operational parameters including the reactor power. The startup procedure is manual and the time to reach the desired reactor power level is different on each irradiation which may introduces differences in induced activity of samples irradiated in different irradiations. In this work, the power evolution during startup and shutdown periods of IPR-R1 operation was evaluated and the mean values of reactor energy production in these operational phases were obtained. The analyses were performed on basis of the Linear Multi-Range Channel data. The results show that the sum of startup and shutdown periods corresponds to 1% of released energy for irradiations during 1h at 100kW. This value may be useful to correct experimental data in neutron activation experiments. (author)

  18. The internal Cdc20 binding site in BubR1 facilitates both spindle assembly checkpoint signalling and silencing

    DEFF Research Database (Denmark)

    Lischetti, Tiziana; Zhang, Gang; Sedgwick, Garry G

    2014-01-01

    Improperly attached kinetochores activate the spindle assembly checkpoint (SAC) and by an unknown mechanism catalyse the binding of two checkpoint proteins, Mad2 and BubR1, to Cdc20 forming the mitotic checkpoint complex (MCC). Here, to address the functional role of Cdc20 kinetochore localization...... in the SAC, we delineate the molecular details of its interaction with kinetochores. We find that BubR1 recruits the bulk of Cdc20 to kinetochores through its internal Cdc20 binding domain (IC20BD). We show that preventing Cdc20 kinetochore localization by removal of the IC20BD has a limited effect...... on the SAC because the IC20BD is also required for efficient SAC silencing. Indeed, the IC20BD can disrupt the MCC providing a mechanism for its role in SAC silencing. We thus uncover an unexpected dual function of the second Cdc20 binding site in BubR1 in promoting both efficient SAC signalling and SAC...

  19. Uptake and incorporation of labeled tryptophan isomers into IAA in the jsR1 mutant of Lemna gibba

    International Nuclear Information System (INIS)

    Baldi, B.G.; Maher, B.R.; Cohen, J.D.

    1989-01-01

    Analyses of the IAA-overproducing mutant of Lemna have been initiated in order to study in vivo biosynthesis of IAA. Using radiolabelled tryptophan isomers prepared from commercial sources of 14 C-D,L tryptophan by chiral separation kinetics of uptake of L and D tryptophan were determined for sterile cultures of individual jsR 1 four-frond colonies. Over a 24 h period, about 50% of the radioactivity from 14 C-L-TRP in media, or about 25% from 14 C-D-TRP, was found in the plant tissue. Maximal rates of uptake were seen in the first six hors for both isomers. Endogenous levels of tryptophan determined in jsR 1 as measures of pool sizes in vivo show 5 to 10 ug/g FW total tryptophan with less than 1% in the D isomer form. Information on uptake and endogenous pool sizes of tryptophan isomers is being used for feeding of stable isotope labeled tryptophan ( 13 C, 14 N) to jsR 1 at physiological levels. Analyses of incorporation of label into IAA using GC-MS and high resolution mass spectrometry are currently underway

  20. Supervisory system to monitor the neutron flux of the IPR-R1 TRIGA research reactor at CDTN

    International Nuclear Information System (INIS)

    Pinto, Antonio Juscelino; Mesquita, Amir Zacarias; Tello, Cledola Cassia Oliveira

    2009-01-01

    The IPR-R1 TRIGA Mark I nuclear research reactor at the Nuclear Technology Development Center - CDTN (Belo Horizonte) is a pool type reactor. It was designed for research, training and radioisotope production. The International Atomic Energy Agency- IAEA - recommends the use of friendly interfaces for monitoring and controlling the operational parameters of nuclear reactors. This paper reports the activities for implementing a supervisory system, using LabVIEW software, with the purpose to provide the IPR-R1 TRIGA research reactor with a modern, safe and reliable system to monitor the time evolution of the power of its core. The use of the LabVIEW will introduce modern techniques, based on electronic processor and visual interface in video monitor, substituting the mechanical strip chart recorders (ink-pen drive and paper) that monitor the current neutrons flux, which is proportional to the thermal power supplied by reactor core. The main objective of the system will be to follow the evolution of the neutronic flux originated in the Linear and Logarithmic channels. A great advantage of the supervisory software nowadays, in relation to computer programs currently used in the facility, is the existence of new resources such as the data transmission and graphical interfaces by net, grid lines display in the graphs, and resources for real time reactor core video recordings. The considered system could also in the future be optimized, not only for data acquisition, but also for the total control of IPR-R1 TRIGA reactor(author)

  1. Impaired IFNγ-Signaling and Mycobacterial Clearance in IFNγR1-Deficient Human iPSC-Derived Macrophages.

    Science.gov (United States)

    Neehus, Anna-Lena; Lam, Jenny; Haake, Kathrin; Merkert, Sylvia; Schmidt, Nico; Mucci, Adele; Ackermann, Mania; Schubert, Madline; Happle, Christine; Kühnel, Mark Philipp; Blank, Patrick; Philipp, Friederike; Goethe, Ralph; Jonigk, Danny; Martin, Ulrich; Kalinke, Ulrich; Baumann, Ulrich; Schambach, Axel; Roesler, Joachim; Lachmann, Nico

    2018-01-09

    Mendelian susceptibility to mycobacterial disease (MSMD) is caused by inborn errors of interferon gamma (IFNγ) immunity and is characterized by severe infections by weakly virulent mycobacteria. Although IFNγ is the macrophage-activating factor, macrophages from these patients have never been studied. We demonstrate the generation of heterozygous and compound heterozygous (iMSMD-cohet) induced pluripotent stem cells (iPSCs) from a single chimeric patient, who suffered from complete autosomal recessive IFNγR1 deficiency and received bone-marrow transplantation. Loss of IFNγR1 expression had no influence on the macrophage differentiation potential of patient-specific iPSCs. In contrast, lack of IFNγR1 in iMSMD-cohet macrophages abolished IFNγ-dependent phosphorylation of STAT1 and induction of IFNγ-downstream targets such as IRF-1, SOCS-3, and IDO. As a consequence, iMSMD-cohet macrophages show impaired upregulation of HLA-DR and reduced intracellular killing of Bacillus Calmette-Guérin. We provide a disease-modeling platform that might be suited to investigate novel treatment options for MSMD and to gain insights into IFNγ signaling in macrophages. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  2. Polymorphisms of ST2-IL18R1-IL18RAP gene cluster: a new risk for autoimmune thyroid diseases.

    Science.gov (United States)

    Wang, X; Zhu, Y F; Li, D M; Qin, Q; Wang, Q; Muhali, F S; Jiang, W J; Zhang, J A

    2016-02-01

    Interleukin 33 (IL33) / ST2 pathway and ST2-interlukin18 receptor1-interlukin18 receptor accessory protein (ST2-IL18R1-IL18RAP) gene cluster have been involved in many autoimmune diseases but few report in autoimmune thyroid diseases (AITD). In this study, we investigated whether polymorphisms of IL33, ST2, IL18R1, and IL18RAP are associated with Graves' disease (GD) and Hashimoto's thyroiditis (HT), two major forms of AITD, among a Chinese population. A total of 11 SNPs were explored in a case-control study including 417 patients with GD, 250 HT patients and 301 controls, including rs1929992, rs10975519, rs10208293, rs6543116, rs1041973, rs3732127, rs11465597, rs1035130, rs2293225, rs1035127, rs917997 of IL 33, ST2-IL18R1-IL18RAP gene cluster. Genotyping of these SNPs was performed using matrix-assisted laser desorption / ionization-time-of-flight mass spectrometer (MALDI-TOF-MS) platform from Sequenom. The frequencies of allele A and AA+AG genotype of rs6543116 (ST2) in HT patients were significantly increased compared with those of the controls (P = 0.029/0.021, OR = 1.31/1.62). And in another SNP rs917997, AA+AG genotype presented an increased frequency in HT subjects compared with controls (P = 0.046, OR = 1.53). Furthermore, the haplotype GAGCCCG from ST2-IL18R1-IL18RAP gene cluster (rs6543116, rs1041973, rs1035130, rs3732127, rs1035127, rs2293225, rs917997) was associated with increased susceptibility to GD with an OR of 2.03 (P = 0.022, 95% CI = 1.07-3.86). Some SNPs of ST2-IL18R1-IL18RAP gene cluster might increase the risk of susceptibility of HT and GD in Chinese Han population. © 2015 John Wiley & Sons Ltd.

  3. Role of Caspase-3 Cleaved IP3R1 on Ca2+ Homeostasis and Developmental Competence of Mouse Oocytes and Eggs

    Science.gov (United States)

    Zhang, Nan; Fissore, Rafael. A.

    2014-01-01

    Apoptosis in most cell types is accompanied by altered Ca2+ homeostasis. During apoptosis, caspase-3 mediated cleavage of the type 1 inositol 1,4,5-trisphosphate receptor (IP3R1) generates a 95-kDa C-terminal fragment (C-IP3R1), which represents the channel domain of the receptor. Aged mouse eggs display abnormal Ca2+ homeostasis and express C-IP3R1, although whether or not C-IP3R1 expression contributes to Ca2+ misregulation or a decrease in developmental competency is unknown. We sought to answer these questions by injecting in mouse oocytes and eggs cRNAs encoding CIP3R1. We found that: 1) expression of C-IP3R1 in eggs lowered the Ca2+ content of the endoplasmic reticulum (ER), although, as C-IP3R1 is quickly degraded at this stage, its expression did not impair pre-implantation embryo development; 2) expression of CIP3R1 in eggs enhanced fragmentation associated with aging; 3) endogenous IP3R1 is required for aging associated apoptosis, as its down-regulation prevented fragmentation, and expression of C-IP3R1 in eggs with downregulated IP3R1 partly restored fragmentation; 4) C-IP3R1 expression in GV oocytes resulted in persistent levels of protein, which abolished the increase in the ER releasable Ca2+ pool that occurs during maturation, undermined the Ca2+ oscillatory ability of matured eggs and their activation potential. Collectively, this study supports a role for IP3R1 and C-IP3R1 in regulating Ca2+ homeostasis and the ER Ca2+ content during oocyte maturation. Nevertheless, the role of C-IP3R1 on Ca2+ homeostasis in aged eggs seems minor, as in MII eggs the majority of endogenous IP3R1 remains intact and C-IP3R1 undergoes rapid turnover. PMID:24692207

  4. Synthesis, physical-chemical properties, antimicrobial and antifungal activity of some 2-(2-((5-(adamantane-1-yl-4-R-1,2,4-triazole-3-ylthioacetyl-N-R1–hydrazine-carbothioamides

    Directory of Open Access Journals (Sweden)

    V. M. Odyntsova

    2017-12-01

    Full Text Available Special attention of pharmaceutical scientists is attracted to the creation of new potential substances. They select natural heterocyclic molecules that exhibit various types of pharmacological activity as basic structures. Adamantane derivatives, as well as a number of other framework compounds, in the vast majority are biologically active substances. This fact causes interest to the given classes of organic compounds as potential sources for the development of new drugs. Due to the high pharmacological action of 1,2,4-triazole derivatives, the combination of adamantane and 1,2,4-triazole in one molecule can lead to the formation of high-level pharmacological substances. The aim of this work is the synthesis of some 2- (2 - ((5- (adamantane-1-yl -4-R-1,2,4-triasole-3-yl thio acetyl -N-R1-hydrazine-carbothioamides, study of their physical and chemical properties, antimicrobial and antifungal activity. Materials and methods. The chemical names of the compounds are given in accordance with the requirements of the IUPAC nomenclature (1979 and the recommendations of the IUPAC (1993. Study of the physical and chemical properties of 2-(2-((5-(adamantane-1-yl-4-R-1,2,4-triazole-3-ylthioacetyl-N-R1-hydrazine-carbothioamides have been carried out on the certified and licensed equipment in the ZSMU physical-chemical laboratories. The melting temperature was determined by an open capillary method on the Opti Melt MPA 100. The elemental composition of the synthesized compounds was determined on the universal analyzer Elementar Vario L cube (CHNS (standard – sulfanilamide. 1H NMR spectra were recorded on a spectrometer Varian Mercury VX-200 (1H, 200 MHz in dimethylsulfoxide-d6solvent (tetramethylsilane - internal standard and are decoded using ADVASP(tmAnalyzer program (Umatek International Inc.. Chromatographic mass spectral studies were performed on a gas-liquid chromatograph Agilent 1260 Infinity HPLC equipped with an Agilent 6120 mass spectrometer

  5. BubR1 Acts as a Promoter in Cellular Motility of Human Oral Squamous Cancer Cells through Regulating MMP-2 and MMP-9

    Directory of Open Access Journals (Sweden)

    Chou-Kit Chou

    2015-07-01

    Full Text Available BubR1 is a critical component of spindle assembly checkpoint, ensuring proper chromatin segregation during mitosis. Recent studies showed that BubR1 was overexpressed in many cancer cells, including oral squamous cell carcinomas (OSCC. However, the effect of BubR1 on metastasis of OSCC remains unclear. This study aimed to unravel the role of BubR1 in the progression of OSCC and confirm the expression of BubR1 in a panel of malignant OSCC cell lines with different invasive abilities. The results of quantitative real-time PCR showed that the mRNA level of BubR1 was markedly increased in four OSCC cell lines, Ca9-22, HSC3, SCC9 and Cal-27 cells, compared to two normal cells, normal human oral keratinocytes (HOK and human gingival fibroblasts (HGF. Moreover, the expression of BubR1 in these four OSCC cell lines was positively correlated with their motility. Immunofluorescence revealed that BubR1 was mostly localized in the cytosol of human gingival carcinoma Ca9-22 cells. BubR1 knockdown significantly decreased cellular invasion but slightly affect cellular proliferation on both Ca9-22 and Cal-27 cells. Consistently, the activities of metastasis-associated metalloproteinases MMP-2 and MMP-9 were attenuated in BubR1 knockdown Ca9-22 cells, suggesting the role of BubR1 in promotion of OSCC migration. Our present study defines an alternative pathway in promoting metastasis of OSCC cells, and the expression of BubR1 could be a prognostic index in OSCC patients.

  6. Device for neutron flux monitoring in IEA-R1 reactor using rhodium self powered neutron detector; Dispositivo de mapeamento de fluxo de neutron atraves do SPN/Rodio no IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Ricci Filho, Walter; Fernando, Alberto de Jesus; Jerez, Rogerio; Tondin, Julio B.M.; Pasqualetto, Hertz [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    2000-07-01

    The IEA-R1 reactor has undergone a modernization tio increase its operating power to 5 MW, in order to allow a more efficient production of radioisotopes. The objective of this work is to provide the reactor with flux monitoring device using a rhodium self powered neutron detector. Self powered detectors are rugged miniature devices with are increasingly being used for fixed in core reactor monitoring both for safety purposes and flux mapping. The work presents the results obtained with Rhodium-SPND in several irradiation position inside the reactor core. (author)

  7. The C5a/C5aR1 axis controls the development of experimental allergic asthma independent of LysM-expressing pulmonary immune cells.

    Directory of Open Access Journals (Sweden)

    Anna V Wiese

    Full Text Available C5a regulates the development of maladaptive immune responses in allergic asthma mainly through the activation of C5a receptor 1 (C5aR1. Yet, the cell types and the mechanisms underlying this regulation are ill-defined. Recently, we described increased C5aR1 expression in lung tissue eosinophils but decreased expression in airway and pulmonary macrophages as well as in pulmonary CD11b+ conventional dendritic cells (cDCs and monocyte-derived DCs (moDCs during the allergic effector phase using a floxed green fluorescent protein (GFP-C5aR1 knock-in mouse. Here, we determined the role of C5aR1 signaling in neutrophils, moDCs and macrophages for the pulmonary recruitment of such cells and the importance of C5aR1-mediated activation of LysM-expressing cells for the development of allergic asthma. We used LysM-C5aR1 KO mice with a specific deletion of C5aR1 in LysMCre-expressing cells and confirmed the specific deletion of C5aR1 in neutrophils, macrophages and moDCs in the airways and/or the lung tissue. We found that alveolar macrophage numbers were significantly increased in LysM-C5aR1 KO mice. Induction of ovalbumin (OVA-driven experimental allergic asthma in GFP-C5aR1fl/fl and LysM-C5aR1 KO mice resulted in strong but similar airway resistance, mucus production and Th2/Th17 cytokine production. In contrast, the number of airway but not of pulmonary neutrophils was lower in LysM-C5aR1 KO as compared with GFP-C5aR1fl/fl mice. The recruitment of macrophages, cDCs, moDCs, T cells and type 2 innate lymphoid cells was not altered in LysM-C5aR1 KO mice. Our findings demonstrate that C5aR1 is critical for steady state control of alveolar macrophage numbers and the transition of neutrophils from the lung into the airways in OVA-driven allergic asthma. However, C5aR1 activation of LysM-expressing cells plays a surprisingly minor role in the recruitment and activation of such cells and the development of the allergic phenotype in OVA-driven experimental

  8. The architecture of the BubR1 tetratricopeptide tandem repeat defines a protein motif underlying mitotic checkpoint-kinetochore communication

    DEFF Research Database (Denmark)

    Bolanos-Garcia, Victor M; Nilsson, Jakob; Blundell, Tom L

    2012-01-01

    advance to anaphase before every chromosome is properly attached to microtubules of the mitotic spindle. The architecture of the KNL1-BubR1 complex reveals important features of the molecular recognition between SAC components and the kinetochore. The interaction is important for a functional SAC...... as substitution of BubR1 residues engaged in KNL1 binding impaired the SAC and BubR1 recruitment into checkpoint complexes in stable cell lines. Here we discuss the implications of the disorder-to-order transition of KNL1 upon BubR1 binding for SAC signaling and propose a mechanistic model of how BUBs binding may...

  9. Application of safety checklist to the analysis of the IEA-R1 reactor water retreatment system; Utilizacao do checklist de seguranca na analise do sistema de retratamento de agua do reator IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Sauer, Maria Eugenia Lago Jacques; Sara Neto, Antonio Jorge; Lima, Toni Carlos Caboclo de; Ribeiro, Maria Alice Morato [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: melsauer@ipen.br

    2005-07-01

    In 1999, the management of the IEA-R1 Research Reactor (pool type - 5 MWth), located at IPEN/CNEN-SP, started the evaluation of the Reactor Pool Water Retreatment System to identify operational aspects, which could compromise the operators safety. The purpose was to identify and propose enhancements to the system which would be installed to substitute for the existing one. This process was conducted through a qualitative study of the system in operation. This study was carried out by a team composed of specialists in reactor operation, systems maintenance and radiological protection, and one safety analyst. The study consisted, basically, in local inspections to verify the physical and operational conditions of each equipment / component as well as aspects related to maintenance activities of the system. The process control and the operator procedures associated with the retreatment of the reactor pool water were also reviewed. The methodology adopted to develop the study was based in process hazard analysis technique named Safety Checklist. This paper presents a summary of this study and the main results obtained. Some operational and safety problems identified, the prevention and/or correction means to avoid them, and the recommendations and suggestions that have been implemented to the new design of the IEA-R1 Reactor Water Retreatment System, whose installation was concluded in 2003, are also presented. (author)

  10. Circuits design of action logics of the protection system of nuclear reactor IAN-R1 of Colombia; Diseno de los circuitos de la logica de actuacion del sistema de proteccion del reactor nuclear IAN-R1 de Colombia

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez M, J. L.; Rivero G, T.; Sainz M, E., E-mail: joseluis.gonzalez@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2014-10-15

    Due to the obsolescence of the instrumentation and control system of the nuclear research reactor IAN-R1, the Institute of Geology and Mining of Colombia, IngeoMinas, launched an international convoking for renewal it which was won by the Instituto Nacional de Investigaciones Nucleares (ININ). Within systems to design, the reactor protection system is described as important for safety, because this carried out, among others two primary functions: 1) ensuring the reactor shutdown safely, and 2) controlling the interlocks to protect against operational errors if defined conditions have not been met. To fulfill these functions, the various subsystems related to the safety report the state in which they are using binary signals and are connected to the inputs of two redundant logic wiring circuits called action logics (Al) that are part of the reactor protection system. These Al also serve as logical interface to indicate at all times the status of subsystems, both the operator and other systems. In the event that any of the subsystems indicates a state of insecurity in the reactor, the Al generate signals off (or scram) of the reactor, maintaining the interlock until the operator sends a reset signal. In this paper the design, implementation, verification and testing of circuits that make up the Al 1 and 2 of IAN-R1 reactor is described, considering the fulfillment of the requirements that the different international standards imposed on this type of design. (Author)

  11. Application of nondestructive methods for qualification of high density fuels in the IEA-R1 reactor

    International Nuclear Information System (INIS)

    Silva, Jose E.R.; Silva, Antonio T.; Domingos, Douglas B.; Terremoto, Luis A.A.

    2011-01-01

    IPEN/CNEN-SP manufactures fuels to be used in its research reactor - the IEA-R1. To qualify those fuels, it is necessary to check if they have a good performance under irradiation. As Brazil still does not have nuclear research reactors with high neutron fluxes, or suitable hot cells for carrying out post-irradiation examination of nuclear fuels, IPEN/CNEN-SP has conducted a fuel qualification program based on the use of uranium compounds (U 3 O 8 and U 3 Si 2 dispersed in Al matrix) internationally tested and qualified to be used in research reactors, and has attained experience in the technological development stages for the manufacturing of fuel plates, irradiation and non-destructive post-irradiation testing. Fuel elements containing low volume fractions of fuel in the dispersion were manufactured and irradiated successfully directly in the core of the IEA-R1. However, there are plans at IPEN/CNEN-SP to increase the uranium density of the fuels. Ten fuel miniplates (five containing U 3 O 8 -Al and five containing U 3 Si 2 -Al), with densities of 3.2 gU/cm 3 and 4.8 gU/cm 3 respectively, are being irradiated inside an irradiation device placed in a peripheral position of the IEA-R1 core. Non-destructive methods will be used to evaluate irradiation performance of the fuel miniplates after successive cycles of irradiation, by means: monitoring the reactor parameters during operation; periodic underwater visual inspection of fuel miniplates, eventual sipping test for fuel miniplates suspected of leakage and underwater measuring of the miniplate thickness for assessment of the fuel miniplate swelling. (author)

  12. Application of nondestructive methods for qualification of high density fuels in the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Jose E.R.; Silva, Antonio T.; Domingos, Douglas B.; Terremoto, Luis A.A., E-mail: jersilva@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    IPEN/CNEN-SP manufactures fuels to be used in its research reactor - the IEA-R1. To qualify those fuels, it is necessary to check if they have a good performance under irradiation. As Brazil still does not have nuclear research reactors with high neutron fluxes, or suitable hot cells for carrying out post-irradiation examination of nuclear fuels, IPEN/CNEN-SP has conducted a fuel qualification program based on the use of uranium compounds (U{sub 3}O{sub 8} and U{sub 3}Si{sub 2} dispersed in Al matrix) internationally tested and qualified to be used in research reactors, and has attained experience in the technological development stages for the manufacturing of fuel plates, irradiation and non-destructive post-irradiation testing. Fuel elements containing low volume fractions of fuel in the dispersion were manufactured and irradiated successfully directly in the core of the IEA-R1. However, there are plans at IPEN/CNEN-SP to increase the uranium density of the fuels. Ten fuel miniplates (five containing U{sub 3}O{sub 8}-Al and five containing U{sub 3}Si{sub 2}-Al), with densities of 3.2 gU/cm{sup 3} and 4.8 gU/cm{sup 3} respectively, are being irradiated inside an irradiation device placed in a peripheral position of the IEA-R1 core. Non-destructive methods will be used to evaluate irradiation performance of the fuel miniplates after successive cycles of irradiation, by means: monitoring the reactor parameters during operation; periodic underwater visual inspection of fuel miniplates, eventual sipping test for fuel miniplates suspected of leakage and underwater measuring of the miniplate thickness for assessment of the fuel miniplate swelling. (author)

  13. Near-infrared Spectroscopic Observations of Comet C/2013 R1 (Lovejoy) by WINERED: CN Red-system Band Emission

    Energy Technology Data Exchange (ETDEWEB)

    Shinnaka, Yoshiharu; Yasui, Chikako; Izumi, Natsuko [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Kawakita, Hideyo; Kondo, Sohei; Ikeda, Yuji; Kobayashi, Naoto; Hamano, Satoshi; Sameshima, Hiroaki; Fukue, Kei; Matsunaga, Noriyuki; Otsubo, Shogo; Takenaka, Keiichi; Watase, Ayaka; Kawanishi, Takafumi; Nakanishi, Kenshi; Nakaoka, Tetsuya [Laboratory of Infrared High-resolution Spectroscopy, Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Mizumoto, Misaki, E-mail: yoshiharu.shinnaka@nao.ac.jp, E-mail: kawakthd@cc.kyoto-su.ac.jp [Department of Astronomy, School of Science, The University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan)

    2017-08-01

    Although high-resolution spectra of the CN red-system band are considered useful in cometary sciences, e.g., in the study of isotopic ratios of carbon and nitrogen in cometary volatiles, there have been few reports to date due to the lack of high-resolution ( R  ≡  λ /Δ λ  > 20,000) spectrographs in the near-infrared region around ∼1 μ m. Here, we present the high-resolution emission spectrum of the CN red-system band in comet C/2013 R1 (Lovejoy), acquired by the near-infrared high-resolution spectrograph WINERED mounted on the 1.3 m Araki telescope at the Koyama Astronomical Observatory, Kyoto, Japan. We applied our fluorescence excitation models for CN, based on modern spectroscopic studies, to the observed spectrum of comet C/2013 R1 (Lovejoy) to search for CN isotopologues ({sup 13}C{sup 14}N and {sup 12}C{sup 15}N). We used a CN fluorescence excitation model involving both a “pure” fluorescence excitation model for the outer coma and a “fully collisional” fluorescence excitation model for the inner coma region. Our emission model could reproduce the observed {sup 12}C{sup 14}N red-system band of comet C/2013 R1 (Lovejoy). The derived mixing ratio between the two excitation models was 0.94(+0.02/−0.03):0.06(+0.03/−0.02), corresponding to the radius of the collision-dominant region of ∼800–1600 km from the nucleus. No isotopologues were detected. The observed spectrum is consistent, within error, with previous estimates in comets of {sup 12}C/{sup 13}C (∼90) and {sup 14}N/{sup 15}N (∼150).

  14. Ageing implementation and refurbishment development at the IEA-R1 nuclear research reactor: a 15 years experience

    International Nuclear Information System (INIS)

    Cardenas, Jose Patricio N.; Ricci Filho, Walter; Carvalho, Marcos R. de; Berretta, Jose Roberto; Marra Neto, Adolfo

    2011-01-01

    IPEN (Instituto de Pesquisas Energeticas e Nucleares) is a nuclear research center established into the Secretary of Science and Technology from the government of the state of Sao Paulo, and administered both technically and financially by Comissao Nacional de Energia Nuclear (CNEN), a federal government organization under the Ministry of Science and Technology. The institute is located inside the campus of the University of Sao Paulo, Sao Paulo city, Brazil. One of major nuclear facilities at IPEN is the IEA-R1 nuclear research reactor. It is the unique Brazilian research reactor with substantial power level suitable for application with research in physics, chemistry, biology and engineering, as well as radioisotope production for medical and other applications. Designed and built by Babcok-Wilcox, in accordance with technical specifications established by the Brazilian Nuclear Energy Commission, and financed by the US Atoms for Peace Program, it is a swimming pool type reactor, moderated and cooled by light water and uses graphite and beryllium as reflector elements. The first criticality was achieved on September 16, 1957 and the reactor is currently operating at 4.0 MW on a 64h per week cycle. Since 1996, an IEA-R1 reactor ageing study was established at the Research Reactor Center (CRPq) related with general deterioration of components belonging to some operational systems, as cooling towers from secondary cooling system, piping and pumps, sample irradiation devices, radiation monitoring system, fuel elements, rod drive mechanisms, nuclear and process instrumentation and safety operational system. Although basic structures are almost the same as the original design, several improvements and modifications in components, systems and structures had been made along reactor life. This work aims to show the development of the ageing program in the IEA-R1 reactor and the upgrading (modernization) that was carried out, concerning several equipment and system in the

  15. Ageing implementation and refurbishment development at the IEA-R1 nuclear research reactor: a 15 years experience

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Jose Patricio N.; Ricci Filho, Walter; Carvalho, Marcos R. de; Berretta, Jose Roberto; Marra Neto, Adolfo, E-mail: ahiru@ipen.b, E-mail: wricci@ipen.b, E-mail: carvalho@ipen.b, E-mail: jrretta@ipen.b, E-mail: amneto@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    IPEN (Instituto de Pesquisas Energeticas e Nucleares) is a nuclear research center established into the Secretary of Science and Technology from the government of the state of Sao Paulo, and administered both technically and financially by Comissao Nacional de Energia Nuclear (CNEN), a federal government organization under the Ministry of Science and Technology. The institute is located inside the campus of the University of Sao Paulo, Sao Paulo city, Brazil. One of major nuclear facilities at IPEN is the IEA-R1 nuclear research reactor. It is the unique Brazilian research reactor with substantial power level suitable for application with research in physics, chemistry, biology and engineering, as well as radioisotope production for medical and other applications. Designed and built by Babcok-Wilcox, in accordance with technical specifications established by the Brazilian Nuclear Energy Commission, and financed by the US Atoms for Peace Program, it is a swimming pool type reactor, moderated and cooled by light water and uses graphite and beryllium as reflector elements. The first criticality was achieved on September 16, 1957 and the reactor is currently operating at 4.0 MW on a 64h per week cycle. Since 1996, an IEA-R1 reactor ageing study was established at the Research Reactor Center (CRPq) related with general deterioration of components belonging to some operational systems, as cooling towers from secondary cooling system, piping and pumps, sample irradiation devices, radiation monitoring system, fuel elements, rod drive mechanisms, nuclear and process instrumentation and safety operational system. Although basic structures are almost the same as the original design, several improvements and modifications in components, systems and structures had been made along reactor life. This work aims to show the development of the ageing program in the IEA-R1 reactor and the upgrading (modernization) that was carried out, concerning several equipment and system in the

  16. Reactivity-worth estimates of the OSMOSE samples in the MINERVE reactor R1-UO2 configuration.

    Energy Technology Data Exchange (ETDEWEB)

    Klann, R. T.; Perret, G.; Nuclear Engineering Division

    2007-10-03

    An initial series of calculations of the reactivity-worth of the OSMOSE samples in the MINERVE reactor with the R1-UO2 core configuration were completed. The reactor model was generated using the REBUS code developed at Argonne National Laboratory. The calculations are based on the specifications for fabrication, so they are considered preliminary until sampling and analysis have been completed on the fabricated samples. The estimates indicate a range of reactivity effect from -22 pcm to +25 pcm compared to the natural U sample.

  17. Spatial distribution of the neutron flux in the IEA-R1 reactor core obtained by means of foil activation

    International Nuclear Information System (INIS)

    Mestnik Filho, J.

    1979-01-01

    A three-dimensional distribution of the neutron flux in IEA-R1 reactor, obtained by activating gold foils, is presented. The foils of diameter 8mm and thickness 0,013mm were mounted on lucite plates and located between the fuel element plates. Foil activities were measured using a 3x3 inches Nal(Tl) scintilation detector calibrated against a 4πβγ coincidence detector. Foil positions were chosen to minimize the errors of measurement; the overall estimated error on the measured flux is 5%. (Author) [pt

  18. Utilization of the IPR-R1 as a tool in the evaluation of the brazilian uranium reserves

    International Nuclear Information System (INIS)

    Stasiulevicius, R.

    1986-01-01

    The Brazilian uranium ore resources reach an amount of 301,490 metric tons of U 3 O 8 , twenty-seven times more than the known value when NUCLEBRAS was founded, at the end of 1974. In evaluating this reserve, the IPR-R1 research nuclear reactor has given a significant contribution. This reactor has been in operation since 1960 for research, technology, radionuclide production and training purposes. The available irradiation facilities allow the use of neutron-activation to determine uranium contents. Up to now, a total of 330,000 mineral sample analyses were carried out. (Author) [pt

  19. Utilization of the IPR-R1 as a tool in the evaluation of the Brazilian uranium reserves

    International Nuclear Information System (INIS)

    Stasiulevicius, R.

    1986-01-01

    The Brazilian uranium ore resources reach an amount of 301,490 metric tons of U 3 O 8 , twenty-seven times more than the known value when NUCLEBRAS was founded, at the end of 1974. In evaluating this reserve, the IPR-R1 research nuclear reactor has given a significant contribution. This reactor has been in operation since 1960 for research, technology, radionuclide production and training purposes. The evailable irradiation facilities allow the use of neutron-activation to determine uranium contents. Up to now, a total of 330,000 mineral sample analyses were carried out. (Author) [pt

  20. Experiment of IEA-R1 reactor core cooling by air convection after pool water loss accident

    International Nuclear Information System (INIS)

    Torres, Walmir Maximo; Baptista Filho, Benedito Dias

    2000-01-01

    This paper presents a study of a Emergency Core Cooling to be applied to the IEA-R1 reactor. This system must have the characteristics of passive action, with water spraying over the core, and feeding by gravity from elevated reservoirs. In the evaluation, this system must demonstrate that when the reservoirs are emptied, the core cooling must assure to be fulfilled by air natural convection. This work presents the results of temperature distribution in a test section with plates electrically heated simulation the heat generation conditions on the most heated reactor element

  1. Doping of monocrystalline silicon with phosphorus by means of neutron irradiation at the IEA-R1 research reactor

    International Nuclear Information System (INIS)

    Carbonari, A.W.; Puget, M.A.C.

    1990-11-01

    The first neutron irradiation experiments with monocrystal silicon in the IEA-R1 research reactor of IPEN are related. The silicon is irradiated with phosphorus producing a N type semiconductor with a very small resistivity variation throughout the crystal volume. The neutrons induce nuclear reactions in Si-30 isotope and these atoms are then transformed in to phosphorous atoms. This process is known as Neutron Transmutation Doping. In order to irradiate the silicon crystals in the reactor, a specific device has been constructed, and it permits the irradiation of up to 2.5'' diameter monocrystals. (author)

  2. Insertion of reactivity (RIA) without scram in the reactor core IEA-R1 using code PARET

    International Nuclear Information System (INIS)

    Alves, Urias F.; Castrillo, Lazara S.; Lima, Fernando A.

    2013-01-01

    The modeling and analysis thermo hydraulics of a research reactor with MTR type fuel elements - Material Testing Reactor - was performed using the code PARET (Program for the Analysis of Reactor Transients) when in the system some external event is introduced that changed the reactivity in the reactor core. Transients of Reactivity Insertion of 0.5 , 1.5 and 2.0$/ 0.7s in the brazilian reactor IEA-R1 will be presented, and will be shown under what conditions it is possible to ensure the safe operation of its nucleus. (author)

  3. ERK-GluR1 phosphorylation in trigeminal spinal subnucleus caudalis neurons is involved in pain associated with dry tongue.

    Science.gov (United States)

    Nakaya, Yuka; Tsuboi, Yoshiyuki; Okada-Ogawa, Akiko; Shinoda, Masamichi; Kubo, Asako; Chen, Jui Yen; Noma, Noboru; Batbold, Dulguun; Imamura, Yoshiki; Sessle, Barry J; Iwata, Koichi

    2016-01-01

    Dry mouth is known to cause severe pain in the intraoral structures, and many dry mouth patients have been suffering from intraoral pain. In development of an appropriate treatment, it is crucial to study the mechanisms underlying intraoral pain associated with dry mouth, yet the detailed mechanisms are not fully understood. To evaluate the mechanisms underlying pain related to dry mouth, the dry-tongue rat model was developed. Hence, the mechanical or heat nocifensive reflex, the phosphorylated extracellular signal-regulated kinase and phosphorylated GluR1-IR immunohistochemistries, and the single neuronal activity were examined in the trigeminal spinal subnucleus caudalis of dry-tongue rats. The head-withdrawal reflex threshold to mechanical, but not heat, stimulation of the tongue was significantly decreased on day 7 after tongue drying. The mechanical, but not heat, responses of trigeminal spinal subnucleus caudalis nociceptive neurons were significantly enhanced in dry-tongue rats compared to sham rats on day 7. The number of phosphorylated extracellular signal-regulated kinase-immunoreactive cells was also significantly increased in the trigeminal spinal subnucleus caudalis following noxious stimulation of the tongue in dry-tongue rats compared to sham rats on day 7. The decrement of the mechanical head-withdrawal reflex threshold (HWT) was reversed during intracisternal administration of the mitogen-activated protein kinase kinase 1 inhibitor, PD98059. The trigeminal spinal subnucleus caudalis neuronal activities and the number of phosphorylated extracellular signal-regulated kinase-immunoreactive cells following noxious mechanical stimulation of dried tongue were also significantly decreased following intracisternal administration of PD98059 compared to vehicle-administrated rats. Increased number of the phosphorylated GluR1-IR cells was observed in the trigeminal spinal subnucleus caudalis of dry-tongue rats, and the number of phosphorylated GluR1-IR cells

  4. Final report on the IAEA research contracts No. 1194/RB, 1194/R1/RB and 1194/R2/RB

    International Nuclear Information System (INIS)

    Zobor, E.; Janosy, J.S.; Szentgali, A.

    1980-09-01

    The final report summarizes the research activities made in the framework of the IAEA Research Contracts No. 1194/RB, 1194/R1/RB and 1194/R2/RB. A multilevel hierarchical control system is treated which uses weakly-coupled low dimensional subsystems under the supervision of a dynamic coordinator program. This self-organizing adaptive control system was checked by a 5 MW research reactor. As an example the paper describes the experimental computer control system of the 5 MW WWR-SM research reactor, where the reactor power and outlet temperature have been controlled on the basis of the treated control concept since 1978. (author)

  5. Common genetic variations in the CYP2R1 and GC genes are determinants of vitamin D status in Danes

    DEFF Research Database (Denmark)

    Nissen, Ioanna

    Vitamin D is considered a key fat-soluble vitamin critically important for good bone- and overall health throughout life. Vitamin D deficiency increases the risk of developing rickets, osteomalacia and osteoporosis, and moreover increases the risk of various non-skeletal adverse health outcomes......), after 6 months intake of vitamin D3-fortified bread and milk (paper II) and in 92 participants in the VitDgen study after artificial UVB irradiation during winter (paper III). Common genetic variations in the CYP2R1 and GC genes were found to be important determinants of vitamin D status in three out...

  6. Upgrading the electrical system of the IEA-R1 reactor to avoid triggering event of accidents

    International Nuclear Information System (INIS)

    Mello, Jose Roberto de; Madi Filho, Tufic

    2015-01-01

    The IEA-R1 research reactor at the Institute of Energy and Nuclear Research (IPEN) is a research reactor open pool type, built and designed by the American firm 'Babcox and Wilcox', having as coolant and moderator demineralized light water and Beryllium and graphite, as reflectors. The power supply system is designed to meet the electricity demand required by the loads of the reactor (Security systems and systems not related to security) in different situations the plant can meet, such as during startup, normal operation at power, shutdown, maintenance, exchange of fuel elements and accident situations. Studies have been done on possible accident initiating events and deterministic techniques were applied to assess the consequences of such incidents. Thus, the methods used to identify and select the accident initiating events, the methods of analysis of accidents, including sequence of events, transient analysis and radiological consequences, have been described. Finally, acceptance criteria of radiological doses are described. Only a brief summary of the item concerning loss of electrical power will be presented. The loss of normal electrical power at the IEA-R1 reactor is very common. In the case of Electric External Power Loss, at the IEA-R1 reactor building, there may be different sequences of events, as described below. When the supply of external energy in the IEA-R1 facility fails, the Electrical Distribution Vital System, consisting of 4 (four) generators type 'UPS', starts operation, immediately and it will continue supplying power to the reactor control table, core cooling system and other security systems. To contribute to security, in the electric power failure, starts to operate the Emergency Cooling System (SRE). SRE has the function of removing residual heat from the core to prevent the melting of fuel elements in the event of loss of refrigerant to the core. Adding to the generators with batteries group system, new auxiliary

  7. Justify of implementation of a hot water layer system in swimming pool research reactor IEA-R1m

    International Nuclear Information System (INIS)

    Toyoda, Eduardo Yoshio; Gordon, Ana Maria Pinho Leite; Sordi, Gian-Maria A.A.

    2001-01-01

    The IPEN/CNEN-SP has a swimming pool research reactor (IEA-R1m) in operation since 1957 at 2 MW. In 1998, after some modifications, its nominal power increased to 5 MW. Among these modifications some adaptations had to be accomplished in the radiological protection and operational procedure. The present work aim to study the need of implementation of a hot water layer in order to reduce the dose in the workers in the vicinity of the reactor swimming pool. Applying the principles of radioprotection optimization, it was concluded that the decision of the construction of one hot water layer system in the reactor swimming pool, is not necessary. (author)

  8. Measurement of thermal, epithermal and fast neutron flux in the IEA-R1 reactor by the foil activation method

    International Nuclear Information System (INIS)

    Koskinas, M.F.

    1979-01-01

    Experimental and theoretical details of the foil activation method applied to neutrons flux measurements at the IEA-R1 reactor are presented. The thermal - and epithermal - neutron flux were determined form activation measurements of gold, cobalt and manganese foils; and for the fast neutron flux determination, aluminum, iron and nickel foils were used. The measurements of the activity induced in the metal foils were performed using a Ge-Li gamma spectrometry system. In each energy range of the reactor neutron spectrum, the agreement among the experimental flux values obtained using the three kind of materials, indicates the consistency of the theoretical approach and of the nuclear parameters selected. (Author) [pt

  9. Hazard and operability study (Haz Op) of the 2 MW IEA-R1 reactor startup procedures

    International Nuclear Information System (INIS)

    Sauer, Maria E.L.J.; Correa, Francisco; Sara Neto, Antonio J.; Costa, Carlos A.R. da; Santos, Cilas C. dos; Cardenas, Jose P.N.; Berretta, Jose R.; Neves Conti, Thadeu das

    1997-01-01

    This work presents the Hazard and Operability Study (Haz Op) applied to startup procedures of the 2 MW IEA-R1 research reactor, at IPEN/CNEN-S P. The Haz Op was developed by reviewing the procedures of the installation startup, in order to identify hazards and/or operational problems caused by deviations in the execution of these routines. This paper summarizes this study. describing some potential problems of relevant importance to safety as well as preventives and/or correctives measures to avoid their occurrence. Besides, an benefits evaluation and the technique limitations is made. (author). 5 refs., 1 tab

  10. Growth hormone secretagogue receptor (GHS-R1a) knockout mice exhibit improved spatial memory and deficits in contextual memory.

    Science.gov (United States)

    Albarran-Zeckler, Rosie G; Brantley, Alicia Faruzzi; Smith, Roy G

    2012-06-15

    Although the hormone ghrelin is best known for its stimulatory effect on appetite and regulation of growth hormone release, it is also reported to have beneficial effects on learning and memory formation in mice. Nevertheless, controversy exists about whether endogenous ghrelin acts on its receptors in extra-hypothalamic areas of the brain. The ghrelin receptor (GHS-R1a) is co-expressed in neurons that express dopamine receptor type-1 (DRD1a) and type-2 (DRD2), and we have shown that a subset of GHS-R1a, which are not occupied by the agonist (apo-GHSR1a), heterodimerize with these two receptors to regulate dopamine signaling in vitro and in vivo. To determine the consequences of ghsr ablation on brain function, congenic ghsr -/- mice on the C57BL6/J background were subjected to a battery of behavioral tests. We show that the ghsr -/- mice exhibit normal balance, movement, coordination, and pain sensation, outperform ghsr +/+ mice in the Morris water maze, but show deficits in contextual fear conditioning. Copyright © 2012 Elsevier B.V. All rights reserved.

  11. Analysis of the IEA-R1 reactor start-up procedures - an application of the HazOp method

    International Nuclear Information System (INIS)

    Sauer, Maria Eugenia Lago Jacques

    2000-01-01

    An analysis of technological catastrophic events that took place in this century shows that human failure and vulnerability of risk management programs are the main causes for the occurrence of accidents. As an example, plants and complex systems where the interface man-machine is close, the frequency of failures tends to be higher. Thus, a comprehensive knowledge of how a specific process can be potentially hazardous is a sine qua non condition to the operators training, as well as to define and implement more efficient plans for loss prevention and risk management. A study of the IEA-R1 research reactor start-up procedures was carried out, based upon the methodology Hazard and Operability Study (HazOp). The analytical and qualitative multidisciplinary HazOp approach provided means to a comprehensive review of the reactor start-up procedures, contributing to improve the understanding of the potential hazards associated to deviations on performing this routine. The present work includes a historical summary and a detailed description of the HazOp technique, as well as case studies in the process industries and the use of expert systems in the application of the method. An analysis of 53 activities of the IEA-R1 reactor start-up procedures was made, resulting in 25 recommendations of changes covering aspects of the project, operation and safety of the reactor. Eleven recommendations have been implemented. (author)

  12. Shock-front compression of the magnetic field in the Canis Majoris R1 star-formation region

    International Nuclear Information System (INIS)

    Vrba, F.J.; Baierlein, R.; Herbst, W.; Wesleyan Univ., Middletown, CT; Van Vleck Observatory, Middletown, CT)

    1987-01-01

    Results are presented from a linear polarization survey at optical wavelengths of over 140 stars in the direction of the CMa R1 star-formation region; 26 of these are clearly associated with nebulosity within the area. The observations were obtained in order to test the argument of Herbst et al. (1978) that star formation in CMa R1 is driven by a shock wave from a nearby supernova (Herbs and Assousa, 1977 and 1978). The polarizations are found to be consistent with a simple model of the compression by a supernova-induced spherical shock front of an initially uniform interstellar magnetic field. The polarization vectors are inconsistent with a scenario of quiescent cloud collapse along magnetic-field lines. Multicolor polarimetry of the nebular stars provides evidence of grain growth toward increasing cloud optical depth, characterized by a ratio of total-to-selective extinction of R = 3.0 at E(B-V) = 0.23, increasing to R = 4.2 at E(B-V) = 0.7. 15 references

  13. IL18 and IL18R1 polymorphisms, lung CT and fibrosis: a longitudinal study in coal miners

    Energy Technology Data Exchange (ETDEWEB)

    Nadif, R.; Mintz, M.; Marzec, J.; Jedlicka, A.; Kauffmann, F.; Kleeberger, S.R. [INSERM, U780, Villejuif (France)

    2006-12-15

    It has been suggested that interleukin (IL)-18 plays a role in the development of inflammatory and fibrosing lung diseases. Associations of polymorphisms in the genes coding for IL-18 (108 /G-656T, C-607A, G-137C, T113G, C127T) and its receptor (IL8R1/C-69T) with coal workers' pneumoconiosis (CWP) were studied in 200 miners who were examined in 1990, 1994 and 1999. Coal-dust exposure was assessed according to job history and ambient measures. The main health outcome was lung computed tomography (CT) score in 1990. Internal coherence was assessed by studying CT score in 1994, 4-yr change in CT score and CWP incidence and prevalence. CT score in 1990 was a good predictor of radiographic grade in 1999 and, therefore, an appropriate subclinical quantitative trait. The IL18 -137C allele was associated with lower CT score in 1990 and 1994 (11.24 versus 1.69 and 1.57 versus 2.46, respectively), slower progression of CT score between 1990 and 1994 and lower pneumoconiosis prevalence in 1999 relative to the G allele (0.33 versus 0.77 and 8.2 versus 19.6%, respectively). Smoking- or dust-adjustment, and stratification on IL18R1 genotype and adjustment for haplotype effects did not change the conclusions. In conclusion, the results of the present study suggest a role for IL18 in reducing the development of this fibrosing lung disease.

  14. Application of safety checklist to the analysis of the IEA-R1 reactor water retreatment system

    International Nuclear Information System (INIS)

    Sauer, Maria Eugenia Lago Jacques; Sara Neto, Antonio Jorge; Lima, Toni Carlos Caboclo de; Ribeiro, Maria Alice Morato

    2005-01-01

    In 1999, the management of the IEA-R1 Research Reactor (pool type - 5 MWth), located at IPEN/CNEN-SP, started the evaluation of the Reactor Pool Water Retreatment System to identify operational aspects, which could compromise the operators safety. The purpose was to identify and propose enhancements to the system which would be installed to substitute for the existing one. This process was conducted through a qualitative study of the system in operation. This study was carried out by a team composed of specialists in reactor operation, systems maintenance and radiological protection, and one safety analyst. The study consisted, basically, in local inspections to verify the physical and operational conditions of each equipment / component as well as aspects related to maintenance activities of the system. The process control and the operator procedures associated with the retreatment of the reactor pool water were also reviewed. The methodology adopted to develop the study was based in process hazard analysis technique named Safety Checklist. This paper presents a summary of this study and the main results obtained. Some operational and safety problems identified, the prevention and/or correction means to avoid them, and the recommendations and suggestions that have been implemented to the new design of the IEA-R1 Reactor Water Retreatment System, whose installation was concluded in 2003, are also presented. (author)

  15. Measurement and calculation of spatial and energetic neutron flux in the IEA-R1 reactor core

    International Nuclear Information System (INIS)

    Bittelli, U.D.

    1988-01-01

    This work presents spatial and energetic flux distribution measured in the IEA-R1 reactor core. The thermal neutron flux was measured by gold activation foils (bare and covered with cadmium) in the fuel element number 108 (reaction: 197 Au(n,γ) 198 Au) at 451W overall reactor power. The fast neutron flux was measured by indium activation foils (reaction: 115 In(n,n') 115m In) in the fuel elements number 94 at 4510W overall reactor power. The neutron energy spectrum was adjusted by SAND II code with the data produced by the irradiation of seven activation detectors in the fuel element number 94 at 4510 W overall reactor power. The following reactions were used: 58 Fe(n,γ) 59 Fe, 232 Th(n,γ) 233 Th, 197 Au(n,γ) 198 Au, 59 Co(n,γ) 60 Co, 54 Fe(n,p) 54 Mn, 24 Mg(n,p) 24 Na, 47 Ti(n,p) 47 Sc, 48 Ti(n,p) 48 Sc and 115 In(n,n') 115m In. The experimental results compared to those obtained by CITATION (spatial distribution flux) and HAMMER (energetic distribution flux) code, showed good agreement. The results presented in this work are a good contribution for a better knowledge of spatial and energetic neutron flux distribution in the IEA-R1 reactor core, besides that the experimental procedure is easily applicable to another situations. (autor) [pt

  16. Bacillus licheniformis BlaR1 L3 Loop Is a Zinc Metalloprotease Activated by Self-Proteolysis

    Science.gov (United States)

    Sépulchre, Jérémy; Amoroso, Ana; Joris, Bernard

    2012-01-01

    In Bacillus licheniformis 749/I, BlaP β-lactamase is induced by the presence of a β-lactam antibiotic outside the cell. The first step in the induction mechanism is the detection of the antibiotic by the membrane-bound penicillin receptor BlaR1 that is composed of two functional domains: a carboxy-terminal domain exposed outside the cell, which acts as a penicillin sensor, and an amino-terminal domain anchored to the cytoplasmic membrane, which works as a transducer-transmitter. The acylation of BlaR1 sensor domain by the antibiotic generates an intramolecular signal that leads to the activation of the L3 cytoplasmic loop of the transmitter by a single-point cleavage. The exact mechanism of L3 activation and the nature of the secondary cytoplasmic signal launched by the activated transmitter remain unknown. However, these two events seem to be linked to the presence of a HEXXH zinc binding motif of neutral zinc metallopeptidases. By different experimental approaches, we demonstrated that the L3 loop binds zinc ion, belongs to Gluzincin metallopeptidase superfamily and is activated by self-proteolysis. PMID:22623956

  17. Circuits design of action logics of the protection system of nuclear reactor IAN-R1 of Colombia

    International Nuclear Information System (INIS)

    Gonzalez M, J. L.; Rivero G, T.; Sainz M, E.

    2014-10-01

    Due to the obsolescence of the instrumentation and control system of the nuclear research reactor IAN-R1, the Institute of Geology and Mining of Colombia, IngeoMinas, launched an international convoking for renewal it which was won by the Instituto Nacional de Investigaciones Nucleares (ININ). Within systems to design, the reactor protection system is described as important for safety, because this carried out, among others two primary functions: 1) ensuring the reactor shutdown safely, and 2) controlling the interlocks to protect against operational errors if defined conditions have not been met. To fulfill these functions, the various subsystems related to the safety report the state in which they are using binary signals and are connected to the inputs of two redundant logic wiring circuits called action logics (Al) that are part of the reactor protection system. These Al also serve as logical interface to indicate at all times the status of subsystems, both the operator and other systems. In the event that any of the subsystems indicates a state of insecurity in the reactor, the Al generate signals off (or scram) of the reactor, maintaining the interlock until the operator sends a reset signal. In this paper the design, implementation, verification and testing of circuits that make up the Al 1 and 2 of IAN-R1 reactor is described, considering the fulfillment of the requirements that the different international standards imposed on this type of design. (Author)

  18. Experimental study of the temperature distribution in the TRIGA IPR-R1 Brazilian research reactor; Investigacao experimental da distribuicao de temperaturas no reator nuclear de pesquisa TRIGA IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Zacarias

    2005-07-01

    The TRIGA-IPR-R1 Research Nuclear Reactor has completed 44 years in operation in November 2004. Its initial nominal thermal power was 30 kW. In 1979 its power was increased to 100 kW by adding new fuel elements to the reactor. Recently some more fuel elements were added to the core increasing the power to 250 kW. The TRIGA-IPR-R1 is a pool type reactor with a natural circulation core cooling system. Although the large number of experiments had been carried out with this reactor, mainly on neutron activation analysis, there is not many data on its thermal-hydraulics processes, whether experimental or theoretical. So a number of experiments were carried out with the measurement of the temperature inside the fuel element, in the reactor core and along the reactor pool. During these experiments the reactor was set in many different power levels. These experiments are part of the CDTN/CNEN research program, and have the main objective of commissioning the TRIGA-IPR-R1 reactor for routine operation at 250 kW. This work presents the experimental and theoretical analyses to determine the temperature distribution in the reactor. A methodology for the calibration and monitoring the reactor thermal power was also developed. This methodology allowed adding others power measuring channels to the reactor by using thermal processes. The fuel thermal conductivity and the heat transfer coefficient from the cladding to the coolant were also experimentally valued. lt was also presented a correlation for the gap conductance between the fuel and the cladding. The experimental results were compared with theoretical calculations and with data obtained from technical literature. A data acquisition and processing system and a software were developed to help the investigation. This system allows on line monitoring and registration of the main reactor operational parameters. The experiments have given better comprehension of the reactor thermal-fluid dynamics and helped to develop numerical

  19. Transgenic wheat expressing Thinopyrum intermedium MYB transcription factor TiMYB2R-1 shows enhanced resistance to the take-all disease.

    Science.gov (United States)

    Liu, Xin; Yang, Lihua; Zhou, Xianyao; Zhou, Miaoping; Lu, Yan; Ma, Lingjian; Ma, Hongxiang; Zhang, Zengyan

    2013-05-01

    The disease take-all, caused by the fungus Gaeumannomyces graminis, is one of the most destructive root diseases of wheat worldwide. Breeding resistant cultivars is an effective way to protect wheat from take-all. However, little progress has been made in improving the disease resistance level in commercial wheat cultivars. MYB transcription factors play important roles in plant responses to environmental stresses. In this study, an R2R3-MYB gene in Thinopyrum intermedium, TiMYB2R-1, was cloned and characterized. The gene sequence includes two exons and an intron. The expression of TiMYB2R-1 was significantly induced following G. graminis infection. An in vitro DNA binding assay proved that TiMYB2R-1 protein could bind to the MYB-binding site cis-element ACI. Subcellular localization assays revealed that TiMYB2R-1 was localized in the nucleus. TiMYB2R-1 transgenic wheat plants were generated, characterized molecularly, and evaluated for take-all resistance. PCR and Southern blot analyses confirmed that TiMYB2R-1 was integrated into the genomes of three independent transgenic wheat lines by distinct patterns and the transgene was heritable. Reverse transcription-PCR and western blot analyses revealed that TiMYB2R-1 was highly expressed in the transgenic wheat lines. Based on disease response assessments for three successive generations, the significantly enhanced resistance to take-all was observed in the three TiMYB2R-1-overexpressing transgenic wheat lines. Furthermore, the transcript levels of at least six wheat defence-related genes were significantly elevated in the TiMYB2R-1 transgenic wheat lines. These results suggest that engineering and overexpression of TiMYB2R-1 may be used for improving take-all resistance of wheat and other cereal crops.

  20. Ionotropic Glutamate Receptor GluR1 in the Visual Cortex of Hamster: Distribution and Co-Localization with Calcium-Binding Proteins and GABA

    International Nuclear Information System (INIS)

    Ye, Eun-Ah; Kim, Tae-Jin; Choi, Jae-Sik; Jin, Mi-Joo; Jeon, Young-Ki; Kim, Moon-Sook; Jeon, Chang-Jin

    2006-01-01

    The subunit composition of the AMPA receptor is critical to its function. AMPA receptors that display very low calcium permeability include the GluR2 subunit, while AMPA receptors that contain other subunits, such as GluR1, display high calcium permeability. We have studied the distribution and morphology of neurons containing GluR1 in the hamster visual cortex with antibody immunocytochemistry. We compared this labeling to that for calbindin D28K, parvalbumin, and GABA. Anti-GluR1-immunoreactive (IR) neurons were located in all layers. The highest density of GluR1-IR neurons was found in layers II/III. The labeled neurons were non-pyramidal neurons, but were varied in morphology. The majority of the labeled neurons were round or oval cells. However, stellate, vertical fusiform, pyriform, and horizontal neurons were also labeled with the anti-GluR1 antibody. Two-color immunofluorescence revealed that many of the GluR1-IR neurons in the hamster visual cortex were double-labeled with either calbindin D28K (31.50%), or parvalbumin (22.91%), or GABA (63.89%). These results indicate that neurons in the hamster visual cortex express GluR1 differently according to different layers and selective cell types, and that many of the GluR1-IR neurons are limited to neurons that express calbindin D28K, parvalbumin, or GABA. The present study elucidates the neurochemical structure of GluR1, a useful clue in understanding the differential vulnerability of GluR1-containing neurons with regard to calcium-dependent excitotoxic mechanisms

  1. Development of methodology for characterization of cartridge filters from the IEA-R1 using the Monte Carlo method; Desenvolvimento de uma metodologia para caracterizacao do filtro cuno do reator IEA-R1 utilizando o Metodo Monte Carlo

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila

    2014-07-01

    The Cuno filter is part of the water processing circuit of the IEA-R1 reactor and, when saturated, it is replaced and becomes a radioactive waste, which must be managed. In this work, the primary characterization of the Cuno filter of the IEA-R1 nuclear reactor at IPEN was carried out using gamma spectrometry associated with the Monte Carlo method. The gamma spectrometry was performed using a hyperpure germanium detector (HPGe). The germanium crystal represents the detection active volume of the HPGe detector, which has a region called dead layer or inactive layer. It has been reported in the literature a difference between the theoretical and experimental values when obtaining the efficiency curve of these detectors. In this study we used the MCNP-4C code to obtain the detector calibration efficiency for the geometry of the Cuno filter, and the influence of the dead layer and the effect of sum in cascade at the HPGe detector were studied. The correction of the dead layer values were made by varying the thickness and the radius of the germanium crystal. The detector has 75.83 cm{sup 3} of active volume of detection, according to information provided by the manufacturer. Nevertheless, the results showed that the actual value of active volume is less than the one specified, where the dead layer represents 16% of the total volume of the crystal. A Cuno filter analysis by gamma spectrometry has enabled identifying energy peaks. Using these peaks, three radionuclides were identified in the filter: {sup 108m}Ag, {sup 110m}Ag and {sup 60}Co. From the calibration efficiency obtained by the Monte Carlo method, the value of activity estimated for these radionuclides is in the order of MBq. (author)

  2. X-ray sources associated with young stellar objects in the star formation region CMa R1

    Science.gov (United States)

    Santos-Silva, Thais; Gregorio-Hetem, Jane; Montmerle, Thierry

    2013-07-01

    In previous works we studied the star formation scenario in the molecular cloud Canis Major R1 (CMa R1), derived from the existence of young stellar population groups near the Be stars Z CMa and GU CMa. Using data from the ROSAT X-ray satellite, having a field-of-view of ~ 1° in diameter, Gregorio-Hetem et al. (2009) discovered in this region young stellar objects mainly grouped in two clusters of different ages, with others located in between. In order to investigate the nature of these objects and to test a possible scenario of sequential star formation in this region, four fields (each 30 arcmin diameter, with some overlap) have been observed with the XMM-Newton satellite, with a sensitivity about 10 times better than ROSAT. The XMM-Newton data are currently under analysis. Preliminary results indicate the presence of about 324 sources, most of them apparently having one or more near-infrared counterparts showing typical colors of young stars. The youth of the X-ray sources was also confirmed by X-ray hardness ratio diagrams (XHRD), in different energy bands, giving an estimate of their Lx/Lbol ratios. In addition to these results, we present a detailed study of the XMM field covering the cluster near Z CMa. Several of these sources were classified as T Tauri and Herbig Ae/Be stars, using optical spectroscopy obtained with Gemini telescopes, in order to validate the use of XHRD applied to the entire sample. This classification is also used to confirm the relation between the luminosities in the near-infrared and X-ray bands expected for the T Tauri stars in CMa R1. In the present work we show the results of the study based on the spectra of about 90 sources found nearby Z CMa. We checked that the X-ray spectra (0.3 to 10 keV) of young objects is different from that observed in field stars and extragalactic objects. Some of the candidates also have light curve showing flares that are typical of T Tauri stars, which confirms the young nature of these X

  3. Calcium-Dependent Energetics of Calmodulin Domain Interactions with Regulatory Regions of the Ryanodine Receptor Type 1 (RyR1)

    Science.gov (United States)

    Newman, Rhonda A.; Sorensen, Brenda R.; Kilpatrick, Adina M.; Shea, Madeline A.

    2014-01-01

    Calmodulin (CaM) plays a vital role in calcium homeostasis by allosterically modulating intracellular calcium channels including the homo-tetrameric human Ryanodine Receptor Type 1 (hRyR1). Apo (calcium-free) CaM activates hRyR1 while calcium-saturated CaM inhibits it. Two CaM-binding regions (residues 1975–1999 and 3614–3643) identified in each RyR1 monomer were proposed to allow CaM to bridge adjacent RyR1 subunits. We explored the distinct roles of CaM domains by using fluorescence anisotropy to determine the affinity of CaM1–148 (full-length), CaM1–80 (N-domain) and CaM76–148 (C-domain) for peptides encompassing hRyR1 residues 1975–1999 or 3614–3643. Both CaM1–148 and CaM76–148 associated in a calcium-independent manner with similar affinities for hRyR1(3614–3643)p while CaM1–80 required calcium and bound ~250-fold more weakly. Association of CaM1–148, CaM1–80 and CaM76–148 with hRyR1(1975–1999)p was much less favorable than with hRyR1(3614–3643)p; differences between the two CaM domains were smaller. Equilibrium calcium titrations monitored by steady-state fluorescence demonstrated that both hRyR1 peptides increased the calcium-binding affinity of both CaM domains. These thermodynamic properties support a prior model in which the CaM C-domain associates with RyR1(3614–3643) at low levels of calcium, positioning CaM to rapidly respond to calcium efflux. However, the affinity of the N-domain of CaM for hRyR1(1975–1999)p is insufficient to explain a model in which CaM bridges adjacent RyR1 subunits within the tetramer. This indicates that other protein factors or properties of the tertiary or quaternary structure of hRyR1 contribute to the energetics of CaM-mediated regulation. PMID:25145833

  4. Real time monitoring system of the operation variables of the TRIGA IPR-R1 nuclear research reactor

    International Nuclear Information System (INIS)

    Ricardo, Carla Pereira; Mesquita, Amir Zacarias

    2007-01-01

    During the last two years all the operation parameters of the TRIGA IPR-R1 were monitored and real time indicated bu the data acquisition system developed for the reactor. All the information were stored on a rigid disk, at the collection system computer, leaving the information on the reactor performance and behaviour available for consultation in a chronological order. The data acquisition program has been updated and new reactor operation parameters were included for increasing the investigation and experiments possibilities. The register of reactor operation variables are important for the immediate or subsequent safety analyses for reporting the reactor operations to the external organizations. This data acquisition satisfy the IAEA recommendations. (author)

  5. A simple approach to solving the kinematics of the 4-UPS/PS (3R1T) parallel manipulator

    Energy Technology Data Exchange (ETDEWEB)

    Gallardo-Alvarado, Jaime; Gracio-Murillo, Mario A. [Instituto Tecnologico de Celaya, Celaya (Mexico); Islam, Md. Nazrul [Universiti Malasya Sabah, Sabah (Malaysia); Abedinnasab, Mohammad H. [Rowan University, New Jersey (United States)

    2016-05-15

    This work reports on the position, velocity and acceleration analyses of a four-degrees-of-freedom parallel manipulator, 4-DoF-PM for brevity, which generates Three-rotation-one-translation (3R1T) motion. Nearly closed-form solutions to solve the forward displacement analysis are easily obtained based on closure equations formulated upon linear combinations of the coordinates of three non-collinear points embedded in the moving platform. Then, the input-output equations of velocity and acceleration of the robot manipulator are systematically established by resorting to the theory of screws. To this end, the Klein form of the Lie algebra se(3) of the Euclidean group SE(3) is systematically applied to the velocity and reduced acceleration state in screw form of the moving platform cancelling the passive joint rates of the parallel manipulator. Numerical examples, which are confirmed by means of commercially available software, are provided to show the application of the method.

  6. FALCAO - a relational database to storaging the variables monitored in the research reactor IEA-R1

    International Nuclear Information System (INIS)

    Gomes Neto, Jose; Andrade, Delvonei Alves de

    2007-01-01

    The objective of this work is to introduce all initial steps for the creation of a relational database, named FALCAO, to support the storaging of the monitored variables in the IEA-R1 research reactor, located in the Instituto de Pesquisas Energeticas e Nucleares, IPEN-CNEN/SP. As introduction, it is considered the modeling importance of the logic diagram and its direct influence in the integrity of the provided information. It is presented the concepts and steps of normalization and denormalization including the entities and relations involved in the logical model. It is also presented the effects of the model rules in the acquisition, loading and availability of the final information, under the performance concept, since the acquisition process, loads and provides lots of information in small intervals of time. The data logical model, considering the desired performance and the sharing information is also presented. (author)

  7. Preliminary analysis of control rod accidents in the CRCN-R1 multipurpose reactor core of Recife in Brazil

    International Nuclear Information System (INIS)

    Souza dos Santos, Rubens; Rubens Maiorino, Jose

    1999-01-01

    The paper shows some results of the neutronic accident analyses arisen by uncontrolled control rod withdrawal, based on the Conceptual Project of the CRCN-R1 MultiPurpose Reactor of Recife. In that reactor, a project of the CNEN/Brazil, under the leadership of the IPEN/Sao Paulo, is verified the thermal hydraulic limits in the reactor core during transients that simulate startup and power operation accidents. It has utilized a computer program that solved the kinetic equations based on multigroup diffusion theory, in our case we have used 4 energy groups, Two-Dimensional X-Y in the space, and 6 groups of delayed neutrons. A simple model of feedback is admitted in the capture and scattering macroscopic cross sections, in the fuel regions, temperature and coolant densities dependents. Based on those models, the results demonstrated that the reactor exhibits good degree of safety. (author)

  8. International benchmark study of advanced thermal hydraulic safety analysis codes against measurements on IEA-R1 research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Hainoun, A., E-mail: pscientific2@aec.org.sy [Atomic Energy Commission of Syria (AECS), Nuclear Engineering Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Doval, A. [Nuclear Engineering Department, Av. Cmdt. Luis Piedrabuena 4950, C.P. 8400 S.C de Bariloche, Rio Negro (Argentina); Umbehaun, P. [Centro de Engenharia Nuclear – CEN, IPEN-CNEN/SP, Av. Lineu Prestes 2242-Cidade Universitaria, CEP-05508-000 São Paulo, SP (Brazil); Chatzidakis, S. [School of Nuclear Engineering, Purdue University, West Lafayette, IN 47907 (United States); Ghazi, N. [Atomic Energy Commission of Syria (AECS), Nuclear Engineering Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Park, S. [Research Reactor Design and Engineering Division, Basic Science Project Operation Dept., Korea Atomic Energy Research Institute (Korea, Republic of); Mladin, M. [Institute for Nuclear Research, Campului Street No. 1, P.O. Box 78, 115400 Mioveni, Arges (Romania); Shokr, A. [Division of Nuclear Installation Safety, Research Reactor Safety Section, International Atomic Energy Agency, A-1400 Vienna (Austria)

    2014-12-15

    Highlights: • A set of advanced system thermal hydraulic codes are benchmarked against IFA of IEA-R1. • Comparative safety analysis of IEA-R1 reactor during LOFA by 7 working teams. • This work covers both experimental and calculation effort and presents new out findings on TH of RR that have not been reported before. • LOFA results discrepancies from 7% to 20% for coolant and peak clad temperatures are predicted conservatively. - Abstract: In the framework of the IAEA Coordination Research Project on “Innovative methods in research reactor analysis: Benchmark against experimental data on neutronics and thermal hydraulic computational methods and tools for operation and safety analysis of research reactors” the Brazilian research reactor IEA-R1 has been selected as reference facility to perform benchmark calculations for a set of thermal hydraulic codes being widely used by international teams in the field of research reactor (RR) deterministic safety analysis. The goal of the conducted benchmark is to demonstrate the application of innovative reactor analysis tools in the research reactor community, validation of the applied codes and application of the validated codes to perform comprehensive safety analysis of RR. The IEA-R1 is equipped with an Instrumented Fuel Assembly (IFA) which provided measurements for normal operation and loss of flow transient. The measurements comprised coolant and cladding temperatures, reactor power and flow rate. Temperatures are measured at three different radial and axial positions of IFA summing up to 12 measuring points in addition to the coolant inlet and outlet temperatures. The considered benchmark deals with the loss of reactor flow and the subsequent flow reversal from downward forced to upward natural circulation and presents therefore relevant phenomena for the RR safety analysis. The benchmark calculations were performed independently by the participating teams using different thermal hydraulic and safety

  9. Development of an emergency core cooling system for the converted IEA-R1m research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Torres, Walmir Maximo; Baptista Filho, Benedito Dias; Ting, Daniel Kao Sun [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Dept. de Tecnologia de Reatores]. E-mail: wmtorres@net.ipen.br; bdbfilho@net.ipen.br; dksting@net.ipen.br

    1998-07-01

    This present work describes the development program carried out in the design and construction of the Emergency Core Cooling System for the IEA-R1m Research Reactor, including the system design, the experiments performed to validate the design, manufacturing, installation and commissioning. The experiments were performed in two phases. In the first phase, the spray flow rate and distribution were measured, using a full scale mock-up of the entire core, to establish the spray header geometry and specifications. In the second phase, a test section was fitted with electrically heated plates to simulate the fuel plates. Temperature measurements were carried out to demonstrate the effectiveness of the system to keep the temperatures below the limiting value. The experimental results were shown to the licensing authorities during the certification process. The main difficulties during the system assembly are also described. (author)

  10. Transient cases analyses of the TRIGA IPR-R1 using thermal hydraulic and neutron kinetic coupled codes

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Patricia A.L.; Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Scari, Maria E., E-mail: patricialire@yahoo.com.br, E-mail: antonella@nuclear.ufmg.br, E-mail: claubia@nuclear.ufmg.br, E-mail: dora@nuclear.ufmg.br, E-mail: melizabethscari@yahoo.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Instituto Nacional de Ciencias e Tecnologia de Reatores Nucleares Inovadores (INCT/CNPq), Belo Horizonte (Brazil); Miro, Rafael; Verdu, Gumersindo, E-mail: rmiro@iqn.upv.es, E-mail: gverdu@iqn.upv.es [Universidad Politecnica de Valencia (Spain). Departamento de Ingenieria Quimica y Nuclear

    2015-07-01

    Simulations and analyses of nuclear reactors have been improved by utilization of coupled thermal-hydraulic (TH) and neutron kinetics (NK) system codes especially to simulate transients that involve strong feedback effects between NK and TH. The TH-NK coupling technique was initially developed and used to simulate the behavior of power reactors; however, several coupling methodologies are now being applied for research reactors. This work presents the coupling methodology application between RELAP5 and PARCS codes using as a model the TRIGA IPR-R1 research reactor. Analyses of steady state and transient conditions and comparisons with results from simulations using only the RELAP5 code are being presented in this paper. (author)

  11. Criticality analysis of the storage tubes for irradiated fuel elements from the IEA-R1 with the MCNP code

    International Nuclear Information System (INIS)

    Maragni, M.G.; Moreira, J.M.L.

    1992-01-01

    A criticality safety analysis has been carried out for the storage tubes for irradiated fuel elements from the IEA-R1 research reactor. The analysis utilized the MCNP computer code which allows exact simulations of complex geometries. Aiming reducing the amount of input data, the fuel element cross-sections have been spatially smeared out. The earth material interstice between fuel elements has been approximated conservatively as concrete because its composition was unknown. The storage tubes have been found subcritical for the most adverse conditions (water flooding and un-irradiated fuel elements). A similar analysis with the KENO-IV computer code overestimated the KEF result but still confirmed the criticality safety of the storage tubes. (author)

  12. A simple approach to solving the kinematics of the 4-UPS/PS (3R1T) parallel manipulator

    International Nuclear Information System (INIS)

    Gallardo-Alvarado, Jaime; Gracio-Murillo, Mario A.; Islam, Md. Nazrul; Abedinnasab, Mohammad H.

    2016-01-01

    This work reports on the position, velocity and acceleration analyses of a four-degrees-of-freedom parallel manipulator, 4-DoF-PM for brevity, which generates Three-rotation-one-translation (3R1T) motion. Nearly closed-form solutions to solve the forward displacement analysis are easily obtained based on closure equations formulated upon linear combinations of the coordinates of three non-collinear points embedded in the moving platform. Then, the input-output equations of velocity and acceleration of the robot manipulator are systematically established by resorting to the theory of screws. To this end, the Klein form of the Lie algebra se(3) of the Euclidean group SE(3) is systematically applied to the velocity and reduced acceleration state in screw form of the moving platform cancelling the passive joint rates of the parallel manipulator. Numerical examples, which are confirmed by means of commercially available software, are provided to show the application of the method.

  13. RAD24 (=R1/sup S/) gene product of Saccharomyces cerevisiae participates in two different pathways of DNA repair

    International Nuclear Information System (INIS)

    Eckardt-Schupp, F.; Siede, W.; Game, J.C.

    1987-01-01

    The moderately UV- and X-ray-sensitive mutant of Saccharomyces cerevisiae originally designated r 1 /sup s/ complements all rad and mms mutants available. Therefore, the new nomination rad24-1 according to the RAD nomenclature is suggested. RAD24 maps on chromosome V, close to RAD3 (1.3 cM). In order to associate the RAD24 gene with one of the three repair pathways, double mutants of rad24 and various representative genes of each pathway were constructed. The UV and X-ray sensitivities of the double mutants compared to the single mutants indicate that RAD24 is involved in excision repair of UV damage (RAD3 epistasis group), as well as in recombination repair of UV and X-ray damage (RAD52 epistasis group). Properties of the mutant are discussed which hint at the control of late steps in the pathways

  14. Radioactive inventory in structural materials of ET-R R-1 reactor and its implication on decommissioning.

    Energy Technology Data Exchange (ETDEWEB)

    Elkady, A; Amin, E [National center for nuclear safety and radiation control, atomic energy authority, Cairo, (Egypt)

    1995-10-01

    A plan for decommissioning of ET-R R-1 reactor should include estimation of radioactivity in structural materials. The inventory will help in assessing the radiological consequences decommissioning. Conservative calculations have been made to evaluate the activity of the long lived isotopes which can be produced by neutron activation. The materials which are present in significant quantities in the reactor structural materials are aluminium, cast iron, graphite, ordinary and iron shot concrete. The radioactivity of each component is dependent not only upon the major elements, but also on the concentration of the trace elements. The main radioactive inventory are expected to be from Co-60 and Fe-55 which are present in aluminium as trace elements in larger quantities in other construction materials. 2 figs., 4 tabs.

  15. Neutronic calculations in core conversion of the IAN-R1 research reactor from MTR HEU to TRIGA LEU fuel

    International Nuclear Information System (INIS)

    Sarta Fuentes, Jose A.; Castiblanco, L.A.

    2003-01-01

    With cooperation of the International Atomic Energy Agency (IAEA), neutronic calculations were carried out for conversion of the Ian-R1 Reactor from MTR-HEU fuel to TRIGA-LEU fuel. In order to establish a staff for neutronic calculation at the Instituto de Cancan's Nucleares y Energia s Alternatives (INEA) a program was established. This program included training, acquisition of hardware, software and calculation for the core with MTR-HEU fuel , enriched nominally to 93% and calculation for several arrangements with the TRIGA-LEU fuel, enriched to 19.7%. The results were verified and compared with several groups of calculation at the Instituto Nacional de Investigaciones Nucleares (ININ) in Mexico, and General Atomics (GA) in United States. As a result of this program, several technical reports have been wrote. (author)

  16. Development of a computational program to planning and control of the IEA-R1 reactor maintenance

    International Nuclear Information System (INIS)

    Martins, Mauro Onofre; Madi Filho, Tufic

    2013-01-01

    Maintenance is an essential activity in nuclear reactors. The components of safety systems of an industrial plant should have a low probability of failure, especially if there is a high risk of accidents that may cause environmental damage. In nuclear facilities, the presence of security systems is a technical specification and a requirement for their license and operation. In order to manage the entire information flow from the maintenance of the IEA-R1, a computational program (software) was developed, which not only plans and control all the maintenance, but also updates the documents and records to safeguard the quality, ensuring the safe operation of the reactor. The software has access levels and provides detailed reports of all maintenance planned and implemented, together with an individual history of the equipment during its lifetime in the facility. This work presents all the stages of the software development, description, compatibility, application, advantages and results obtained experimentally. (author)

  17. Identification of branched-chain amino acid aminotransferases active towards (R)-(+)-1-phenylethylamine among PLP fold type IV transaminases.

    Science.gov (United States)

    Bezsudnova, Ekaterina Yu; Dibrova, Daria V; Nikolaeva, Alena Yu; Rakitina, Tatiana V; Popov, Vladimir O

    2018-04-10

    New class IV transaminases with activity towards L-Leu, which is typical of branched-chain amino acid aminotransferases (BCAT), and with activity towards (R)-(+)-1-phenylethylamine ((R)-PEA), which is typical of (R)-selective (R)-amine:pyruvate transaminases, were identified by bioinformatics analysis, obtained in recombinant form, and analyzed. The values of catalytic activities in the reaction with L-Leu and (R)-PEA are comparable to those measured for characteristic transaminases with the corresponding specificity. Earlier, (R)-selective class IV transaminases were found to be active, apart from (R)-PEA, only with some other (R)-primary amines and D-amino acids. Sequences encoding new transaminases with mixed type of activity were found by searching for changes in the conserved motifs of sequences of BCAT by different bioinformatics tools. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. The Herbaspirillum seropedicae SmR1 Fnr orthologs controls the cytochrome composition of the electron transport chain.

    Science.gov (United States)

    Batista, Marcelo B; Sfeir, Michelle Z T; Faoro, Helisson; Wassem, Roseli; Steffens, Maria B R; Pedrosa, Fábio O; Souza, Emanuel M; Dixon, Ray; Monteiro, Rose A

    2013-01-01

    The transcriptional regulatory protein Fnr, acts as an intracellular redox sensor regulating a wide range of genes in response to changes in oxygen levels. Genome sequencing of Herbaspirillum seropedicae SmR1 revealed the presence of three fnr-like genes. In this study we have constructed single, double and triple fnr deletion mutant strains of H. seropedicae. Transcriptional profiling in combination with expression data from reporter fusions, together with spectroscopic analysis, demonstrates that the Fnr1 and Fnr3 proteins not only regulate expression of the cbb3-type respiratory oxidase, but also control the cytochrome content and other component complexes required for the cytochrome c-based electron transport pathway. Accordingly, in the absence of the three Fnr paralogs, growth is restricted at low oxygen tensions and nitrogenase activity is impaired. Our results suggest that the H. seropedicae Fnr proteins are major players in regulating the composition of the electron transport chain in response to prevailing oxygen concentrations.

  19. Thermal neutron flux measurements in the rotary specimen rack of the IPR-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Rose Mary G. do Prado; Rodrigues, Rogério R.; Souza, Luiz Claudio A., E-mail: souzarm@cdtn.br, E-mail: rrr@cdtn.br, E-mail: lcas@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2017-07-01

    The thermal neutron flux in the rotary specimen rack of the IPR-R1 TRIGA reactor at the Nuclear Technology Development Center (CDTN), Belo Horizonte, Brazil, has been measured by the neutron activation method, using bare and cadmium covered gold foils. Those foils were irradiated in the rotary specimen rack with the reactor at 100 kW. The reactor core configuration has 63 fuel elements, composed of 59 original aluminum-clad elements and 4 stainless steel-clad fuel elements. The gamma activities of the foils were measured using Ge spectrometer. The perturbations of the thermal neutron flux caused by the introduction of an absorbing foil into the medium were considered in order to obtain accurate determination of the flux. The thermal neutron flux obtained was 7.4 x 10{sup 11} n.cm{sup -2}.s{sup -1}. (author)

  20. Invisible watermarking optical camera communication and compatibility issues of IEEE 802.15.7r1 specification

    Science.gov (United States)

    Le, Nam-Tuan

    2017-05-01

    Copyright protection and information security are two most considered issues of digital data following the development of internet and computer network. As an important solution for protection, watermarking technology has become one of the challenged roles in industry and academic research. The watermarking technology can be classified by two categories: visible watermarking and invisible watermarking. With invisible technique, there is an advantage on user interaction because of the visibility. By applying watermarking for communication, it will be a challenge and a new direction for communication technology. In this paper we will propose one new research on communication technology using optical camera communications (OCC) based invisible watermarking. Beside the analysis on performance of proposed system, we also suggest the frame structure of PHY and MAC layer for IEEE 802.15.7r1 specification which is a revision of visible light communication (VLC) standardization.

  1. Development of methodology for characterization of cartridge filters from the IEA-R1 using the Monte Carlo method

    International Nuclear Information System (INIS)

    Costa, Priscila

    2014-01-01

    The Cuno filter is part of the water processing circuit of the IEA-R1 reactor and, when saturated, it is replaced and becomes a radioactive waste, which must be managed. In this work, the primary characterization of the Cuno filter of the IEA-R1 nuclear reactor at IPEN was carried out using gamma spectrometry associated with the Monte Carlo method. The gamma spectrometry was performed using a hyperpure germanium detector (HPGe). The germanium crystal represents the detection active volume of the HPGe detector, which has a region called dead layer or inactive layer. It has been reported in the literature a difference between the theoretical and experimental values when obtaining the efficiency curve of these detectors. In this study we used the MCNP-4C code to obtain the detector calibration efficiency for the geometry of the Cuno filter, and the influence of the dead layer and the effect of sum in cascade at the HPGe detector were studied. The correction of the dead layer values were made by varying the thickness and the radius of the germanium crystal. The detector has 75.83 cm 3 of active volume of detection, according to information provided by the manufacturer. Nevertheless, the results showed that the actual value of active volume is less than the one specified, where the dead layer represents 16% of the total volume of the crystal. A Cuno filter analysis by gamma spectrometry has enabled identifying energy peaks. Using these peaks, three radionuclides were identified in the filter: 108m Ag, 110m Ag and 60 Co. From the calibration efficiency obtained by the Monte Carlo method, the value of activity estimated for these radionuclides is in the order of MBq. (author)

  2. Characterization of filters cartridges from the water polishing system of IEA-R1 reactor: radiometric methods

    International Nuclear Information System (INIS)

    Tessaro, Ana Paula G.; Vicente, Roberto

    2015-01-01

    The acceptance of radioactive waste in a repository depends primarily on knowledge of the radioisotopic inventory of the material, according to regulations established by regulatory agencies. The primary characterization is also a fundamental action to determine further steps in the management of the radioactive wastes. The aim of this work is to report the development of non-destructive methods for primary characterization of filters cartridges discarded as radioactive waste. The filters cartridges are used in the water polishing system of the IEA-R1 reactor retaining the particles in suspension in the reactor cooling water. The IEA-R1 is a pool type reactor with a thermal power of 5 MW, moderated and cooled with light water. It is located in the Energy and Nuclear Research Institute (IPEN-CNEN), in São Paulo, Brazil. The cartridge filters become radioactive waste when they are saturated and do not meet the required flow for the proper operation of the water polishing system. The activities of gamma emitters present in the filters are determined using gamma spectrometry, dose rate measurements and the Point Kernel Method to correlate results from both measurements. For the primary characterization, one alternative method is the radiochemical analysis of slices taken from each filter, what presents the disadvantage of higher exposures personnel and contamination risks. Another alternative method is the calibration of the measurement geometry of a gamma spectrometer, which requires the production of a standard filter. Both methods are necessary but can not be used in operational routine of radioactive waste management owing to cost and complexity. The method described can be used to determine routinely the radioactive inventory of these filters and other radioactive wastes, avoiding the necessity of destructive radiochemical analysis, or the necessity of calibrating the geometry of measurement. (author)

  3. Effects of hyperbaric oxygen and normobaric carbogen on the radiation response of the rat rhabdomyosarcoma R1H

    International Nuclear Information System (INIS)

    Hartmann, K. Axel; Kleij, Ad J. van der; Carl, Ulrich M.; Hulshof, Maarten C.C.M.; Willers, Reinhart; Sminia, Peter

    2001-01-01

    Purpose: Hypoxic tumor cells are an important factor of radioresistance. Hyperbaric oxygen (HBO) and normobaric carbogen (95% oxygen, 5% carbon dioxide) increase the oxygen delivery to tumors. This study was performed to explore changes of tumor oxygenation during a course of fractionated irradiation and to determine the effectiveness of normobaric carbogen and HBO during the final phase of the radiation treatment. Methods and Materials: Experiments were performed on the rhabdomyosarcoma R1H growing on WAG/Rij rats. After 20 X-ray fractions of 2 Gy within 4 weeks, oxygen partial pressure (pO 2 ) was measured using the Eppendorf oxygen electrode under ambient conditions, with normobaric carbogen or HBO at a pressure of 240 kPa. Following the 4-week radiation course, a top-up dose of 10-50 Gy was applied in 2-10 fractions of 5 Gy with or without hyperoxygenation. Results: HBO but not carbogen significantly increased the median pO 2 in irradiated tumors. The radiation doses to control 50% of tumors were 38.0 Gy, 29.5 Gy, and 25.0 Gy for air, carbogen, and HBO, respectively. Both high oxygen content gas inspirations led to significantly improved tumor responses with oxygen enhancement ratios (OERs) of 1.3 for normobaric carbogen and 1.5 for HBO (air vs. carbogen: p=0.044; air vs. HBO: p=0.02; carbogen vs. HBO: p=0.048). Conclusion: Both normobaric carbogen and HBO significantly improved the radiation response of R1H tumors. HBO appeared to be more effective than normobaric carbogen, both with regard to tumor oxygenation and response to irradiation

  4. Thermal power calibrations of the IPR-R1 TRIGA reactor by the calorimetric and the heat balance methods

    International Nuclear Information System (INIS)

    Mesquita, Amir Zacarias; Rezende, Hugo Cesar; Souza, Rose Mary Gomes do Prado

    2009-01-01

    Since the first nuclear reactor was built, a number of methodological variations have been evolved for the calibration of the reactor thermal power. Power monitoring of reactors is done by means of neutronic instruments, but its calibration is always done by thermal procedures. The purpose of this paper is to present the results of the thermal power calibration carried out on March 5th, 2009 in the IPR-R1 TRIGA reactor. It was used two procedures: the calorimetric and heat balance methods. The calorimetric procedure was done with the reactor operating at a constant power, with primary cooling system switched off. The rate of temperature rise of the water was recorded. The reactor power is calculate as a function of the temperature-rise rate and the system heat capacity constant. The heat balance procedure consists in the steady-state energy balance of the primary cooling loop of the reactor. For this balance, the inlet and outlet temperatures and the water flow in the primary cooling loop were measured. The heat transferred through the primary loop was added to the heat leakage from the reactor pool. The calorimetric method calibration presented a large uncertainty. The main source of error was the determination of the heat content of the system, due to a large uncertainty in the volume of the water in the system and a lack of homogenization of the water temperature. The heat balance calibration in the primary loop is the standard procedure for calibrating the power of the IPR-R1 TRIGA nuclear reactor. (author))

  5. Effects of PPP1R1B (DARPP-32 Polymorphism on Feedback-related Brain Potentials across the Life Span

    Directory of Open Access Journals (Sweden)

    Dorothea eHämmerer

    2013-03-01

    Full Text Available Maximizing gains during probabilistic reinforcement learning requires the updating of choice–outcome expectations at the time when the feedback about a specific choice or action is given. Extant theories and evidence suggest that dopaminergic modulation plays a crucial role in reinforcement learning and the updating of choice–outcome expectations. Furthermore, recently a positive component of the event-related potential (ERP about 200 msec (P2 after feedback has been suggested to reflect such updating. The efficacy of dopaminergic modulation changes across the life span. However, to date investigations of age-related differences in feedback-related P2 during reinforcement learning are still scarce. The present study thus aims to investigate whether individual differences in the feedback-related P2 would be associated with polymorphic variations in a dopamine relevant gene PPP1R1B (also known as DARPP-32 and whether the genetic effect may differ between age groups. We observed larger P2 amplitudes in individuals carrying the genotype associated with higher dopamine receptor efficacy, i.e., A allele homozygotes of a single nucleotide polymorphism (rs907094 of the PPP1R1B gene. Moreover, this effect was more pronounced in children and older adults in comparison to adolescents and younger adults. Together, our findings indicate that polymorphic variations in a dopamine relevant gene are associated with individual differences in brain-evoked potentials of outcome updating and hint at the possibility that genotype effects on neurocognitive phenotypes may vary as a function of brain maturation and aging.

  6. NMDA and mGluR1 receptor subtypes as major players affecting depotentiation in the hippocampal CA1-region

    Directory of Open Access Journals (Sweden)

    Amira Latif-Hernandez

    2014-03-01

    Full Text Available Neurons have the ability to modify their structure and function which ultimately serves for learning (Abraham and Bear, 1996. Dendritic events provide a major contribution to such modifications. For example, natural and artificial patterns of afferent activation have been shown to induce persistent forms of synaptic plasticity, such as long-term potentiation (LTP and long-term depression (LTD at distinct dendritic synapses. LTP and LTD are both assumed to occur during the physiological processes of learning and memory formation and to sustain the latter (Abraham, 2008. In recent years, there has been a burgeoning interest in the understanding of metaplasticity, which refers to the plasticity of synaptic plasticity (Abraham and Bear, 1996. In particular, depotentiation (DP is the mechanism by which synapses that have recently undergone LTP can reverse their synaptic strengthening in response to low frequency stimulation (LFS; Abraham, 2008. Typically, DP is thought to prevent the saturation of synaptic potentiation by resetting synapses into a more efficient state to store new information. The detailed mechanisms that underlie DP still remain unclear. Bortolotto et al. (1994 first identified metabotropic glutamate receptors (mGluRs as being involved in DP. Experimental evidence indicates that both subtypes of group I mGluRs (mGluR1 and mGluR5 have distinct functions in synaptic plasticity in the hippocampal CA1 region (Gladding et al., 2008. However, their role in DP was not addressed yet in detail and appear to be distinct from those involved in NMDAR-dependent DP (Zho et al., 2002. Therefore, we investigated the precise mechanisms responsible for NMDAR and mGluR-dependent DP by combining electrophysiological recordings in vitro and pharmacological approach. Transverse hippocampal slices (400 µm thick were prepared from the right hippocampus with a tissue chopper and placed into a submerged-type chamber, where they were continuously perfused

  7. SIGN-R1 and complement factors are involved in the systemic clearance of radiation-induced apoptotic cells in whole-body irradiated mice

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin-Yeon; Loh, SoHee; Cho, Eun-hee [Department of Biomedical Science & Technology, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Choi, Hyeong-Jwa [Division of Radiation Effect, Korea Institute of Radiological and Medical Sciences, 215-4, 75 Nowon gil Nowon-Gu, Seoul, 139-706 (Korea, Republic of); Na, Tae-Young [College of Pharmacy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 151-741 (Korea, Republic of); Nemeno, Judee Grace E.; Lee, Jeong Ik [Regenerative Medicine Laboratory, Department of Veterinary Medicine, College of Veterinary Medicine, Konkuk University, Seoul, 143-701 (Korea, Republic of); Yoon, Taek Joon [Department of Food and Nutrition, Yuhan College, Bucheon, Gyeonggi-do, 422-749 (Korea, Republic of); Choi, In-Soo [Department of Infectious Diseases, College of Veterinary Medicine, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Lee, Minyoung [Division of Radiation Effect, Korea Institute of Radiological and Medical Sciences, 215-4, 75 Nowon gil Nowon-Gu, Seoul, 139-706 (Korea, Republic of); Lee, Jae-Seon [Department of Biomedical Sciences, College of Medicine, Inha University, Incheon, 400-712 (Korea, Republic of); Kang, Young-Sun, E-mail: kangys1967@naver.com [Department of Biomedical Science & Technology, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Department of Veterinary Pharmacology and Toxicology, College of Veterinary Medicine, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of)

    2015-08-07

    Although SIGN-R1-mediated complement activation pathway has been shown to enhance the systemic clearance of apoptotic cells, the role of SIGN-R1 in the clearance of radiation-induced apoptotic cells has not been characterized and was investigated in this study. Our data indicated that whole-body γ-irradiation of mice increased caspase-3{sup +} apoptotic lymphocyte numbers in secondary lymphoid organs. Following γ-irradiation, SIGN-R1 and complements (C4 and C3) were simultaneously increased only in the mice spleen tissue among the assessed tissues. In particular, C3 was exclusively activated in the spleen. The delayed clearance of apoptotic cells was markedly prevalent in the spleen and liver of SIGN-R1 KO mice, followed by a significant increase of CD11b{sup +} cells. These results indicate that SIGN-R1 and complement factors play an important role in the systemic clearance of radiation-induced apoptotic innate immune cells to maintain tissue homeostasis after γ-irradiation. - Highlights: • Splenic SIGN-R1{sup +} macrophages are activated after γ-irradiation. • C3 and C4 levels increased and C3 was activated in the spleen after γ-irradiation. • SIGN-R1 mediated the systemic clearance of radiation-induced apoptotic cells in spleen and liver.

  8. The impact of R1and R3a genes on tuber resistance to late blight of the potato breeding clones

    Directory of Open Access Journals (Sweden)

    Zoteyeva Nadezhda

    2016-04-01

    Full Text Available Potato breeding clones were evaluated for resistance to late blight (agent Phytophthora infestans using tuber inoculation tests and for presence of the resistance alleles of R1 and R3a genes in polymerase chain reaction tests. Among clones tested those expressing high, moderate and low resistance were identified. The data were analysed for the impact of R1 and R3a genes on tuber resistance to late blight in tested plant material. In previous evaluations performed on smaller amount of clones the tuber resistance levels significantly depended on presence/absence of the resistance allele of R3a gene and did not depend on presence of R1 gene allele. In the current study the statistical analyses did not prove the significant difference in resistance levels depending on presence of the resistance alleles, neither of R1 gene, nor of R3a gene. Tuber resistant clones bearing R3a gene resistance alleles still noticeably prevailed over the clones bearing the alleles of R1 gene as well as over the clones bearing the no resistance alleles of both genes. In several cases the resistance of clones with detected resistance allele of R1 gene was higher compared to those derived from the same crosses and showing amplification of the allele of R3a gene or those with no resistance alleles. Clones accumulating the resistance alleles of both (R1 and R3a genes expressed high tuber resistance accompanied by necrotic reaction.

  9. SIGN-R1 and complement factors are involved in the systemic clearance of radiation-induced apoptotic cells in whole-body irradiated mice

    International Nuclear Information System (INIS)

    Park, Jin-Yeon; Loh, SoHee; Cho, Eun-hee; Choi, Hyeong-Jwa; Na, Tae-Young; Nemeno, Judee Grace E.; Lee, Jeong Ik; Yoon, Taek Joon; Choi, In-Soo; Lee, Minyoung; Lee, Jae-Seon; Kang, Young-Sun

    2015-01-01

    Although SIGN-R1-mediated complement activation pathway has been shown to enhance the systemic clearance of apoptotic cells, the role of SIGN-R1 in the clearance of radiation-induced apoptotic cells has not been characterized and was investigated in this study. Our data indicated that whole-body γ-irradiation of mice increased caspase-3 + apoptotic lymphocyte numbers in secondary lymphoid organs. Following γ-irradiation, SIGN-R1 and complements (C4 and C3) were simultaneously increased only in the mice spleen tissue among the assessed tissues. In particular, C3 was exclusively activated in the spleen. The delayed clearance of apoptotic cells was markedly prevalent in the spleen and liver of SIGN-R1 KO mice, followed by a significant increase of CD11b + cells. These results indicate that SIGN-R1 and complement factors play an important role in the systemic clearance of radiation-induced apoptotic innate immune cells to maintain tissue homeostasis after γ-irradiation. - Highlights: • Splenic SIGN-R1 + macrophages are activated after γ-irradiation. • C3 and C4 levels increased and C3 was activated in the spleen after γ-irradiation. • SIGN-R1 mediated the systemic clearance of radiation-induced apoptotic cells in spleen and liver

  10. VEGF controls lung Th2 inflammation via the miR-1–Mpl (myeloproliferative leukemia virus oncogene)–P-selectin axis

    Science.gov (United States)

    Vasavada, Hema; Zhang, Jian-ge; Ahangari, Farida; Niu, Naiqian; Liu, Qing; Lee, Chun Geun; Cohn, Lauren

    2013-01-01

    Asthma, the prototypic Th2-mediated inflammatory disorder of the lung, is an emergent disease worldwide. Vascular endothelial growth factor (VEGF) is a critical regulator of pulmonary Th2 inflammation, but the underlying mechanism and the roles of microRNAs (miRNAs) in this process have not been defined. Here we show that lung-specific overexpression of VEGF decreases miR-1 expression in the lung, most prominently in the endothelium, and a similar down-regulation occurs in lung endothelium in Th2 inflammation models. Intranasal delivery of miR-1 inhibited inflammatory responses to ovalbumin, house dust mite, and IL-13 overexpression. Blocking VEGF inhibited Th2-mediated lung inflammation, and this was restored by antagonizing miR-1. Using mRNA arrays, Argonaute pull-down assays, luciferase expression assays, and mutational analysis, we identified Mpl as a direct target of miR-1 and showed that VEGF controls the expression of endothelial Mpl during Th2 inflammation via the regulation of miR-1. In vivo knockdown of Mpl inhibited Th2 inflammation and indirectly inhibited the expression of P-selectin in lung endothelium. These experiments define a novel VEGF–miR-1–Mpl–P-selectin effector pathway in lung Th2 inflammation and herald the utility of miR-1 and Mpl as potential therapeutic targets for asthma. PMID:24043765

  11. VEGF controls lung Th2 inflammation via the miR-1-Mpl (myeloproliferative leukemia virus oncogene)-P-selectin axis.

    Science.gov (United States)

    Takyar, Seyedtaghi; Vasavada, Hema; Zhang, Jian-ge; Ahangari, Farida; Niu, Naiqian; Liu, Qing; Lee, Chun Geun; Cohn, Lauren; Elias, Jack A

    2013-09-23

    Asthma, the prototypic Th2-mediated inflammatory disorder of the lung, is an emergent disease worldwide. Vascular endothelial growth factor (VEGF) is a critical regulator of pulmonary Th2 inflammation, but the underlying mechanism and the roles of microRNAs (miRNAs) in this process have not been defined. Here we show that lung-specific overexpression of VEGF decreases miR-1 expression in the lung, most prominently in the endothelium, and a similar down-regulation occurs in lung endothelium in Th2 inflammation models. Intranasal delivery of miR-1 inhibited inflammatory responses to ovalbumin, house dust mite, and IL-13 overexpression. Blocking VEGF inhibited Th2-mediated lung inflammation, and this was restored by antagonizing miR-1. Using mRNA arrays, Argonaute pull-down assays, luciferase expression assays, and mutational analysis, we identified Mpl as a direct target of miR-1 and showed that VEGF controls the expression of endothelial Mpl during Th2 inflammation via the regulation of miR-1. In vivo knockdown of Mpl inhibited Th2 inflammation and indirectly inhibited the expression of P-selectin in lung endothelium. These experiments define a novel VEGF-miR-1-Mpl-P-selectin effector pathway in lung Th2 inflammation and herald the utility of miR-1 and Mpl as potential therapeutic targets for asthma.

  12. The SigmaR1 chaperone drives breast and colorectal cancer cell migration by tuning SK3-dependent Ca2+ homeostasis.

    Science.gov (United States)

    Gueguinou, M; Crottès, D; Chantôme, A; Rapetti-Mauss, R; Potier-Cartereau, M; Clarysse, L; Girault, A; Fourbon, Y; Jézéquel, P; Guérin-Charbonnel, C; Fromont, G; Martin, P; Pellissier, B; Schiappa, R; Chamorey, E; Mignen, O; Uguen, A; Borgese, F; Vandier, C; Soriani, O

    2017-06-22

    The remodeling of calcium homeostasis contributes to the cancer hallmarks and the molecular mechanisms involved in calcium channel regulation in tumors remain to be characterized. Here, we report that SigmaR1, a stress-activated chaperone, is required to increase calcium influx by triggering the coupling between SK3, a Ca 2+ -activated K + channel (KCNN3) and the voltage-independent calcium channel Orai1. We show that SigmaR1 physically binds SK3 in BC cells. Inhibition of SigmaR1 activity, either by molecular silencing or by the use of sigma ligand (igmesine), decreased SK3 current and Ca 2+ entry in breast cancer (BC) and colorectal cancer (CRC) cells. Interestingly, SigmaR1 inhibition diminished SK3 and/or Orai1 levels in lipid nanodomains isolated from BC cells. Analyses of tissue microarray from CRC patients showed higher SigmaR1 expression levels in cancer samples and a correlation with tumor grade. Moreover, the exploration of a cohort of 4937 BC patients indicated that high expression of SigmaR1 and Orai1 channels was significantly correlated to a lower overall survival. As the SK3/Orai1 tandem drives invasive process in CRC and bone metastasis progression in BC, our results may inaugurate innovative therapeutic approaches targeting SigmaR1 to control the remodeling of Ca 2+ homeostasis in epithelial cancers.

  13. [3H]Azidodantrolene photoaffinity labeling, synthetic domain peptides and monoclonal antibody reactivity identify the dantrolene binding sequence on RyR1

    Energy Technology Data Exchange (ETDEWEB)

    Paul-Pletzer, Kalanethee; Yamamoto, Takeshi; Bhat, Manju B.; Ma, Jianjie; Ikemoto, Noriaki; Jimenez, Leslie S.; Morimoto, Hiromi; Williams, Philip G.; Parness, Jerome

    2002-06-14

    Dantrolene is a drug that suppresses intracellular Ca2+ release from sarcoplasmic reticulum in normal skeletal muscle and is used as a therapeutic agent in individuals susceptible to malignant hyperthermia. Though its precise mechanism of action has not been elucidated, we have identified the N-terminal region (amino acids 1-1400) of the skeletal muscle isoform of the ryanodine receptor (RyR1), the primary Ca2+ release channel in sarcoplasmic reticulum, as a molecular target for dantrolene using the photoaffinity analog [3H]azidodantrolene(1). Here, we demonstrate that heterologously expressed RyR1 retains its capacity to be specifically labeled with [3H]azidodantrolene,indicating that muscle specific factors are not required for this ligand-receptor interaction. Synthetic domain peptides of RyR1, previously shown to affect RyR1 function in vitro and in vivo, were exploited as potential drug binding site mimics and used in photoaffinity labeling experiments. Only DP1 and DP1-2, peptide s containing the amino acid sequence corresponding to RyR1 residues 590-609, were specifically labeled by [3H]azidodantrolene. A monoclonal anti-RyR1 antibody which recognizes RyR1 and its 1400 amino acid N-terminal fragment, recognizes DP1 and DP1-2 in both Western blots and immunoprecipitation assays, and specifically inhibits [3H]azidodantrolene photolabeling of RyR1 and its N-terminal fragment in sarcoplasmic reticulum. Our results indicate that synthetic domain peptides can mimic a native, ligand binding conformation in vitro, and that the dantrolene binding site and the epitope for the monoclonal antibody on RyR1 are equivalent and composed of amino-acids 590-609.

  14. Considerations about decommissioning of the IEA-R1 research reactor and the future of its installations after shutdown; Consideracoes sobre o descomissionamento do reator de pesquisa IEA-R1 e futuro de suas instalacoes apos o seu desligamento

    Energy Technology Data Exchange (ETDEWEB)

    Frajndlich, Roberto

    2014-07-01

    The IEA-R1 Nuclear Research Reactor, in operation since 1957, in the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), is one of the oldest research reactors in the world. However at some point in time in the future, as example of the other reactors, it will be shutdown definitively. Before that time actually arrives, the operational organization needs to plan the future of its installations and define the final destination of equipment and radioactive as well as non-radioactive material contained inside the installations. These and other questions should be addressed in the so called Preliminary decommissioning plan of the installation, which is the subject of this work. The work initially presents an over view about the theme and defines the general and specific objectives describing, in succession, the directions that the operating organization should consider for the formulation of a decommissioning plan. The present structure of the Brazilian nuclear sector emphasizing principally the norms utilized in the management of radioactive waste is also presented. A description of principle equipment of the IEA-R1 reactor which constitutes its inventory of radioactive and non-radioactive material is given. The work emphasizes the experience of the reactor technicians, acquired during several reforms and modifications of the reactor installations realized during its useful life time. This experience may be of great help for the decommissioning in the future. An experiment using the high resolution gamma spectrometric method and computer calculation using Monte Carlo theory were performed with the objective of obtaining an estimate of the radioactive waste produced from dismantling of the reactor pool walls. The cost of reactor decommissioning for different choices of strategies was determined using the CERREX code. Finally, a discussion about different strategies is presented. On the basis of these discussions it is concluded that the most advantageous

  15. Thermal and fast neutron distribution determination in the IPR-R1 reactor core; Levantamento das distribuicoes dos fluxos de neutrons termicos e rapidos no nucleo do reator IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Guimaraes, R R.R.

    1985-06-01

    The work is aimed at obtaining a physical method for neutron flux distribution determination within the reactor core, in order to analyze the project of power increase in the TRIGA IPR-R1 reactor at the Nuclebras Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), located in Belo Horizonte, Minas Gerais, Brazil. The experimental process utilizes the neutron activation technique in impurities of stainless steel welding rods 700 mm long, set in acrylic supports. These rods provide simultaneous information on the thermal and fast neutron fluxes through capture and threshold reactions. The process of detection and counting of activation products utilizes a high resolution Ge (Li) detector and a mechanical scanning device, designed and manufactured at CDTN for burn-up measurements of irradiated fuel elements. Besides its simplicity, the method presents the advantage of substituting high purity imported materials by one easily obtained that also furnishes simultaneous information on the thermal and fast neutron fluxes. Furthermore, values for the absolute thermal neutron flux a long the whole core height are obtained. The procedure consists of the assessment of the thermal neutron flux in a fixed point by means of a conventional detector, and then establishing the correspondence of this measurement with the response of the stainless steel rods. (author). 30 refs, 39 figs, 9 tabs.

  16. Development and implementation of a new pneumatic transfer system for materials irradiation at IEA-R1 reactor; Desenvolvimento e implementacao de um novo sistema pneumatico de transferencia para irradiacao de materiais no reator IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Fernando, Alberto de Jesus

    2011-07-01

    Pneumatic Transfer Systems (PTS) are classified as mechanical equipment largely operated all over the world for transport of a huge sort of objects, samples and materials located at nearly terminals or even at separated ones. System applicability is often recognized in many activities, such as medicine (hospital settings, clinical analysis labs), industry (steel, automobiles, mining, chemical, food, construction), trading (gas station, movies, supermarkets, banks, e-commerce) and federal agencies (post services, federal courts, public enterprises). In the nuclear settings, PTS shows also a vast array of applications, being a part of radioisotope production, as well as short-lived radiopharmaceuticals, including 67 Ga, 201 Tl, 18 F and 123 I-ultra pure. Besides, PTS are also used at radioactive waste management plants and research institutes that apply neutron activation analysis (NAA). This work was directed toward the design and operation of a new PTS for the IEA-R1 nuclear research reactor settled at Instituto de Pesquisas Energeticas e Nucleares (IPEN) for NAA application. With this aim, it was calculated the charge of reactor core grid plate and sample transport testing. Neutron flux at irradiating position was determined as 3,70 {+-} 0,26 10{sup 12} n cm{sup -2} s{sup -1}. (author)

  17. Synthesis, in vitro and in vivo evaluation of [11C]MMTP: a potential PET ligand for mGluR1 receptors

    DEFF Research Database (Denmark)

    Prabhakaran, Jaya; Majo, Vattoly J; Milak, Matthew S

    2010-01-01

    Synthesis, in vitro and in vivo evaluation of [O-methyl-(11)C]dimethylamino-3(4-methoxyphenyl)-3H-pyrido[3',2':4,5]thieno[3,2-d]pyrimidin-4-one (1), a potential imaging agent for mGluR1 receptors using PET are described. Synthesis of the corresponding desmethyl precursor 2 was achieved...... selectively labeled mGluR1 receptors in slide-mounted sections of postmortem human brain containing cerebellum, hippocampus, prefrontal cortex and striatum as demonstrated by in vitro autoradiography using phosphor-imaging. PET studies in anesthetized baboon show that [(11)C]1 penetrates the BBB...... and accumulates in cerebellum, a region reported to have higher expression of mGluR1. These findings suggest [(11)C]1 is a promising PET radiotracer candidate for mGluR1....

  18. Homoeologous Recombination of the V1r1-V1r2 Gene Cluster of Pheromone Receptors in an Allotetraploid Lineage of Teleosts

    Directory of Open Access Journals (Sweden)

    Lei Zhong

    2017-11-01

    Full Text Available In contrast to other olfactory receptor families that exhibit frequent lineage-specific expansions, the vomeronasal type 1 receptor (V1R family exhibits a canonical six-member repertoire in teleosts. V1r1 and V1r2 are present in no more than one copy in all examined teleosts, including salmons, which are ancient polyploids, implying strict evolutionary constraints. However, recent polyploids have not been examined. Here, we identified a young allotetraploid lineage of weatherfishes and investigated their V1r1-V1r2 cluster. We found a novel pattern that the parental V1r1-V1r2 clusters had recombined in the tetraploid genome and that the recombinant was nearly fixed in the tetraploid population. Subsequent analyses suggested strong selective pressure, for both a new combination of paralogs and homogeneity among gene duplicates, acting on the V1r1-V1r2 pair.

  19. Considerations about decommissioning of the IEA-R1 research reactor and the future of its installations after shutdown

    International Nuclear Information System (INIS)

    Frajndlich, Roberto

    2014-01-01

    The IEA-R1 Nuclear Research Reactor, in operation since 1957, in the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), is one of the oldest research reactors in the world. However at some point in time in the future, as example of the other reactors, it will be shutdown definitively. Before that time actually arrives, the operational organization needs to plan the future of its installations and define the final destination of equipment and radioactive as well as non-radioactive material contained inside the installations. These and other questions should be addressed in the so called Preliminary decommissioning plan of the installation, which is the subject of this work. The work initially presents an over view about the theme and defines the general and specific objectives describing, in succession, the directions that the operating organization should consider for the formulation of a decommissioning plan. The present structure of the Brazilian nuclear sector emphasizing principally the norms utilized in the management of radioactive waste is also presented. A description of principle equipment of the IEA-R1 reactor which constitutes its inventory of radioactive and non-radioactive material is given. The work emphasizes the experience of the reactor technicians, acquired during several reforms and modifications of the reactor installations realized during its useful life time. This experience may be of great help for the decommissioning in the future. An experiment using the high resolution gamma spectrometric method and computer calculation using Monte Carlo theory were performed with the objective of obtaining an estimate of the radioactive waste produced from dismantling of the reactor pool walls. The cost of reactor decommissioning for different choices of strategies was determined using the CERREX code. Finally, a discussion about different strategies is presented. On the basis of these discussions it is concluded that the most advantageous

  20. C/2013 R1 (Lovejoy) at IR wavelengths and the variability of CO abundances among Oort Cloud comets

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, L.; Mumma, M. J.; Villanueva, G. L.; Bonev, B. P.; DiSanti, M. A. [Goddard Center for Astrobiology, NASA GSFC, MS 690, Greenbelt, MD 20771 (United States); Keane, J. V.; Meech, K. J. [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States); Blake, G. A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Gibb, E. L., E-mail: lucas.paganini@nasa.gov [Department of Physics and Astronomy, University of Missouri-St. Louis, St. Louis, MO 63121 (United States)

    2014-08-20

    We report production rates, rotational temperatures, and related parameters for gases in C/2013 R1 (Lovejoy) using the Near InfraRed SPECtrometer at the Keck Observatory, on six UT dates spanning heliocentric distances (R{sub h} ) that decreased from 1.35 AU to 1.16 AU (pre-perihelion). We quantified nine gaseous species (H{sub 2}O, OH*, CO, CH{sub 4}, HCN, C{sub 2}H{sub 6}, CH{sub 3}OH, NH{sub 3}, and NH{sub 2}) and obtained upper limits for two others (C{sub 2}H{sub 2} and H{sub 2}CO). Compared with organics-normal comets, our results reveal highly enriched CO, (at most) slightly enriched CH{sub 3}OH, C{sub 2}H{sub 6}, and HCN, and CH{sub 4} consistent with {sup n}ormal{sup ,} yet depleted, NH{sub 3}, C{sub 2}H{sub 2}, and H{sub 2}CO. Rotational temperatures increased from ∼50 K to ∼70 K with decreasing R{sub h} , following a power law in R{sub h} of –2.0 ± 0.2, while the water production rate increased from 1.0 to 3.9 × 10{sup 28} molecules s{sup –1}, following a power law in R{sub h} of –4.7 ± 0.9. The ortho-para ratio for H{sub 2}O was 3.01 ± 0.49, corresponding to spin temperatures (T {sub spin}) ≥ 29 K (at the 1σ level). The observed spatial profiles for these emissions showed complex structures, possibly tied to nucleus rotation, although the cadence of our observations limits any definitive conclusions. The retrieved CO abundance in Lovejoy is more than twice the median value for comets in our IR survey, suggesting this comet is enriched in CO. We discuss the enriched value for CO in comet C/2013 R1 in terms of the variability of CO among Oort Cloud comets.