Directory of Open Access Journals (Sweden)
Fernando Mendes Lamas
1999-10-01
Full Text Available O objetivo do presente estudo foi avaliar os efeitos de diferentes dosagens de cloreto de mepiquat, thidiazuron e ethephon, aplicadas parceladamente no algodoeiro (Gossypium hirsutum L. na Fazenda Itamarati, Ponta Porã, MS. As dosagens de cloreto de mepiquat foram: (0; 12,5 + 12,5 + 25,0 = 50; 25 + 25 + 25 = 75; 0 + 50 + 50 = 100; 12,5 + 62,5 + 50 = 125 g ha-1, com aplicações efetuadas aos 34, 47 e 62 dias após a emergência (DAE em 1993/94, e aos 42, 60 e 73 DAE, em 1994/95, enquanto o thidiazuron foi aplicado quando 70% dos capulhos estavam abertos, nas dosagens de 0, 45, 60 e 75 g ha-1; já o ethephon foi aplicado sete dias após o thidiazuron, quando já se observava desfolha de 85%, nas dosagens de 0, 960 e 1.440 g ha-1. O delineamento experimental utilizado foi o de blocos casualizados em faixa, com subparcelas subdivididas e quatro repetições. O cloreto de mepiquat proporcionou redução do número de frutos verdes, aumento do peso de 100 sementes e do peso médio de um capulho; a percentagem de desfolha aumentou com as dosagens de thidiazuron e ethephon; constatou-se que a interação cloreto de mepiquat x thidiazuron x ethephon foi significativa para percentagem de abertura de capulhos e produção de algodão em caroço.The objective of this study was to evaluate the effect of doses of mepiquat chloride, thidiazuron and ethephon on cotton (Gossypium hirsutum L., applied in parcels, and were surveyed in Itamarati Farm at Ponta Porã county. The mepiquat chloride doses were: (0.0; 12.5 + 12.5 + 25.0 = 50.0; 25.0 + 25.0 + 25.0 = 75.0; 0.0 + 50.0 + 50.0 = 100.0; 12.5 + 62.5 + 50.0 = 125.0 g ha-1. The applications were made at 34, 47 and 63 days after emergence(DAE in 1993/94 and at 42, 60 and 73 DAE in 1994/95. Thidiazuron was applied when 70% of bolls were opened at the doses 0.0, 45.0, 60.0 and 75.0 g ha-1. Ethephon was applied seven days after thidiazuron, when 85% defoliation was observed, in the doses of 0.0, 960.0 and 1,440.0 g
Greenberg, Shoil M; Sappington, Thomas W; Elzen, Gary W; Norman, John W; Sparks, Alton N
2004-09-01
In laboratory, greenhouse and field tests, we determined the effects of combining full rates of the defoliants tribufos and thidiazuron and the herbicide thifensulfuron-methyl with half rates of the insecticides lambda-cyhalothrin or azinphos-methyl, and the combination of tribufos and thidiazuron, both in half rates, on mortality of the boll weevil, Anthonomus grandis grandis Boheman and on the quality of defoliation. Tribufos, 0.47 kg ha(-1) and tribufos, 0.235 kg ha(-1) + thidiazuron, 0.125 kg ha(-1) exhibited a slightly toxic effect to boll weevil, while tribufos, 0.47 kg ha(-1) + lambda-cyhalothrin, 0.019 kg ha(-1), tribufos, 0.47 kg ha(-1) + azinphos-methyl, 0.14 kg ha(-1), and tribufos, 0.235 kg ha(-1) + thidiazuron, 0.125 kg ha(-1) + azinphos-methyl, 0.14 kg ha(-l), provided control of boll weevil as good as or better than full-rate azinphos-methyl or lambda-cyhalothrin alone owing to synergistic effects. Thidiazuron or thifensulfuron-methyl alone or in combination with insecticides did not affect boll weevil mortality. Treatment with tribufos + thidiazuron, both at half rate, significantly increased defoliation compared to full rates of tribufos or thidiazuron alone, and provided adequate defoliation for approximately the same cost per hectare.
Effect of different defoliants and application times on the yield and ...
African Journals Online (AJOL)
This study was conducted to determine the effect of different defoliants (Dropp ultra® (DU): thidiazuron+diuron and Roundup (RU): glyphosate) and application times [60, 75 and 90 days after flowering (DAF)] on cotton. The research was carried out at the Harran University, Faculty of Agriculture Research and Application ...
DETERMINATION THE EFFECT OF DEFOLIATION TIMING ON COTTON YIELD AND QUALITY
Directory of Open Access Journals (Sweden)
Karademir Emine
2007-12-01
Full Text Available This study was carried out for determining the effect of different application times at 40, 50, 60 and 70 % boll opening and untreated plot of the defoliant on cotton yield, earliness and technological properties in Southeast Anatolia Region conditions in Turkey. Maras 92 cotton variety was used as plant material in the experiment field of the Southeast Anatolia Agricultural Research Institute during 2000-2001. Defoliant was including thidiazuron + diuron chemical substance. The result of this study showed that ginning percentage, 100 seed weight, seed germination percentage, fiber fineness, fiber length, fiber strength, reflectance, elongation and seed cotton yield were not affected by the treatment; plant height and first picking percentage in 2001, fiber uniformity in 2000 were 5 % significantly affected. This study showed that application of defoliant didn’t affect significantly yield and technological properties of cotton and after 40 % boll opening the defoliant can be used.
Energy Technology Data Exchange (ETDEWEB)
Yang, Yisi [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China); Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zhang, Yan [Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Dong, Mingguang; Yan, Ting; Zhang, Maosheng [College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zeng, Qingru, E-mail: 40083763@qq.com [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China)
2017-08-05
Highlights: • Photocatalytic degradation of thidiazuron was performed in a neutral water matrix. • This was carried out in the presence of Ag/AgCl-activated carbon composites and LED light. • The pH effect and the dominant active species were explored. • Degradation products and pathways in water were studied for the first time. - Abstract: Thidiazuron (TDZ; 1-phenyl-3-(1,2,3-thiadiazol-5-yl)urea) is one of the most widely used defoliant and easy to dissolve in surface water. Risk associated with the pesticide is not clearly defined, so it is important to remove/degrade TDZ with an efficient and environment friendly technology. Here, we investigated the use of Ag/AgCl-activated carbon (Ag/AgCl–AC) composites in photocatalytic degradation of TDZ under LED light. By the synergic effect of Ag/AgCl and AC, the optimum Ag/carbon weight ratio of 2:1 exhibited superior visible-light photocatalytic activity, the highest removal efficiency was close to 91% in pH 7 matrix. Different types of Ag/AgCl–AC composites were tested, all showed much faster photodegradation kinetics than bare Ag/AgCl in 210 min. The degradation products as identified by HPLC–MS revealed that the hydroxylation by hydroxyl radicals and that of oxidation by superoxide radicals as well as holes were the two main pathways for TDZ degradation. Results revealed that the adsorption concentrated TDZ molecules and the photocatalytically generated radicals rapidly degradated TDZ, the two contributions functioned together for removal of the pollutant from water.
International Nuclear Information System (INIS)
Yang, Yisi; Zhang, Yan; Dong, Mingguang; Yan, Ting; Zhang, Maosheng; Zeng, Qingru
2017-01-01
Highlights: • Photocatalytic degradation of thidiazuron was performed in a neutral water matrix. • This was carried out in the presence of Ag/AgCl-activated carbon composites and LED light. • The pH effect and the dominant active species were explored. • Degradation products and pathways in water were studied for the first time. - Abstract: Thidiazuron (TDZ; 1-phenyl-3-(1,2,3-thiadiazol-5-yl)urea) is one of the most widely used defoliant and easy to dissolve in surface water. Risk associated with the pesticide is not clearly defined, so it is important to remove/degrade TDZ with an efficient and environment friendly technology. Here, we investigated the use of Ag/AgCl-activated carbon (Ag/AgCl–AC) composites in photocatalytic degradation of TDZ under LED light. By the synergic effect of Ag/AgCl and AC, the optimum Ag/carbon weight ratio of 2:1 exhibited superior visible-light photocatalytic activity, the highest removal efficiency was close to 91% in pH 7 matrix. Different types of Ag/AgCl–AC composites were tested, all showed much faster photodegradation kinetics than bare Ag/AgCl in 210 min. The degradation products as identified by HPLC–MS revealed that the hydroxylation by hydroxyl radicals and that of oxidation by superoxide radicals as well as holes were the two main pathways for TDZ degradation. Results revealed that the adsorption concentrated TDZ molecules and the photocatalytically generated radicals rapidly degradated TDZ, the two contributions functioned together for removal of the pollutant from water.
Directory of Open Access Journals (Sweden)
A. Basak
2015-06-01
Full Text Available Ethephon alone and in a mixture with inorganic defoliants was used to defoliate apple nursery trees of three cultivars: Yellow Transparent, McIntosh and Jonathan. The mixture of ethephon with copper sulphate or magnesium chlorate defoliated the trees better than ethophon or inorganic defoliants used seperately in twice as high concentrations as in a mixture. The tress defoliated with the mixtures of defoliants suffered less from frost injury than those treated with only the inorganic defoliants.
Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
Nisler, Jaroslav; Kopečný, David; Končitíková, Radka; Zatloukal, Marek; Bazgier, Václav; Berka, Karel; Zalabák, David; Briozzo, Pierre; Strnad, Miroslav; Spíchal, Lukáš
2016-09-01
Two new TDZ derivatives (HETDZ and 3FMTDZ) are very potent inhibitors of CKX and are promising candidates for in vivo studies. Cytokinin hormones regulate a wide range of essential processes in plants. Thidiazuron (N-phenyl-N'-1,2,3-thiadiazol-5-yl urea, TDZ), formerly registered as a cotton defoliant, is a well known inhibitor of cytokinin oxidase/dehydrogenase (CKX), an enzyme catalyzing the degradation of cytokinins. TDZ thus increases the lifetime of cytokinins and their effects in plants. We used in silico modeling to design, synthesize and characterize twenty new TDZ derivatives with improved inhibitory properties. Two compounds, namely 1-[1,2,3]thiadiazol-5-yl-3-(3-trifluoromethoxy-phenyl)urea (3FMTDZ) and 1-[2-(2-hydroxyethyl)phenyl]-3-(1,2,3-thiadiazol-5-yl)urea (HETDZ), displayed up to 15-fold lower IC 50 values compared with TDZ for AtCKX2 from Arabidopsis thaliana and ZmCKX1 and ZmCKX4a from Zea mays. Binding modes of 3FMTDZ and HETDZ were analyzed by X-ray crystallography. Crystal structure complexes, solved at 2.0 Å resolution, revealed that HETDZ and 3FMTDZ bound differently in the active site of ZmCKX4a: the thiadiazolyl ring of 3FMTDZ was positioned over the isoalloxazine ring of FAD, whereas that of HETDZ had the opposite orientation, pointing toward the entrance of the active site. The compounds were further tested for cytokinin activity in several cytokinin bioassays. We suggest that the combination of simple synthesis, lowered cytokinin activity, and enhanced inhibitory effects on CKX isoforms, makes 3FMTDZ and HETDZ suitable candidates for in vivo studies.
thidiazuron improves adventitious bud and shoot regeneration
African Journals Online (AJOL)
Prof. Adipala Ekwamu
Induction of adventitious buds and shoots from intact leaves and stem internode segments of two recalcitrant. Ugandan sweetpotato (Ipomoea batatas L.) cultivars was investigated in vitro on Murashige and Skoog (MS) medium, supplemented with 3 different levels (0.5, 2.0 and 4.0 µM) of Thidiazuron (TDZ). Shoots were.
Sex-specific responses of Populus deltoides to defoliation
Directory of Open Access Journals (Sweden)
Li Shuxin
2017-12-01
Full Text Available There has been an increasing interest in understanding the differential effects of sexual dimorphism on plant stress responses. However, there is no clear pattern in the responses of the sexes to defoliation. In this study, the effects of different severity of artificial defoliation on biomass production, total nonstructural carbohydrate (NSC concentration, and photosynthetic rate (PN of male and female Populus deltoides were examined. We used half and full defoliation to observe the differences between the sexes in three harvest dates (1 week, 4 weeks, and 8 weeks after treatments. We hypothesized that female and male P. deltoides compared with an undefoliated control would have compensatory growth in response to defoliation treatments. Results showed that half and full defoliation reduced the growth of both sexes. Following half defoliation, root growth was reduced, especially in males, at T2 (4 weeks after defoliation and T3 (8 weeks after defoliation, while males showed an increase in height increment under the half defoliation compared with the nondefoliation treatments. By contrast, females were more negatively affected by defoliation than males in terms of biomass after 8 weeks. One week after defoliation, PN increased significantly in females and males under half defoliation (+30%, +32%, respectively and full defoliation (+58%, +56%, respectively. However, 8 weeks after defoliation, there was little difference in PN between defoliated and undefoliated female cuttings. Increases in stomatal conductance (gs and leaf nitrogen were observed under fully defoliated female and male cuttings. Moreover, males had less NSC concentrations following half defoliation compared with females. Our results indicate that leaf compensatory growth in male cuttings of P. deltoides was maintained by obtaining greater photosynthetic capacity, higher leaf nitrogen, and lower NSC concentration following half and full defoliation. Our results highlight that
Thidiazuron: A multi-dimensional plant growth regulator | Guo ...
African Journals Online (AJOL)
Thidiazuron (TDZ) has gained a considerable attention during past decades due to its efficient role in plant cell and tissue culture. Wide array of physiological responses were observed in response to TDZapplication in different plant species. TDZ has shown both auxin and cytokinin like effects, although, chemically, it is ...
Directory of Open Access Journals (Sweden)
Innaka Ageng Rineksane
2016-02-01
Full Text Available One of the problems related to the establishment of mangosteen plantation is to obtain seedlings throughout the year, which can be solved by micropropagation. The propagation of Mangosteen was done through somatic embryogenesis. The objective of this study was to determine the effect of Thidiazuron concentration in ½ MS medium to achieve somatic embryo stages of mangosteen seed. The study consisted of two experiments. Experiment 1: The embryogenic callus c.a.1 g derived from MS solid medium containing of Thidiazuron (0,1; 0,5; dan 1 mg/l and 2,4-Dichlorophenoxy acetic acid (4,6,8 dan 10 mg/l was subcultured into ½ MS0 liquid medium. 2. The embryogenic callus from the previous medium were subcultured into ½ MS liquid medium containing Thidiazuron (0, 1, 2, 4 dan 8 mg/L and Casein hydrolysate 500 mg/L. The results showed that cell suspension were developed after mangosteen embryogenic callus subcultured into ½ MS0 liquid medium. Somatic embryo stages such as globular, heart and torpedo were formed after the calli derived from the previous ½ MS solid medium containing 10 mg/L 2,4-D and 1 mg/L Thidiazuron were subcultured into ½ MS0 liquid medium in 8 weeks. Cell suspension in ½ MS liquid medium with or without the addition of Thidiazuron and Casein hydrolysate has induced the formation of embryo somatic stages such as globular, heart and torpedo after 6 months of incubation.
What causes the patterns of gypsy moth defoliation?
Clive G. Jones
1991-01-01
Gypsy moth defoliation is typically observed to occur on xeric ridge tops before more mesic, lowland forest, in oak-dominated habitats in the Northeast. In subsequent years defoliation may also occur in mesic forests. What causes this pattern of defoliation? Differences in the degree of defoliation may be due to differences in the density of gypsy moth populations in...
INFLUENCE BY ARTIFICIAL DEFOLIATION AND NPK FERTILIZER ...
African Journals Online (AJOL)
Dr. K.E. Law-Ogbomo
main plot, defoliation (sub-plot) and time of defoliation (sub- sub plot). ... using analysis of variance procedure for split – split plot design and means were ... The interaction between NPK fertilizer application and defoliation was only .... yield components (number of dry pod per plant, number of seeds per pod and plant).
Simulated impacts of insect defoliation on forest carbon dynamics
International Nuclear Information System (INIS)
Medvigy, D; Clark, K L; Skowronski, N S; Schäfer, K V R
2012-01-01
Many temperate and boreal forests are subject to insect epidemics. In the eastern US, over 41 million meters squared of tree basal area are thought to be at risk of gypsy moth defoliation. However, the decadal-to-century scale implications of defoliation events for ecosystem carbon dynamics are not well understood. In this study, the effects of defoliation intensity, periodicity and spatial pattern on the carbon cycle are investigated in a set of idealized model simulations. A mechanistic terrestrial biosphere model, ecosystem demography model 2, is driven with observations from a xeric oak–pine forest located in the New Jersey Pine Barrens. Simulations indicate that net ecosystem productivity (equal to photosynthesis minus respiration) decreases linearly with increasing defoliation intensity. However, because of interactions between defoliation and drought effects, aboveground biomass exhibits a nonlinear decrease with increasing defoliation intensity. The ecosystem responds strongly with both reduced productivity and biomass loss when defoliation periodicity varies from 5 to 15 yr, but exhibits a relatively weak response when defoliation periodicity varies from 15 to 60 yr. Simulations of spatially heterogeneous defoliation resulted in markedly smaller carbon stocks than simulations with spatially homogeneous defoliation. These results show that gypsy moth defoliation has a large effect on oak–pine forest biomass dynamics, functioning and its capacity to act as a carbon sink. (letter)
Effect of thidiazuron on in vivo shoot proliferation of popular banana ...
African Journals Online (AJOL)
SARAH
2014-09-30
Sep 30, 2014 ... Mzuzu underscore the need for further studies to determine alternative best cytokine-based growth regulators. Key words: Thidiazuron, in vivo proliferation, Sucker growth, Banana. INTRODUCTION. In vivo macropropagation is an alternative technique for mass production of banana planting materials.
Outbreaks of forest defoliating insects in Japan, 1950-2000.
Kamata, N; Kamata, N
2002-04-01
In Japan, several forest-defoliating insects reach outbreak levels and cause serious defoliation. Stand mortality sometimes occurs after severe defoliation. However, in general, tree mortality caused by insect defoliation is low because of the prevailing moist climate in Japan. Evergreen conifers are more susceptible to tree mortality as a result of insect defoliation whereas deciduous broad-leaved trees are seldom killed. Insect defoliation occurs more frequently in man-made environments such as among shade trees, orchards, and plantations than in natural habitats. Outbreaks of some defoliators tend to occur in stands of a particular age: e.g. outbreaks of the pine caterpillar, Dendrolimus spectabilis Butler (Lepidoptera: Lasiocampidae) occur more frequently in young pine plantations. In contrast, defoliation caused by outbreaks of lepidopterous and hymenopterous pests in larch plantations is more frequent with stand maturation. There is a relationship between outbreaks of some defoliators and altitude above sea level. Most outbreaks of forest defoliators were terminated by insect pathogens that operated in a density-dependent fashion. Since the 1970s, Japan has been prosperous and can afford to buy timber from abroad. More recently, there has been an increasing demand for timber in Japan, that coincides with a huge demand internationally, so that the country will need to produce more timber locally in the future. The increasing pressure on the forestry industry to meet this demand will require more sophisticated methods of pest control coupled with more sustainable methods of silviculture.
Carry-over effect of Thidiazuron on banana in vitro proliferation at ...
African Journals Online (AJOL)
Thidiazuron (TDZ) is an active cytokinin that was shown to induce increased shoot proliferation and habituation in black walnut, Phaseolus lunatus and evergreen azalea, which are tree species but has not been widely investigated in bananas. Unlike other cytokines commonly in use that are adeninebased, TDZ is a urea ...
Remote monitoring of forest insect defoliation. A review
Energy Technology Data Exchange (ETDEWEB)
Rullan-Silva, C. D.; Olthoff, A. E.; Delgado de la Mata, J. A.; Pajares-Alonso, J. A.
2013-07-01
Aim of study: This paper reviews the global research during the last 6 years (2007-2012) on the state, trends and potential of remote sensing for detecting, mapping and monitoring forest defoliation caused by insects. Area of study: The review covers research carried out within different countries in Europe and America. Main results: A nation or region wide monitoring system should be scaled in two levels, one using time-series with moderate to coarse resolutions, and the other with fine or high resolution. Thus, MODIS data is increasingly used for early warning detection, whereas Landsat data is predominant in defoliation damage research. Furthermore, ALS data currently stands as the more promising option for operative detection of defoliation. Vegetation indices based on infrared-medium/near-infrared ratios and on moisture content indicators are of great potential for mapping insect pest defoliation, although NDVI is the most widely used and tested. Research highlights: Among most promising methods for insect defoliation monitoring are Spectral Mixture Analysis, best suited for detection due to its sub-pixel recognition enhancing multispectral data, and use of logistic models as function of vegetation index change between two dates, recommended for predicting defoliation. (Author)
Xie, Wen; Shi, Yingzhu; Hou, Jianbo; Huang, Chaoqun; Zhao, Dong; Pan, Lulu; Dong, Suozhuai
2014-02-01
A method for the determination of ethephon, thidiazuron and diuron in cotton samples has been developed by high performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS). The sample was extracted with methanol-water. The separation was carried out on a C8 column (150 mm x 4.6 mm, 5 microm) with methanol-water (6:4, v/v) as mobile phase at a flow rate of 0.4 mL/min, and the injection volume was 20 microL. Then the sample solution was analyzed by HPLC-MS/MS in negative ion mode with multiple reaction monitoring (MRM). There were one precursor/two product ion transitions for each pesticide. The results showed that the working curves were linear in the range of 0-10 microg/L for ethephon and thidiazuron, and 0-1 microg/L for diuron. The correlation coefficients (r) were all over 0. 999. The limits of quantitation (LOQ) of ethephon, diuron were 40 microg/kg, that of thidiazuron was 4 microg/kg. The average recoveries varied from 89.4% to 100.2% with the relative standard deviations (RSDs) of 5.7%-11.5% at three spiked levels (LOQ, 2LOQ and 4LOQ). The method is simple, rapid and accurate, and can meet the requirements of the domestic and international legislation. The method adapts to confirm the residues of ethephon, thidiazuron and diuron pesticides in cotton samples.
Remote Monitoring of Forest Insect Defoliation -A Review-
Directory of Open Access Journals (Sweden)
C.D. Rullan-Silva
2013-12-01
Full Text Available Aim of study: This paper reviews the global research during the last 6 years (2007-2012 on the state, trends and potential of remote sensing for detecting, mapping and monitoring forest defoliation caused by insects.Area of study: The review covers research carried out within different countries in Europe and America.Main results: A nation or region wide monitoring system should be scaled in two levels, one using time-series with moderate to coarse resolutions, and the other with fine or high resolution. Thus, MODIS data is increasingly used for early warning detection, whereas Landsat data is predominant in defoliation damage research. Furthermore, ALS data currently stands as the more promising option for operative detection of defoliation.Vegetation indices based on infrared-medium/near-infrared ratios and on moisture content indicators are of great potential for mapping insect pest defoliation, although NDVI is the most widely used and tested.Research highlights: Among most promising methods for insect defoliation monitoring are Spectral Mixture Analysis, best suited for detection due to its sub-pixel recognition enhancing multispectral data, and use of logistic models as function of vegetation index change between two dates, recommended for predicting defoliation.Key words: vegetation damage; pest outbreak; spectral change detection.
Tree condition and mortality following defoliation by the gypsy moth
Robert W. Campbell; Harry T. Valentine; Harry T. Valentine
1972-01-01
Relationships between expected defoliation and the subsequent condition and mortality rate among the defoliated trees are almost always important factors in deciding if, when, and where to take control action against a defoliator such as the gypsy moth, Porthetria dispar (L. )
Effects of Basal Defoliation on Wine Aromas: A Meta-Analysis
Directory of Open Access Journals (Sweden)
Yu Wang
2018-03-01
Full Text Available Basal defoliation, as one of the most common viticulture management practices to modify fruit zone microclimates, has been widely applied aiming at improving wine quality. Wine aroma contributes greatly to wine quality, yet the effects of basal defoliation on wine aromas show discrepancies according to previous studies. This study is a meta-analysis performed to dissect the factors related to the influence of basal defoliation on volatile compounds in wine. Timing of basal defoliation plays an important role in the concentration of varietal aromas in wine. Pre-veraison defoliation induces an increase in β-damascenone and linalool as well as a reduction in 3-isobutyl-2-methoxypyrazine (IBMP. The effects of basal defoliation on certain volatile compounds relative to fermentation aromas in wine (1-hexanol, β-phenylethanol, 2-phenylethyl acetate, decanoic acid, and ethyl octanoate depend on grape maturity. There are also other factors, such as cultivar and climate conditions, that might be responsible for the effect of basal defoliation on wine aromas. The concentrations of isobutanol, isoamyl alcohol, hexanoic acid, and octanoic acid as well as ethyl isobutyrate, ethyl hexanoate, ethyl isovalerate, and ethyl decanoate in wine are not markedly affected by basal defoliation. Due to limited studies included in this meta-analysis, more trials are needed to confirm the current findings.
Effects of defoliation on growth of cauliflower
Boogaard, van den R.; Grevsen, K.; Thorup Kristensen, K.
2001-01-01
Three experiments were performed with defoliation of young cauliflower plants in the field. The leaves were removed 3–6 weeks after planting and about 65 f the leaf area were removed. After defoliation, several plant processes contributed to compensate for the loss of leaf area. Right after
The response of Acacia karroo plants to defoliation by hand ...
African Journals Online (AJOL)
Shoot production of all plants defoliated by hand was no different to that of the undefoliated control plants and was considerably less than that of the plants defoliated by goats. Keywords: acacia karroo; browse production; browsing; clipping; defoliation; goats; growth stimulation; leaf growth; leaves; shoot growth; shoot ...
Effect of intensity of defoliation by goats at different phenophases on ...
African Journals Online (AJOL)
... within weeks of defoliation. Keywords: acacia karroo; alice; carbohydrate; consumption; defoliation; eastern cape; goats; growth; growth stimulation; insect defoliation; leaf growth; leaf mortality; leaf removal; leaves; phenophases; production; shoot growth; shoot production; shoot removal; south africa; university of fort hare ...
Regeneration in defoliated and thinned hardwood stands of north-central West Virginia
R. M. Muzika; M. J. Twery
1995-01-01
Overstory species regeneration was examined in 1989, prior to gypsy moth defoliation and thinnings, on 16 stands in the West Virginia University Forest. Three stands were thinned and defoliated while five were thinned only and three were defoliated only. Five stands were neither thinned nor defoliated. Data were collected from these stands for three years subsequent to...
Effect of timing and intensity of defoliation on yield and quality of sugar beet
Directory of Open Access Journals (Sweden)
ali kamandi
2009-06-01
Full Text Available The effect of defoliation on root yield and quality of suagrbeet (Beta vulgaris L. was examined in a field study in Research Station of Faculty of Agriculture, Ferdowsi University of Mashhd during 2005 growing season. The experiment was conducted as a split plot on the basis of randomized complete block design with three replications.Time of Defoliation (May 16th, May 31th, June 18th, July 9th, July 31th, and August 20th were allocated to main plots and defoliation severity (0, 30, 60, and 100% were assigned to subplots. Results showed that root yield, shoot and root dry weight and sugar yield were influenced by defoliation time. However, defoliation time had no significant effects on sugar white content and white sugar yield. Effects of defoliation on plant growth was more pronounced in mid season when about 1500 degree days was accumulated, compared to early or late season. Defoliation intensity resulted in a significant decrease in root yield, shoot fresh weigth, root and shoot dry weight, sugar and white sugar content, and white sugar yield compared with undefoliated control, but molass sugar was increased in all defoliation intensities. sugar and white suagr percent were significantly affected by defoliation time x intensity interaction. Complete defoliation (100% on July 30th and Auguat 19th led to 18 and 21% reduction in sugar and 29 and 28% in white suagar, respectively. However, 100% defoliation in July 8th resulted in 6 and 8% increase in sugar and white sugar, respectively. Keywords: Time of defoliation, defoliation intensity, sugarbeet yield,sugar beet quality.
Jing, Yanli; Guan, Dexin; Wu, Jiabing; Wang, Anzhi; Jin, Changjie; Yuan, Fenghui
2015-01-01
Previous studies with different experimental methods have demonstrated that photosynthesis significantly influences soil respiration (RS). To compare the experimental results of different methods, RS after girdling and defoliation was measured in five-year-old seedlings of Fraxinus mandshurica from June to September. Girdling and defoliation significantly reduced RS by 33% and 25% within 4 days, and 40% and 32% within the entire treatment period, respectively. The differential response of RS to girdling and defoliation was a result of the over-compensation for RS after girdling and redistribution of stored carbon after defoliation. No significant effect on RS was observed between girdling and defoliation treatment, while the soluble sugar content in fine roots was higher in defoliation than in girdling treatment, indicating that defoliation had less compensation effect for RS after interrupting photosynthates supply. We confirm the close coupling of RS with photosynthesis and recommend defoliation for further studies to estimate the effect of photosynthesis on RS.
The response of Acacia karroo plants to defoliation of the upper or ...
African Journals Online (AJOL)
... of the canopy. Plants were very sensitive to defoliation in the early-flush phenophase. This probably masked the positive effects of the partial defoliations applied at this phenophase. Keywords: acacia karroo; browse production; defoliation; eastern cape; goats; growth stimulation; leaves; south africa; university of fort hare ...
Stream Response to an Extreme Defoliation Event
Gold, A.; Loffredo, J.; Addy, K.; Bernhardt, E. S.; Berdanier, A. B.; Schroth, A. W.; Inamdar, S. P.; Bowden, W. B.
2017-12-01
Extreme climatic events are known to profoundly impact stream flow and stream fluxes. These events can also exert controls on insect outbreaks, which may create marked changes in stream characteristics. The invasive Gypsy Moth (Lymantria dispar dispar) experiences episodic infestations based on extreme climatic conditions within the northeastern U.S. In most years, gypsy moth populations are kept in check by diseases. In 2016 - after successive years of unusually warm, dry spring and summer weather -gypsy moth caterpillars defoliated over half of Rhode Island's 160,000 forested ha. No defoliation of this magnitude had occurred for more than 30 years. We examined one RI headwater stream's response to the defoliation event in 2016 compared with comparable data in 2014 and 2015. Stream temperature and flow was gauged continuously by USGS and dissolved oxygen (DO) was measured with a YSI EXO2 sonde every 30 minutes during a series of deployments in the spring, summer and fall from 2014-2016. We used the single station, open channel method to estimate stream metabolism metrics. We also assessed local climate and stream temperature data from 2009-2016. We observed changes in stream responses during the defoliation event that suggest changes in ET, solar radiation and heat flux. Although the summer of 2016 had more drought stress (PDSI) than previous years, stream flow occurred throughout the summer, in contrast to several years with lower drought stress when stream flow ceased. Air temperature in 2016 was similar to prior years, but stream temperature was substantially higher than the prior seven years, likely due to the loss of canopy shading. DO declined dramatically in 2016 compared to prior years - more than the rising stream temperatures would indicate. Gross Primary Productivity was significantly higher during the year of the defoliation, indicating more total fixation of inorganic carbon from photo-autotrophs. In 2016, Ecosystem Respiration was also higher and Net
Nardeli, Sarah Muniz; Artico, Sinara; Aoyagi, Gustavo Mitsunori; de Moura, Stéfanie Menezes; da Franca Silva, Tatiane; Grossi-de-Sa, Maria Fatima; Romanel, Elisson; Alves-Ferreira, Marcio
2018-06-01
The MADS-box gene family encodes transcription factors that share a highly conserved domain known to bind to DNA. Members of this family control various processes of development in plants, from root formation to fruit ripening. In this work, a survey of diploid (Gossypium raimondii and Gossypium arboreum) and tetraploid (Gossypium hirsutum) cotton genomes found a total of 147, 133 and 207 MADS-box genes, respectively, distributed in the MIKC, Mα, Mβ, Mγ, and Mδ subclades. A comparative phylogenetic analysis among cotton species, Arabidopsis, poplar and grapevine MADS-box homologous genes allowed us to evaluate the evolution of each MADS-box lineage in cotton plants and identify sequences within well-established subfamilies. Chromosomal localization and phylogenetic analysis revealed that G. raimondii and G. arboreum showed a conserved evolution of the MIKC subclade and a distinct pattern of duplication events in the Mα, Mγ and Mδ subclades. Additionally, G. hirsutum showed a combination of its parental subgenomes followed by a distinct evolutionary history including gene gain and loss in each subclade. qPCR analysis revealed the expression patterns of putative homologs in the AP1, AP3, AGL6, SEP4, AGL15, AG, AGL17, TM8, SVP, SOC and TT16 subfamilies of G. hirsutum. The identification of putative cotton orthologs is discussed in the light of evolution and gene expression data from other plants. This analysis of the MADS-box genes in Gossypium species opens an avenue to understanding the origin and evolution of each gene subfamily within diploid and polyploid species and paves the way for functional studies in cotton species. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
Near-Real-Time Monitoring of Insect Defoliation Using Landsat Time Series
Directory of Open Access Journals (Sweden)
Valerie J. Pasquarella
2017-07-01
Full Text Available Introduced insects and pathogens impact millions of acres of forested land in the United States each year, and large-scale monitoring efforts are essential for tracking the spread of outbreaks and quantifying the extent of damage. However, monitoring the impacts of defoliating insects presents a significant challenge due to the ephemeral nature of defoliation events. Using the 2016 gypsy moth (Lymantria dispar outbreak in Southern New England as a case study, we present a new approach for near-real-time defoliation monitoring using synthetic images produced from Landsat time series. By comparing predicted and observed images, we assessed changes in vegetation condition multiple times over the course of an outbreak. Initial measures can be made as imagery becomes available, and season-integrated products provide a wall-to-wall assessment of potential defoliation at 30 m resolution. Qualitative and quantitative comparisons suggest our Landsat Time Series (LTS products improve identification of defoliation events relative to existing products and provide a repeatable metric of change in condition. Our synthetic-image approach is an important step toward using the full temporal potential of the Landsat archive for operational monitoring of forest health over large extents, and provides an important new tool for understanding spatial and temporal dynamics of insect defoliators.
Evaluation of Insect Defoliation in Baldcypress and Its Relationship to Flooding
National Research Council Canada - National Science Library
Goyer, Richard
1996-01-01
This project was undertaken to delineate the extent of defoliation of baldcypress and to compare defoliation and refoliation rates under different flooding regimes in naturally occurring field situations...
Phenolic composition of Tempranillo wines following early defoliation of the vines.
Diago, Maria P; Ayestarán, Belén; Guadalupe, Zenaida; Garrido, Álvaro; Tardaguila, Javier
2012-03-15
Early defoliation is a viticultural practice aimed at crop control. So far, the impact of early leaf removal on the monomeric phenolic composition of wines has not been explored. This study examines the effects of early defoliation on the phenolic profile and content in Tempranillo wines. The influence of the defoliation method (manual vs mechanical) and the timing of leaf removal (pre-bloom vs fruit set) was investigated. Over two consecutive seasons, 2007 and 2008, the monomeric phenolic composition in Tempranillo wines was studied by high-performance liquid chromatography with photodiode array detection, and 22 compounds were identified and quantified. Overall, early defoliation led to wines more intensely coloured, of higher alcohol content and with larger concentrations of hydroxycinnamic acids, flavonols and anthocyanins (in 2008 only for mechanical treatments). In the absence of fungal infection, resveratrol was found to increase in wines corresponding to early defoliation treatments. The method of leaf removal seemed to be more critical than the timing of intervention, and larger effects on wine phenolic composition were observed for mechanical treatments. Early defoliation proved to be an effective technique for improving the phenolic composition of Tempranillo wines, by favouring the accumulation of hydroxycinnamics, flavonols and anthocyanins. This is an important achievement, as wine quality is often described by its colour and phenolic attributes. Copyright © 2011 Society of Chemical Industry.
Assessing Pine Processionary Moth Defoliation Using Unmanned Aerial Systems
Directory of Open Access Journals (Sweden)
Adrián Cardil
2017-10-01
Full Text Available Pine processionary moth (PPM is one of the most destructive insect defoliators in the Mediterranean for many conifers, causing losses of growth, vitality and eventually the death of trees during outbreaks. There is a growing need for cost-effective monitoring of the temporal and spatial impacts of PPM in forest ecology to better assess outbreak spread patterns and provide guidance on the development of measures targeting the negative impacts of the species on forests, industry and human health. Remote sensing technology mounted on unmanned aerial systems (UASs with high-resolution image processing has been proposed to assess insect outbreak impacts at local and forest stand levels. Here, we used UAS-acquired RGB imagery in two pine sites to quantify defoliation at the tree-level and to verify the accuracy of the estimates. Our results allowed the identification of healthy, infested and completely defoliated trees and suggested that pine defoliation estimates using UASs are robust and allow high-accuracy (79% field-based infestation indexes to be derived that are comparable to those used by forest technicians. When compared to current field-based methods, our approach provides PPM impact assessments with an efficient data acquisition method in terms of time and staff, allowing the quantitative estimation of defoliation at tree-level scale. Furthermore, our method could be expanded to a number of situations and scaled up in combination with satellite remote sensing imagery or citizen science approaches.
Comparative responses of the Savanna grasses Cenchrus ciliaris and Themeda triandra to defoliation.
Hodgkinson, K C; Ludlow, M M; Mott, J J; Baruch, Z
1989-04-01
Two perennial tussock grasses of savannas were compared in a glasshouse study to determine why they differed in their ability to withstand frequent, heavy grazing; Cenchrus ciliaris is tolerant and Themeda triandra is intolerant of heavy grazing. Frequent defoliation at weekly intervals for six weeks reduced shoot biomass production over a subsequent 42 day regrowth period compared with previously undefoliated plants (infrequent) in T. triandra, but not in C. ciliaris. Leaf area of T. triandra expanded rapidly following defoliation but high initial relative growth rates of shoots were not sustained after 14 days of regrowth because of reducing light utilising efficiency of leaves. Frequently defoliated plants were slower in rate of leaf area expansion and this was associated with reduced photosynthetic capacity of newly formed leaves, lower allocation of photosynthate to leaves but not lower tiller numbers. T. triandra appears well adapted to a regime where defoliation is sufficiently infrequent to allow carbon to be fixed to replace that used in initial leaf area expansion. In contrast, C. ciliaris is better adapted to frequent defoliation than is T. triandra, because horizontally orientated nodal tillers are produced below the defoliation level. This morphological adaptation resulted in a 10-fold higher leaf area remaining after defoliation compared with similarly defoliated T. triandra, which together with the maintenance of moderate levels of light utilising efficiency, contributed to the higher leaf area and shoot weight throughout the regrowth period.
Defoliation reduces soil biota - and modifies stimulating effects of elevated CO2
DEFF Research Database (Denmark)
Dam, Marie; Christensen, Søren
2015-01-01
defoliation increased activity and biomass of soil biota and more so at elevated CO2. Based on soil biota responses, plants defoliated in active growth therefore conserve resources, whereas defoliation after termination of growth results in release of resources. This result challenges the idea that plants via...... was needed to reduce nematodes. We found positive effects of CO2 on root density and microbial biomass. Defoliation affected soil biota negatively, whereas elevated CO2 stimulated the plant-soil system. This effect seen in June is contrasted by the effects seen in September at the same site. Late season...... assessed in the rhizosphere of manually defoliated patches of Deschampsia flexuosa in June in a full-factorial FACE experiment with the treatments: increased atmospheric CO2, increased nighttime temperatures, summer droughts, and all of their combinations. We found a negative effect of defoliation...
Efficient Direct Protocorm-Like Bodies Induction of Dwarf Dendrobium using Thidiazuron
Directory of Open Access Journals (Sweden)
Panjan SUJJARITTHURAKARN
2011-11-01
Full Text Available An efficient induction of protocorm-like bodies (PLBs from seedlings of dwarf Dendrobium was accomplished in order to develop mass-scale propagation. The effect of N6-benzyladenine (BA and thidiazuron (TDZ on the in vitro induction of PLBs was studied. TDZ was found to be a more effective inducer of PLBs and their proliferation than BA. The highest percentage for the induction of PLBs (86% and the highest number of PLBs (3.6 per protocorm were observed after 9 weeks of culture in modified Murashige and Skoog (MS liquid medium supplemented with 18 ?M TDZ.
(Gossypium barbadense) germplasm resources
Indian Academy of Sciences (India)
Navya
2017-03-28
Mar 28, 2017 ... Running title: Marker-trait associations in sea-island cotton ... In this study, Gossypium barbadense germplasm accessions with ... origins (n = 123) were used to perform association analysis of fiber traits with 120 polymorphic simple ... Because fiber yield and quality traits are complex quantitative traits, ...
Itter, M.; D'Orangeville, L.; Dawson, A.; Kneeshaw, D.; Finley, A. O.
2017-12-01
Drought and insect defoliation have lasting impacts on the dynamics of the boreal forest. Impacts are expected to worsen under global climate change as hotter, drier conditions forecast for much of the boreal increase the frequency and severity of drought and defoliation events. Contemporary ecological theory predicts physiological feedbacks in tree responses to drought and defoliation amplify impacts potentially causing large-scale productivity losses and forest mortality. Quantifying the interactive impacts of drought and insect defoliation on regional forest health is difficult given delayed and persistent responses to disturbance events. We developed a Bayesian hierarchical model to estimate forest growth responses to interactions between drought and insect defoliation by species and size class. Delayed and persistent responses to past drought and defoliation were quantified using empirical memory functions allowing for improved detection of interactions. The model was applied to tree-ring data from stands in Western (Alberta) and Eastern (Québec) regions of the Canadian boreal forest with different species compositions, disturbance regimes, and regional climates. Western stands experience chronic water deficit and forest tent caterpillar (FTC) defoliation; Eastern stands experience irregular water deficit and spruce budworm (SBW) defoliation. Ecosystem memory to past water deficit peaked in the year previous to growth and decayed to zero within 5 (West) to 8 (East) years; memory to past defoliation ranged from 8 (West) to 12 (East) years. The drier regional climate and faster FTC defoliation dynamics (compared to SBW) likely contribute to shorter ecosystem memory in the West. Drought and defoliation had the largest negative impact on large-diameter, host tree growth. Surprisingly, a positive interaction was observed between drought and defoliation for large-diameter, non-host trees likely due to reduced stand-level competition for water. Results highlight the
Future Risk of Gypsy Moth Defoliation
U.S. Environmental Protection Agency — Data from the suitable habitat combined with forest density, and adjusted by prefered species basal area and the predicited geographic pattern of defoliation can be...
The effect of frequency of defoliation on Themeda triandra in the ...
African Journals Online (AJOL)
Tufts of Themeda triandra were subjected to different frequencies of defoliation during a single season under irrigated and non-irrigated conditions. Frequent defoliation (> 5 times per year) severely reduced clipped yield on both moisture treatments. On irrigated treatments, root mass declined and shoot apex elevation was ...
Directory of Open Access Journals (Sweden)
Guillermo eGuada
2016-04-01
Full Text Available Mediterranean pine forests display high resilience after extreme climatic events such as severe droughts. However, recent dry spells causing growth decline and triggering forest dieback challenge the capacity of some forests to recover following major disturbances. To describe how resilient the responses of forests to drought can be, we quantified growth dynamics in plantations of two pine species (Scots pine, black pine located in south-eastern Spain and showing drought-triggered dieback. Radial growth was characterized at inter- (tree-ring width and intra-annual (xylogenesis scales in three defoliation levels. It was assumed that the higher defoliation the more negative the impact of drought on tree growth. Tree-ring width chronologies were built and xylogenesis was characterized three years after the last severe drought occurred. Annual growth data and the number of tracheids produced in different stages of xylem formation were related to climate data at several time scales. Drought negatively impacted growth of the most defoliated trees in both pine species. In Scots pine, xylem formation started earlier in the non-defoliated than in the most defoliated trees. Defoliated trees presented the shortest duration of the radial-enlargement phase in both species. On average the most defoliated trees formed 60% of the number of mature tracheids formed by the non-defoliated trees in both species. Since radial enlargement is the xylogenesis phase most tightly related to final growth, this explains why the most defoliated trees grew the least due to their altered xylogenesis phases. Our findings indicate a very limited resilience capacity of drought-defoliated Scots and black pines. Moreover, droughts produce legacy effects on xylogenesis of highly defoliated trees which could not recover previous growth rates and are thus more prone to die.
Leaf-cutting ant attack in initial pine plantations and growth of defoliated plants
Directory of Open Access Journals (Sweden)
Mariane Aparecida Nickele
2012-07-01
Full Text Available The objective of this work was to evaluate the natural attack by Acromyrmex crassispinus in initial Pinus taeda plantations without control measures against ants, as well as the effect of defoliation in seedlings of P. taeda. Evaluations of the attack of leaf-cutting ants on P. taeda plantations were done monthly in the first six months, then 9 and 12 months after planting. The percentages of plants that were naturally attacked by ants were registered. The effect of defoliation was evaluated by artificial defoliation, simulating the natural patterns of attack by A. crassispinus on P. taeda seedlings. The natural attack of A. crassispinus was greater during the first months after planting, being more intense in the first 30 days. Artificial defoliation indicated that there were no significant losses in diameter and height in plants with less than 75% defoliation. However, there were significant losses in diameter and height in plants with 100% defoliation, independently of the cut of the apical meristem, and also plant death. The control of leaf-cutting ants in P. taeda plantings, in which A. crassispinus is the most frequent leaf-cutting ant, should be intense only at the beginning of planting, since the most severe attacks occur during this time.
The draft genome of a diploid cotton Gossypium raimondii
DEFF Research Database (Denmark)
Wang, Kunbo; Wang, Zhiwen; Li, Fuguang
2012-01-01
We have sequenced and assembled a draft genome of G. raimondii, whose progenitor is the putative contributor of the D subgenome to the economically important fiber-producing cotton species Gossypium hirsutum and Gossypium barbadense. Over 73% of the assembled sequences were anchored on 13 G. raim...
Evaluation of IRS-1C LISS-3 satellite data for Norway spruce defoliation assessment
Energy Technology Data Exchange (ETDEWEB)
Falkenstroem, H.
1999-02-01
Satellite based remote sensing supported by air photo and field surveys, provide a means to area covering forest health assessment on a regional scale. Landsat TM data has been extensively used in studies of spruce and fir defoliation in Europe and North America. The temporal coverage of Landsat TM in combination with cloudiness however restrict the availability of data. In this study the LISS-3 sensor onboard the Indian Resource Satellite, IRS-1C, was evaluated for defoliation assessments in Norway spruce (Picea abies) in the central part of Sweden. The near infrared wavelength band proved to be best correlated with mean stand defoliation. After normalisation of satellite data for topographic conditions, the correlation coefficient increased from -0,19 to -0,83. Normalising satellite data for species composition did not improve the results though. The correction coefficients involved in the procedure were originally developed for Landsat TM, and proved to be inadequate for the LISS-3 data set. A thorough examination of the effects of species composition on LISS-3 data is needed to yield better results. The correlation between observed defoliation in the verification stands and predicted (based on the inverse regression function between corrected NIR values and defoliation in reference stands) was 0,70, despite a very limited range of defoliation in the verification set. IRS-1C LISS-3 is fully comparable to Landsat TM for spruce defoliation studies, although the results would probably not be significantly improved 49 refs, 7 figs, 10 tabs
The use of non-lethal defoliation to minimize the foliar Cs-uptake by vine
International Nuclear Information System (INIS)
Carini, F.; Montruccoli, M.; Anguissola-Scotti, I.; Silva, S.
1994-01-01
The chemical non-lethal defoliation of fruit trees might be used to minimize the translocation of radionuclides from the leaves to the fruits and to the internal ligneous tissues, reducing their redistribution in next harvest. The current paper describes a study on vine - a Mediteranian arboreous specie of high economical value. The leaf-fruit translocation of radiocaesium has been analyzed from different points of view, in particular, the possibility of reducing the foliar uptake of such radionuclide by means of a nonlethal defoliation. Vines grown in pots have been directly contaminated in two different years by sprinkling a carrier free solution of 134 Cs on leaves. Grapes have been covered during sprinkling to avoid their direct contamination. Other vines have been defoliated after contamination to evaluate the influence of leaf removal on the radiocaesium translocation to the fruits. The radiocaesium concentration has been determined in grapes at the ripening stage in the must. The radiocaesium interception measured on removed leaves is about 30% of the sprinkled activity. The radioactivity of covered grapes is with 20% lower than uncovered ones. Such a lower activity is likely ascribable only to leaf-fruit translocation without direct contamination of the grapes. The translocation factor expressed as percentage of fruit activity compared to the total intercepted one is about four times lower when the leaf removal treatment is affected just after the contamination. Grapes of plants contaminated a year before have a 134 Cs residual activity about 17 times lower than plants contaminated in the same year. When the vines have been contaminated and defoliated the year before, the residual activity of grapes is about 70 times lower. The ratio between defoliated and non-defoliated plants is still 1:4. Radioactivity of the must is five times lower for defoliated vines than for non-defoliated ones. (author)
Nitrogen side-dress as a strategy to reduce defoliation demages at different growth stages of maize
Directory of Open Access Journals (Sweden)
Luis Sangoi
2014-02-01
Full Text Available Nitrogen can mitigate damages caused by leaf area reduction due to its influence on cell division. This work was carried out aiming to evaluate the efficiency of side-dressing different rates of nitrogen as a management strategy to maize stem defoliation at different growth stages. The experiment was set in Lages, during the 2008/2009 and 2009/2010 growing seasons. The experimental design was a randomized block with split plots. Three defoliation times were tested in the main plot: eight expanded leaves (V8, fifteen expanded leaves (V15 and tasseling (VT, plus a control without defoliation. Four nitrogen rates were assessed in the split-plots: 0, 50, 100 and 200 kg ha-1 of N. Nitrogen was side-dressed at the defoliation day of each growth stage and at V8 in the control. Defoliations performed at V8 did not reduce grain yield, in comparison to the control, regardless of N rate. Side-dressing N rates at V15 increased grain yield, mitigating damages caused by defoliation. Defoliation carried out at VT promoted great grain yield reduction that could not be alleviated with subsequent nitrogen fertilization. The success of nitrogen side-dress as a strategy to minimize maize grain yield losses caused by defoliation depends on the growth stage leaf area reduction occurs.
Reduction of radio-contamination of vines by the method of 'non-lethal defoliation'
International Nuclear Information System (INIS)
Arapis, G.
1998-01-01
This study is included in the European Commission Programme RESSAC (Rehabilitation of Soils and Surfaces after a nuclear Accident). Its objective is to investigate the possibility of using 'non-lethal defoliation' as a countermeasure to mitigate the foliar uptake of radionuclides by plant leaves. We experimented on vines in productive agricultural fields in Spata - Attica, Greece. Interception factors and translocation of radionuclides studies were performed by using 134 Cs as marker. The deposition of 134 Cs was dry. Two pesticides, Harvade 60% FL and Basta 20 S.L., were used as defoliants. Our data showed that the recommended commercial doses of these chemicals resulted in defoliating up to 80% of the plants. We observed a reduction of radioactivity translocation to grapes by half, related to the defoliating degree. The efficacy of Harvade seemed higher than that of Basta. (authors)
THE EFFECT OF PARTIAL DEFOLIATION ON MONOTERPENE LEVELS OF GEWURZTRAMINER WINE (Vitis vinifera L.
Directory of Open Access Journals (Sweden)
Marko Karoglan
2008-07-01
Full Text Available It is well known that different viticultural practices have an important influence on the quality of grapes, must and wine. Aiming to examine impact of partial defoliation we were measured composition of the aromatic components in the wine of Gewurztraminer, winegrowing hills of Zagreb, subregion Prigorje-Bilogora. Partial defoliation, i.e. removing of 4 (D1 and 8 (D2 basal leaves, conducted manually at veraison and grapevines without defoliation (ND-non defoliated were used as control. Samples for analyses were taken after filtration, stabilization and bottling of wine. It was shown that the wine made from completely sun exposed grapes (D2, were the richest in the content of free volatile terpenes (FVT and potentially volatile terpenes (PVT respectively.
Sueki, S.; Healey, J. M.; Acharya, K.
2013-12-01
Saltcedar (tamarisk; Tamarix spp) has become the most widespread invasive plant species in the western United States. Waterways and their corridors have evolved into mono-species stands of saltcedar. Chemical and mechanical methods of tamarisk eradication have been partially effective and prove to be expensive and cause irrepressible damage to natural resources. In the late 1960s, biological control program began in order to reduce the risk of damaging native plants. In 2001, Diorhabda elongate (leaf beetles) was released for open field tests followed by other releases in several locations in the western United States. One of the successful releases occurred in St. George, UT along the Virgin River in 2006. The last few years has seen establishment of large scale populations in the lower Virgin River. Eddy covariance (EC) tower including groundwater monitoring well was set up along the Virgin River near Mesquite, NV in 2010 to monitor effects of tamarisk defoliation on evapotranspiration (ET). Initial 2010 data (pre-beetle) established a baseline for characterization of tamarisk ET and groundwater consumption prior to defoliation of tamarisk. The beetles arrived at the site in late 2010 and established a healthy population at the growing season of 2011. 2010 data compared to the episodic herbivore events, observed at the site in 2011 and 2012, clearly show the direct impact of tamarisk defoliation. The results show that the post-defoliation ET values along with magnitude of diurnal fluctuations, found in the water level record, decreased compared to the pre-defoliation values. However, magnitude of the effects of defoliation seemed to be dependent on growth stage of tamarisk at the time of defoliation. Also, the defoliation periods are short lived as tamarisk quickly recovered and establish new growth. In 2012, the defoliation occurred twice since tamarisk re-foliated quickly after the first defoliation by late summer before beetles started overwintering
Pinkard, E A; Eyles, A; O'Grady, A P
2011-10-01
Productivity of trees can be affected by limitations in resources such as water and nutrients, and herbivory. However, there is little understanding of their interactive effects on carbon uptake and growth. We hypothesized that: (1) in the absence of defoliation, photosynthetic rate and leaf respiration would be governed by limiting resource(s) and their impact on sink limitation; (2) photosynthetic responses to defoliation would be a consequence of changing source:sink relationships and increased availability of limiting resources; and (3) photosynthesis and leaf respiration would be adjusted in response to limiting resources and defoliation so that growth could be maintained. We tested these hypotheses by examining how leaf photosynthetic processes, respiration, carbohydrate concentrations and growth rates of Eucalyptus globulus were influenced by high or low water and nitrogen (N) availability, and/or defoliation. Photosynthesis of saplings grown with low water was primarily sink limited, whereas photosynthetic responses of saplings grown with low N were suggestive of source limitation. Defoliation resulted in source limitation. Net photosynthetic responses to defoliation were linked to the degree of resource availability, with the largest responses measured in treatments where saplings were ultimately source rather than sink limited. There was good evidence of acclimation to stress, enabling higher rates of C uptake than might otherwise have occurred. © 2011 Blackwell Publishing Ltd.
Selection of Gossypium hirsutum genotypes for interspecific ...
African Journals Online (AJOL)
FORRESTER
ARS), Crop Genetics Research Unit in. Stoneville, Mississippi ... Key words: Cotton, germplasm, immature embryo, tissue culture, wide-hybridization. INTRODUCTION. Tetraploid upland cotton, Gossypium hirsutum L., is comprised of over 90% ...
Defoliation management affects morphogenetic and structural ...
African Journals Online (AJOL)
... increase of about 30% on forage and leaf accumulation rates of both grass and legume. Therefore, to enhance productivity and stability when these species are associated we recommend defoliating at 90–95% LI, which represents a canopy height ranging from 26 to 32 cm. Keywords: Arachis pintoi, Brachiaria brizantha, ...
Invasion of Winter Moth in New England: Effects of Defoliation and Site Quality on Tree Mortality
Directory of Open Access Journals (Sweden)
Michael J. Simmons
2014-10-01
Full Text Available Widespread and prolonged defoliation by the European winter moth, Operophtera brumata L., has occurred in forests of eastern Massachusetts for more than a decade and populations of winter moth continue to invade new areas of New England. This study characterized the forests of eastern Massachusetts invaded by winter moth and related the duration of winter moth defoliation estimated using dendrochronology to observed levels of tree mortality and understory woody plant density. Quercus basal area mortality in mixed Quercus and mixed Quercus—Pinus strobus forests in eastern Massachusetts ranged from 0–30%; mortality of Quercus in these forests was related to site quality and the number of winter moth defoliation events. In addition, winter moth defoliation events lead to a subsequent increase in understory woody plant density. Our results indicate that winter moth defoliation has been an important disturbance in New England forests that may have lasting impacts.
The chemical defoliation of Ligitstrum vulgare L. and Spiraea x arguta Zab. shrubs in nursery
Directory of Open Access Journals (Sweden)
Szczepan Marczyński
2015-06-01
Full Text Available To defoliate Ligustrum vulgare and Spiraea x arguta – ethephon, KJ, Mg(ClO32•6H2O, CuSO4•5H2O and (NH42SO4 in various concentrations were used alone or in mixtures. Treating plants with potassium iodide gave the best results. KJ concentrations of 0.05-0,1% and 0.1-0.% were sufficient to defoliate Spiraea and Ligusturm respectively. Magnesium chlorate at concentration of 0.24 and 2% CuSO4 were also effective, the latter however, proved slight harmful to the plants. Spraying with defoliants on Sept. 26 gave better results than treating plants on Sept. 16. Chemical defoliation decreased negligibly the frost resistance of Ligusturm vulgare shrubs.
Foster, Jane R
2017-09-01
Defoliation outbreaks are biological disturbances that alter tree growth and mortality in temperate forests. Trees respond to defoliation in many ways; some recover rapidly, while others decline gradually or die. Functional traits such as xylem anatomy, growth phenology or non-structural carbohydrate (NSC) storage could explain these responses, but idiosyncratic measures used by defoliation studies have frustrated efforts to generalize among species. Here, I test for functional differences with published growth and mortality data from 37 studies, including 24 tree species and 11 defoliators from North America and Eurasia. I synthesized data into standardized variables suitable for numerical models and used linear mixed-effects models to test the hypotheses that responses to defoliation vary among species and functional groups. Standardized data show that defoliation responses vary in shape and degree. Growth decreased linearly or curvilinearly, least in ring-porous Quercus and deciduous conifers (by 10-40% per 100% defoliation), whereas growth of diffuse-porous hardwoods and evergreen conifers declined by 40-100%. Mortality increased exponentially with defoliation, most rapidly for evergreen conifers, then diffuse-porous, then ring-porous species and deciduous conifers (Larix). Goodness-of-fit for functional-group models was strong (R2c = 0.61-0.88), if lower than species-specific mixed-models (R2c = 0.77-0.93), providing useful alternatives when species data are lacking. These responses are consistent with functional differences in leaf longevity, wood growth phenology and NSC storage. When defoliator activity lags behind wood-growth, either because xylem-growth precedes budburst (Quercus) or defoliator activity peaks later (sawflies on Larix), impacts on annual wood-growth will always be lower. Wood-growth phenology of diffuse-porous species and evergreen conifers coincides with defoliation and responds more drastically, and lower axial NSC storage makes them
Effects of defoliation and drought on root food reserves in sugar maple seedlings
Johnson Parker; Johnson Parker
1970-01-01
The artificial defoliation of sugar maple (Acer. saccharum Marsh.) can cause a marked decline in root food reserves, especially starch, and an increase in the levels of the reducing sugars, fructose and glucose. Defoliation can also bring on the dieback-decline syndrome in sugar maples (Parker and Houston 1968). Two experiments designed to examine this question were...
Defoliation effects on pasture photosynthesis and respiration
Ecosystem C gain or loss from managed grasslands can depend on the type and intensity of management practices that are employed. However, limited information is available at the field scale on how the type of defoliation, specifically grazing vs. cutting, affects gross primary productivity (GPP) an...
Dhont, Catherine; Castonguay, Yves; Nadeau, Paul; Bélanger, Gilles; Drapeau, Raynald; Laberge, Serge; Avice, Jean-Christophe; Chalifour, François-P
2006-01-01
The objective of the study was to characterize variations in proline, arginine, histidine, vegetative storage proteins, and cold-inducible gene expression in overwintering roots of field-grown alfalfa, in response to autumn defoliation, and in relation to spring regrowth and winter survival. Field trials, established in 1996 in eastern Canada, consisted of two alfalfa cultivars ('AC Caribou' and 'WL 225') defoliated in 1997 and 1998 either only twice during the summer or three times with the third defoliation taken 400, 500 or 600 growing degree days (basis 5 degrees C) after the second summer defoliation. The root accumulation of proline, arginine, histidine and soluble proteins of 32, 19 and 15 kDa, characterized as alfalfa vegetative storage proteins, was reduced the following spring by an early autumn defoliation at 400 or 500 growing degree days in both cultivars; the 600-growing-degree-days defoliation treatment had less or no effect. Transcript levels of the cold-inducible gene msaCIA, encoding a glycine-rich protein, were markedly reduced by autumn defoliation in 'WL 225', but remained unaffected in the more winter-hardy cultivar 'AC Caribou'. The expression of another cold-inducible gene, the dehydrin homologue msaCIG, was not consistently affected by autumn defoliation. Principal component analyses, including components of root organic reserves at the onset of winter, along with yield and plant density in the following spring, revealed that (a) amino acids and soluble proteins are positively related to the vigour of spring regrowth but poorly related to winter survival and (b) winter survival, as indicated by plant density in the spring, is associated with higher concentrations of cryoprotective sugars in alfalfa roots the previous autumn. An untimely autumn defoliation of alfalfa reduces root accumulation of specific N reserves such as proline, arginine, histidine and vegetative storage proteins that are positively related to the vigour of spring
Narbona, Eduardo; Dirzo, Rodolfo
2010-08-01
Monoecious plants have the capacity to allocate resources separately to male and female functions more easily than hermaphrodites. This can be advantageous against environmental stresses such as leaf herbivory. However, studies showing effects of herbivory on male and female functions and on the interaction with the plant's pollinators are limited, particularly in tropical plants. Here, the effects of experimental defoliation were examined in the monoecious shrub Croton suberosus (Euphorbiaceae), a wasp-pollinated species from a Mexican tropical dry forest. Three defoliation treatments were applied: 0 % (control), 25 % (low) or 75 % (high) of plant leaf area removed. Vegetative (production of new leaves) and reproductive (pistillate and staminate flower production, pollen viability, nectar production, fruit set, and seed set) performance variables, and the abundance and activity of floral visitors were examined. Defoliated plants overcompensated for tissue loss by producing more new leaves than control plants. Production of staminate flowers gradually decreased with increasing defoliation and the floral sex ratio (staminate : pistillate flowers) was drastically reduced in high-defoliation plants. In contrast, female reproductive performance (pistillate flower production, fruit set and seed set) and pollinator visitation and abundance were not impacted by defoliation. The asymmetrical effects of defoliation on male and female traits of C. suberosus may be due to the temporal and spatial flexibility in the allocation of resources deployed by monoecious plants. We posit that this helps to maintain the plant's pollination success in the face of leaf herbivory stress.
Energy Technology Data Exchange (ETDEWEB)
Silva, Tania Maria Sarmento; Camara, Celso Amorim, E-mail: taniasarmento@dq.ufrpe.b [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Quimica; Barbosa-Filho, Jose Maria [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Lab. de Tecnologia Farmaceutica; Giulietti, Ana Maria [Universidade Estadual de Feira de Santana, BA (Brazil). Dept. de Ciencias Biologicas
2010-07-01
The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)
Potential defoliation of trees by outbreak populations of gypsy moth in the Chicago area
David W. Onstad; David J. Nowak; Michael R. Jeffords
1997-01-01
The gypsy moth, Lymantria dispar, will soon become established in much of the Midwest. If an outbreak with extremely high population levels of this serious defoliator is allowed to occur in the Chicago area, what kind of damage can be expected? A model for defoliation, refoliation and mortality was developed based on the number of trees and...
Evolution and Stress Responses of Gossypium hirsutum SWEET Genes.
Li, Wei; Ren, Zhongying; Wang, Zhenyu; Sun, Kuan; Pei, Xiaoyu; Liu, Yangai; He, Kunlun; Zhang, Fei; Song, Chengxiang; Zhou, Xiaojian; Zhang, Wensheng; Ma, Xiongfeng; Yang, Daigang
2018-03-08
The SWEET (sugars will eventually be exported transporters) proteins are sugar efflux transporters containing the MtN3_saliva domain, which affects plant development as well as responses to biotic and abiotic stresses. These proteins have not been functionally characterized in the tetraploid cotton, Gossypium hirsutum , which is a widely cultivated cotton species. In this study, we comprehensively analyzed the cotton SWEET gene family. A total of 55 putative G. hirsutum SWEET genes were identified. The GhSWEET genes were classified into four clades based on a phylogenetic analysis and on the examination of gene structural features. Moreover, chromosomal localization and an analysis of homologous genes in Gossypium arboreum , Gossypium raimondii , and G. hirsutum suggested that a whole-genome duplication, several tandem duplications, and a polyploidy event contributed to the expansion of the cotton SWEET gene family, especially in Clade III and IV. Analyses of cis -acting regulatory elements in the promoter regions, expression profiles, and artificial selection revealed that the GhSWEET genes were likely involved in cotton developmental processes and responses to diverse stresses. These findings may clarify the evolution of G. hirsutum SWEET gene family and may provide a foundation for future functional studies of SWEET proteins regarding cotton development and responses to abiotic stresses.
How does synchrony with host plant affect the performance of an outbreaking insect defoliator?
Fuentealba, Alvaro; Pureswaran, Deepa; Bauce, Éric; Despland, Emma
2017-08-01
Phenological mismatch has been proposed as a key mechanism by which climate change can increase the severity of insect outbreaks. Spruce budworm (Choristoneura fumiferana) is a serious defoliator of North American conifers that feeds on buds in the early spring. Black spruce (Picea mariana) has traditionally been considered a poor-quality host plant since its buds open later than those of the preferred host, balsam fir (Abies balsamea). We hypothesize that advancing black spruce budbreak phenology under a warmer climate would improve its phenological synchrony with budworm and hence increase both its suitability as a host plant and resulting defoliation damage. We evaluated the relationship between tree phenology and both budworm performance and tree defoliation by placing seven cohorts of budworm larvae on black spruce and balsam fir branches at different lags with tree budburst. Our results show that on both host plants, spruce budworm survival and pupal mass decrease sharply when budbreak occurs prior to larval emergence. By contrast, emergence before budbreak decreases survival, but does not negatively impact growth or reproductive output. We also document phytochemical changes that occur as needles mature and define a window of opportunity for the budworm. Finally, larvae that emerged in synchrony with budbreak had the greatest defoliating effect on black spruce. Our results suggest that in the event of advanced black spruce phenology due to climate warming, this host species will support better budworm survival and suffer increased defoliation.
Directory of Open Access Journals (Sweden)
Oyeyemi Adigun DADA
2010-12-01
Full Text Available The effect of defoliation on mineral and food value of two cassava varieties defoliated at varying phenological phases was studied to ascertain the appropriate phenological phase when harvested leaves would contain the optimum mineral and proximate composition, gross energy and the least cyanide content. Two cassava cultivars were subjected to defoliation at varying phenological stages including logarithmic, vegetative and physiological maturity phases. The mineral content was highest at the logarithmic phase than any other phases. The proximate composition of the cassava leaves showed that crude protein was highest at physiological maturity, while the least HCN was observed in cassava defoliated at logarithmic phase. Analysis of mineral and proximate content showed that leaf of the �TMS30572� cultivar had the highest mineral content, fat, fibre, ash, dry matter and gross energy at the logarithm phase while �Oko-Iyawo� had the highest crude protein and HCN at physiological maturity. This study indicates the high potential of cassava leaf as an unconventional source of protein for both humans and animals when defoliated at logarithmic growth phase.
Rengarajan, Rajagopalan; Schott, John R.
2016-09-01
Remote sensing techniques such as change detection are widely used for mapping and monitoring forest cover to detect the declining health and vigor of forests. These techniques rely on the assumption that the biophysical variation in the forest introduces a corresponding variation in its reflectance. The biophysical variations are assessed by foresters, but these assessment techniques are expensive and cannot be performed frequently to identify a specific level of change in the forest, for example, infection due to gypsy moths that results in forest defoliation. Further, the interaction of atmosphere, sensor characteristics, and phenology that are inherent in the remotely sensed images makes it difficult to separate biophysical changes from observational effects. We have addressed these limitations by developing a method to model the spectral reflectance properties of forests with varying degrees of defoliation using the Digital Image and Remote Sensing Image Generation (DIRSIG) tool. This paper discusses the in-canopy radiative approach and the impact of defoliation on the reflectance and radiance observed by sensors such as Landsat. The results indicate that the relative variation in forest reflectance between a non-defoliated and a 30% defoliated deciduous forest can be as high as 10% in the NIR spectral band. A function can be fit to predict the level of defoliation from the relative variation in radiance. The modeling and analysis techniques can be extended to assess the impact of atmospheric factors and sensor characteristics relative to the biophysical changes as well as for assessing other biophysical variables in forests.
Hultine, K.R.; Nagler, P.L.; Dennison, P.E.; Bush, S.E.; Ehleringer, J.R.
2009-01-01
Tamarisk (Tamarix) species are among the most successful and economically costly plant invaders in the western United States, in part due to its potential to remove large amounts of water from shallow aquifers. Accordingly, local, state and federal agencies have released a new biological control - the saltcedar leaf beetle (Diorhabda elongata) along many watersheds in the western United States to reduce the spread of tamarisk. The beetle defoliates tamarisk for much of the growing season resulting in potentially large seasonal declines in productivity, fitness, and water loss from tamarisk stands. We measured sap flux density (Js) using heat dissipation sensors to investigate water use patterns of tamarisk before, during and after a single, six week beetle-induced defoliation event in southeastern, Utah, USA. Granier-style probes were installed on 20 dominant trees from May through September 2008, a period that covers almost the entire growing season. As the beetle emerged from dormancy in mid-June, daytime and nighttime Js measurably increased for approximately two weeks before declining to less than 20% of predicted values (predicted by modeling Js with atmospheric vapor pressure deficit in May and June before defoliation). Tamarisk trees in mid-August produced new leaves and Js returned to pre-defoliation levels. Total Js, summed over the duration of the study was 13% lower than predicted values. These data suggest that defoliation results in only small changes in seasonal water loss from tamarisk stands. Current research is focusing on long-term ecohydrological impacts of tamarisk defoliation over multiple growing seasons.
Karolewski, Piotr; Zadworny, Marcin; Mucha, Joanna; Napierała-Filipiak, Anna; Oleksyn, Jacek
2010-08-01
Understory shrubs are frequently attacked by insect herbivores. However, very little is known regarding possible interactions between light condition, defoliation (D) and fine root vitality (% live roots) and metabolic activity, and whether different plant strategies (compensation, trade-off and equilibrium) to defoliation depend on individual species light requirements. To explore the response of roots to such conditions, an experiment was established in which we experimentally removed 50% of leaves in 1-year-old seedlings of Sambucus nigra, Cornus sanguinea, Prunus serotina, Frangula alnus and Corylus avellana grown in 15% and full sunlight. On average, defoliation leads to a 15% reduction in fine root (vitality (% live roots). However, a statistically significant reduction in root vitality after defoliation was detected only in those species that are less herbivorized in nature (48% in S. nigra and 5% in C. sanguinea). On average, shade conditions (L) resulted in 18% decline in root vitality, and the effects of defoliation were also 22% higher than for plants grown in full light. Root vitality in both treatments (D and L) was significantly correlated with their dry mass, concentration of total phenol (TPh) and carbon to nitrogen ratio, and negatively correlated with nitrogen, soluble carbohydrates, starch and total non-structural carbohydrates (TNC). To a large extent, root vitality and chemistry varied by species. Higher root vitality was related to higher concentrations of phenolics, more than to N and TNC concentrations. Concentrations of phenolics also differed significantly between defoliated plants and controls. However, in defoliated plants, an increase in TPh was observed only in two species, which belong to two different groups in light requirements and susceptibility to insect grazing (C. sanguinea and P. serotina). This study indicated that higher vitality of roots occurred in species that are characterized by higher insect defoliation under natural
Directory of Open Access Journals (Sweden)
Carlos Augusto Rodrigues Matrangolo
2010-09-01
Full Text Available O objetivo deste trabalho foi avaliar os efeitos do desfolhamento total, realizado após o plantio e ao longo do primeiro ano de cultivo, sobre o crescimento de Eucalyptus grandis, desde a implantação até ao corte do povoamento. Foram avaliados cinco tratamentos: sem desfolhamento; um desfolhamento aos 56 dias após o plantio (DAP; dois desfolhamentos, aos 56 e 143 DAP; dois desfolhamentos, aos 56 e 267 DAP; e três desfolhamentos, aos 56, 143 e 278 DAP. Foram mensurados os diâmetros do tronco a 1,3 m e a altura total de 60 árvores por tratamento, em oito avaliações, do 21º ao 92º mês de cultivo. O crescimento médio em cada tratamento foi descrito por modelos de regressão não lineares e comparados por testes de identidade para comparar as tendências entre a testemunha e os demais tratamentos. O desfolhamento causou reduções significativas nas taxas de crescimento em diâmetro e altura das plantas, e diminuição expressiva no faturamento ao final da rotação, mesmo quando realizado uma única vez, no início do plantio. Maiores danos, no entanto, foram verificados após consecutivos desfolhamentos ao longo do primeiro ano de cultivo. A manutenção de áreas que tenham sofrido desfolhamento total na fase inicial de plantio pode tornar-se uma medida economicamente inviável.The objective of this work was to evaluate the effects of total defoliation at planting initial stages, and along the first year of cultivation, on Eucalyptus grandis growth, from planting to plantation cut. Five treatments were tested: without defoliation; one defoliation, at 56th day after planting (DAP; two defoliations, at 56th and 143th DAP; two defoliations, at 56th and 267th DAP; and three defoliations, at 56th, 143th and 278th DAP. Trunk diameter at 1.30-m height and the total height of 60 trees were measured from the 21st to the 92th cultivation months. The average growth of each treatment was described by nonlinear models and compared by identity
Barbara S. Burns; Henry, Jr. Trial
2000-01-01
Following an outbreak of spring hemlock looper in 1991, ten hemlocks in each of fifteen study plots were monitored annually through 1999. Although some mortality occurred within two years after defoliation, and additional mortality occurred in plots which were subsequently disturbed by logging, most defoliated trees recovered. Twenty-four percent of the trees with 90%...
Delaney, Kevin J; Higley, Leon G
2006-07-01
One type of specialised herbivory receiving little study even though its importance has frequently been mentioned is vein cutting. We examined how injury to a leaf's midrib vein impairs gas exchange, whether impairment occurs downstream or upstream from injury, duration of impairment, compared the severity of midrib injury with non-midrib defoliation, and modelled how these two leaf injuries affect whole-leaf photosynthesis. Leaf gas exchange response to midrib injury was measured in five Asclepiadaceae (milkweed), one Apocynaceae (dogbane), one Polygonaceae and one Fabaceae species, which have been observed or reported to have midrib vein cutting injury in their habitats. Midrib vein injury impaired several leaf gas exchange parameters, but only downstream (distal) from the injury location. The degree of gas exchange impairment from midrib injury was usually more severe than from manually imposed and actual insect defoliation (non-midrib), where partial recovery occurred after 28 d in one milkweed species. Non-midrib tissue defoliation reduced whole-leaf photosynthetic activity mostly by removing photosynthetically active tissue, while midrib injury was most severe as the injury location came closer to the petiole. Midrib vein cutting has been suggested to have evolved as a countermeasure to deactivate induced leaf latex or cardenolide defences of milkweeds and dogbanes, yet vein cutting effects on leaf physiology seem more severe than the non-midrib defoliation the defences evolved to deter.
Joseph P. Spruce; Steven Sader; Robert E. Ryan; James Smoot; Philip Kuper; al. et.
2011-01-01
This paper discusses an assessment of Moderate Resolution Imaging Spectroradiometer (MODIS) time-series data products for detecting forest defoliation from European gypsy moth (Lymantria dispar). This paper describes an effort to aid the United States Department of Agriculture (USDA) Forest Service in developing and assessing MODIS-based gypsy moth defoliation...
Use of 10,129 singleton SNPs of known genomic location in tetraploid cotton provided unique opportunities to characterize genome-wide diversity among 440 Gossypium hirsutum and 219 G. barbadense cultivars and landrace accessions of widespread origin. Using the SNPs distributed genome-wide, we exami...
(Gossypium hirsutum L.) CONTRE LA FUSARIOSE EFFECT ...
African Journals Online (AJOL)
EFFECT OFOLIGOSACCHARIDE FRACTION OF Fusarium oxysporum f. sp. vasinfectum ON COTTON PROTECTION (Gossypium hirsutum L.) AGAINST FUSARIUM WILT. R. A. N'GORAN épse BLA1,2, H. T. KOUAKOU2, F. K. Y. KONAN2, B. CAMARA1,. N. K. KOUASSI3 et D. KONE1. 1Laboratoire de Physiologie Végétale, ...
Spruce, Joseph P.; Ryan, Robert E.; Smoot, James C.; Prados, Donald; McKellip, Rodney; Sader. Steven A.; Gasser, Jerry; May, George; Hargrove, William
2007-01-01
A NASA RPC (Rapid Prototyping Capability) experiment was conducted to assess the potential of VIIRS (Visible/Infrared Imager/Radiometer Suite) data for monitoring non-native gypsy moth (Lymantria dispar) defoliation of forests. This experiment compares defoliation detection products computed from simulated VIIRS and from MODIS (Moderate Resolution Imaging Spectroradiometer) time series products as potential inputs to a forest threat EWS (Early Warning System) being developed for the USFS (USDA Forest Service). Gypsy moth causes extensive defoliation of broadleaved forests in the United States and is specifically identified in the Healthy Forest Restoration Act (HFRA) of 2003. The HFRA mandates development of a national forest threat EWS. This system is being built by the USFS and NASA is aiding integration of needed satellite data products into this system, including MODIS products. This RPC experiment enabled the MODIS follow-on, VIIRS, to be evaluated as a data source for EWS forest monitoring products. The experiment included 1) assessment of MODIS-simulated VIIRS NDVI products, and 2) evaluation of gypsy moth defoliation mapping products from MODIS-simulated VIIRS and from MODIS NDVI time series data. This experiment employed MODIS data collected over the approximately 15 million acre mid-Appalachian Highlands during the annual peak defoliation time frame (approximately June 10 through July 27) during 2000-2006. NASA Stennis Application Research Toolbox software was used to produce MODIS-simulated VIIRS data and NASA Stennis Time Series Product Tool software was employed to process MODIS and MODIS-simulated VIIRS time series data scaled to planetary reflectance. MODIS-simulated VIIRS data was assessed through comparison to Hyperion-simulated VIIRS data using data collected during gypsy moth defoliation. Hyperion-simulated MODIS data showed a high correlation with actual MODIS data (NDVI R2 of 0.877 and RMSE of 0.023). MODIS-simulated VIIRS data for the same
Arbellay, Estelle; Jarvis, Ingrid; Chavardès, Raphaël D; Daniels, Lori D; Stoffel, Markus
2018-05-19
Reconstructions of defoliation by larch bud moth (LBM, Zeiraphera diniana Gn.) based on European larch (Larix decidua Mill.) tree rings have unraveled outbreak patterns over exceptional temporal and spatial scales. In this study, we conducted tree-ring analyses on 105 increment cores of European larch from the Valais Alps, Switzerland. The well-documented history of LBM outbreaks in Valais provided a solid baseline for evaluating the LBM defoliation signal in multiple tree-ring parameters. First, we used tree-ring width measurements along with regional records of LBM outbreaks to reconstruct the occurrence of these events at two sites within the Swiss Alps. Second, we measured earlywood width, latewood width and blue intensity, and compared these parameters with tree-ring width to assess the capacity of each proxy to detect LBM defoliation. A total of six LBM outbreaks were reconstructed for the two sites between AD 1850 and 2000. Growth suppression induced by LBM was, on average, highest in latewood width (59%), followed by total ring width (54%), earlywood width (51%) and blue intensity (26%). We show that latewood width and blue intensity can improve the temporal accuracy of LBM outbreak reconstructions, as both proxies systematically detected LBM defoliation in the first year it occurred, as well as the differentiation between defoliation and non-defoliation years. This study introduces blue intensity as a promising new proxy of insect defoliation and encourages its use in conjunction with latewood width.
Impact of grape cluster defoliation on TDN potential in cool climate Riesling wines
Directory of Open Access Journals (Sweden)
Schüttler Armin
2015-01-01
Full Text Available Many cool climate grape vine growing regions are and will be affected by the global climate change. It is likely that increasing temperatures, as well as changing precipitation pattern will impact the wines’ composition and wine styles. In the last decades the sensory concept of German Riesling wines was considered to represent fresh and fruity notes. However, aged wines of this variety are characterized by petrol like aroma, which is not appreciated in modern Riesling wines. The C13-norisoprenoid 1,1,6-trimethyl-1,2-dihydronaphthalene (TDN is considered to be the marker compound for this undesired sensory impression. The biogenesis of this compound is impacted by grape vine growth conditions. Wines made from Riesling grapes grown in warmer climates have higher concentrations of TDN. Therefore “TDN management” will be one of the most challenging tasks in viticulture in Riesling growing regions in general and particularly in cool climate regions. Two approaches considered are the canopy management of the grape vines as well as an appropriate selection of yeast strain for alcoholic fermentation. Therefore, the aim of this project was to study the impact of grape zone defoliation on potential TDN concentrations in grapes, must and finished wines under cool climate conditions, in example of regional conditions of the landmark Hessische Bergstraße, in com- bination with the usage of two commercially available yeast strains during alcoholic fermentation. The experiment consisted of four treatments in a balanced incomplete block design, grape zone defoliation at berry set on the eastern side of the canopy, grape zone defoliation at berry set on eastern and western side of the canopy, grape zone defoliation at veraison on eastern and western side of the canopy, and a non-defoliated treatment. The treatments and repetitions were harvested separately, pressed, and then fermented with two different commercial Saccharomyces cerevisiae strains. Grape
Aguadé, D; Poyatos, R; Gómez, M; Oliva, J; Martínez-Vilalta, J
2015-03-01
Drought-related tree die-off episodes have been observed in all vegetated continents. Despite much research effort, however, the multiple interactions between carbon starvation, hydraulic failure and biotic agents in driving tree mortality under field conditions are still not well understood. We analysed the seasonal variability of non-structural carbohydrates (NSCs) in four organs (leaves, branches, trunk and roots), the vulnerability to embolism in roots and branches, native embolism (percentage loss of hydraulic conductivity (PLC)) in branches and the presence of root rot pathogens in defoliated and non-defoliated individuals in a declining Scots pine (Pinus sylvestris L.) population in the NE Iberian Peninsula in 2012, which included a particularly dry and warm summer. No differences were observed between defoliated and non-defoliated pines in hydraulic parameters, except for a higher vulnerability to embolism at pressures below -2 MPa in roots of defoliated pines. No differences were found between defoliation classes in branch PLC. Total NSC (TNSC, soluble sugars plus starch) values decreased during drought, particularly in leaves. Defoliation reduced TNSC levels across tree organs, especially just before (June) and during (August) drought. Root rot infection by the fungal pathogen Onnia P. Karst spp. was detected but it did not appear to be associated to tree defoliation. However, Onnia infection was associated with reduced leaf-specific hydraulic conductivity and sapwood depth, and thus contributed to hydraulic impairment, especially in defoliated pines. Infection was also associated with virtually depleted root starch reserves during and after drought in defoliated pines. Moreover, defoliated and infected trees tended to show lower basal area increment. Overall, our results show the intertwined nature of physiological mechanisms leading to drought-induced mortality and the inherent difficulty of isolating their contribution under field conditions. © The
Directory of Open Access Journals (Sweden)
Tania Maria Sarmento Silva
2010-01-01
Full Text Available The phaeophorbide ethyl ester named Purpurin-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm.
Effects of late defoliations on chemical and sensory characteristics of cv. uva longanesi wines
Tessarin, P; Boliani, A. C; Botelho, R. V; Rusin, C; Versari, A; Parpinello, G. P; Rombolà, A. D
2014-01-01
In this study we investigated the effects of late leaf removal on the berry and wine composition and on wine sensory characteristics of Uva Longanesi, a late maturing red Italian grape variety, which wines are characterized by high levels of alcohol and excessive astringency, the latter apparently intensified by late defoliation practices. During 2008 season, spur-pruned trained vines were submitted to manual defoliation (4 basal leaves) at the onset (DEF I, 210 DOY) or at the end (DEF II, 23...
Directory of Open Access Journals (Sweden)
Wei Liu
2018-01-01
Full Text Available Terpenes are the largest and most diverse class of secondary metabolites in plants and play a very important role in plant adaptation to environment. 3-Hydroxy-3-methylglutaryl coenzyme A reductase (HMGR is a rate-limiting enzyme in the process of terpene biosynthesis in the cytosol. Previous study found the HMGR genes underwent gene expansion in Gossypium raimondii, but the characteristics and evolution of the HMGR gene family in Gossypium genus are unclear. In this study, genome-wide identification and comparative study of HMGR gene family were carried out in three Gossypium species with genome sequences, i.e., G. raimondii, Gossypium arboreum, and Gossypium hirsutum. In total, nine, nine and 18 HMGR genes were identified in G. raimondii, G. arboreum, and G. hirsutum, respectively. The results indicated that the HMGR genes underwent gene expansion and a unique gene cluster containing four HMGR genes was found in all the three Gossypium species. The phylogenetic analysis suggested that the expansion of HMGR genes had occurred in their common ancestor. There was a pseudogene that had a 10-bp deletion resulting in a frameshift mutation and could not be translated into functional proteins in G. arboreum and the A-subgenome of G. hirsutum. The expression profiles of the two pseudogenes showed that they had tissue-specific expression. Additionally, the expression pattern of the pseudogene in the A-subgenome of G. hirsutum was similar to its paralogous gene in the D-subgenome of G. hirsutum. Our results provide useful information for understanding cytosolic terpene biosynthesis in Gossypium species.
Directory of Open Access Journals (Sweden)
Alina Basak
2015-06-01
Full Text Available In most cases 2-year-old trees of 3 cultivars responded better to defoliants than 1-year-old ones. Spraying with defoliants on September 25 - 28 was more effective than spraying 10 days earlier. There was also more bark injury in the autumn, and more frost injury on trees defoliated on the ealier date. Mg(ClO32 seemed to be the best defoliant but markedly decreased the frost resistance of McIntosh trees. Defoliants investigated may be applied to limited extent to 2-year-old trees but not to 1-year-old ones.
Poyatos, Rafael; Aguadé, David; Galiano, Lucía; Mencuccini, Maurizio; Martínez-Vilalta, Jordi
2013-10-01
Drought-induced defoliation has recently been associated with the depletion of carbon reserves and increased mortality risk in Scots pine (Pinus sylvestris). We hypothesize that defoliated individuals are more sensitive to drought, implying that potentially higher gas exchange (per unit of leaf area) during wet periods may not compensate for their reduced photosynthetic area. We measured sap flow, needle water potentials and whole-tree hydraulic conductance to analyse the drought responses of co-occurring defoliated and nondefoliated Scots pines in northeast Spain during typical (2010) and extreme (2011) drought conditions. Defoliated Scots pines showed higher sap flow per unit leaf area during spring, but were more sensitive to summer drought, relative to nondefoliated pines. This pattern was associated with a steeper decline in soil-to-leaf hydraulic conductance with drought and an enhanced sensitivity of canopy conductance to soil water availability. Near-homeostasis in midday water potentials was observed across years and defoliation classes, with minimum values of -2.5 MPa. Enhanced sensitivity to drought and prolonged periods of near-zero gas exchange were consistent with low levels of carbohydrate reserves in defoliated trees. Our results support the critical links between defoliation, water and carbon availability, and their key roles in determining tree survival and recovery under drought. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Alina Basak; A. Czynczyk; L. S. Jankiewicz
2015-01-01
In most cases 2-year-old trees of 3 cultivars responded better to defoliants than 1-year-old ones. Spraying with defoliants on September 25 - 28 was more effective than spraying 10 days earlier. There was also more bark injury in the autumn, and more frost injury on trees defoliated on the ealier date. Mg(ClO3)2 seemed to be the best defoliant but markedly decreased the frost resistance of McIntosh trees. Defoliants investigated may be applied to limited extent to 2-year-old trees but not to ...
Directory of Open Access Journals (Sweden)
Maria Angélica Damascos
2005-11-01
Full Text Available Morphological and physiological leaf traits were studied on control and defoliated potted Leandra lacunosa young plants. After defoliation, remaining bottom leaves showed no significant change in net photosynthesis and stomatal conductance values with time, but the leaf transpiration rate was higher. The production of the new leaves was greater after defoliation in top defoliated plants. Bottom defoliated plants increased stem extension rates and net photosynthesis transitorily. Two months after defoliation, control and defoliated plants did not differ in stem length and root dry mass values. In spite of smaller area and photosynthetic capacity, remaining bottom leaves were able to compensate top leaves elimination. The effectiveness of this compensatory response, however, depended on the ability of new leaves to escape from herbivores.Características morfológicas e fisiológicas foliares foram estudadas em indivíduos jovens envasados de Leandra lacunosa que sofreram desfolhamento e em indivíduos controle. Após o desfolhamento, as folhas remanescentes da parte inferior não apresentaram mudanças significativas dos valores de fotossíntese e condutância estomática. Entretanto, a taxa de transpiração foliar foi maior quando comparada com plantas desfolhadas em porções inferiores. A rebrota de folhas foi maior após o desfolhamento da parte superior. Nas plantas desfolhadas em porções inferiores, ocorreu, momentaneamente, aumento da taxa fotossintética e da extensão do caule. Após dois meses de desfolhamento as plantas controle e desfolhadas não diferiram quanto aos valores do comprimento do caule e massa seca da raiz. Portanto, apesar da menor área foliar e menor capacidade fotossintética, as folhas na parte inferior foram capazes de compensar a eliminação das folhas superiores. A efetividade desta resposta compensatória, no entanto, dependerá da habilidade das novas folhas emitidas escaparem do ataque dos herbívoros.
KUTUN : a morphogenetic model for cotton (Gossypium hirsitum L.)
Mutsaers, H.J.W.
1982-01-01
A whole crop model for growth and development of cotton ( Gossypium hirsutum L.) is presented. The model is based on previous extensive studies on plant morphogenesis, growth of fruits and canopy photosynthesis. The crop model basically is a carbohydrate budget, but all
Grass defoliation affecting survival and growth of seedlings of ...
African Journals Online (AJOL)
Two experiments were conducted, one in the field and the other in the greenhouse, to investigate the effects of the intensity and frequency of grass defoliation on the survival and growth of Acacia karroo seedlings. In the greenhouse, seedlings growing with heavily clipped grasses had higher biomass production than those ...
Ethyl ester purpurine-18 from Gossypium mustelinum (Malvaceae)
International Nuclear Information System (INIS)
Silva, Tania Maria Sarmento; Camara, Celso Amorim; Barbosa-Filho, Jose Maria; Giulietti, Ana Maria
2010-01-01
The phaeophorbide ethyl ester named Purpurine-18 and the flavonoids quercetin and kaempferol were obtained by chromatographic procedures from the chloroform fraction of aerial parts of Gossypium mustelinum. The structure of these compound was determined by NMR, IR and mass spectra data analysis. This is the first occurrence of this compound in Angiosperm. (author)
Directory of Open Access Journals (Sweden)
Simone Pedro da Silva
2013-07-01
Full Text Available The experiment was carried out to evaluate the patterns of defoliation in plants of various heights in the same pasture of Brachiaria decumbens cv. Basilisk under continuous stocking with cattle. Four plant heights were evaluated (10, 20, 30 and 40 cm in the same managed sward, with mean height equal to 25 cm. A randomized blocks design was used, with two replications. Defoliation frequency increased linearly along with plant height in the same pasture. Defoliation intensity, number of defoliations in leaf blade and percentage of leaf blade grazed per tiller also increased linearly along with plant height. The defoliation interval decreased linearly according to plant height. The quadratic model was adequately fitted into grazing efficiency data, reaching the highest value (98% at the sward site with 35 cm plants. The percentage variation in signal grass height showed a negative linear response with initial plant height. The structure of the pasture, characterized by the diversity in plant heights, is simultaneously the cause and consequence of the variability in defoliation patterns in individual tillers, which occur on the horizontal plane of the pasture.
Defoliation effects of perennial grasses – continuing confusion | DL ...
African Journals Online (AJOL)
Although an adequate knowledge of growth patterns and defoliation effects in perennial grasses is a prerequisite for the rational use of veld and pastures for animal production, our knowledge of this subject is far from adequate. The results of various physiological and clipping studies on tropical and sub-tropical grasses are ...
Association mapping of resistance to Verticillium wilt in Gossypium ...
African Journals Online (AJOL)
Verticillium wilt is a major disease affecting the growth of cotton. For screening the resistant genes, 320 Gossypium hirsutum germplasms were evaluated in Verticillium nursery, and association mapping was used to detect the markers associated with the Verticillium wilt resistance. 106 microsatellite marker primer pairs ...
Zhang, Meiping; Rong, Ying; Lee, Mi-Kyung; Zhang, Yang; Stelly, David M; Zhang, Hong-Bin
2015-10-01
Cotton is the world's leading textile fiber crop and is also grown as a bioenergy and food crop. Knowledge of the phylogeny of closely related species and the genome origin and evolution of polyploid species is significant for advanced genomics research and breeding. We have reconstructed the phylogeny of the cotton genus, Gossypium L., and deciphered the genome origin and evolution of its five polyploid species by restriction fragment analysis of repeated sequences. Nuclear DNA of 84 accessions representing 35 species and all eight genomes of the genus were analyzed. The phylogenetic tree of the genus was reconstructed using the parsimony method on 1033 polymorphic repeated sequence restriction fragments. The genome origin of its polyploids was determined by calculating the diploid-polyploid restriction fragment correspondence (RFC). The tree is consistent with the morphological classification, genome designation and geographic distribution of the species at subgenus, section and subsection levels. Gossypium lobatum (D7) was unambiguously shown to have the highest RFC with the D-subgenomes of all five polyploids of the genus, while the common ancestor of Gossypium herbaceum (A1) and Gossypium arboreum (A2) likely contributed to the A-subgenomes of the polyploids. These results provide a comprehensive phylogenetic tree of the cotton genus and new insights into the genome origin and evolution of its polyploid species. The results also further demonstrate a simple, rapid and inexpensive method suitable for phylogenetic analysis of closely related species, especially congeneric species, and the inference of genome origin of polyploids that constitute over 70 % of flowering plants.
Directory of Open Access Journals (Sweden)
Willian Rodrigues Macedo
2010-12-01
Full Text Available Com o objetivo de avaliar os efeitos das doses de ácido giberélico (AG3 e do thidiazuron (TDZ nas características dos cachos e bagas da uva ‘Centennial Seedless’, um experimento foi realizado em um vinhedo comercial em São Miguel Arcanjo (SP. Os tratamentos consistiram de AG3 nas doses de 0 e 5 mg L-1 associados às doses de 0, 2, 4, 6, 8 e 10 mg L-1 de TDZ, sendo estes reguladores vegetais aplicados aos 15 dias após o pleno florescimento, via pulverização direta nos cachos. Foram avaliadas as variáveis diâmetro do pedicelo, índice de esbagoamento, massa, comprimento e largura dos cachos, bagas e engaços; teores de sólidos solúveis, pH, acidez titulável e relação SS/AT do mosto. A dose de 8 mg L-1 de TDZ associada a 5 mg L-1 de AG3, resultou em maiores médias de massa, comprimento e largura dos cachos, sendo que esta interação não alterou o pH, a relação SS/AT e o índice de esbagoamento dos cachos. O TDZ promoveu aumentos lineares sobre a massa e largura das bagas e reduziu os teores de sólidos solúveis, sendo que do ponto de vista agronômico a dose de 8 mg L-1, apresentou-se mais promissora para uso comercial.Abstract With the objective of evaluating the effects of gibberellic acid (GA3 and thidiazuron (TDZ on the physicochemical characteristics of ‘Centennial Seedless’ table grapes a trial was carried out in a commercial vineyard located in São Miguel Arcanjo (SP, Brazil. The treatments consisted of GA3 on the doses at 0 and 5 mg L-1 associated to 0, 2, 4, 6, 8 and 10 mg L-1 of thidiazuron, applied 15 days after full bloom, sprayed directly to the clusters. The following variables were evaluated: pedicel diameter, drop index, weight, length and width of clusters, berries and rachis; soluble solutes content, pH, titratable acidity and ratio SS/TA of the juice. The dose at 8 mg L-1 of TDZ associated to 5 mg L-1 of AG3 resulted in the highest means of cluster weight, length and width, this interaction did not
Trough and pot crop systems with leaching recirculation and defoliation levels for mini tomatoes
Directory of Open Access Journals (Sweden)
Lais Perin
2017-11-01
Full Text Available The use of raw rice husk as substrate allows the use of crop systems that promote the recirculation of leachate in long crop cycles. Mini tomatoes present relatively low demand for photoassimilates. Thus, partial defoliation of the sympodium could benefit the crop without damage to the production or quality of the fruits. The objective of this work was to evaluate the plant growth, fruit yield and fruit quality of Cherry Hybrid Wanda and Grape Hybrid Dolcetto mini tomatoes cultivated in two recirculation crop systems (pots and troughs, using raw rice husk as substrate, under three defoliation conditions (without defoliation, removal of one and two leaves of the sympodium. The Cherry cultivar showed higher plant growth, fruit yield and mean fruit size. The Grape cultivar produced fruits with higher sugar concentration. For the Grape cultivar, the removal of one sympodium leaf did not affect the plant responses. However, for the Cherry cultivar, it was necessary to maintain the complete sympodium. The trough cultivation system improved plant growth and yield, whereas the pot system increased fruit sugar concentration.
Using dendrochronology to measure radial growth of defoliated trees
Thomas W. Swetnam; Marna Ares Thompson; Elaine Kennedy. Sutherland
1985-01-01
Budworms (Choristoneura spp.) have repeatedly defoliated millions of hectares of conifers throughout North America. The seriousness of the problem is underscored by research findings in eastern Canada and the northern U.S. Rocky Mountains that the extent, severity, and frequency of bud worm outbreaks have increased in the 20th century, primarily as a result of human-...
Chemical-Free Cotton Defoliation by; Mechanical, Flame and Laser Girdling
Directory of Open Access Journals (Sweden)
Mathew G. Pelletier
2017-01-01
Full Text Available A novel new way to achieve chemical-free defoliation of cotton is discussed. The research found that by severing the phloem tissue on the main stalk, via a girdling operation, the operation stimulated the cotton plant to alter its growth into an early senescence pathway that resulted in the plant shedding its leaves and opening up all its bolls, leaving the plant in the perfect state for machine harvesting. Even with follow-up rains, zero regrowth occurred in the treated plants, unlike the untreated control plots where significant regrowth did occur. This report compares the results of greenhouse and field trials where the girdling operation was performed by hand, flame, mechanical and via a CO2 laser to achieve phloem tissue severance. Design parameters for a prototype laser girdling system are also provided. Results suggest that for deficit irrigated cotton, girdling can provide an alternative means to defoliate cotton.
This study investigated the effect of defoliation prior to a frost on postharvest storage properties of sugarbeet (Beta vulgaris L.). Roots of plants with canopies intact until harvest were compared to roots of plants that had been defoliated prior to a frost on multiple harvest dates following a da...
Multiple shoot regeneration of cotton (Gossypium hirsutum L.) via ...
African Journals Online (AJOL)
user
2011-03-14
Mar 14, 2011 ... Induction of multiple shoots of cotton (Gossypium hirsutum L.) plant in two commercial varieties (Sahel and Varamin) using shoot apex was done. Explants were isolated from 3 - 4 days old seedlings, then they were cultured on a shoot induction media, modified MS nutrient agar with combinations: 1- ...
Cloning and Functional Analysis of the Promoter of an Ascorbate Oxidase Gene from Gossypium hirsutum
Xin, Shan; Tao, Chengcheng; Li, Hongbin
2016-01-01
Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibite...
Utilization of bio-waste cotton ( Gossypium hirsutum L.) stalks and ...
African Journals Online (AJOL)
... three-layer particleboard containing different cotton (Gossypium hirsutum L.) stalks and underutilized paulownia (paulownia fortunie) wood particle ratios (30, 50 and 70%) using urea formaldehyde resin. Addition of cotton stalk and paulownia wood in particleboard improved mechanical properties of resulting composites ...
Šuklje, Katja; Antalick, Guillaume; Buica, Astrid; Langlois, Jennifer; Coetzee, Zelmari A; Gouot, Julia; Schmidtke, Leigh M; Deloire, Alain
2016-02-01
The aim of this study, performed on Sauvignon blanc clones SB11 and SB316, grafted on the same rootstock 101-14 Mgt (Vitis riparia × V. ruperstris) and grown at two adjacent vineyards, was two-fold: (1) to study wine chemical and sensory composition of both clones within an unaltered canopy; and (2) to determine the effect of defoliation (e.g. bunch microclimate) on wine chemical and sensory composition. Orthogonal projection to latent structures discriminate analysis (OPLS-DA) was applied to the concentration profiles of volatile compounds derived from gas chromatography-mass spectrometry data. The loadings directions inferred that 3-isobutyl-2-methoxypyrazine (IBMP) discriminated control treatments (shaded fruit zone) of both clones from defoliation treatments (exposed fruit zone), whereas 3-sulfanyl-hexan-1-ol (3SH), 3-sulfanylhexyl acetate (3SHA), hexanol, hexyl hexanoate and some other esters discriminated defoliated treatments from the controls. The OPLS-DA indicated the importance of IBMP, higher alcohol acetates and phenylethyl esters, for discrimination of clone SB11 from clone SB316 irrespective of the treatment. Defoliation in the fruit zone significantly decreased perceived greenness in clone SB11 and elevated fruitier aromas, whereas in clone SB316 the effect of defoliation on wine sensory perception was less noticeable regardless the decrease in IBMP concentrations. These findings highlight the importance of clone selection and bunch microclimate to diversify produced wine styles. © 2015 Society of Chemical Industry.
The influence of defoliation and moisture on the tannin and ...
African Journals Online (AJOL)
To determine whether tannin and total polyphenol contents of Portulacaria afra change owing to damage, different trees were subjected to three intensities of defoliation, namely, none, fifty and ninety per cent. In addition, the influence of an improved water supply through irrigation was determined. Results showed an initial ...
Hultine, K. R.; Nagler, P. L.; Dennison, P. E.
2008-12-01
Tamarisk (Tamarix) species are among the most successful plant invaders in the western United States, and has had significant impacts on watershed hydrology and water resources. Accordingly, local, state and federal agencies have undertaken considerable efforts to eradicate tamarisk and restore riparian habitats to pre-invasion status. A biological control - the saltcedar leaf beetle (Diorhabda elongata) - was released in the summer of 2004 at several locations in eastern Utah, USA to control the spread and impact of tamarisk within the Colorado River watershed. Beginning in April of 2008, sap flux techniques were used to monitor changes in transpiration fluxes in response to canopy defoliation by the beetle. Specifically we installed modified (10 mm length) heat dissipation probes into the main stem of 20 mature tamarisk trees within a single stand on the Colorado Plateau. In July, the saltcedar leaf beetle reduced the total leaf area to near 0% of pre-beetle invasion status. Consequently, sap flux declined by up to 80% compared to pre-beetle invasion fluxes. By mid-August, refoliation of the canopy occurred, and sap flux rates returned to pre- defoliation status. Sap flux rates prior to defoliation were modeled against atmospheric vapor pressure deficit in order to predict the amount of water salvage from defoliation. Sap flux from June 1 through September 1 was on average 36% lower than predicted values. Combined with scaling techniques, the heat dissipation approach shows a high potential for monitoring changes in watershed hydrology in response to tamarisk defoliation by the saltcedar leaf beetle. Nevertheless, tamarisk sap flux studies with heat dissipation probes presents several challenges, including, narrow sapwood depth, low flux rates in response to defoliation, and large thermal gradients that are inevitable in warm climates (particularly after defoliation removes canopy shading). We will present results from ongoing research to address these potential
Energy Technology Data Exchange (ETDEWEB)
Ferretti, Marco [Dipartimento di Biologia Vegetale, Universita di Firenze, Piazzale Cascine 28, I-50144 Florence (Italy)]. E-mail: m.ferretti@linnaea.it; Calderisi, Marco [Dipartimento di Biologia Vegetale, Universita di Firenze, Piazzale Cascine 28, I-50144 Florence (Italy)]. E-mail: calderisi@chemiometria.it; Bussotti, Filippo [Dipartimento di Biologia Vegetale, Universita di Firenze, Piazzale Cascine 28, I-50144 Florence (Italy)]. E-mail: filippo.bussotti@unifi.it
2007-02-15
The relationships between crown defoliation of beech, visible foliar symptoms on native vegetation and ozone exposure were investigated on permanent monitoring sites in South-Western Europe in the years 2000-2002. Relationships between defoliation of beech and O{sub 3} (seasonal mean, 2-week maximum, AOT40) were investigated by means of multiple regression models (11 plots, 1-3 years of data each) and a model based on temporal autocorrelation of defoliation data (14 plots, 1-3 years of data each). Different multiple regression techniques were used. The four models generated (R {sup 2} = 0.71-0.85, explained variance in cross-validation 61-78%) identified several significant predictors of defoliation, with AOT40 (p = 0.008) and foliar content of phosphorous (p = 0.0002-0.0004) being common to all models. The autocorrelation model (R {sup 2} = 0.55; p < 0.0001) was used to calculate expected defoliation on the basis of the previous year's defoliation, and model predictions were used as an estimate of expected defoliation under constant site and environmental condition. Residuals (predicted-measured) plotted against current AOT40 shows that a possible effect of ozone occurs only at very high AOT40 (>35,000 ppbh). O{sub 3}-like visible foliar symptoms were recorded on 65 species at 47% of the common monitoring sites in 2001 and 38% in 2002. No relationship was found between O{sub 3} exposure, frequency of symptomatic sites and frequency of species with symptoms (R {sup 2} = 0.11; p > 0.05). A number of questions related to the ecological and methodological basis of the survey were identified. Inherent sampling and non-sampling errors and multicollinearity of the data suggest great caution when examining results obtained from mensurational, correlative studies. - Ozone AOT40 was identified as a significant predictor of defoliation of beech, but a limited relationship was found between ozone exposure and visible symptoms on native vegetation.
Dobbertin, Matthias; Hug, Christian; Mizoue, Nobuya
2004-11-01
In this study we used photographs of tree crowns to test whether the assessment methods for tree defoliation in Switzerland have changed over time. We randomly selected 24 series of slides of Norway spruce with field assessments made between 1986 and 1995. The slides were randomly arranged and assessed by three experts without prior knowledge of the year when the slide was taken or the tree number. Defoliation was assessed using the Swiss reference photo guide. Although the correlations between the field assessments and slide assessments were high (Spearman's rank correlation coefficient ranged between 0.79 and 0.83), we found significant differences between field and slide assessments (4.3 to 9% underprediction by the slide assessors) and between the slide assessments. However, no significant trends in field assessment methods could be detected. When the mean differences between field and slide assessments were subtracted, in some years, field assessors consistently underpredicted (1990, 1992) or overpredicted defoliation (1987, 1991). Defoliation tended to be overpredicted in slides taken against the light, and underpredicted for trees with more than 25% crown overlap. We conclude that slide series can be used to detect changes in assessment methods. However, potential observer bias calls for more objective methods of assessment.
Nitrogen side-dress as a strategy to reduce defoliation demages at different growth stages of maize
Luis Sangoi; Gilmar José Picoli Junior; Vitor Paulo Vargas; Jefferson Vieira; Amauri Schmitt; Sérgio Roberto Zoldan; Eduardo Siega; Giovani Carniel
2014-01-01
Nitrogen can mitigate damages caused by leaf area reduction due to its influence on cell division. This work was carried out aiming to evaluate the efficiency of side-dressing different rates of nitrogen as a management strategy to maize stem defoliation at different growth stages. The experiment was set in Lages, during the 2008/2009 and 2009/2010 growing seasons. The experimental design was a randomized block with split plots. Three defoliation times were tested in the main plot: eight expa...
Effect of the intensity and phenophase of defoliation and water ...
African Journals Online (AJOL)
A field study was conducted with Acacia karroo plant to determine changes in relative photosynthetic rates, the extent of carbohydrate reserve depletion and the rate reserves take to recover, following defoliation by goats at different intensities and phenophases, at a "wet" and a "dry" site. The rate of photosynthesis of fully ...
Directory of Open Access Journals (Sweden)
Juliana Domingues Lima
Full Text Available ABSTRACT: Defoliation caused by Black Sigatoka in yield and quality of banana 'Nanica' was stimulated in this study. A completely randomized 2x8 factorial design with six repetitions was used, in which period of bunch formation and number of leaves at flowering were established as factors. Plants for defoliation were selected on 04/05/2013 (Period 1, and on 07/01/2014 (Period 2. Six to to 13 leaves remained per plant by removing those with more than 50% of blade with injury or senescence. More appropriate climatic conditions before and after flowering, promoted greater mass accumulation in the bunch in Period 2. The increased number of leaves at flowering increased the length of the fruit and the mass of 4th hand, as well as the bunch mass and postharvest period. Defoliation is suggested only for non-functional leaves as well as the maintenance of at least 10 leaves per plant, independent of the period of bunch formation.
Matthes, J. H.; Pederson, N.; David, O.; Martin-Benito, D.
2017-12-01
Understanding the effects of climate change and biotic disturbance within diverse temperate mesic forests is complicated by the need to scale between impacts within individuals and across species in the community. It is not clear how these impacts within individuals and across a community influences the stand- and regional-scale response. Furthermore, co-occurring or sequential disturbances can make it challenging to interpret forest responses from observational data. In the northeastern United States, the 1960s drought was perhaps the most severe period of climatic stress within the past 300 years and negatively impacted the growth of individual trees across all species, but unevenly. Additionally, in 1981 the northeast experienced an outbreak of the defoliator Lymantria dispar, which preferentially consumes oak leaves, but in 1981 impacted a high proportion of other species as well. To investigate the effects of drought (across functional groups) and defoliation (within a functional group), we combined a long-term tree-ring dataset from an old-growth forest within the Palmaghatt Ravine in New York with a version of the Ecosystem Demography model that includes a scheme for representing forest insects and pathogens. We explored the sequential impacts of severe drought and defoliation on tree growth, community composition, and ecosystem-atmosphere interactions (carbon, water, and heat flux). We also conducted a set of modeling experiments with climate and defoliation disturbance scenarios to bound the potential long-term response of this forest to co-occurring and sequential drought-defoliator disturbances over the next fifty years.
Directory of Open Access Journals (Sweden)
Osmar Alves Lameira
1997-03-01
Full Text Available O trabalho teve como objetivo avaliar a influência do Thidiazuron (TDZ na formação e manutenção de calos de Cordia verbenacea. Segmentos caulinares com 3 a 4cm de comprimento provenientes de mudas cultivadas em casa de vegetação foram desinfestados em solução contendo hipoclorito de sódio comercial a 30% e duas gotas de detergente por 10 minutos, sendo 5 minutos em agitação. Posteriormente, foram excisados e inoculados com 5mm de tamanho em meio sólido a 0,6% de Murashige & Skoog (MURASHIGE & SKOOG, 1962 - MS, complementado com 0,22; 0,68: 2,04 e 6,l3uM de TDZ. A formação de calos ocorreu em todos os tratamentos com 10 a 15 dias de cultivo Os tratamentos que apresentaram o explante com a maior área coberta com calos, em média 75%, foram 2,04 e 6,13miM de TDZ. Somente nesses tratamentos os calos aumentaram de volume e mantiveram a coloração inicial quando transferidos para o meio fresco de cultura. Os tratamentos com menores concentrações de TDZ apresentaram explantes com 50% da área coberta com calos e quando transferidos para o meio fresco de cultura ocorreu a paralisação do crescimento com a posterior morte dos calos.The influence of thidiazuron on calius formation and maintenance of Corola verbenacea was evaluated. Stem segments with 3 to 4cm length were excisedfrom greenhouse plants and surface sterilized with 30% commercial sodium hypochiorite for 10 minutes. Explants were inoculated with 5mm on Murashige and Skoog (MVRASHIGE & SKOOG, 1962 - MSsolid médium (0.6% suppiemented with 0.22, 0.68, 2.04 and 6.13muM TDZ. Calius induction was observed 10 to 15 days after incubation. The media contaming, 2.04 and 6.13uM TDZ induced 75% expiam with calius. The calius when transferred to fresh culture médium exhibited active growth. The treatments containing lower concentration induced 50% expiam with caltus that when transferred to fresh culture médium, showed no development.
Directory of Open Access Journals (Sweden)
Shan Xin
Full Text Available Apoplastic ascorbate oxidase (AO plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1 gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA. Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome, Gossypium raimondii (Gr, diploid cotton with a DD genome and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence
Xin, Shan; Tao, Chengcheng; Li, Hongbin
2016-01-01
Apoplastic ascorbate oxidase (AO) plays significant roles in plant cell growth. However, the mechanism of underlying the transcriptional regulation of AO in Gossypium hirsutum remains unclear. Here, we obtained a 1,920-bp promoter sequence from the Gossypium hirsutum ascorbate oxidase (GhAO1) gene, and this GhAO1 promoter included a number of known cis-elements. Promoter activity analysis in overexpressing pGhAO1::GFP-GUS tobacco (Nicotiana benthamiana) showed that the GhAO1 promoter exhibited high activity, driving strong reporter gene expression in tobacco trichomes, leaves and roots. Promoter 5'-deletion analysis demonstrated that truncated GhAO1 promoters with serial 5'-end deletions had different GUS activities. A 360-bp fragment was sufficient to activate GUS expression. The P-1040 region had less GUS activity than the P-720 region, suggesting that the 320-bp region from nucleotide -720 to -1040 might include a cis-element acting as a silencer. Interestingly, an auxin-responsive cis-acting element (TGA-element) was uncovered in the promoter. To analyze the function of the TGA-element, tobacco leaves transformed with promoters with different 5' truncations were treated with indole-3-acetic acid (IAA). Tobacco leaves transformed with the promoter regions containing the TGA-element showed significantly increased GUS activity after IAA treatment, implying that the fragment spanning nucleotides -1760 to -1600 (which includes the TGA-element) might be a key component for IAA responsiveness. Analyses of the AO promoter region and AO expression pattern in Gossypium arboreum (Ga, diploid cotton with an AA genome), Gossypium raimondii (Gr, diploid cotton with a DD genome) and Gossypium hirsutum (Gh, tetraploid cotton with an AADD genome) indicated that AO promoter activation and AO transcription were detected together only in D genome/sub-genome (Gr and Gh) cotton. Taken together, these results suggest that the 1,920-bp GhAO1 promoter is a functional sequence with a
Thidiazuron enhanced regeneration and silymarin content in silybum marianum
International Nuclear Information System (INIS)
Khan, M.A.; Abbasi, B.H.; Shinwari, Z.K.
2014-01-01
Silybum marianum, of family Asteraceae is renowned for production of biologically important silymarin, which has shown multi-dimensional medicinal properties. It has a high protective role against jaundice and hepatitis C worldwide. We hereby established a feasible and efficient method for indirect regeneration of S. marianum for production of consistent plantlets. Calli were induced from leaf explants of seed-derived plantlets on Murashige and Skoog (MS) medium supplemented with several concentrations of different plant growth regulators (PGRs). Highest callogenic response (89%) was recorded for 4.4 meu M Thidiazuron (TDZ) in combination with 6.6 meu M Kinetin (Kn). Subsequent sub-culturing of callus after 4 weeks of culture, on medium with similar compositions of PGRs induced shoot organogenesis. Highest shoot induction frequency (86%) with maximum mean multiple shoots (26 shoots per explant) were recorded for 11meu M TDZ after 4 weeks of transfer. Longest shoots (4.1 cm) were recorded for MS medium augmented with 6.6 meu M TDZ and 4.4 meu M naphthalene acetic acid (NAA). Furthermore, rooted plantlets were developed on MS medium containing different concentrations of indole acetic acid (IAA). Silymarin was determined by High performance liquid chromatography (HPLC) and 8.47 mg/g DW silymarin was detected in the regenerated plantlets. This study contributes to a better understanding of the different mechanisms involved in morphogenesis and production of biologically active principle in Silybum marianum. (author)
Transient increases in methylbutenol emission following partial defoliation of Pinus ponderosa
Gray, Dennis W.
Methybutenol (MBO or 2-methyl-3-butene-2-ol) is a five-carbon alcohol produced and emitted in large amounts by many species of pine native to Western North America. Upon entering the atmosphere, MBO may engage in a series of chemical reactions which may ultimately lead to the production of tropospheric ozone which is a damaging pollutant. While the physical factors controlling MBO emission are well understood, the ecological factors controlling MBO emission have yet to be addressed. This study examines the response of MBO emission from Pinus ponderosa to herbivory simulated by needle clipping. Following defoliation early in the season, MBO emission from some plants tripled but similar increase did not occur later in the season. Anecdotal evidence suggests that the variable response of MBO emission to defoliation may have been due to the action of insect herbivores early in the season, or may have been due to phenological changes in the plants over the course of the season.
Hultine, K.R.; Nagler, P.L.; Morino, K.; Bush, S.E.; Burtch, K.G.; Dennison, P.E.; Glenn, E.P.; Ehleringer, J.R.
2010-01-01
The release of the saltcedar beetle (Diorhabda carinulata) has resulted in the periodic defoliation of tamarisk (Tamarix spp.) along more than 1000 river km in the upper Colorado River Basin and is expected to spread along many other river reaches throughout the upper basin, and possibly into the lower Colorado River Basin. Identifying the impacts of these release programs on tamarisk water use and subsequent water cycling in arid riparian systems are largely unknown, due in part to the difficulty of measuring water fluxes in these systems. We used lab-calibrated, modified heat-dissipation sap flux sensors to monitor tamarisk water use (n=20 trees) before, during and after defoliation by the saltcedar leaf beetle during the 2008 and 2009 growing seasons (May-October) in southeastern Utah. We incorporated a simple model that related mean stem sap flux density (Js) with atmospheric vapor pressure deficit (vpd) before the onset of defoliation in 2008. The model was used to calculate differences between predicted Js and Js measured throughout the two growing seasons. Episodic defoliation resulted in a 16% reduction in mean annual rates of Js in both 2008 and 2009, with decreases occurring only during the periods in which the trees were defoliated (about 6-8 weeks per growing season). In other words, rates of Js rebounded to values predicted by the model when the trees produced new leaves after defoliation. Sap flux data were scaled to stand water use by constructing a tamarisk-specific allometric equation to relate conducting sapwood area to stem diameter, and by measuring the size distribution of stems within the stand. Total water use in both years was 0.224m, representing a reduction of about 0.04myr-1. Results showed that repeated defoliation/refoliation cycles did not result in a progressive decrease in either leaf production or water use over the duration of the study. This investigation improves ground-based estimates of tamarisk water use, and will support
Song, Yuan Yuan; Simard, Suzanne W; Carroll, Allan; Mohn, William W; Zeng, Ren Sen
2015-02-16
Extensive regions of interior Douglas-fir (Pseudotsuga menziesii var. glauca, IDF) forests in North America are being damaged by drought and western spruce budworm (Choristoneura occidentalis). This damage is resulting from warmer and drier summers associated with climate change. To test whether defoliated IDF can directly transfer resources to ponderosa pine (Pinus ponderosae) regenerating nearby, thus aiding in forest recovery, we examined photosynthetic carbon transfer and defense enzyme response. We grew pairs of ectomycorrhizal IDF 'donor' and ponderosa pine 'receiver' seedlings in pots and isolated transfer pathways by comparing 35 μm, 0.5 μm and no mesh treatments; we then stressed IDF donors either through manual defoliation or infestation by the budworm. We found that manual defoliation of IDF donors led to transfer of photosynthetic carbon to neighboring receivers through mycorrhizal networks, but not through soil or root pathways. Both manual and insect defoliation of donors led to increased activity of peroxidase, polyphenol oxidase and superoxide dismutase in the ponderosa pine receivers, via a mechanism primarily dependent on the mycorrhizal network. These findings indicate that IDF can transfer resources and stress signals to interspecific neighbors, suggesting ectomycorrhizal networks can serve as agents of interspecific communication facilitating recovery and succession of forests after disturbance.
Directory of Open Access Journals (Sweden)
Andréa Machado Groff
2002-09-01
Full Text Available O experimento foi realizado no INRA (Institut National de la Recherche Agronomique em Theix, França. Duas gramíneas (azevém perene e festucaforam semeadas em caixas (0,13 m² e submetidas a três intervalos (3,5, 7 e 14 dias e três intensidades (160, 320 e 640 bocados.m-2 a cada desfolhação de desfolhação, com quatro repetições por tratamento. Quatro meses após a semeadura, a cada data de desfolhação, as caixas foram oferecidas, individualmente, a quatro ovelhas secas e retiradas após a realização de um determinado número de bocados. Para cada gramínea foram estudadas as taxas de crescimento, senescência e desfolhação. Os resultados mostraram que o intervalo e a intensidade de desfolhação tiveram efeitos diferenciados nas taxas de crescimento, senescência e desfolhação e no equilíbrio da associação.The experiment was carried in INRA (Institut National de la Recherche Agronomique at Theix, France. Two grasses (perennial ryegrass and tall fescue were grown in sward boxes (0,13 m² and submitted to three defoliation intervals (3,5, 7 and 14 days between two successive defoliation and three defoliation intensities (160, 320 and 640 bites.m-2 at each defoliation. Four months after sowing, at defoliation date, sward boxes were offered to four individual dry ewes and removed after a given number of bites had been taken. For each grass species, the growth, senescence and defoliation fluxes were studied. The results showed that the interval and the intensity of grazing had distinct effects on the growth, senescence and defoliation fluxes as well as on the equilibrium of grass mixtures.
Directory of Open Access Journals (Sweden)
Cassandro Vidal Talamini do Amarante
2003-04-01
Full Text Available Apple trees, cultivars Gala and Fuji, were sprayed at full bloom with thidiazuron (TDZ at the doses of 0, 5, 10, or 20 g (a.i. ha-1 and fruit were assessed for quality and maturity. In both cultivars, the increase of TDZ dose had detrimental effects on fruit quality, causing a reduction of fruit red surface and an increase of percentage of fruit that was asymmetrical and with calyx-end rot. TDZ caused an increment of calyx-end aperture that might have increased calyx-end rot. TDZ increased density and the length : diameter (L : D ratio of the fruit. The number of viable seeds was not affected by TDZ. TDZ resulted in a substantial delay of fruit maturity in 'Gala' but not in 'Fuji'. TDZ also reduced soluble solids content (SSC in 'Gala' and reduced titratable acidity in both cultivars.Macieiras, cultivares Gala e Fuji, foram pulverizadas em plena floração com thidiazuron (TDZ, nas doses de 0; 5; 10 e 20 g (i.a. ha-1, e os frutos avaliados em termos de qualidade e maturação. Em ambas as cultivares, o TDZ apresentou efeitos negativos na qualidade dos frutos, com redução na percentagem de cor vermelha na casca e aumento na percentagem de frutos assimétricos e com podridão carpelar. O TDZ causou aumento na abertura carpelar, o que pode ter ocasionado aumento de incidência de podridão carpelar. O TDZ aumentou a densidade e a relação comprimento : diâmetro (C : D dos frutos. O número de sementes viáveis não foi afetado pelo TDZ. O TDZ retardou substancialmente a maturação dos frutos na cultivar Gala, mas não na cultivar Fuji. O TDZ reduziu os teores de sólidos solúveis totais na cultivar Gala e reduziu a acidez titulável em ambas as cultivares.
Ijdo, Marleen; Schtickzelle, Nicolas; Cranenbrouck, Sylvie; Declerck, Stéphane
2010-04-01
Arbuscular mycorrhizal (AM) fungi obligatorily depend on carbon (C) resources provided via the plant and therefore fluctuations in C availability may strongly and differently affect AM fungi with different life-history strategies (LHS). In the present study, we examined the effect of repeated defoliation of in vitro grown barrel medic (Medicago truncatula) on the spore and auxiliary cell (AC) production dynamics of a presumed r-strategist (Glomus intraradices) and a presumed K-strategist (Dentiscutata reticulata). Glomus intraradices modulated the production of spores directly to C availability, showing direct investment in reproduction as expected for r-strategists. In contrast, AC production of D. reticulata was not affected after a single defoliation and thus showed higher resistance to fluctuating C levels, as expected for K-strategists. Our results demonstrate that plant defoliation affects the production of extraradical C storage structures of G. intraradices and D. reticulata differently. Our results contribute towards revealing differences in LHS among AM fungal species, a step further towards understanding their community dynamics in natural ecosystems and agroenvironments.
Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres
Emergent phenotypes are common in polyploids relative to their diploid progenitors, a phenomenon exemplified by spinnable cotton fibers. Following 15-18 fold paleopolyploidy, allopolyploidy 1-2 million years ago reunited divergent Gossypium genomes, imparting new combinatorial complexity that might ...
Hartmann, Henrik; Messier, Christian
2008-01-01
Background and Aims Natural and anthropogenic disturbances can act as stresses on tree vigour. According to Manion's conceptual model of tree disease, the initial vigour of trees decreases as a result of predisposing factors that render these trees more vulnerable to severe inciting stresses, stresses that can then cause final vigour decline and subsequent tree death. This tree disease model was tested in sugar maple (Acer saccharum) by assessing the roles of natural and anthropogenic disturbances in tree decline and death. Methods Radial growth data from 377 sugar maple trees that had undergone both defoliations by insects and partial harvest were used to estimate longitudinal survival probabilities as a proxy for tree vigour. Radial growth rates and survival probabilities were compared among trees subjected to different levels of above- and below-ground disturbances, between periods of defoliation and harvest, and between live and dead trees. Key Results Manion's tree disease model correctly accounts for vigour decline and tree death in sugar maple; tree growth and vigour were negatively affected by a first defoliation, predisposing these trees to death later during the study period due to a second insect outbreak that initiated a final vigour decline. This decline was accelerated by the partial harvest disturbance in 1993. Even the most severe anthropogenic disturbances from partial harvest did not cause, unlike insect defoliation, any growth or vigour declines in live sugar maple. Conclusions Natural disturbances acted as predisposing and inciting stresses in tree sugar maple decline and death. Anthropogenic disturbances from a partial harvest at worst accelerated a decline in trees that were already weakened by predisposing and inciting stresses (i.e. repeated insect defoliations). Favourable climatic conditions just before and after the partial harvest may have alleviated possible negative effects on growth resulting from harvesting. PMID:18660493
Ai, XianTao; Liang, YaJun; Wang, JunDuo; Zheng, JuYun; Gong, ZhaoLong; Guo, JiangPing; Li, XueYuan; Qu, YanYing
2017-10-01
Cotton (Gossypium spp.) is the most important natural textile fiber crop, and Gossypium hirsutum L. is responsible for 90% of the annual cotton crop in the world. Information on cotton genetic diversity and population structure is essential for new breeding lines. In this study, we analyzed population structure and genetic diversity of 288 elite Gossypium hirsutum cultivar accessions collected from around the world, and especially from China, using genome-wide single nucleotide polymorphisms (SNP) markers. The average polymorphsim information content (PIC) was 0.25, indicating a relatively low degree of genetic diversity. Population structure analysis revealed extensive admixture and identified three subgroups. Phylogenetic analysis supported the subgroups identified by STRUCTURE. The results from both population structure and phylogenetic analysis were, for the most part, in agreement with pedigree information. Analysis of molecular variance revealed a larger amount of variation was due to diversity within the groups. Establishment of genetic diversity and population structure from this study could be useful for genetic and genomic analysis and systematic utilization of the standing genetic variation in upland cotton.
Directory of Open Access Journals (Sweden)
Ricardo Fabiano Hettwer Giehl
2010-04-01
Full Text Available This work was carried out aiming to evaluate the effect of thidiazuron (TDZ on the quality of 'Gala' apples stored under controlled atmosphere (CA conditions. Plants were sprayed at full bloom with TDZ at 0, 10, 20, or 40g ha-1 (a.i.. Harvested fruits were then stored in CA with 1.0+2.5, 1.5+2.5 and 1.5+5.0 (kPa O2+kPa CO2, both at 0.5°C. In addition, the partial pressure of 1.5kPa of O2+2.5kPa of CO2 was also evaluated at -0.5°C. Higher flesh firmness and titratable acidity was obtained by applying 20 or 40g ha-1 TDZ. Furthermore, these TDZ doses decreased the respiration rate as well as the occurrence of flesh breakdown, mealiness and decay. The application of TDZ at doses ranging from 20 to 40g ha-1 maintains higher fruit quality for up to 8 months under CA. In addition, the storage of 'Gala' apples under CA with 1.0kPa O2+2.5kPa CO2 at 0.5°C results in higher flesh firmness and titratable acidity. Moreover, this CA condition reduces the incidence of flesh breakdown, mealiness and postharvest decay in 'Gala' apple fruits.O objetivo deste trabalho foi avaliar o efeito da aplicação de thidiazuron (TDZ na qualidade de maçãs 'Gala' armazenadas em condições de atmosfera controlada (AC. Avaliou-se o efeito do TDZ nas doses de 0, 10, 20 e 40g ha-1 (i.a., aplicadas no pleno florescimento. Após a colheita, os frutos foram armazenados em condições de AC com 1,0+2,5; 1,5+2,5 ou 1,5+5,0 (kPa de O2+kPa de CO2, ambas a 0,5°C. Além disso, a pressão parcial de 1,5kPa de O2+2,5kPa de CO2 também foi avaliada a -0,5°C. Doses de TDZ entre 20 e 40g ha-1 mantiveram maior firmeza da polpa e acidez titulável. Além disso, essas mesmas doses reduziram a atividade respiratória e a incidência de degenerescência da polpa, de polpa farinhenta e de podridões. A aplicação pré-colheita de TDZ, especialmente em doses entre 20 e 40g ha-1, melhora a qualidade de maçãs 'Gala' armazenadas em AC por até oito meses. Em relação às condições de AC
He, Shou-Pu; Sun, Jun-Ling; Zhang, Chao; Du, Xiong-Ming
2011-01-01
The impact of alien DNA fragments on plant genome has been studied in many species. However, little is known about the introgression lines of Gossypium. To study the consequences of introgression in Gossypium, we investigated 2000 genomic and 800 epigenetic sites in three typical cotton introgression lines, as well as their cultivar (Gossypium hirsutum) and wild parents (Gossypium bickii), by amplified fragment length polymorphism (AFLP) and methylation-sensitive amplified polymorphism (MSAP). The results demonstrate that an average of 0.5% of exotic DNA segments from wild cotton is transmitted into the genome of each introgression line, with the addition of other forms of genetic variation. In total, an average of 0.7% of genetic variation sites is identified in introgression lines. Simultaneously, the overall cytosine methylation level in each introgression line is very close to that of the upland cotton parent (an average of 22.6%). Further dividing patterns reveal that both hypomethylation and hypermethylation occurred in introgression lines in comparison with the upland cotton parent. Sequencing of nine methylation polymorphism fragments showed that most (7 of 9) of the methylation alternations occurred in the noncoding sequences. The molecular evidence of introgression from wild cotton into introgression lines in our study is identified by AFLP. Moreover, the causes of petal variation in introgression lines are discussed.
Directory of Open Access Journals (Sweden)
Çiğdem Alev Özel
2016-12-01
Full Text Available Muscari neglectum Guss. Ex Ten, is an ornamental, herbaceous perennial plant species that grows in the Mediterranean countries with attractive and scented blue-colored flowers. The plant has low seed output, seed dormancy, low germination and propagation rates. This study aimed to develop a reliable microclonal propagation protocol for M. neglectum using TDZ (Thidiazuron-NAA (α Naphthalene acetic acid to induce bulblets, roots, and acclimatization of the regenerated bulblets. Maximum number of bulblets per explant (8.25±0.05 was noted on MS medium containing 0.0454 µM TDZ-5.37 µM NAA. The bulblets regenerated in each type of culture medium were very vigorous, and acclimatized easily following rooting on a subculture. Here we show that this protocol is a useful clonal micropropagation system for this important ornamental plant.
Elevated CO2 and defoliation effects on nitrogen (N) cycling in rangeland soils remain poorly understood. Here we tested whether effects of elevated CO2 and defoliation (clipping to 2.5 cm height) on N cycling depended on soil N availability (addition of 1 vs. 11 g N/m2) in intact mesocosms extracte...
Predicting abundance and productivity of blueberry plants under insect defoliation in Alaska
Robin Reich; Nathan Lojewski; John Lundquist; Vanessa Bravo
2018-01-01
Unprecedented outbreaks of defoliating insects severely damaged blueberry crops near Port Graham on the Kenai Peninsula in Alaska from 2008-2012. The Native people in this region rely heavily on gathered blueberries and other foods for sustenance and nourishment. Influences of topography and stand structure on blueberry abundance and fruiting were examined and used to...
International Nuclear Information System (INIS)
Ferretti, Marco; Calderisi, Marco; Bussotti, Filippo
2007-01-01
The relationships between crown defoliation of beech, visible foliar symptoms on native vegetation and ozone exposure were investigated on permanent monitoring sites in South-Western Europe in the years 2000-2002. Relationships between defoliation of beech and O 3 (seasonal mean, 2-week maximum, AOT40) were investigated by means of multiple regression models (11 plots, 1-3 years of data each) and a model based on temporal autocorrelation of defoliation data (14 plots, 1-3 years of data each). Different multiple regression techniques were used. The four models generated (R 2 = 0.71-0.85, explained variance in cross-validation 61-78%) identified several significant predictors of defoliation, with AOT40 (p = 0.008) and foliar content of phosphorous (p = 0.0002-0.0004) being common to all models. The autocorrelation model (R 2 = 0.55; p 35,000 ppbh). O 3 -like visible foliar symptoms were recorded on 65 species at 47% of the common monitoring sites in 2001 and 38% in 2002. No relationship was found between O 3 exposure, frequency of symptomatic sites and frequency of species with symptoms (R 2 = 0.11; p > 0.05). A number of questions related to the ecological and methodological basis of the survey were identified. Inherent sampling and non-sampling errors and multicollinearity of the data suggest great caution when examining results obtained from mensurational, correlative studies. - Ozone AOT40 was identified as a significant predictor of defoliation of beech, but a limited relationship was found between ozone exposure and visible symptoms on native vegetation
Genetics of the ovule fuzzless trait in Gossypium arboreum germplasm line PI 615737
The diploid cotton species Gossypium arboreum possesses many favorable agronomic traits such as drought tolerance and disease resistance, which can be utilized in the development of improved upland cotton cultivars. The USDA National Plant Germplasm System maintains more than 1,600 G. arboreum acces...
Directory of Open Access Journals (Sweden)
S. Sabiu
2017-12-01
Full Text Available Gossypium spp. belong to a class of botanicals with global therapeutic applications against a number of disorders including ulcers. This study evaluated the membrane stabilization and detoxification potential of aqueous leaf extract of Gossypium barbadense L. (Malvaceae in indomethacin-induced oxidative gastric ulceration in Wistar rats. The ulcerated rats were orally pretreated with the extract and esomeprazole for 4 weeks. Gastric function and antioxidative parameters were thereafter evaluated. The indomethacin-mediated significant elevations in the ulcer index, gastric volume, pepsin activity and mucosal level of malondialdehyde were dosedependently attenuated in the extract-treated animals. The extract also significantly modulated and improved the pH, mucin content, glutathione (reduced as well as gastric activities of superoxide dismutase and catalase in the ulcerated rats. These improvements may be ascribed to the antioxidant and membrane stabilization activities of the extract which are attributable to its active metabolites as revealed by the analytical chromatogram. The observed effects compared favorably with that of esomeprazole and are suggestive of the capability of the extract to prevent mucosal damage and preserve gastric functions as evidently supported by the macroscopical appearance of the stomachs and the % ulcer inhibitory values. Conclusively, the overall data from the present findings suggest that the aqueous leaf extract of G. barbadense could prevent indomethacin-mediated oxidative gastric ulceration via fortification of antioxidant defense mechanisms. Keywords: Esomeprazole, Gossypium barbadense, Indomethacin, Mucosal damage, Oxidative stress
Anjum, Sumaira; Abbasi, Bilal Haider
2016-01-01
Green synthesis of silver nanoparticles (AgNPs) by using plants is an emerging class of nanobiotechnology. It revolutionizes all domains of medical sciences by synthesizing chemical-free AgNPs for various biomedical applications. In this report, AgNPs were successfully synthesized by using whole plant extract (WPE) and thidiazuron-induced callus extract (CE) of Linum usitatissimum. The phytochemical analysis revealed that the total phenolic and flavonoid contents were higher in CE than that in WPE. Ultraviolet-visible spectroscopy of synthesized AgNPs showed a characteristic surface plasmon band in the range of 410-426 nm. Bioreduction of CE-mediated AgNPs was completed in a shorter time than that of WPE-mediated AgNPs. Scanning electron microscopy showed that both types of synthesized AgNPs were spherical in shape, but CE-mediated AgNPs were smaller in size (19-24 nm) and more scattered in distribution than that of WPE-mediated AgNPs (49-54 nm). X-ray diffraction analysis confirmed crystalline nature (face-centered cubic) of both types of AgNPs. Fourier-transform infrared spectroscopy revealed that the polyphenols and flavonoids were mainly responsible for reduction and capping of synthesized AgNPs. Energy dispersive X-ray analysis further confirmed the successful synthesis of AgNPs. Moreover, the synthesized AgNPs were found to be stable over months with no change in the surface plasmon bands. More importantly, CE-mediated AgNPs displayed significantly higher bactericidal activity against multiple drug-resistant human pathogens than WPE-mediated AgNPs. The present work highlighted the potent role of thidiazuron in in vitro-derived cultures for enhanced biosynthesis of chemical-free AgNPs, which can be used as nanomedicines in many biomedical applications.
GhNAC18 , a novel cotton ( Gossypium hirsutum L.) NAC gene, is ...
African Journals Online (AJOL)
GhNAC18 is a novel NAC gene that was isolated from cotton (Gossypium hirsutum L.). The full-length cDNA was 1511 bp including an open reading frame of 1260 bp in length and encodes a protein of 419 amino acids. With qRT-PCR analysis, GhNAC18 was downregulated during natural and dark-induced senescence, ...
Christine G. Niwa; David L. Overhulser
2015-01-01
A detailed procedure is described for monitoring western spruce budworm with pheromone-baited sticky traps and interpreting the results to predict defoliation the following year. Information provided includes timing of the survey, how to obtain traps and baits, how many traps are needed, trap assembly, field placement of traps, and how to evaluate the catches.
Qi, Juan; Nie, Zhongnan; Jiao, Ting; Zhang, Degang
2015-01-01
Pasture degradation caused by overgrazing and inappropriate fertiliser management is a major production and environmental threat in Qinghai-Tibet Plateau. Previous research has focused on the effects of mixed nitrogen (N) and phosphorus (P) fertiliser and reduced grazing pressure on the plant community of the grassland; however, the role of P and how it interacts with various defoliation (the process of the complete or partial removal of the above-ground parts of plants by grazing or cutting) intensities on the plant and soil of the grassland ecosystem have not been quantified. A field experiment was conducted to quantify how P application in combination of defoliation pressure could impact the dynamic change of the plant and soil in a native alpine grassland ecosystem of the Qinghai-Tibet Plateau, China, from May 2012 to September 2014. A split-plot design with 4 replicates and repeated measures was used to determine the growth and composition of plant community and soil physical and chemical properties under various levels of P fertiliser and defoliation intensity. The results showed that applying 20 kg P/ha increased the herbage yield of Melissitus ruthenica by 68% and total pasture yield by 25%. Close defoliation favoured the growth and plant frequency of the shorter species, whereas lax defoliation favoured that of the taller plant species. Medium P rate and cutting to 3 cm above ground gave an overall best outcome in pasture yield, quality and frequency and soil moisture and nutrient concentration. Application of P fertiliser with a moderate defoliation pressure to promote legume growth and N fixation has the potential to achieve multiple benefits in increasing pasture and livestock production and improving environmental sustainability in the alpine pasture of Qinghai-Tibet Plateau, a fragile and P-deficient ecosystem zone in China and its western neighbouring countries.
Development of a core set of SSR markers for the characterization of Gossypium germplasm
Molecular markers such as simple sequence repeats (SSR) are a useful tool for characterizing genetic diversity of Gossypium germplasm collections. Genetic profiles by DNA fingerprinting of cotton accessions can only be compared among different collections if a common set of molecular markers are us...
Peña Tapia, Denisse Fabiola; Rocano Curillo, Melida Noemi; Salazar, Jazmin M.; Torres, Carlos S.; Universidad de Cuenca; Dirección de Investigación de la Universidad de Cuenca; DIUC
2014-01-01
El nogal (Juglans neotropica) es una especie de gran potencial para proyectos de conservación y agro-productivos en la eco-región Andina. No obstante, su baja capacidad germinativa limita su propagación para reforestación. El objetivo de este estudio fue determinar el efecto del tratamiento con Thidiazuron (TDZ) y 6-Bencilaminopurina (BAP) en la inducción in vitro de brotes de J. neotropica. Las microplántulas tratadas con BAP produjeron más brotes que aquellas tratadas con TDZ. Las microplán...
Directory of Open Access Journals (Sweden)
Cassandro Vidal Talamini do Amarante
2002-10-01
Full Text Available Apple (Malus domestica Borkh. trees, cultivars Gala and Fuji, were sprayed at full bloom with thidiazuron (TDZ at doses of 0, 5, 10, or 20 g ha-1 of a.i. in order to evaluate its effects on plant growth and development, return bloom, fruit set, nutrition, and fruit yield. Fruit set increased with TDZ dose in 'Gala' but not in 'Fuji'. TDZ did not affect fruit yield in any cultivar. In 'Gala', the return bloom was reduced in about 50% at TDZ doses of 10 or 20 g ha-1. TDZ increased shoot growth in both cultivars. In leaves, TDZ decreased the concentration of Ca and Mg in 'Gala' and of Mg in 'Fuji', but did not affect the chlorophyll content, leaf area, length, width, and dry mass per cm² regardless of cultivar. In fruits, the effect of TDZ varied according to the portion evaluated. Highest doses of TDZ decreased the concentration of Ca and K in 'Gala' and of K in 'Fuji' in the entire fruits (flesh + skin; in the skin, highest doses of TDZ reduced the levels of N, Ca, and Mg in both cultivars, in addition to the level of K in 'Fuji'.Macieiras (Malus domestica Borkh., cultivares Gala e Fuji, foram pulverizadas na plena floração com thidiazuron (TDZ nas doses de 0, 5, 10 e 20 g ha-1 de ingrediente ativo com o objetivo de serem avaliadas quanto ao crescimento, florescimento, nutrição, frutificação e rendimento de frutos. A frutificação efetiva aumentou com a dose de TDZ na cultivar Gala, mas não na cultivar Fuji. Os tratamentos não afetaram o rendimento de frutos em nenhuma cultivar. Na cultivar Gala o florescimento no ano posterior ao da aplicação de TDZ foi reduzido em cerca de 50% nas doses de 10 e 20 g ha-1. O TDZ promoveu aumento no crescimento dos ramos do ano em ambas as cultivares. Nas folhas, o aumento nas doses de TDZ reduziu os teores de Ca e Mg na cultivar Gala, e de Mg na cultivar Fuji mas não afetou o conteúdo de clorofila, área, comprimento, diâmetro e massa seca cm-2 da folha, em ambas as cultivares. Em frutos inteiros
Paritsis, Juan; Elgueta, Mario; Quintero, Carolina; Veblen, Thomas T
2010-01-01
Ormiscodes amphimone (Fabricius) is a phytophagous moth species known to severely defoliate woody species in Chile and Argentina. Here we document new records of O. amphimonehost associations emphasizing the role of Nothofagus pumilio as its primary host in our study area. This new record for Argentina is highly significant given the economic importance of N. pumilio as a timber resource and the potential of O. amphimone to generate extensive outbreaks.
Paritsis, Juan; Elgueta, Mario; Quintero, Carolina; Veblen, Thomas T
2010-01-01
Ormiscodes amphimone (Fabricius) is a phytophagous moth species known to severely defoliate woody species in Chile and Argentina. Here we document new records of O. amphimonehost associations emphasizing the role of Nothofagus pumilio as its primary host in our study area. This new record for Argentina is highly significant given the economic importance of N. pumilio as a timber resource and the potential of O. amphimone to generate extensive outbreaks.
International Nuclear Information System (INIS)
Ribeiro, Rafael C.; Lemos, Walkymario P.; Muller, Antonio A.
2010-01-01
The oil palm Elaeis guineensis is usually attacked by pests, particularly, defoliating caterpillars. Between 2004 and 2006 a stinkbug predator (Asopinae) was registered preying on caterpillars of Brassolis sophorae L., Opsiphanes invirae Hubner (Lepidoptera: Nymphalidae) and Sibine spp. (Lepidoptera: Limacodidae), reducing their populations in commercial oil palm plantations in the State of Para, Brazil. Specimens of the natural enemy were collected, mounted, and identified as Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae), corresponding to the first report of the occurrence of this stinkbug attacking defoliating caterpillars of oil palm in Brazil. (author)
Effect of season and interval of prescribed burn on ponderosa pine butterfly defoliation patterns
Becky K. Kerns; Douglas J. Westlind
2013-01-01
Current knowledge concerning the interactions between forest disturbances such as fire and insect defoliation is limited. Wildfires and prescribed burns may influence the intensity and severity of insect outbreaks by affecting the vigor of residual trees, altering aspects of stand structure and abundance of preferred hosts, and by changing the physical environment...
Genotype and planting density effects on rooting traits and yield in cotton (Gossypium hirsutum L.)
Zhang, L.Z.; Li, B.G.; Yan, G.T.; Werf, van der W.; Spiertz, J.H.J.; Zhang, S.P.
2006-01-01
Root density distribution of plants is a major indicator of competition between plants and determines resource capture from the soil. This experiment was conducted in 2005 at Anyang, located in the Yellow River region, Henan Province, China. Three cotton (Gossypium hirsutum L.) cultivars were
Tao, Tao; Zhao, Liang; Lv, Yuanda; Chen, Jiedan; Hu, Yan; Zhang, Tianzhen; Zhou, Baoliang
2013-01-01
The genus Gossypium is a globally important crop that is used to produce textiles, oil and protein. However, gossypol, which is found in cultivated cottonseed, is toxic to humans and non-ruminant animals. Efforts have been made to breed improved cultivated cotton with lower gossypol content. The delayed gland morphogenesis trait possessed by some Australian wild cotton species may enable the widespread, direct usage of cottonseed. However, the mechanisms about the delayed gland morphogenesis are still unknown. Here, we sequenced the first Australian wild cotton species ( Gossypium australe ) and a diploid cotton species ( Gossypium arboreum ) using the Illumina Hiseq 2000 RNA-seq platform to help elucidate the mechanisms underlying gossypol synthesis and gland development. Paired-end Illumina short reads were de novo assembled into 226,184, 213,257 and 275,434 transcripts, clustering into 61,048, 47,908 and 72,985 individual clusters with N50 lengths of 1,710 bp, 1544 BP and 1,743 bp, respectively. The clustered Unigenes were searched against three public protein databases (TrEMBL, SwissProt and RefSeq) and the nucleotide and protein sequences of Gossypium raimondii using BLASTx and BLASTn. A total of 21,987, 17,209 and 25,325 Unigenes were annotated. Of these, 18,766 (85.4%), 14,552 (84.6%) and 21,374 (84.4%) Unigenes could be assigned to GO-term classifications. We identified and analyzed 13,884 differentially expressed Unigenes by clustering and functional enrichment. Terpenoid-related biosynthesis pathways showed differentially regulated expression patterns between the two cotton species. Phylogenetic analysis of the terpene synthases family was also carried out to clarify the classifications of TPSs. RNA-seq data from two distinct cotton species provide comprehensive transcriptome annotation resources and global gene expression profiles during seed germination and gland and gossypol formation. These data may be used to further elucidate various mechanisms and
Legume ground covers alter defoliation response of black walnut saplings to drought and anthracnose
J. W. Van Sambeek
2003-01-01
Growth and premature defoliation of black walnut saplings underplanted 5 or 6 years earlier with six different ground covers were quantified in response to a summer drought or anthracnose. Walnut saplings growing with ground covers of hairy vetch, crownvetch, and to a lesser extent sericea lespedeza continued to have more rapid height and diameter growth than saplings...
Defoliating Insect Mass Outbreak Affects Soil N Fluxes and Tree N Nutrition in Scots Pine Forests.
Grüning, Maren M; Simon, Judy; Rennenberg, Heinz; L-M-Arnold, Anne
2017-01-01
Biotic stress by mass outbreaks of defoliating pest insects does not only affect tree performance by reducing its photosynthetic capacity, but also changes N cycling in the soil of forest ecosystems. However, how insect induced defoliation affects soil N fluxes and, in turn, tree N nutrition is not well-studied. In the present study, we quantified N input and output fluxes via dry matter input, throughfall, and soil leachates. Furthermore, we investigated the effects of mass insect herbivory on tree N acquisition (i.e., organic and inorganic 15 N net uptake capacity of fine roots) as well as N pools in fine roots and needles in a Scots pine ( Pinus sylvestris L.) forest over an entire vegetation period. Plots were either infested by the nun moth ( Lymantria monacha L.) or served as controls. Our results show an increased N input by insect feces, litter, and throughfall at the infested plots compared to controls, as well as increased leaching of nitrate. However, the additional N input into the soil did not increase, but reduce inorganic and organic net N uptake capacity of Scots pine roots. N pools in the fine roots and needles of infested trees showed an accumulation of total N, amino acid-N, protein-N, and structural N in the roots and the remaining needles as a compensatory response triggered by defoliation. Thus, although soil N availability was increased via surplus N input, trees did not respond with an increased N acquisition, but rather invested resources into defense by accumulation of amino acid-N and protein-N as a survival strategy.
Chen, Yu; Wang, Yingying; Wang, Kai; Zhu, Xiefei; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang
2014-05-01
We report the first complete set of alien addition lines of G. hirsutum . The characterized lines can be used to introduce valuable traits from G. australe into cultivated cotton. Gossypium australe is a diploid wild cotton species (2n = 26, GG) native to Australia that possesses valuable characteristics unavailable in the cultivated cotton gene pool, such as delayed pigment gland morphogenesis in the seed and resistances to pests and diseases. However, it is very difficult to directly transfer favorable traits into cultivated cotton through conventional gene recombination due to the absence of pairing and crossover between chromosomes of G. australe and Gossypium hirsutum (2n = 52, AADD). To enhance the transfer of favorable genes from wild species into cultivated cotton, we developed a set of hirsutum-australe monosomic alien chromosome addition lines (MAAL) using a combination of morphological survey, microsatellite marker-assisted selection, and molecular cytogenetic analysis. The amphidiploid (2n = 78, AADDGG) of G. australe and G. hirsutum was consecutively backcrossed with upland cotton to develop alien addition lines of individual G. australe chromosomes in G. hirsutum. From these backcross progeny, we generated the first complete set of chromosome addition lines in cotton; 11 of 13 lines are monosomic additions, and chromosomes 7G(a) and 13G(a) are multiple additions. MAALs of 1G(a) and 11G(a) were the first to be isolated. The chromosome addition lines can be employed as bridges for the transfer of desired genes from G. australe into G. hirsutum, as well as for gene assignment, isolation of chromosome-specific probes, flow sorting and microdissection of chromosome, development of chromosome-specific ''paints'' for fluorochrome-labeled DNA fragments, physical mapping, and selective isolation and mapping of cDNAs for a particular G. australe chromosome.
Directory of Open Access Journals (Sweden)
Luiz Sebastião Poltronieri
2011-06-01
Full Text Available Leaf blight and defoliation of Eugenia stipitata Mc Vaugh and Eugenia patrisii Vahl, caused respectively by Cylindrocladium candelabrum (Calonectria scoparia and C. spathiphylli (Calonectria spathiphylli are reported in the state of Pará, Brazil. On both host species, the disease is characterized by dark brown lesions of different sizes and shapes. A whitish bright sporulation, resembling Cylindrocladium is observed on the necrotic lesions by using a stereomycroscope or a pocket lense (10-20 X. Under favorable conditions and depending on the level of infection, intense premature tree defoliation may also be found.Although the conidial germination and mycelial growth were higher at 25ºC for both species, C. candelabrum was more sensitive to the variation of temperature (10, 20, 30 and 40 ºC than C. spathiphylli. This is the first report of C. candelabrum and C. spathiphylli on Eugenia stipitata (araçá-boi and on Eugenia patrisii (ubaia-da-amazônia, respectively in Brazil.
Directory of Open Access Journals (Sweden)
Joy Nyangasi Kirungu
2018-01-01
Full Text Available The challenge in tetraploid cotton cultivars is the narrow genetic base and therefore, the bottleneck is how to obtain interspecific hybrids and introduce the germplasm directly from wild cotton to elite cultivars. Construction of genetic maps has provided insight into understanding the genome structure, interrelationships between organisms in relation to evolution, and discovery of genes that carry important agronomic traits in plants. In this study, we generated an interspecific hybrid between two wild diploid cottons, Gossypium davidsonii and Gossypium klotzschianum, and genotyped 188 F2:3 populations in order to develop a genetic map. We screened 12,560 SWU Simple Sequence Repeat (SSR primers and obtained 1000 polymorphic markers which accounted for only 8%. A total of 928 polymorphic primers were successfully scored and only 728 were effectively linked across the 13 chromosomes, but with an asymmetrical distribution. The map length was 1480.23 cM, with an average length of 2.182 cM between adjacent markers. A high percentage of the markers on the map developed, and for the physical map of G. raimondii, exhibited highly significant collinearity, with two types of duplication. High level of segregation distortion was observed. A total of 27 key genes were identified with diverse roles in plant hormone signaling, development, and defense reactions. The achievement of developing the F2:3 population and its genetic map constructions may be a landmark in establishing a new tool for the genetic improvement of cultivars from wild plants in cotton. Our map had an increased recombination length compared to other maps developed from other D genome cotton species.
TWIG BLIGHT AND DEFOLIATION CAUSED BY Colletotrichum horii IN PERSIMMONS IN BRAZIL
Directory of Open Access Journals (Sweden)
LOUISE LARISSA MAY DE MIO
2015-03-01
Full Text Available Persimmon anthracnose has been a great concern to Brazilian producers. This study aimed to identify and characterized the causal species from Brazilian persimmons byassessing morphological and molecular characteristics and pathogenicity tests. Five fungal isolatesobtained from diseased twigs and fruits were identified as Colletotrichum horii, based on morphologicalcharacteristics and nucleotide sequences of ITS region. Inoculation tests revealed that the fungal isolates caused necrotic spots followed by defoliation of leaves, blight of twigs and buds of potted persimmon plants.
Defoliating Insect Mass Outbreak Affects Soil N Fluxes and Tree N Nutrition in Scots Pine Forests
Directory of Open Access Journals (Sweden)
Maren M. Grüning
2017-06-01
Full Text Available Biotic stress by mass outbreaks of defoliating pest insects does not only affect tree performance by reducing its photosynthetic capacity, but also changes N cycling in the soil of forest ecosystems. However, how insect induced defoliation affects soil N fluxes and, in turn, tree N nutrition is not well-studied. In the present study, we quantified N input and output fluxes via dry matter input, throughfall, and soil leachates. Furthermore, we investigated the effects of mass insect herbivory on tree N acquisition (i.e., organic and inorganic 15N net uptake capacity of fine roots as well as N pools in fine roots and needles in a Scots pine (Pinus sylvestris L. forest over an entire vegetation period. Plots were either infested by the nun moth (Lymantria monacha L. or served as controls. Our results show an increased N input by insect feces, litter, and throughfall at the infested plots compared to controls, as well as increased leaching of nitrate. However, the additional N input into the soil did not increase, but reduce inorganic and organic net N uptake capacity of Scots pine roots. N pools in the fine roots and needles of infested trees showed an accumulation of total N, amino acid-N, protein-N, and structural N in the roots and the remaining needles as a compensatory response triggered by defoliation. Thus, although soil N availability was increased via surplus N input, trees did not respond with an increased N acquisition, but rather invested resources into defense by accumulation of amino acid-N and protein-N as a survival strategy.
Directory of Open Access Journals (Sweden)
Castrillón-Arbeláez Paula
2012-09-01
Full Text Available Abstract Background Amaranthus cruentus and A. hypochondriacus are crop plants grown for grain production in subtropical countries. Recently, the generation of large-scale transcriptomic data opened the possibility to study representative genes of primary metabolism to gain a better understanding of the biochemical mechanisms underlying tolerance to defoliation in these species. A multi-level approach was followed involving gene expression analysis, enzyme activity and metabolite measurements. Results Defoliation by insect herbivory (HD or mechanical damage (MD led to a rapid and transient reduction of non-structural carbohydrates (NSC in all tissues examined. This correlated with a short-term induction of foliar sucrolytic activity, differential gene expression of a vacuolar invertase and its inhibitor, and induction of a sucrose transporter gene. Leaf starch in defoliated plants correlated negatively with amylolytic activity and expression of a β-amylase-1 gene and positively with a soluble starch synthase gene. Fatty-acid accumulation in roots coincided with a high expression of a phosphoenolpyruvate/phosphate transporter gene. In all tissues there was a long-term replenishment of most metabolite pools, which allowed damaged plants to maintain unaltered growth and grain yield. Promoter analysis of ADP-glucose pyrophosphorylase and vacuolar invertase genes indicated the presence of cis-regulatory elements that supported their responsiveness to defoliation. HD and MD had differential effects on transcripts, enzyme activities and metabolites. However, the correlation between transcript abundance and enzymatic activities was very limited. A better correlation was found between enzymes, metabolite levels and growth and reproductive parameters. Conclusions It is concluded that a rapid reduction of NSC reserves in leaves, stems and roots followed by their long-term recovery underlies tolerance to defoliation in grain amaranth. This requires the
Genetic diversity and relationship analysis of Gossypium arboreum accessions.
Liu, F; Zhou, Z L; Wang, C Y; Wang, Y H; Cai, X Y; Wang, X X; Zhang, Z S; Wang, K B
2015-11-19
Simple sequence repeat techniques were used to identify the genetic diversity of 101 Gossypium arboreum accessions collected from India, Vietnam, and the southwest of China (Guizhou, Guangxi, and Yunnan provinces). Twenty-six pairs of SSR primers produced a total of 103 polymorphic loci with an average of 3.96 polymorphic loci per primer. The average of the effective number of alleles, Nei's gene diversity, and Shannon's information index were 0.59, 0.2835, and 0.4361, respectively. The diversity varied among different geographic regions. The result of principal component analysis was consistent with that of unweighted pair group method with arithmetic mean clustering analysis. The 101 G. arboreum accessions were clustered into 2 groups.
Public tolerance to defoliation and flower distortion in a public horticulture garden.
Sadof, Clifford S; Sclar, D Casey
2002-04-01
Surveys of visitor and grower perception of live potted plant quality were conducted in various locations in a large public display garden. Canna lily, Canna x generalis L.H.Bailey, was used to examine effects of defoliation by Japanese beetle, Popillia japonica Newman, on public perception. Chrysanthemums, Chrysanthemum x morifolium Ramat., were used to identify visitor and grower tolerance to flower distortion caused by western flower thrips, Frankliniella occidentalis (Pergande), on single and multiple flowered plants. On average, the maximum amount of defoliation or flower distortion tolerated by any respondent was low (< or = 10% for canna and < or = 25% for chrysanthemum). The level of acceptable injury was influenced by factors intrinsic to both the respondents and the plants themselves. Tolerance to injury was negatively associated with the risk aversion of the respondents. Visitors were less tolerant of injury on plants they considered for purchase than those that they would view at the garden. Similarly, grower tolerance was lower than that of visitors because producing substandard plants could put their professional reputation at risk. Factors that distracted visitor attention (e.g., presence of flowers and higher levels of background injury) increased their tolerance to plant injury. Visitors tolerated greater levels of flower distortion on multiple flowering chrysanthemum than on those with single flowers. We suggest that tolerance to insect pests can be increased by designing plantings that distract viewers from injured plant parts.
Zhang, Xueying; Wang, Liman; Xu, Xiaoyang; Cai, Caiping; Guo, Wangzhen
2014-12-10
Mitogen-activated protein kinase (MAPK) cascades play a crucial role in plant growth and development as well as biotic and abiotic stress responses. Knowledge about the MAPK gene family in cotton is limited, and systematic investigation of MAPK family proteins has not been reported. By performing a bioinformatics homology search, we identified 28 putative MAPK genes in the Gossypium raimondii genome. These MAPK members were anchored onto 11 chromosomes in G. raimondii, with uneven distribution. Phylogenetic analysis showed that the MAPK candidates could be classified into the four known A, B, C and D groups, with more MAPKs containing the TEY phosphorylation site (18 members) than the TDY motif (10 members). Furthermore, 21 cDNA sequences of MAPKs with complete open reading frames (ORFs) were identified in G. hirsutum via PCR-based approaches, including 13 novel MAPKs and eight with homologs reported previously in tetraploid cotton. The expression patterns of 23 MAPK genes reveal their important roles in diverse functions in cotton, in both various developmental stages of vegetative and reproductive growth and in the stress response. Using a reverse genetics approach based on tobacco rattle virus-induced gene silencing (TRV-VIGS), we further verified that MPK9, MPK13 and MPK25 confer resistance to defoliating isolates of Verticillium dahliae in cotton. Silencing of MPK9, MPK13 and MPK25 can significantly enhance cotton susceptibility to this pathogen. This study presents a comprehensive identification of 28 mitogen-activated protein kinase genes in G. raimondii. Their phylogenetic relationships, transcript expression patterns and responses to various stressors were verified. This study provides the first systematic analysis of MAPKs in cotton, improving our understanding of defense responses in general and laying the foundation for future crop improvement using MAPKs.
van Klink, R.; Schrama, M.; Nolte, S.; Bakker, J. P.; WallisDeVries, M. F.; Berg, M. P.
In addition to the well-studied impacts of defecation and defoliation, large herbivores also affect plant and arthropod communities through trampling, and the associated soil compaction. Soil compaction can be expected to be particularly important on wet, fine-textured soils. Therefore, we
van Klink, R.; Schrama, M.; Nolte, S.; Bakker, Jan P.; WallisDeVries, M.F.; Berg, M.P.
2015-01-01
In addition to the well-studied impacts of defecation and defoliation, large herbivores also affect plant and arthropod communities through trampling, and the associated soil compaction. Soil compaction can be expected to be particularly important on wet, fine-textured soils. Therefore, we
Comparative transmission genetics of introgressed chromatin in Gossypium (cotton) polyploids.
Waghmare, Vijay N; Rong, Junkang; Rogers, Carl J; Bowers, John E; Chee, Peng W; Gannaway, John R; Katageri, Ishwarappa; Paterson, Andrew H
2016-04-01
Introgression is widely acknowledged as a potential source of valuable genetic variation, and growing effort is being invested in analysis of interspecific crosses conferring transgressive variation. Experimental backcross populations provide an opportunity to study transmission genetics following interspecific hybridization, identifying opportunities and constraints to introgressive crop improvement. The evolutionary consequences of introgression have been addressed at the theoretical level, however, issues related to levels and patterns of introgression among (plant) species remain inadequately explored, including such factors as polyploidization, subgenome interaction inhabiting a common nucleus, and the genomic distribution and linkage relationships of introgressant alleles. We analyze introgression into the polyploid Gossypium hirsutum (upland cotton) from its sister G. tomentosum and compare the level and pattern with that of G. barbadense representing a different clade tracing to the same polyploidization. Across the genome, recurrent backcrossing to Gossypium hirsutum yielded only one-third of the expected average frequency of the G. tomentosum allele, although one unusual region showed preferential introgression. Although a similar rate of introgression is found in the two subgenomes of polyploid (AtDt) G. hirsutum, a preponderance of multilocus interactions were largely within the Dt subgenome. Skewed G. tomentosum chromatin transmission is polymorphic among two elite G. hirsutum genotypes, which suggests that genetic background may profoundly affect introgression of particular chromosomal regions. Only limited correspondence is found between G. hirsutum chromosomal regions that are intolerant to introgression from the two species, G. barbadense and G. tomentosum, concentrated near possible inversion polymorphisms. Complex transmission of introgressed chromatin highlights the challenges to utilization of exotic germplasm in crop improvement. © 2016
Kumari, Kavita; Lal, Madan; Saxena, Sangeeta
2017-10-01
An efficient, simple and commercially applicable protocol for rapid micropropagation of sugarcane has been designed using variety Co 05011. Pretreatment of shoot tip explants with thidiazuron (TDZ) induced high frequency regeneration of shoot cultures with improved multiplication ratio. The highest frequency (80%) of shoot initiation in explants pretreated with 10 mg/l of TDZ was obtained during the study. Maximum 65% shoot cultures could be established from the explants pretreated with TDZ as compared to minimum 40% establishment in explants without pretreatment. The explants pretreated with 10 mg/l of TDZ required minimum 40 days for the establishment of shoot cultures as compared to untreated explants which required 60 days. The highest average number of shoots per culture (19.1) could be obtained from the explants pretreated with 10 mg/l of TDZ, indicating the highest multiplication ratio (1:6). Highest rooting (over 94%) was obtained in shoots regenerated from pretreated explants on ½ strength MS medium containing 5.0 mg/l of NAA and 50 g/l of sucrose within 15 days. Higher number of tillers/clump (15.3) could be counted in plants regenerated from pretreated explants than untreated ones (10.9 tillers/clump) in field condition, three months after transplantation. Molecular analysis using RAPD and DAMD markers suggested that the pretreatment of explants with TDZ did not adversely affect the genetic stability of regenerated plants and maintained high clonal purity.
Richard C. Cronn; Randall L. Small; Tamara Hanselkorn; Jonathan F. Wendel
2002-01-01
Previous molecular phylogenetic studies have failed to resolve the branching order among the major cotton (Gossypium) lineages, and it has been unclear whether this reflects actual history (rapid radiation) or sampling properties of the genes evaluated. In this paper, we reconsider the phylogenetic relationships of diploid cotton genome groups using DNA sequences from...
EFFECT OF DEFOLIATION ON THE YIELD AND QUALITY OF ‘PRATA COMUM’ BANANA FRUITS
Directory of Open Access Journals (Sweden)
JULIANA DOMINGUES LIMA
Full Text Available ABSTRACT With the advent of black sigatoka in commercial banana crops in the “Vale do Ribeira” region, state of São Paulo, the monitoring the severity and chemical control of the disease in susceptible varieties have become more frequent in order to avoid leaf loss. This study simulated the effect of defoliation caused by the disease on the yield and quality of ‘Prata Comum’ banana fruits, depending on the formation period and fruit position in the bunch. The experimental design was completely randomized in a 2 x11 factorial scheme (period of bunch formation x number of leaves at flowering, 6-16 leaves at flowering in two periods of bunch formation with six replicates. In Period 1, flowering occurred at 04/15/13 and in Period 2 at 01/07/14, although in Period 1, bunch mass was higher and in Period 2, higher average maximum and minimum daily temperatures, precipitation and radiation were observed. Regardless of formation period, the number of leaves at flowering affected bunch mass, which ranged from 18 to 23 kg plant-1. Defoliation affected the size of fruits of hand 1 and last hand of the bunch, but not the variability in fruit size due to the position the fruit occupies in the bunch and physicochemical characteristics.
Gan, Yimei; Liu, Fang; Chen, Dan; Wu, Qiong; Qin, Qin; Wang, Chunying; Li, Shaohui; Zhang, Xiangdi; Wang, Yuhong; Wang, Kunbo
2013-01-01
We investigated the locations of 5S and 45S rDNA in Gossypium diploid A, B, D, E, F, G genomes and tetraploid genome (AD) using multi-probe fluorescent in situ hybridization (FISH) for evolution analysis in Gossypium genus. The rDNA numbers and sizes, and synteny relationships between 5S and 45S were revealed using 5S and 45S as double-probe for all species, and the rDNA-bearing chromosomes were identified for A, D and AD genomes with one more probe that is single-chromosome-specific BAC clone from G. hirsutum (A1D1). Two to four 45S and one 5S loci were found in diploid-species except two 5S loci in G. incanum (E4), the same as that in tetraploid species. The 45S on the 7th and 9th chromosomes and the 5S on the 9th chromosomes seemed to be conserved in A, D and AD genomes. In the species of B, E, F and G genomes, the rDNA numbers, sizes, and synteny relationships were first reported in this paper. The rDNA pattern agrees with previously reported phylogenetic history with some disagreements. Combined with the whole-genome sequencing data from G. raimondii (D5) and the conserved cotton karyotype, it is suggested that the expansion, decrease and transposition of rDNA other than chromosome rearrangements might occur during the Gossypium evolution.
Directory of Open Access Journals (Sweden)
Jinping Hua
2017-05-01
Full Text Available Acetyl-CoA carboxylase is an important enzyme, which catalyzes acetyl-CoA’s carboxylation to produce malonyl-CoA and to serve as a committed step for de novo fatty acid biosynthesis in plastids. In this study, 24 putative cotton BCCP genes were identified based on the lately published genome data in Gossypium. Among them, 4, 4, 8, and 8 BCCP homologs were identified in Gossypium raimondii, G. arboreum, G. hirsutum, and G. barbadense, respectively. These genes were divided into two classes based on a phylogenetic analysis. In each class, these homologs were relatively conserved in gene structure and motifs. The chromosomal distribution pattern revealed that all the BCCP genes were distributed equally on corresponding chromosomes or scaffold in the four cotton species. Segmental duplication was a predominant duplication event in both of G. hirsutum and G. barbadense. The analysis of the expression profile showed that 8 GhBCCP genes expressed in all the tested tissues with changed expression levels, and GhBCCP genes belonging to class II were predominantly expressed in developing ovules. Meanwhile, the expression analysis for the 16 cotton BCCP genes from G. raimondii, G. arboreum and G. hirsutum showed that they were induced or suppressed by cold or salt stress, and their expression patterns varied among different tissues. These findings will help to determine the functional and evolutionary characteristics of the BCCP genes in Gossypium species.
While the boll weevil, Anthonomus grandis, has been identified as one of the most devastating pests in U.S. history, its origin and activity in Mexico, both on wild and cultivated cotton hosts (genus Gossypium), is poorly understood. Three forms (geographical or host-associated races) of A. grandis ...
Cullings, Ken; Raleigh, Christopher; New, Michael H.; Henson, Joan
2005-01-01
Loss of photosynthetic area can affect soil microbial communities by altering the availability of fixed carbon. We used denaturing gradient gel electrophoresis (DGGE) and Biolog filamentous-fungus plates to determine the effects of artificial defoliation of pines in a mixed pine-spruce forest on the composition of the fungal community in a forest soil. As measured by DGGE, two fungal species were affected significantly by the defoliation of pines (P soil fungus increased. The decrease in the amount of Cenococcum organisms may have occurred because of the formation of extensive hyphal networks by species of this genus, which require more of the carbon fixed by their host, or because this fungus is dependent upon quantitative differences in spruce root exudates. The defoliation of pines did not affect the overall composition of the soil fungal community or fungal-species richness (number of species per core). Biolog filamentous-fungus plate assays indicated a significant increase (P soil fungi and the rate at which these substrates were used, which could indicate an increase in fungal-species richness. Thus, either small changes in the soil fungal community give rise to significant increases in physiological capabilities or PCR bias limits the reliability of the DGGE results. These data indicate that combined genetic and physiological assessments of the soil fungal community are needed to accurately assess the effect of disturbance on indigenous microbial systems.
Zhang, Pangzhen; Wu, Xiwen; Needs, Sonja; Liu, Di; Fuentes, Sigfredo; Howell, Kate
2017-07-01
Defoliation is a commonly used viticultural technique to balance the ratio between grapevine vegetation and fruit. Defoliation is conducted around the fruit zone to reduce the leaf photosynthetic area, and to increase sunlight exposure of grape bunches. Apical leaf removal is not commonly practiced, and therefore its influence on canopy structure and resultant wine aroma is not well studied. This study quantified the influences of apical and basal defoliation on canopy structure parameters using canopy cover photography and computer vision algorithms. The influence of canopy structure changes on the chemical compositions of grapes and wines was investigated over two vintages (2010-11 and 2015-16) in Yarra Valley, Australia. The Shiraz grapevines were subjected to five different treatments: no leaf removal (Ctrl); basal (TB) and apical (TD) leaf removal at veraison and intermediate ripeness, respectively. Basal leaf removal significantly reduced the leaf area index and foliage cover and increased canopy porosity, while apical leaf removal had limited influences on canopy parameters. However, the latter tended to result in lower alcohol level in the finished wine. Statistically significant increases in pH and decreases in TA was observed in shaded grapes, while no significant changes in the color profile and volatile compounds of the resultant wine were found. These results suggest that apical leaf removal is an effective method to reduce wine alcohol concentration with minimal influences on wine composition.
I. Alvarez; R. Cronn; J.F. Wendel
2005-01-01
American diploid cottons (Gossypium L., subgenus Houzingenia Fryxell) form a monophyletic group of 13 species distributed mainly in western Mexico, extending into Arizona, Baja California, and with one disjunct species each in the Galapagos Islands and Peru. Prior phylogenetic analyses based on an alcohol dehydrogenase gene (...
Directory of Open Access Journals (Sweden)
Fábio Shigeo Takatsuka
2007-09-01
Full Text Available
Avaliou-se a seletividade de inseticidas sobre o complexo de inimigos naturais na cultura do algodão (Gossypium hirsutum L., no município de Goiânia, GO. Utilizou-se a cultivar Deltapine e o delineamento experimental em blocos ao acaso, com sete tratamentos e quatro repetições. Os tratamentos foram: testemunha, thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1, betacyflutrin (800 mL.ha-1, imidacloprid (70 g.ha-1, diflubenzuron (6,0 g.ha-1, endosulfan (1500 mL.ha-1, em suas apresentações comerciais. A pulverização dos inseticidas foi efetuada aos 45 dias após a emergência das plantas. Além da avaliação prévia, foram efetuadas avaliações aos três e sete dias após a aplicação dos inseticidas. As amostragens foram realizadas através do método de batida de pano, com duas batidas ao acaso por parcela, identificando-se e contando-se, o número de inimigos naturais presentes. Três dias após a aplicação dos tratamentos, os inseticidas thiamethoxam (300 g.ha-1, lufenuron (300 mL.ha-1 e diflubenzuron (60 g.ha-1, considerando os produtos comerciais, não apresentaram efeito de choque sobre o complexo de inimigos naturais presentes na cultura do algodoeiro. Entretanto, aos sete dias após a aplicação, apenas o tratamento com lufenuron manteve a seletividade.a esses artrópodes predadores.
PALAVRAS-CHAVE: Inseticida; controle biológico; Gossypium.
Margarida Tome; Maria Vasconcelos
2000-01-01
The study presented in this paper is part of a project to monitor the defoliation degree of cork and holm oak trees in stands with signs of "decline," alter application of different amounts of Aliette, a product specific for Phytophotora cinnamonii, one of the possible causes of the "decline". The specific objective was to...
Polyploidization altered gene functions in cotton (Gossypium spp.).
Xu, Zhanyou; Yu, John Z; Cho, Jaemin; Yu, Jing; Kohel, Russell J; Percy, Richard G
2010-12-16
Cotton (Gossypium spp.) is an important crop plant that is widely grown to produce both natural textile fibers and cottonseed oil. Cotton fibers, the economically more important product of the cotton plant, are seed trichomes derived from individual cells of the epidermal layer of the seed coat. It has been known for a long time that large numbers of genes determine the development of cotton fiber, and more recently it has been determined that these genes are distributed across At and Dt subgenomes of tetraploid AD cottons. In the present study, the organization and evolution of the fiber development genes were investigated through the construction of an integrated genetic and physical map of fiber development genes whose functions have been verified and confirmed. A total of 535 cotton fiber development genes, including 103 fiber transcription factors, 259 fiber development genes, and 173 SSR-contained fiber ESTs, were analyzed at the subgenome level. A total of 499 fiber related contigs were selected and assembled. Together these contigs covered about 151 Mb in physical length, or about 6.7% of the tetraploid cotton genome. Among the 499 contigs, 397 were anchored onto individual chromosomes. Results from our studies on the distribution patterns of the fiber development genes and transcription factors between the At and Dt subgenomes showed that more transcription factors were from Dt subgenome than At, whereas more fiber development genes were from At subgenome than Dt. Combining our mapping results with previous reports that more fiber QTLs were mapped in Dt subgenome than At subgenome, the results suggested a new functional hypothesis for tetraploid cotton. After the merging of the two diploid Gossypium genomes, the At subgenome has provided most of the genes for fiber development, because it continues to function similar to its fiber producing diploid A genome ancestor. On the other hand, the Dt subgenome, with its non-fiber producing D genome ancestor
Genome-wide investigation and transcriptome analysis of the WRKY gene family in Gossypium.
Ding, Mingquan; Chen, Jiadong; Jiang, Yurong; Lin, Lifeng; Cao, YueFen; Wang, Minhua; Zhang, Yuting; Rong, Junkang; Ye, Wuwei
2015-02-01
WRKY transcription factors play important roles in various stress responses in diverse plant species. In cotton, this family has not been well studied, especially in relation to fiber development. Here, the genomes and transcriptomes of Gossypium raimondii and Gossypium arboreum were investigated to identify fiber development related WRKY genes. This represents the first comprehensive comparative study of WRKY transcription factors in both diploid A and D cotton species. In total, 112 G. raimondii and 109 G. arboreum WRKY genes were identified. No significant gene structure or domain alterations were detected between the two species, but many SNPs distributed unequally in exon and intron regions. Physical mapping revealed that the WRKY genes in G. arboreum were not located in the corresponding chromosomes of G. raimondii, suggesting great chromosome rearrangement in the diploid cotton genomes. The cotton WRKY genes, especially subgroups I and II, have expanded through multiple whole genome duplications and tandem duplications compared with other plant species. Sequence comparison showed many functionally divergent sites between WRKY subgroups, while the genes within each group are under strong purifying selection. Transcriptome analysis suggested that many WRKY genes participate in specific fiber development processes such as fiber initiation, elongation and maturation with different expression patterns between species. Complex WRKY gene expression such as differential Dt and At allelic gene expression in G. hirsutum and alternative splicing events were also observed in both diploid and tetraploid cottons during fiber development process. In conclusion, this study provides important information on the evolution and function of WRKY gene family in cotton species.
International Nuclear Information System (INIS)
Ali, M.A.; Alia, K.B.; Atif, R.M.; Rasulj, I.; Nadeem, H.U.; Shahid, A.; Azeem, F
2017-01-01
SQUAMOSA-Promoter Binding Proteins (SBP) are class of transcription factors that play vital role in regulation of plant tissue growth and development. The genes encoding these proteins have not yet been identified in diploid cotton. Thus here, a comprehensive genome wide analysis of SBP genes/proteins was carried out to identify the genes encoding SBP proteins in Gossypium raimondii and Arabidopsis thaliana. We identified 17 SBP genes from Arabidopsis thaliana genome and 30 SBP genes from Gossypium raimondii. Chromosome localization studies revealed the uneven distribution of SBP encoding genes both in the genomes of A. thaliana and G. raimondii. In cotton, five SBP genes were located on chromosome no. 2, while no gene was found on chromosome 9. In A. thaliana, maximum seven SBP genes were identified on chromosome 9, while chromosome 4 did not have any SBP gene. Thus, the SBP gene family might have expanded as a result of segmental as well as tandem duplications in these species. The comparative phylogenetic analysis of Arabidopsis and cotton SBPs revealed the presence of eight groups. The gene structure analysis of SBP encoding genes revealed the presence of one to eleven inrons in both Arabidopsis and G. raimondii. The proteins sharing the same phyletic group mostly demonstrated the similar intron-exon occurrence pattern; and share the common conserved domains. The SBP DNA-binding domain shared 24 absolutely conserved residues in Arabidopsis. The present study can serve as a base for the functional characterization of SBP gene family in Gossypium raimondii. (author)
Sun, Gao-Fei; He, Shou-Pu; Du, Xiong-Ming
2013-10-01
Cotton genomic studies have boomed since the release of Gossypium raimondii draft genome. In this study, cis-regulatory element (CRE) in 1 kb length sequence upstream 5' UTR of annotated genes were selected and scanned in the Arabidopsis thaliana (At) and Gossypium raimondii (Gr) genomes, based on the database of PLACE (Plant cis-acting Regulatory DNA Elements). According to the definition of this study, 44 (12.3%) and 57 (15.5%) CREs presented "peak-like" distribution in the 1 kb selected sequences of both genomes, respectively. Thirty-four of them were peak-like distributed in both genomes, which could be further categorized into 4 types based on their core sequences. The coincidence of TATABOX peak position and their actual position ((-) -30 bp) indicated that the position of a common CRE was conservative in different genes, which suggested that the peak position of these CREs was their possible actual position of transcription factors. The position of a common CRE was also different between the two genomes due to stronger length variation of 5' UTR in Gr than At. Furthermore, most of the peak-like CREs were located in the region of -110 bp-0 bp, which suggested that concentrated distribution might be conductive to the interaction of transcription factors, and then regulate the gene expression in downstream.
Directory of Open Access Journals (Sweden)
EVERLAN FAGUNDES
2017-10-01
Full Text Available ABSTRACT ‘Gala’ apple trees have low fruit set in restrictive pollination situations, being an obstacle to the achievement of high production rates in orchards in southern Brazil, which can be minimized by the use of growth regulators. The aim of this study was to evaluate the effect of thidiazuron concentrations in ‘Royal Gala’ apple fruiting and production, grown in mild winter conditions. The experiment was conducted during the 2011/2012, 2012/2013 and 2013/2014 crop years in Fraiburgo, SC, on ‘Royal Gala’ apple trees in Marubakaido rootstock M9 with filter. In all evaluation cycles, the experimental design was a randomized block with factorial arrangement (6x2 with six TDZ concentrations and two application forms, with six replicates, and the experimental unit consisting of one plant. The TDZ concentrations of each treatment were applied split into two seasons. The first application was performed on pink bud stage (E2 and the second application was in full bloom stage (F2. The variables evaluated were: fruit set (%, return bloom (%, number and weight of fruits per plant, mean fruit weight (g and average number of seeds per fruit. Data were submitted to analysis of variance, in which for significant variables by the F test, analysis of contrast and polynomial regression were performed in order to evaluate the response of variables with increasing TDZ concentration. TDZ is effective even at low concentrations, increasing the production and fruit set of ‘Gala’ apples in the climatic conditions of southern Brazil.
Changes in temperature, atmospheric [CO2] and precipitation under the scenarios of projected climate change present a challenge to crop production, and may have significant impacts on the physiology, growth and yield of cotton (Gossypium hirsutum L.). A glasshouse experiment explored the early growt...
Response of barley to grasshopper defoliation in interior Alaska: dry matter and grain yield.
Begna, Sultan H; Fielding, Dennis J
2005-12-01
Barley, Hordeum vulgare L., is well adapted to subarctic Alaska growing conditions, but little is known about its response to grasshopper defoliation. A field experiment was conducted to study dry matter and grain yield in response to a combination of grasshopper defoliation and weeds in 2002 and 2003 near Delta Junction, AK (63 degrees 55' N, 145 degrees 20' W). Barley plants at third to fourth leaf stage were exposed to a combination of two levels of weeds (present or absent) and four densities of grasshoppers (equivalent to 0, 25, 50, and 75 grasshoppers per m2) of third to fourth instars of Melanoplus sanguinipes (F). Dry matter accumulation by the barley plants was determined at three times during the growing seasons: approximately 10 d after introduction of the grasshoppers, shortly after anthesis, and at maturity. Dry matter accumulation and grain yield were much lower in 2003 than in 2002, probably due to very low levels of soil moisture early in the growing season of 2003. Head clipping accounted for a greater portion of yield loss in 2003 than in 2002. The percentage of reduction in harvestable yield due to grasshoppers remained fairly constant between years (1.9 and 1.4 g per grasshopper per m2 in 2002 and 2003, respectively) despite a large difference in overall yield. Examination of the yield components suggest that yields were reduced by the early season drought in 2003 primarily through fewer seeds per head, whereas grasshoppers in both years reduced average seed weight, but not numbers of seeds.
Jeffrey P. Prestemon; James A. Turner; Joseph Buongiorno; Shushuai Zhu; Ruhong Li
2008-01-01
US policy and forest product industry decisionmakers need quantitative information about the magnitude of timber product market impacts from the possible introduction of an exotic and potentially dangerous defoliating forest pest. We applied the Global Forest Products Model to evaluate the effects on the United States of an invasion by the Asian gypsy (...
Energy Technology Data Exchange (ETDEWEB)
Moreno, R.; Torregrosa, A.; Moltó, E.; Chueca, P.
2015-07-01
Spain ranks as the world’s leading exporter of citrus for fresh consumption. Manual harvest accounts for 50% of the total production costs. Mechanical harvest would increase labor productivity and benefits of growers. Efficiency of these machines depends on the varieties and operating conditions. Use of abscission chemicals has been promoted to increase the detachment rate of fruit without affecting its quality. This work is aimed at studying whether the mechanical harvest and/or the application of an abscission agent affect the quality and quantity of harvested fruit and tree defoliation under the conditions of citrus cultivation in Spain. Trials were made in a completely randomized experimental design. From 2008 to 2011, different orchards of mandarin and orange trees were sprayed with different doses of ethephon as abscission agent and harvested with a trunk shaker. Harvest related variables (detachment percentage, defoliation and fruit without calyx) were measured. The percentage of fruit detached by the trunk shaker ranged between 70 and 85% and it did not depend on the orchard. The shaker produced minimal damage to the bark when gripped incorrectly. Increased doses of ethephon increased fruit detachment except in ‘Clemenules’ orchard, but also increased the fruit without calyx in 1-9%. Moreover, ethephon promoted significant defoliation. Neither gummosis nor death of branches was observed. This work demonstrates that mechanical harvesting with trunk shakers may be a feasible solution for citrus cultivated in Spain for fresh market. Use of ethephon could only be recommended for citrus destined to industry and only for certain varieties. (Author)
Directory of Open Access Journals (Sweden)
Rosana Moreno
2015-03-01
Full Text Available Spain ranks as the world’s leading exporter of citrus for fresh consumption. Manual harvest accounts for 50% of the total production costs. Mechanical harvest would increase labor productivity and benefits of growers. Efficiency of these machines depends on the varieties and operating conditions. Use of abscission chemicals has been promoted to increase the detachment rate of fruit without affecting its quality. This work is aimed at studying whether the mechanical harvest and/or the application of an abscission agent affect the quality and quantity of harvested fruit and tree defoliation under the conditions of citrus cultivation in Spain. Trials were made in a completely randomized experimental design. From 2008 to 2011, different orchards of mandarin and orange trees were sprayed with different doses of ethephon as abscission agent and harvested with a trunk shaker. Harvest related variables (detachment percentage, defoliation and fruit without calyx were measured. The percentage of fruit detached by the trunk shaker ranged between 70 and 85% and it did not depend on the orchard. The shaker produced minimal damage to the bark when gripped incorrectly. Increased doses of ethephon increased fruit detachment except in ‘Clemenules’ orchard, but also increased the fruit without calyx in 1-9%. Moreover, ethephon promoted significant defoliation. Neither gummosis nor death of branches was observed. This work demonstrates that mechanical harvesting with trunk shakers may be a feasible solution for citrus cultivated in Spain for fresh market. Use of ethephon could only be recommended for citrus destined to industry and only for certain varieties.
Cullings, Ken; Raleigh, Christopher; New, Michael H.; Henson, Joan
2005-01-01
Loss of photosynthetic area can affect soil microbial communities by altering the availability of fixed carbon. We used denaturing gradient gel electrophoresis (DGGE) and Biolog filamentous-fungus plates to determine the effects of artificial defoliation of pines in a mixed pine-spruce forest on the composition of the fungal community in a forest soil. As measured by DGGE, two fungal species were affected significantly by the defoliation of pines (P the frequency of members of the ectomycorrhizal fungus genus Cenococcum decreased significantly, while the frequency of organisms of an unidentified soil fungus increased. The decrease in the amount of Cenococcum organisms may have occurred because of the formation of extensive hyphal networks by species of this genus, which require more of the carbon fixed by their host, or because this fungus is dependent upon quantitative differences in spruce root exudates. The defoliation of pines did not affect the overall composition of the soil fungal community or fungal-species richness (number of species per core). Biolog filamentous-fungus plate assays indicated a significant increase (P the number of carbon substrates utilized by the soil fungi and the rate at which these substrates were used, which could indicate an increase in fungal-species richness. Thus, either small changes in the soil fungal community give rise to significant increases in physiological capabilities or PCR bias limits the reliability of the DGGE results. These data indicate that combined genetic and physiological assessments of the soil fungal community are needed to accurately assess the effect of disturbance on indigenous microbial systems.
Axelson, Jodi; Gärtner, Holger; Alfaro, René; Smith, Dan
2013-04-01
The western spruce budworm (Choristoneura occidentalis Freeman) is the most widespread and destructive defoliator of coniferous forests in western North America, and has a long-term coexistence with its primary host tree, Douglas-fir (Pseudotsuga menziesii Franco). Western spruce budworm (WSB) outbreaks usually last for several years, and cause reductions in annual growth, stem defects, and regeneration delays. In British Columbia, the WSB is the second most damaging insect after the mountain pine beetle, and sustained and/or severe defoliation can result in the mortality of host trees. Numerous studies have used tree rings to reconstruct WSB outbreaks across long temporal scales, to evaluate losses in stand productivity, and examine isotope ratios. Although some studies have looked at the impacts of artificial defoliation on balsam fir in eastern North America, there has been no prior research on how WSB outbreaks affect the anatomical structure of the stem as described by intra-annual wood density and potential cell size variations. The objective of this study was to anatomically examine the response of Douglas-fir to sustained WSB outbreaks in two regions of southern British Columbia. We hypothesize that the anatomical intra-annual characteristics of the tree rings, such as cell wall thickness, latewood cell size, and/or lumen area changes during sustained WSB outbreaks. To test this hypothesis we sampled four permanent sample plots in coastal and dry interior sites, which had annually resolved defoliation data collected over a 7-12 year period. At each site diameter-at-breast height (cm), height (m), and crown position were recorded and three increment cores were extracted from 25 trees. Increment cores were prepared to permit anatomical and x-ray density analyses. For each tree, a 15µm thick micro section was cut from the radial plane. Digital images of the micro sections were captured and processed. In each annual ring, features such as cell lumen area (µm2
MIC-3-related genes of cotton (Gossypium spp.) were identified and shown to have root-specific expression, associated with pathogen defense-related function and specifically increased expression in root-knot nematode (RKN) resistant plants after nematode infection. Here we cloned and sequenced MIC-...
Genetic basis of some yield components in gossypium hirsutum l
International Nuclear Information System (INIS)
Javed, A.; Azhar, F.M.; Khan, I.A.; Rana, S.A.
2014-01-01
A 5 * 5 diallel analysis was conducted to study the inheritance of seed cotton yield, number of bolls and boll weight in Gossypium hirsutum L. using combining ability technique. The analysis of the data revealed that variance due to specific combining ability was significant for all the three traits signifying the importance of non additive gene action. The comparison of the parents showed that NF-801-2-37 was the best general combiner for seed cotton yield, number of bolls and boll weight followed by Acala-63-75. Best hybrid combinations identified were Acala-63-75 * NF-801-2-37 for seed cotton yield and DPL-61 * NF-801-2-37 for number of bolls and boll weight. Higher proportion of dominance variance in all three traits suggested delayed selection or use of heterosis breeding in crop improvement programs. (author)
To Identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode and fungal disease resistance traits, a series of interspecific cotton (Gossypium spp.) chromosome substitution (CS) lines were used in this study. The CS lines were developed in ...
Tessema, Z.K.; Mihret, J.; Solomon, M.
2010-01-01
Growth characteristics, dry-matter (DM) yield, chemical components and in vitro dry-matter digestibility (IVDMD) of Napier grass were studied in a randomized complete block design with three replications at Haramaya University, Ethiopia. The treatments were three defoliation frequencies (60, 90 and
Hou, Meiying; Cai, Caiping; Zhang, Shuwen; Guo, Wangzhen; Zhang, Tianzhen; Zhou, Baoliang
2013-12-01
Gossypium tomentosum, a wild tetraploid cotton species with AD genomes, possesses genes conferring strong fibers and high heat tolerance. To effectively transfer these genes into Gossypium hirsutum, an entire microsatellite (simple sequence repeat, SSR)-based genetic map was constructed using the interspecific cross of G. hirsutum x G. tomentosum (HT). We detected 1800 loci from 1347 pairs of polymorphic primers. Of these, 1204 loci were grouped into 35 linkage groups at LOD ≥ 4. The map covers 3320.8 cM, with a mean density of 2.76 cM per locus. We detected 420 common loci (186 in the At subgenome and 234 in Dt) between the HT map and the map of TM-1 (G. hirsutum) and Hai 7124 (G. barbadense; HB map). The linkage groups were assigned chromosome numbers based on location of common loci and the HB map as reference. A comparison of common markers revealed that no significant chromosomal rearrangement exist between G. tomentosum and G. barbadense. Interestingly, however, we detected numerous (33.7%) segregation loci deviating from 3:1 ratio (P constructed in this study will be useful for further genetic studies on cotton breeding, including mapping loci controlling quantitative traits associated with fiber quality, stress tolerance and developing chromosome segment specific introgression lines from G. tomentosum into G. hirsutum using marker-assisted selection.
Directory of Open Access Journals (Sweden)
Chenghao Zhu
2018-02-01
Full Text Available Pine forests (Pinus tabulaeformis have been in danger of defoliation by a caterpillar in the west Liaoning province of China for more than thirty years. This paper aims to assess and predict the degree of damage to pine forests by using remote sensing and ancillary data. Through regression analysis of the pine foliage remaining ratios of field plots with several vegetation indexes of Landsat data, a feasible inversion model was obtained to detect the degree of damage using the Normalized Difference Infrared Index of 5th band (NDII5. After comparing the inversion result of the degree of damage to the pine in 29 years and the historical damage record, quantized results of damage assessment in a long time-series were accurately obtained. Based on the correlation analysis between meteorological variables and the degree of damage from 1984 to 2015, the average degree of damage was predicted in temporal scale. By adding topographic and other variables, a linear prediction model in spatiotemporal scale was constructed. The spatiotemporal model was based on 5015 public pine points for 24 years and reached 0.6169 in the correlation coefficient. This paper provided a feasible and quantitative method in the spatiotemporal prediction of forest pest occurrence by remote sensing.
Exp2 polymorphisms associated with variation for fiber quality properties in cotton (Gossypium spp.
Directory of Open Access Journals (Sweden)
Daohua He
2014-10-01
Full Text Available Plant expansins are a group of extracellular proteins thought to affect the quality of cotton fibers. Previous expression profile analysis revealed that six Expansin A genes are present in cotton, of which two (GhExp1 and GhExp2 produce transcripts that are specific to the developing cotton fiber. To identify the phenotypic function of Exp2, and to determine whether nucleotide variation among alleles of Exp2 affects fiber quality, candidate gene association mapping was conducted. Gene-specific primers were designed to amplify the Exp2 gene. By amplicon sequencing, the nucleotide diversity of Exp2 was investigated across 92 accessions (including 7 Gossypium arboreum, 74 Gossypium hirsutum, and 11 Gossypium barbadense accessions with different fiber qualities. Twenty-six SNPs and seven InDels including 14 from the coding region of Exp2 were detected, forming twelve distinct haplotypes in the cotton collection. Among the 14 SNPs in the coding region, five were missense mutations and nine were synonymous nucleotide changes. The average SNP/InDel per nucleotide ratio was 2.61% (one SNP per 39 bp, with 1.81 and 3.87% occurring in coding and non-coding regions, respectively. Nucleotide and haplotype diversity across the entire Exp2 region was 0.00603 (π and 0.844, respectively, and diversity in non-coding regions was higher than that in coding regions. For linkage disequilibrium (LD, the mean r2 value for all polymorphism loci pairs was 0.48, and LD did not decay over 748 bp. Based on 132 simple sequence repeat (SSR loci evenly covering 26 chromosomes, the population structure was estimated, and the accessions were divided into seven groups that agreed well with their genomic origin and evolutionary history. A general linear model was used to calculate the Exp2-wide diversity–trait associations of 5 fiber quality traits, considering population structure (Q. Four SNPs in Exp2 were associated with at least one of the fiber quality traits, but not with
Directory of Open Access Journals (Sweden)
Mario Hirano
2010-09-01
Full Text Available Este estudo teve como objetivo avaliar a precisão e acurácia de avaliadores com o uso de escala diagramática, em estimativas de desfolha provocada por doenças em soja. A escala apresenta seis níveis de severidade de desfolha (5, 15, 45, 65, 85 e 100%. As imagens utilizadas para avaliação foram obtidas em parcelas atacadas por ferrugem asiática (Phakopsora pachyrhizi, apresentando diferentes níveis de desfolha. A validação foi feita por dez avaliadores, utilizando-se como parâmetro de comparação dados reais da área com cobertura foliar, obtidos através de processamento de imagens, nos softwares Paint Shop Pro 4, e Adobe Photoshop 7.0. Quando não foi utilizada a escala, os avaliadores apresentaram tendência de subestimar a severidade de desfolha nos níveis mais baixos e de superestimar em níveis altos. A acurácia e precisão dos avaliadores aumentaram com o auxílio da escala diagramática.This study aimed to evaluate the precision and accuracy of evaluators using diagrammatic scale to estimate defoliation caused by diseases in soybean. The scale had six levels of severity of defoliation (5, 15, 45, 65, 85 and 100%. The images used for evaluation were obtained in plots attacked by Asian soybean rust (Phakopsora pachyrhizi, presenting different levels of defoliation. The validation was performed by ten evaluators, comparing estimated data with the actual data of the area coverage leaf, obtained by processing images in Paint Shop Pro 4 software, and Adobe Photoshop 7.0. The evaluators presented tendency to underestimate the defoliation in the lower levels of severity and overestimate the defoliation in high levels of severity, when the scale was not used. The accuracy and precision of the evaluators increased with the use of the scale diagrammatic.
El-Ashry, Amal Abd El-Latif; Gabr, Ahmed Mohamed Magdy; Bekheet, Shawky Abd El-Hamid
2017-01-01
Jojoba is a promising industrial plant, which recommended with pharmaceutical benefits. The present study was conducted to stimulate embryogenic calli formation from jojoba using zeatin and thidiazuron (TDZ), as well as determination of the antioxidant activity of proliferated calli. For callus induction, leaf and stem explants derived from in vitro grown shootlets, were cultured on Murashige and Skoog (MS) medium with different combinations of 0.5 mg L-1 benzyl adenine (BA) or kinetin with 2,4-Dichlorophenoxyacetic acid (2,4-D), Naphthalene acetic acid (NAA) and picloram at 0.5 or 1mg L-1. To stimulate embryogenic calli, friable callus were transferred to woody plant medium (WPM) supplemented with different concentrations of zeatin or TDZ. Antioxidant activity of different treatments was determined using hexane or petroleum ether extraction. Data was analyzed as mean±standard deviation (SD). The MS medium supplemented with 0.5 mg L-1 BA+0.5 or 1 mg L-1 picloram was the best treatment to obtain friable calli from both explants types. WPM medium supplemented with 2 mg L-1 zeatin gave the highest percentage of embryogenic calli derived from leaf explants. While the highest percentage of embryogenic calli derived from stem explants was registered using 1 or 4 mg L-1 TDZ containing medium. Embryogenic calli originated from leaves explants on 1.5 mg L-1 zeatin showed promising activity of antioxidant with hexane extraction. However, embryogenic calli originated from stem explants on 1 mg L-1 TDZ showed the highest antioxidant activity with petroleum ether extraction. TDZ has promising effect on embryogenic callus induction from stem explants. While, zeatin has promising effect on embryogenic callus induction from leaf explants.
Nohong, Budiman
2016-01-01
Phosphorus fertilization on crop mixtures Cogongrass-Stylo's very important for the development of root nodules, nitrogen fixation and improve the botanical composition Stylo to confront an aggressive Cogon grass. This study aims to improve the productivity and quality of crops mixtures Cogon grass-Stylo through fertilization and defoliation frequency. The study consisted of two factors . The first factor is the phosphorus fertilizer with a dose of 0 (P0 ) and 100 kg P2O/ha (P1 ). The second ...
Cytomorphological studies in X-ray induced glandless haploids in Gossypium hirsutum L. (cotton)
Energy Technology Data Exchange (ETDEWEB)
Mehetre, S.S.; Thombre, M.V. (Mahatma Phule Krishi Vidyapeeth, Rahuri (India))
1981-08-01
Six haploid plants were obtained in M/sub 2/ generation of the 25 kr. X-ray irradiated Gossypium hirsutum L. cotton variety H.G. 108. The cytomorphological studies on these plants indicated highly irregular meiosis, giving on an average six bivalents, the range being 0-9. Unequal separation of chromosomes and chromatids at anaphase-1 and II respectively led to formation of abnormal tetrads and pollens with high size variations leading to high pollen sterility. These plants were characterized by miniature stature, shorter stem and internodes, smaller leaves, flowers and stomata with fewer chloroplasts, male and female sterility and halving of chromosomes. The reduction in morphological characters was nearly in the proportion of 1:2 as compared to their diploid counterparts. 31 refs.; 5 tables; 12 figures.
Effect of factory effluents on physiological and biochemical contents of Gossypium hirsutum l.
Muthusamy, A; Jayabalan, N
2001-10-01
The effect of sago and sugar factory effluents was studied on Gossypium hirsutum L. var. MCU 5 and MCU 11. Plants were irrigated with 0, 25, 50, 75 and 100% of effluents of both factories. At lower concentration (25%) of sugar factory effluents had stimulatory effect on all biochemical contents observed. Moreover, all concentration of sago factory effluents were found to have inhibitory effect on all biochemical contents except proline content which increased with increasing concentration of both the effluents. Plants growing on adjacent to sago and sugar factories or they irrigated with such type of polluted water, may accumulate the heavy metals found in both the effluents, at higher levels in plant products and if consumed may have similar effect on living organisms.
Guo, Hui; Wang, Xiyin; Gundlach, Heidrun; Mayer, Klaus F X; Peterson, Daniel G; Scheffler, Brian E; Chee, Peng W; Paterson, Andrew H
2014-08-01
Genome duplication is thought to be central to the evolution of morphological complexity, and some polyploids enjoy a variety of capabilities that transgress those of their diploid progenitors. Comparison of genomic sequences from several tetraploid (AtDt) Gossypium species and genotypes with putative diploid A- and D-genome progenitor species revealed that unidirectional DNA exchanges between homeologous chromosomes were the predominant mechanism responsible for allelic differences between the Gossypium tetraploids and their diploid progenitors. Homeologous gene conversion events (HeGCEs) gradually subsided, declining to rates similar to random mutation during radiation of the polyploid into multiple clades and species. Despite occurring in a common nucleus, preservation of HeGCE is asymmetric in the two tetraploid subgenomes. At-to-Dt conversion is far more abundant than the reciprocal, is enriched in heterochromatin, is highly correlated with GC content and transposon distribution, and may silence abundant A-genome-derived retrotransposons. Dt-to-At conversion is abundant in euchromatin and genes, frequently reversing losses of gene function. The long-standing observation that the nonspinnable-fibered D-genome contributes to the superior yield and quality of tetraploid cotton fibers may be explained by accelerated Dt to At conversion during cotton domestication and improvement, increasing dosage of alleles from the spinnable-fibered A-genome. HeGCE may provide an alternative to (rare) reciprocal DNA exchanges between chromosomes in heterochromatin, where genes have approximately five times greater abundance of Dt-to-At conversion than does adjacent intergenic DNA. Spanning exon-to-gene-sized regions, HeGCE is a natural noninvasive means of gene transfer with the precision of transformation, potentially important in genetic improvement of many crop plants. Copyright © 2014 by the Genetics Society of America.
Liu, Guozheng; Cao, Dandan; Li, Shuangshuang; Su, Aiguo; Geng, Jianing; Grover, Corrinne E; Hu, Songnian; Hua, Jinping
2013-01-01
Mitochondria are the main manufacturers of cellular ATP in eukaryotes. The plant mitochondrial genome contains large number of foreign DNA and repeated sequences undergone frequently intramolecular recombination. Upland Cotton (Gossypium hirsutum L.) is one of the main natural fiber crops and also an important oil-producing plant in the world. Sequencing of the cotton mitochondrial (mt) genome could be helpful for the evolution research of plant mt genomes. We utilized 454 technology for sequencing and combined with Fosmid library of the Gossypium hirsutum mt genome screening and positive clones sequencing and conducted a series of evolutionary analysis on Cycas taitungensis and 24 angiosperms mt genomes. After data assembling and contigs joining, the complete mitochondrial genome sequence of G. hirsutum was obtained. The completed G.hirsutum mt genome is 621,884 bp in length, and contained 68 genes, including 35 protein genes, four rRNA genes and 29 tRNA genes. Five gene clusters are found conserved in all plant mt genomes; one and four clusters are specifically conserved in monocots and dicots, respectively. Homologous sequences are distributed along the plant mt genomes and species closely related share the most homologous sequences. For species that have both mt and chloroplast genome sequences available, we checked the location of cp-like migration and found several fragments closely linked with mitochondrial genes. The G. hirsutum mt genome possesses most of the common characters of higher plant mt genomes. The existence of syntenic gene clusters, as well as the conservation of some intergenic sequences and genic content among the plant mt genomes suggest that evolution of mt genomes is consistent with plant taxonomy but independent among different species.
Effects of ionizing radiation on the hypocotyl-root axis of three species of gossypium
International Nuclear Information System (INIS)
Reed, J.P.
1977-01-01
The hypocotyl-root axis of cotton seedlings grown from irradiated and non-irradiated seeds was investigated using light microscopy and histological techniques. Special emphasis was placed on the pattern of vascular transition. Two patterns of vascular transition in non-irradiated seedlings were found. In Gossypium hirsutum and G. barbadense there are prominent metaxylem bands between the vascular bundles in the hypocotyl. In G. gossypioides there are no bands. The presence or absence of the bands was easily detected using polarized light. The most outstanding effects of radiation were inhibition of lateral root development and alteration of the pattern of vascular transition in seedlings grown from irradiated seeds. The findings suggest that the root apical meristem determines the vascular pattern
Directory of Open Access Journals (Sweden)
Sarr D.
2009-01-01
Full Text Available Genetic broadening of the main cultivated cotton species Gossypium hirsutum L. by creation and exploitation of monosomic alien addition lines. The genus Gossypium is composed of about forty wild diploïd species that constitute an important reservoir of interesting genes for the genetic improvement of Gossypium hirsutum L., the main cultivated cotton species. Creation of monosomic alien addition lines (MAAL, made up of plants having in addition to the chromosome set of the cultivated species one wild species' supernumerary chromosome, is an interesting way to exploit this diversity. Numerous constraints limit the creation of MAAL, among them the most important is doubtless the production of first generation derivatives from pentaploids obtained by backcrossing G. hirsutum with bispecific hexaploid hybrids made of the cultivated species tetraploid genome and the genome of a donor diploid species. Raising this impediment by appropriate techniques allows to develop MAAL offering the possibility to introgress finely traits of interest from diploid species and to better understand genomic relationships between species in the genus Gossypium. Identification and exploitation of these MAAL have been for a long time based on not very reliable morphological characteristics and on the use of classical cytogenetic techniques, very heavy to implement. Nowadays, the exploitation of MAAL benefits from the great advances registered in molecular biology through the development of DNA markers and molecular cytogenetics. These progresses make of MAAL a promising way for the genetic improvement of the main cultivated cotton species.
Directory of Open Access Journals (Sweden)
Otilia Ivan
2009-11-01
Full Text Available This study was carried out in the context of some complex researches concerning the effects of long standing use of the pesticides in the control of the defoliating insects, in forest ecosystems. These investigations showed that the structural parameters of the oribatid mites' communities are obviously influenced by the stands biotic and abiotic factors, alongside some varied anthropogenic factors, such as:treatments, industrial pollution, some management measures etc. This paper includes a comparative analysis of the research results obtained in two forest stands placed in the Moldavian Plateau (Ciurea Forest District, Iasi county: Tomesti-Poieni (integratedcontrol of the defoliating insects and ªanta (chemical control. The analysis of the faunistic material collected in these two forests has shown that, in the first stand (the control perimeter, the density, the number of species, and also the specific diversity have higher values compared to the second station. In unfavourable climatic conditions(e. g. during the winter season it was observed a more increased decline of these parameters in the ªanta forest, related to the control station. In such conditions (low temperatures, deficit of humidity etc. the change of the vertical distribution of the effectives was observed in both stands, and a massive migration of the oribatid mites in the deeper, humiferous layer of the soil. The results gathered during the project emphasize that the chemical treatments used against the defoliating insects enhance the negative effects of some natural factors, representing an additional stressing factor on the edaphic microarthropods' communities.
Directory of Open Access Journals (Sweden)
Otilia Ivan
2009-12-01
Full Text Available This study was carried out in the context of some complex researches concerning the effects of long standing use of the pesticides in the control of the defoliating insects, in forest ecosystems. These investigations showed that the structural parameters of the oribatid mites' communities are obviously influenced by the stands biotic and abiotic factors, alongside some varied anthropogenic factors, such as: treatments, industrial pollution, some management measures etc. This paper includes a comparative analysis of the research results obtained in two forest stands placed in the Moldavian Plateau (Ciurea Forest District, Iasi county: Tomesti-Poieni (integrated control of the defoliating insects and Santa (chemical control. The analysis of the faunistic material collected in these two forests has shown that, in the first stand (the control perimeter, the density, the number of species, and also the specific diversity have higher values compared to the second station. In unfavourable climatic conditions (e. g. during the winter season it was observed a more increased decline of these parameters in the Santa forest, related to the control station. In such conditions (low temperatures, deficit of humidity etc. the change of the vertical distribution of the effectives was observed in both stands, and a massive migration of the oribatid mites in the deeper, humiferous layer of the soil. The results gathered during the project emphasize that the chemical treatments used against the defoliating insects enhance the negative effects of some natural factors, representing an additional stressing factor on the edaphic microarthropods' communities.
Infraspecific DNA methylation polymorphism in cotton (Gossypium hirsutum L.).
Keyte, Anna L; Percifield, Ryan; Liu, Bao; Wendel, Jonathan F
2006-01-01
Cytosine methylation is important in the epigenetic regulation of gene expression and development in plants and has been implicated in silencing duplicate genes after polyploid formation in several plant groups. Relatively little information exists, however, on levels and patterns of methylation polymorphism (MP) at homologous loci within species. Here we explored the levels and patterns of methylation-polymorphism diversity at CCGG sites within allotetraploid cotton, Gossypium hirsutum, using a methylation-sensitive amplified fragment length polymorphism screen and a selected set of 20 G. hirsutum accessions for which we have information on genetic polymorphism levels and relationships. Methylation and MP exist at high levels within G. hirsutum: of 150 HpaII/MspI sites surveyed, 48 were methylated at the inner cytosine (32%) and 32 of these were polymorphic (67%). Both these values are higher than comparable measures of genetic diversity using restriction fragment length polymorphisms. The high percentage of methylation-polymorphic sites and potential relationship to gene expression underscore the potential significance of MP within and among populations. We speculate that biased correlation of methylation-polymorphic sites and genes in cotton may be a consequence of polyploidy and the attendant doubling of all genes.
Major quantitative trait loci (QTL) have been mapped to Upland cotton (Gossypium hirsutum L.) chromosomes 11 and 14 that govern the highly resistant phenotype in response to infection by root-knot nematode (RKN; Meloidogyne incognita Chitwood & White); however, nearly nothing is known regarding the ...
Nagler, P. L.; Dennison, P. E.; Hultine, K. R.; van Riper, C.; Glenn, E. P.
2008-12-01
Since its introduction to the western U.S. more than a century ago, tamarisk (Tamarix spp.) has become dominant or sub-dominant over many major arid, and semi-arid river systems and their tributaries. The presence of tamarisk has been cited for reducing water availability for human enterprise and biodiversity, displacing native vegetation and for reducing habitat quality for wildlife. With increasing emphasis by public and private sectors on controlling saltcedar (Tamarix chinensis) in the western US, there will likely be a dramatic change in riparian vegetation composition over the course of the next several decades. The rates at which these changes will occur, and the resultant effects on riparian insects and birds that utilize insects for food, are presently unknown. Effects on riparian vegetation communities, resulting from changes in host plant species composition, will likely include changes in plant biomass, microclimate changes, and plant species diversity. These changes could potentially have a profound impact on migratory and breeding birds within riparian corridors throughout the southwest. Recently, the saltcedar leaf beetle (Diorhabda elongata) was released as a tamarisk biocontrol agent. This beetle has successfully defoliated tamarisk where it has been introduced, but there are currently no comprehensive programs in place for monitoring the rapid spread of Diorhabda, the impact of defoliation on habitat and water resources, or the long-term impact of defoliation on tamarisk. We used higher spatial resolution ASTER data and coarser MODIS data for monitoring defoliation caused by Diorhabda elongata and subsequent changes in evapotranspiration (ET). Widespread tamarisk defoliation was observed in an eastern Utah study area during summers 2007, 2008. We measured stem sap flux, leaf carbon isotope ratios, leaf area, LAI, and vegetation indices from mounted visible and infrared cameras and satellite imagery. The cameras were paired on towers installed 30
Directory of Open Access Journals (Sweden)
N. Peralta
2011-06-01
Full Text Available La utilización de cultivos de trigo con doble propósito contribuiría a realizar un uso más eficiente de los recursos ambientales. En Balcarce (Buenos Aires, Argentina se estableció un cultivo de trigo (Triticum aestivum, cv. Baguette 20 sembrado en fecha temprana (17 de marzo de 2006 para comparar la producción de forraje obtenida con tres regímenes de defoliación: T1 (tres defoliaciones, T2 (dos defoliaciones y TG (sin defoliaciones. En esos tres tratamientos y en otro no defoliado sembrado en fecha normal para la producción de grano (7 de junio, TN se cuantificó la biomasa aérea (g MS m², el rendimiento de grano (kg ha-1 y sus componentes. La producción de forraje de T1 fue similar que la de T2 (497 y 392 g m-2, respectivamente. Las defoliaciones posteriores al estado de dos nudos (estado Zadoks 32 afectaron negativamente la radiación fotosintéticamente activa interceptada por el cultivo, disminuyendo tanto el número de granos m-2 como el peso por grano; en consecuencia, la producción de grano cayó 60% respecto de TG y 71% respecto de TN. Se estableció una relación cuantitativa entre la disminución del rendimiento en grano y el momento del último corte (i.e., días entre la última defoliación y antesis. El trigo presenta la ventaja de poseer un destino alternativo a su uso forrajero, que no la presentan otros verdeos de invierno. Puede destinarse sólo para uso forrajero, sólo para producir grano, o se lo puede utilizar buscando un balance entre la producción de forraje y grano.The utilization of dual purpose wheat crops may contribute to perform a more efficient use of environmental resources. In Balcarce (Buenos Aires, Argentina a wheat crop (Triticum aestivum, cv. Baguette 20 was seeded at an early date (March 17, 2006 and the forage production was compared with three defoliation frequencies: T1 (three defoliations; T2 (two defoliations and TG (without defoliations. The aerial biomass, grain yield (kg ha-1 and its
Investigating the Antioxidant and Acetylcholinesterase Inhibition Activities of Gossypium herbaceam
Directory of Open Access Journals (Sweden)
Haji Akber Aisa
2013-01-01
Full Text Available Our previous research showed that standardized extract from the flowers of the Gossypium herbaceam labeled GHE had been used in clinical trials for its beneficial effects on brain functions, particularly in connection with age-related dementia and Alzheimer’s disease (AD. The aim of this work was to determine the components of this herb and the individual constituents of GHE. In order to better understand this herb for AD treatment, we investigated the acetylcholinesterase (AChE inhibition and antioxidant activity of GHE as well as the protective effects to PC12 cells against cytotoxicity induced by tertiary butyl hydroperoxide (tBHP using in vitro assays. The antioxidant activities were assessed by measuring their capabilities for scavenging 1,1-diphenyl-2-picylhydrazyl (DPPH and 2-2'-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid (ABTS free radical as well as in inhibiting lipid peroxidation. Our data showed that GHE exhibited certain activities against AChE and also is an efficient free radical scavenger, which may be helpful in preventing or alleviating patients suffering from AD.
Directory of Open Access Journals (Sweden)
L. M. Garé
2017-12-01
Full Text Available A inoculação com bactérias do gênero Azospirillum pode contribuir com o fornecimento de nitrogênio (N e com o crescimento das plantas, pois esses microrganismos são também promotores de crescimento. Por outro lado a aplicação nas doses e épocas adequadas do regulador vegetal de efeito citocinínico thidiazuron (TDZ pode vir a beneficiar a produtividade de grãos. Dessa maneira, o objetivo do trabalho foi avaliar o efeito de doses de TDZ sobre a produtividade do arroz, na presença e ausência da inoculação foliar com Azospirillum brasilense. Foi utilizada a cultivar ANa 5015, no delineamento experimental de blocos casualizados em esquema fatorial 4 x 2, sendo quatro doses de TDZ (0,0; 0,5; 1,0 e 1,5g ha-1 aplicadas por ocasião do perfilhamento, 30 DAE, e da aplicação de Azospirillum brasilense (presença ou ausência em dose fixa aos 20 DAE. Verificou-se que a cultivar ANa 5015 não se mostrou responsiva para a inoculação foliar com Azospirillum brasilense na dose de 200 mL ha-1. Para as doses de TDZ aplicadas via foliar, houve uma variação significativa na altura de plantas, cuja dose de 0,41 g ha-1 resultou na altura máxima de 1,11 m. Não houve efeito das doses de TDZ na produtividade, massa de 100 grãos, número de panículas por m², grãos por panícula e massa hectolítrica.
Carter, William W.
1981-01-01
Gossypium arboreum 'Nanking CB 1402' possessed a high level of resistance to Rotylenchulus reniformis. Within 16 h, the nematode penetrated roots of resistant and susceptible cottons equally. After 36 h, significantly fewer nematodes were found in resistant roots. Larvae fed in either an endodermal or pericyclic cell and had no specificity for root tissue of a particular age. In roots of resistant G. arboreum '1402,' wall breakdown of pericyclic cells was evident after 3 d, endodermal and cortical cells collapsed, and the hypertrophied pericyclic cells disintegrated within 12 d. Cell walls immediately adjacent to the nematode's head were thickened and more safranin positive in resistant than in susceptible cotton cultivars. Several other cultivars of G. arboreum were also resistant to R. reniformis, based on nematode fecundity and percent egg reduction. PMID:19300777
Energy Technology Data Exchange (ETDEWEB)
Ribeiro, Rafael C.; Lemos, Walkymario P.; Muller, Antonio A. [EMBRAPA Amazonia Oriental, Belem, PA (Brazil). Lab. de Entomologia], e-mail: rafaufra@yahoo.com.br, e-mail: wplemos@cpatu.embrapa.br; Muller, Antonio A. [Embrapa Amazonia Oriental, Belem, PA (Brazil). Lab. de Entomologia; Bernardino, Aline S.; Buecke, Joel [Grupo Agropalma S/A., Tailandia, PA (Brazil)
2010-01-15
The oil palm Elaeis guineensis is usually attacked by pests, particularly, defoliating caterpillars. Between 2004 and 2006 a stinkbug predator (Asopinae) was registered preying on caterpillars of Brassolis sophorae L., Opsiphanes invirae Hubner (Lepidoptera: Nymphalidae) and Sibine spp. (Lepidoptera: Limacodidae), reducing their populations in commercial oil palm plantations in the State of Para, Brazil. Specimens of the natural enemy were collected, mounted, and identified as Alcaeorrhynchus grandis (Dallas) (Hemiptera: Pentatomidae), corresponding to the first report of the occurrence of this stinkbug attacking defoliating caterpillars of oil palm in Brazil. (author)
Cullings, Ken; Ishkhanova, Galina; Henson, Joan
2008-11-01
Ectomycorrhizal (EM) basidiomycete fungi are obligate mutualists of pines and hardwoods that receive fixed C from the host tree. Though they often share most recent common ancestors with wood-rotting fungi, it is unclear to what extent EM fungi retain the ability to express enzymes that break down woody substrates. In this study, we tested the hypothesis that the dominant EM fungus in a pure pine system retains the ability to produce enzymes that break down woody substrates in a natural setting, and that this ability is inducible by reduction of host photosynthetic potential via partial defoliation. To achieve this, pines in replicate blocks were defoliated 50% by needle removal, and enzyme activities were measured in individual EM root tips that had been treated with antibiotics to prevent possible bacterial activity. Results indicate that the dominant EM fungal species (Suillus granulatus) expressed all enzymes tested (endocellulase D: -glucosidase, laccase, manganese peroxidase, lignin peroxidase, phosphatase and protease), and that activities of these enzymes increased significantly (P pine) has the potential to play a significant role in C, N and P cycling in this forested ecosystem. Therefore, many above-ground factors that reduce photosynthetic potential or divert fixed C from roots may have wide-reaching ecosystem effects.
Jaiswal, Sarita; Sawhney, Sudhir
2006-05-01
Leaves of Kalanchoe pinnata have crenate margins with each notch bearing a dormant bud competent to develop into a healthy plantlet. Leaf detachment is a common signal for inducing two contrastingly different leaf-based processes, i.e. epiphyllous bud development into plantlet and foliar senescence. To investigate differentiation of bud and its correlation, if any, with foliar senescence, thidiazuron (TDZ), having cytokinin activity and ethrel (ETH), an ethylene releasing compound, were employed. The experimental system was comprised of marginal leaf discs, each harbouring an epiphyllous bud. Most of the growth characteristics of plantlet developing from the epiphyllous bud were significantly inhibited by TDZ but promoted by ETH. The two regulators modulated senescence in a manner different for leaf discs and plantlet leaves. Thus, TDZ caused a complete retention whereas ETH a complete loss of chlorophyll in the leaf discs. In contrast, the former resulted in a complete depletion of chlorophyll from the plantlet leaves producing an albino effect, while the latter reduced it by 50% only. In combined dispensation of the two regulators, the effect of TDZ was expressed in majority of responses studied. The results presented in this investigation clearly show that the foliar processes of epiphyllous bud differentiation and senescence are interlinked as TDZ that delayed senescence inhibited epiphyllous bud differentiation and ETH that hastened senescence promoted it. A working hypothesis to interpret responsiveness of the disc-bud composite on lines of a source-sink duo, has been proposed.
H.A., Reddy, K. and Pettigrew, W.T.
2018-01-01
The effects of cotton (Gossypium hirsutum L.): soybean [Glycine max (L.) Merr.] rotation on the soil fertility levels are limited. An irrigated soybean: cotton rotation experiment was conducted from 2012 through 2015 near Elizabeth, Mississippi, USA. The crop rotation sequences were included continuous cotton (CCCC), continuous soybean (SSSS), cotton-soybean-cotton-soybean (CSCS), cotton-soybean-soybean-cotton (CSSC), soybean-cotton-cotton-soybean (SCCS), soybean-cotton-soybean-cotton (SCSC)....
Singh, Pallavi; Dwivedi, Padmanabh
2014-08-01
Stevia rebaudiana Bertoni, member of Asteraceae family, has bio-active compounds stevioside and rebaudioside which taste about 300 times sweeter than sucrose. It regulates blood sugar, prevents hypertension and tooth decay as well as used in treatment of skin disorders having high medicinal values, and hence there is a need for generating the plant on large scale. We have developed an efficient micropropagation protocol on half strength Murashige and Skoog (MS) media, using two-stage culture procedures. Varying concentrations of cytokinins, i.e., benzylaminopurine, kinetin and thidiazuron (TDZ) were supplemented in the nutrient media to observe their effects on shoot development. All the cytokinins promoted shoot formation, however, best response was observed in the TDZ (0.5 mg/l). The shoots from selected induction medium were sub-cultured on the multiplication media. The media containing 0.01 mg/l TDZ produced maximum number of shoot (11.00 ± 0.40) with longer shoots (7.17 ± 0.16) and highest number of leaves (61.00 ± 1.29). Rooting response was best observed in one-fourth strength on MS media supplemented with indole-3-butyric acid (1.0 mg/l) and activated charcoal (50 mg/l) with (11.00 ± 0.40) number of roots. The plantlets thus obtained were hardened and transferred to the pots with soil and sand mixture, where the survival rate was 80 % after 2 months. Quantitative analysis of stevioside content in leaves of in vivo mother plant and in vitro plantlets was carried out by high performance liquid chromatography. A remarkable increase in stevioside content was noticed in the in vitro-raised plants as compared to in vivo grown plants. The protocol reported here might be useful in genetic improvement and high stevioside production.
Tang, Dong; Feng, Shouli; Li, Sai; Chen, Yu; Zhou, Baoliang
2018-03-27
Gossypium bickii: (2n = 26, G 1 G 1 ), a wild diploid cotton, carries many favourable traits. However, these favourable traits cannot be directly transferred into G. hirsutum (2n = 52, AADD) cultivars due to the differences in genomes. Monosomic alien addition lines (MAALs) are considered an invaluable tool for the introgression of genes of interest from wild relatives into cultivated crops. In this study, the G. hirsutum-G. bickii amphidiploid (2n = 78, AADDG 1 G 1 ) was backcrossed with G. hirsutum to develop alien additions containing individual G. bickii chromosomes in a G. hirsutum background. Genomic in situ hybridization was employed to detect the number of alien chromosomes added to the backcross progenies. A total of 183 G. bickii-specific DNA markers were developed to discriminate the identities of the G. bickii chromosomes added to G. hirsutum and assess the alien chromosome transmissibility. Chromosomes 4G b and 13G b showed the highest transmissibility, while chromosomes 1G b , 7G b and 11G b showed the lowest. Ten of the 13 possible G. hirsutum-G. bickii MAALs were isolated and characterized, which will lay the foundation for transferring resistance genes of G. bickii into G. hirsutum, as well as for gene assignment, physical mapping, and selective isolation and mapping of cDNAs for particular G. bickii chromosomes. The strategies of how to use MAALs to develop varieties with the trait of interest from wild species (such as glanded plant-glandless seed) were proposed and discussed.
Bukhari, Najat A W; Siddique, Iram; Perveen, Kahkashan
2016-09-01
An efficient protocol was developed for clonal multiplication of an important shrub: Capparis decidua (Forsk.) Edgew, through in vitro shoot induction and multiplication from nodal explants. Pretreatment of nodal explants in a liquid Murashige and Skoog (MS) medium augmented with various thidiazuron (TDZ) concentrations at relatively high levels (5-100 μM) for different time duration (4, 8, 12 and 16 d), proved a significant approach for in vitro shoot production. After an initial exposure time to TDZ, nodal explants were inoculated onto a MS basal medium devoid of TDZ for further induction and proliferation. The highest regeneration rate (85%), average number of shoots/explant (8.7 ± 0.22) and maximum shoot length (3.9 ± 0.33 cm) were obtained from the nodal explants exposed to 50 μM TDZ for 8 d. The nodal explants excised from the proliferated cultures of TDZ (50 μM) for 8 d were used as explants and showed an enhancement rate after next three round of in vitro propagation. Best results for rooting was obtained by ex vitro treatment of shoots with 200 μM indole-3-butyric acid (IBA) for 20 min. as it produced an average of 5.7 ± 0.41 roots per microshoot with 4.4 ± 0.39 cm root length in 84% shoots. Different planting substrates was tested for maximum survival of hardening off micropropagated plantlets and soilrite proved most effective than others as 97.1 ± 7.21 plantlets survived. All micropropagated plants grew well in natural conditions and showed similar morphology to the mother plant.
Directory of Open Access Journals (Sweden)
Ranjan Alok
2012-11-01
Full Text Available Abstract Background Root length and its architecture govern the adaptability of plants to various stress conditions, including drought stress. Genetic variations in root growth, length, and architecture are genotypes dependent. In this study, we compared the drought-induced transcriptome of four genotypes of Gossypium herbaceum that differed in their drought tolerance adaptability. Three different methodologies, namely, microarray, pyrosequencing, and qRT–PCR, were used for transcriptome analysis and validation. Results The variations in root length and growth were found among four genotypes of G.herbaceum when exposed to mannitol-induced osmotic stress. Under osmotic stress, the drought tolerant genotypes Vagad and GujCot-21 showed a longer root length than did by drought sensitive RAHS-14 and RAHS-IPS-187. Further, the gene expression patterns in the root tissue of all genotypes were analyzed. We obtained a total of 794 differentially expressed genes by microarray and 104928 high-quality reads representing 53195 unigenes from the root transcriptome. The Vagad and GujCot-21 respond to water stress by inducing various genes and pathways such as response to stresses, response to water deprivation, and flavonoid pathways. Some key regulatory genes involved in abiotic stress such as AP2 EREBP, MYB, WRKY, ERF, ERD9, and LEA were highly expressed in Vagad and GujCot-21. The genes RHD3, NAP1, LBD, and transcription factor WRKY75, known for root development under various stress conditions, were expressed specifically in Vagad and GujCot-21. The genes related to peroxidases, transporters, cell wall-modifying enzymes, and compatible solutes (amino acids, amino sugars, betaine, sugars, or sugar alcohols were also highly expressed in Vagad and Gujcot-21. Conclusion Our analysis highlights changes in the expression pattern of genes and depicts a small but highly specific set of drought responsive genes induced in response to drought stress. Some of these
Genetic divergence and association among polygenic characters in gossypium hirsutum L
International Nuclear Information System (INIS)
BiBi, M.; Khan, N.U.; Mohammad, F.; Gul, R.
2011-01-01
Development of promising cotton populations with improved agronomic performance is primary objective of the cotton breeders. Genetic potential and variability in 8 X 8 F/sub 1/diallel hybrids versus their parental lines, traits correlation and heritability estimates were studied in Gossypium hirsutum L., during 2008-09 at Khyber Pakhtunkhwa Agricultural University, Peshawar, Pakistan. Highly significant variations were observed among the parental cultivars and their F/sub 1/ hybrids for all traits. Results indicated that F/sub 1/ hybrids CIM-506 X CIM-554, CIM-473 X CIM-554, CIM-446 X CIM-554 and CIM-446 X CIM-496 (its reciprocal) produced significantly higher seed cotton yield, bolls per sympodia, boll weight and seeds per boll. Most of the F/sub 1/ populations involving CIM-554 as maternal plant also revealed early maturity. Yield related traits revealed significant positive correlations with seed cotton yield. Heritability (broad sense) was high in magnitude for all traits. Results revealed that traits with high heritability and wide range of genetic variability in breeding material can work as a base population, and their significant contribution towards high yield can help in early segregating generations. (author)
Directory of Open Access Journals (Sweden)
Luiz Eduardo Bassay Blum
2003-10-01
Full Text Available As relações entre fonte e dreno interferem sobre a ocorrência de podridões de colmo na cultura do milho (Zea mays. O estudo foi conduzido em Lages, SC, para avaliar o efeito da desfolha, população de plantas e híbridos sobre as podridões do colmo do milho. O delineamento experimental foi de blocos ao acaso com parcelas sub-subdivididas e três repetições. Os híbridos P32R21 (superprecoce, Premium (precoce e C333B (tardio foram testados sem desfolha e com 50% de desfolha no estágio de espigamento nas populações de 25.000, 50.000, 75.000 e 100.000 plantas ha-1. Avaliaram-se a incidência e a severidade das podridões do colmo causadas por Colletotrichum graminicola, Diplodia maydis e Fusarium moniliforme. O híbrido P32R21 foi o mais afetado pelos fungos causadores de podridões. Nos híbridos P32R21 e Premium, as plantas desfolhadas foram mais severamente infectadas pelos patógenos do que as intactas. O aumento da população de plantas aumentou a intensidade (incidência ou severidade de podridões de colmo nas plantas intactas e diminuiu a ocorrência nas desfolhadas.The relationship between source and sink interferes on maize (Zea mays stalk rot occurrence. This study was conducted in Lages, SC, Brazil, to evaluate the effect of defoliation, plant population, and hybrids on the intensity (incidence or severity of maize stalk rots. The experiment was set in a randomized complete block design (three replications with a split-split-plot arrangement. The hybrids P32R21 (very early, Premium (early and C333B (late were tested without defoliation and with 50% defoliation on ear formation stage at plant populations of 25,000, 50,000, 75,000, and 100,000 plants ha-1. The incidence and severity of Colletotrichum graminicola, Diplodia maydis and Fusarium moniliforme stalk rots were evaluated. The hybrid P32R21 was the most affected by stalk rots. Defoliation enhanced rots on P32R21 and Premium. Enhancements in plant population increased
Directory of Open Access Journals (Sweden)
Geovano Parcianello
2004-04-01
Full Text Available A redução do espaçamento entre fileiras de 40 para 20cm incrementa a interceptação da radiação, o índice de área foliar e o rendimento de grãos. Este trabalho objetivou avaliar se a redução do espaçamento entre fileiras influencia a tolerância da soja à perda de área fotossintética. O experimento foi conduzido, em semeadura direta na Estação Experimental Agronômica da UFRGS, na safra 2000/01. Utilizou-se o delineamento experimental de blocos ao acaso, com quatro repetições, em parcelas sub-subdivididas. Os tratamentos foram desfolhamento em três estádios de desenvolvimento (V9 - nono nó, R2 - floração e R5 - inicio enchimento de grãos, dois espaçamentos entre fileiras (20 e 40cm e quatro níveis de desfolhamento (0 - testemunha, 33, 67 e 100%. Foi utilizada a cultivar FT-Abyara. Os desfolhamentos realizados no período reprodutivo reduziram o rendimento, sendo o estádio R5 o mais crítico. O rendimento médio de grãos da testemunha não desfolhada foi 21% maior no espaçamento de 20cm (4134kg ha-1 do que no de 40cm (3413kg ha-1 e manteve-se sempre superior, em todos os níveis de desfolhamento. O componente que mais influenciou o rendimento foi o número de legumes m-2. Estes resultados indicam que a redução do espaçamento entre fileiras de 40cm para 20cm é uma prática cultural favorável tanto para as plantas com área foliar intacta quando desfolhadas.The row spacing reduction from 40 to 20 cm increase radiation interception, leaf area index and grain yield. This experiment aimed to evaluate if the row spacing reduction influence soybean tolerance to loss of photosynthetic area. The research was performed using no-till tillage system at the Agronomic Experimental Station of Universidade Federal do Rio Grande do Sul, during the 2000/01 growing season. Treatments were arranged in a split-split plot randomized complete block design, with four replications. Treatments included five combination of defoliation in
Pearlstein, S.; Nagler, P. L.; Glenn, E. P.; Hultine, K. R.
2012-12-01
The Dolores River in Southern Utah and the Virgin River in Southern Nevada are ecosystems under pressure from increased groundwater withdrawal due to growing populations and introduced riparian species. We studied the impact of the biocontrol Tamarix leaf beetles (Dirohabda carinulata and D. elongata) on the introduced riparian species, Tamarix spp., phenology and water use over multiple cycles of annual defoliation. Heat balance sap flow measurements, leaf area index (LAI), well data, allometry and satellite imagery from Landsat Thematic Mapper 5 and EOS-1 Moderate Resolution Imaging Spectrometer (MODIS) sensors were used to assess the distribution of beetle defoliation and its effect on evapotranspiration (ET). Study objectives for the Virgin River were to measure pre-beetle arrival ET, while the Dolores River site has had defoliation since 2004 and is a site of long-term beetle effect monitoring. This study focuses on measurements conducted over two seasons, 2010 and 2011. At the Dolores River site, results from 2010 were inconclusive due to sensor malfunctions but plant ET by sap flow in 2011 averaged 1.02 mm/m^2 leaf area/day before beetle arrival, dropping to an average of 0.75 mm/m^2 leaf area/day after beetle arrival. Stand level estimations from May - December, 2010 by MODIS were about 0.63 mm/ day, results from Landsat were 0.51 mm/day in June and 0.78 in August. For January -September, 2011, MODIS values were about 0.6 mm/day, and Landsat was 0.57 mm/day in June and 0.62 mm/day in August. These values are lower than previously reported ET values for this site meaning that repeated defoliation does diminish stand level water use. The Virgin River site showed plant ET from sap flow averaged about 3.9-4 mm/m^2 leaf area/day from mid-May - September, 2010. In 2011, ET from sap flow averaged 3.83 mm/m^2 leaf area/day during June - July, but dropped to 3.73 mm/ m^2 leaf area/day after beetle arrival in August. The slight drop in plant ET is not significant
Directory of Open Access Journals (Sweden)
Ruijuan Li
Full Text Available Reniform nematode is a semi-endoparasitic nematode species causing significant yield loss in numerous crops, including cotton (Gossypium hirsutum L.. An RNA-sequencing analysis was conducted to measure transcript abundance in reniform nematode susceptible (DP90 & SG747, resistant (BARBREN-713, and hypersensitive (LONREN-1 genotypes of cotton (Gossypium hirsutum L. with and without reniform nematode infestation. Over 90 million trimmed high quality reads were assembled into 84,711 and 80, 353 transcripts using the G. arboreum and the G. raimondii genomes as references. Many transcripts were significantly differentially expressed between the three different genotypes both prior to and during nematode pathogenesis, including transcripts corresponding to the gene ontology categories of cell wall, hormone metabolism and signaling, redox reactions, secondary metabolism, transcriptional regulation, stress responses, and signaling. Further analysis revealed that a number of these differentially expressed transcripts mapped to the G. raimondii and/or the G. arboreum genomes within 1 megabase of quantitative trait loci that had previously been linked to reniform nematode resistance. Several resistance genes encoding proteins known to be strongly linked to pathogen perception and resistance, including LRR-like and NBS-LRR domain-containing proteins, were among the differentially expressed transcripts mapping near these quantitative trait loci. Further investigation is required to confirm a role for these transcripts in reniform nematode susceptibility, hypersensitivity, and/or resistance. This study presents the first systemic investigation of reniform nematode resistance-associated genes using different genotypes of cotton. The candidate reniform nematode resistance-associated genes identified in this study can serve as the basis for further functional analysis and aid in further development of reniform a nematode resistant cotton germplasm.
Directory of Open Access Journals (Sweden)
Baohua Wang
2017-10-01
Full Text Available The molecular genetic basis of cotton fiber strength and fineness in crosses between Gossypium mustelinum and Gossypium hirsutum (Upland cotton was dissected using 21 BC3F2 and 12 corresponding BC3F2:3 and BC3F2:4 families. The BC3F2 families were genotyped with simple sequence repeat markers from a G. hirsutum by G. mustelinum linkage map, and the three generations of BC3-derived families were phenotyped for fiber strength (STR and fineness (Micronaire, MIC. A total of 42 quantitative trait loci (QTLs were identified through one-way analysis of variance, including 15 QTLs for STR and 27 for MIC, with the percentage of variance explained by individual loci averaging 13.86 and 14.06%, respectively. Eighteen of the 42 QTLs were detected at least twice near the same markers in different generations/families or near linked markers in the same family, and 28 of the 42 QTLs were identified in both mixed model-based composite interval mapping and one-way variance analyses. Alleles from G. mustelinum increased STR for eight of 15 and reduced MIC for 15 of 27 QTLs. Significant among-family genotypic effects (P < 0.001 were detected in 13 and 10 loci for STR and MIC respectively, and five loci showed significant (P < 0.001 genotype × family interaction for MIC. These results support the hypothesis that fiber quality improvement for Upland cotton could be realized by introgressing G. mustelinum alleles although complexities due to the different effects of genetic background on introgressed chromatin might be faced. Building on prior work with G. barbadense, G. tomentosum, and G. darwinii, QTL mapping involving introgression of G. mustelinum alleles offers new allelic variation to Upland cotton germplasm.
Zhang, Tianzhen; Hu, Yan; Jiang, Wenkai; Fang, Lei; Guan, Xueying; Chen, Jiedan; Zhang, Jinbo; Saski, Christopher A; Scheffler, Brian E; Stelly, David M; Hulse-Kemp, Amanda M; Wan, Qun; Liu, Bingliang; Liu, Chunxiao; Wang, Sen; Pan, Mengqiao; Wang, Yangkun; Wang, Dawei; Ye, Wenxue; Chang, Lijing; Zhang, Wenpan; Song, Qingxin; Kirkbride, Ryan C; Chen, Xiaoya; Dennis, Elizabeth; Llewellyn, Danny J; Peterson, Daniel G; Thaxton, Peggy; Jones, Don C; Wang, Qiong; Xu, Xiaoyang; Zhang, Hua; Wu, Huaitong; Zhou, Lei; Mei, Gaofu; Chen, Shuqi; Tian, Yue; Xiang, Dan; Li, Xinghe; Ding, Jian; Zuo, Qiyang; Tao, Linna; Liu, Yunchao; Li, Ji; Lin, Yu; Hui, Yuanyuan; Cao, Zhisheng; Cai, Caiping; Zhu, Xiefei; Jiang, Zhi; Zhou, Baoliang; Guo, Wangzhen; Li, Ruiqiang; Chen, Z Jeffrey
2015-05-01
Upland cotton is a model for polyploid crop domestication and transgenic improvement. Here we sequenced the allotetraploid Gossypium hirsutum L. acc. TM-1 genome by integrating whole-genome shotgun reads, bacterial artificial chromosome (BAC)-end sequences and genotype-by-sequencing genetic maps. We assembled and annotated 32,032 A-subgenome genes and 34,402 D-subgenome genes. Structural rearrangements, gene loss, disrupted genes and sequence divergence were more common in the A subgenome than in the D subgenome, suggesting asymmetric evolution. However, no genome-wide expression dominance was found between the subgenomes. Genomic signatures of selection and domestication are associated with positively selected genes (PSGs) for fiber improvement in the A subgenome and for stress tolerance in the D subgenome. This draft genome sequence provides a resource for engineering superior cotton lines.
MicroRNA-target gene responses to lead-induced stress in cotton (Gossypium hirsutum L.).
He, Qiuling; Zhu, Shuijin; Zhang, Baohong
2014-09-01
MicroRNAs (miRNAs) play key roles in plant responses to various metal stresses. To investigate the miRNA-mediated plant response to heavy metals, cotton (Gossypium hirsutum L.), the most important fiber crop in the world, was exposed to different concentrations (0, 25, 50, 100, and 200 µM) of lead (Pb) and then the toxicological effects were investigated. The expression patterns of 16 stress-responsive miRNAs and 10 target genes were monitored in cotton leaves and roots by quantitative real-time PCR (qRT-PCR); of these selected genes, several miRNAs and their target genes are involved in root development. The results show a reciprocal regulation of cotton response to lead stress by miRNAs. The characterization of the miRNAs and the associated target genes in response to lead exposure would help in defining the potential roles of miRNAs in plant adaptation to heavy metal stress and further understanding miRNA regulation in response to abiotic stress.
Structural analysis of Gossypium hirsutum fibers grown under greenhouse and hydroponic conditions.
Natalio, Filipe; Tahir, Muhammad Nawaz; Friedrich, Norman; Köck, Margret; Fritz-Popovski, Gerhard; Paris, Oskar; Paschke, Reinhard
2016-06-01
Cotton is the one of the world's most important crops. Like any other crop, cotton growth/development and fiber quality is highly dependent on environmental factors. Increasing global weather instability has been negatively impacting its economy. Cotton is a crop that exerts an intensive pressure over natural resources (land and water) and demands an overuse of pesticides. Thus, the search for alternative cotton culture methods that are pesticide-free (biocotton) and enable customized standard fiber quality should be encouraged. Here we describe a culture of Gossypium hirsutum ("Upland" Cotton) utilizing a greenhouse and hydroponics in which the fibers are morphological similar to conventional cultures and structurally fit into the classical two-phase cellulose I model with 4.19nm crystalline domains surrounded by amorphous regions. These fibers exhibit a single crystalline form of cellulose I-Iß, monoclinic unit cell. Fiber quality bulk analysis shows an improved length, strength, whiteness when compared with soil-based cultures. Finally, we show that our fibers can be spun, used for production of non-woven fabrics and indigo-vat stained demonstrating its potential in industrial and commercial applications. Copyright © 2016 Elsevier Inc. All rights reserved.
Otilia Ivan
2009-01-01
This study was carried out in the context of some complex researches concerning the effects of long standing use of the pesticides in the control of the defoliating insects, in forest ecosystems. These investigations showed that the structural parameters of the oribatid mites' communities are obviously influenced by the stands biotic and abiotic factors, alongside some varied anthropogenic factors, such as: treatments, industrial pollution, some management measures etc. This paper includes a ...
Idris, Ali
2010-12-01
A Cotton leaf crumple virus (CLCrV)-based gene silencing vector containing a fragment of the Gossypium hirsutum Magnesium chelatase subunit I was used to establish endogenous gene silencing in cotton of varied genetic backgrounds. Biolistic inoculation resulted in systemic and persistent photo-bleaching of the leaves and bolls of the seven cultivars tested, however, the intensity of silencing was variable. CLCrV-VIGS-mediated expression of green fluorescent protein was used to monitor the in planta distribution of the vector, indicating successful phloem invasion in all cultivars tested. Acala SJ-1, one of the cotton cultivars, was identified as a particularly optimal candidate for CLCrV-VIGS-based cotton reverse-genetics. © 2010 Elsevier Ltd.
Directory of Open Access Journals (Sweden)
A. Zare Feizabadi
2016-04-01
Full Text Available In order to compare of ecological management of weed control on economical income, yield and yield components of cotton (Gossypium hirsutum L., a Randomized Complete Block design with 12 treatments and four replications was conducted in Mahvelat of Khorasan Razavi province, Iran. Treatments consisted of weeding, harrowing, burning, two times weeding, weeding + harrowing, weeding + burning, harrowing + harrowing, harrowing + weeding, harrowing + burning, weeding+ harrowing+ burning, weed free and weedy as a check treatment. Investigated traits were plant height, number of boll in plant, 20 boll weight, 20 boll cotton lint weight, cotton lint yield per plant, cotton yield, number and biomass of weeds, outcome, net and gross income. The result showed that treatments had significant effect (p
Wang, Wei; Xia, Minxuan; Chen, Jie; Deng, Fenni; Yuan, Rui; Zhang, Xiaopei; Shen, Fafu
2016-12-01
The data presented in this paper is supporting the research article "Genome-Wide Analysis of Superoxide Dismutase Gene Family in Gossypium raimondii and G. arboreum" [1]. In this data article, we present phylogenetic tree showing dichotomy with two different clusters of SODs inferred by the Bayesian method of MrBayes (version 3.2.4), "Bayesian phylogenetic inference under mixed models" [2], Ramachandran plots of G. raimondii and G. arboreum SODs, the protein sequence used to generate 3D sructure of proteins and the template accession via SWISS-MODEL server, "SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information." [3] and motif sequences of SODs identified by InterProScan (version 4.8) with the Pfam database, "Pfam: the protein families database" [4].
DIRECT AND INDIRECT SOMATIC EMBRYOGENESIS ON ARABICA COFFEE (Coffea arabica
Directory of Open Access Journals (Sweden)
Meynarti Sari Dewi Ibrahim
2013-10-01
Full Text Available Propagation of Coffea arabica L. through direct and indirect somatic embryogenesis technique is promising for producing large number of coffee seedlings. The objectives of the research were to evaluate methods for direct and indirect somatic embryo-genesis induction of C. arabica var. Kartika. The explants were the youngest fully expanded leaves of arabica coffee. The evalu-ated medium was modified Murashige and Skoog (MS medium supplemented with a combination of 2.26 µM 2,4-D + 4.54 or 9.08 µM thidiazuron; 4.52 µM 2,4-D + 4.54 or 9.08 µM thidiazuron; or 9.04 µM 2,4-D + 9.08 µM thidiazuron. Both calli (100 mg and pre-embryos developed from the edge of leaf explants were subcultured into regeneration medium (half strength MS with modified vitamin, supplemented with kinetine 9.30 µM and adenine sulfate 40 mg L-1. The results showed coffee leaf explant cultured on medium containing 2.26 µM 2,4-D + 4.54 or 9.08 µM thidiazuron to induce direct somatic embriogenesis from explant, while that of 4.52 or 9.04 µM 2,4-D + 9.08 µM thidiazuron to induced indirect somatic embrio-genesis. The medium for calli induction from coffee by explants was medium supplemented with 4.52 or 9.04 µM 2,4-D in combination with 9.08 µM thidiazuron. On the other hand, the best medium for activation of induction of somatic embryos was MS medium supplemented with 9.04 µM 2,4-D + 9.08 µM thidiazuron. Based on this results, the first step for developing micropropagation for coffee has been resolved. The subsequent studies will be directed to evaluate agronomic performance of the derived planting materials.
Phosphorus use efficiency in pima cotton (Gossypium barbadense L. genotypes
Directory of Open Access Journals (Sweden)
Elcio Santos
2015-06-01
Full Text Available In the Brazilian Cerrado, P deficiency restricts cotton production, which requires large amounts of phosphate fertilizer. To improve the yield of cotton crops, genotypes with high P use efficiency must be identified and used. The present study evaluated P uptake and use efficiency of different Gossypium barbadense L. genotypes grown in the Cerrado. The experiment was carried out in a greenhouse with a completely randomized design, 15 x 2 factorial treatment structure (15 genotypes x 2 P levels, and four replicates. The genotypes were MT 69, MT 70, MT 87, MT 91, MT 92, MT 94, MT 101, MT 102, MT 103, MT 105, MT 106, MT 110, MT 112, MT 124, and MT 125; P levels were sufficient (1000 mg pot-1, PS treatment or deficient (PD treatment. Dry matter (DM and P levels were determined in cotton plant parts and used to calculate plant P content and use efficiency. In general, DM and P content were higher in the PS than in the PD treatment, with the exception of root DM and total DM in some genotypes. Genotypes also differed in terms of P uptake and use capacity. In the PS treatment, genotypes MT 92 and MT 102 had the highest response to phosphate fertilization. Genotype MT 69 exhibited the most efficient P uptake in the PD treatment. Genotype MT 124 showed the best shoot physiological efficiency, apparent recovery efficiency, and utilization efficiency, whereas MT 110 exhibited the highest root physiological efficiency.
Wang, Jun; Sun, Na; Deng, Ting; Zhang, Lida; Zuo, Kaijing
2014-11-06
Heat shock transcriptional factors (Hsfs) play important roles in the processes of biotic and abiotic stresses as well as in plant development. Cotton (Gossypium hirsutum, 2n=4x=(AD)2=52) is an important crop for natural fiber production. Due to continuous high temperature and intermittent drought, heat stress is becoming a handicap to improve cotton yield and lint quality. Recently, the related wild diploid species Gossypium raimondii genome (2n=2x=(D5)2=26) has been fully sequenced. In order to analyze the functions of different Hsfs at the genome-wide level, detailed characterization and analysis of the Hsf gene family in G. hirsutum is indispensable. EST assembly and genome-wide analyses were applied to clone and identify heat shock transcription factor (Hsf) genes in Upland cotton (GhHsf). Forty GhHsf genes were cloned, identified and classified into three main classes (A, B and C) according to the characteristics of their domains. Analysis of gene duplications showed that GhHsfs have occurred more frequently than reported in plant genomes such as Arabidopsis and Populus. Quantitative real-time PCR (qRT-PCR) showed that all GhHsf transcripts are expressed in most cotton plant tissues including roots, stems, leaves and developing fibers, and abundantly in developing ovules. Three expression patterns were confirmed in GhHsfs when cotton plants were exposed to high temperature for 1 h. GhHsf39 exhibited the most immediate response to heat shock. Comparative analysis of Hsfs expression differences between the wild-type and fiberless mutant suggested that Hsfs are involved in fiber development. Comparative genome analysis showed that Upland cotton D-subgenome contains 40 Hsf members, and that the whole genome of Upland cotton contains more than 80 Hsf genes due to genome duplication. The expression patterns in different tissues in response to heat shock showed that GhHsfs are important for heat stress as well as fiber development. These results provide an improved
Wang, W; Zhang, M; Chen, H D; Cai, X X; Xu, M L; Lei, K Y; Niu, J H; Deng, L; Liu, J; Ge, Z J; Yu, S X; Wang, B H
2016-10-06
In this study, a methylation-sensitive amplification polymorphism analysis system was used to analyze DNA methylation level in three cotton accessions. Two disease-sensitive near-isogenic lines, PD94042 and IL41, and one disease-resistant Gossypium mustelinum accession were exposed to Verticillium wilt, to investigate molecular disease resistance mechanisms in cotton. We observed multiple different DNA methylation types across the three accessions following Verticillium wilt exposure. These included hypomethylation, hypermethylation, and other patterns. In general, the global DNA methylation level was significantly increased in the disease-resistant accession G. mustelinum following disease exposure. In contrast, there was no significant difference in the disease-sensitive accession PD94042, and a significant decrease was observed in IL41. Our results suggest that disease-resistant cotton might employ a mechanism to increase methylation level in response to disease stress. The differing methylation patterns, together with the increase in global DNA methylation level, might play important roles in tolerance to Verticillium wilt in cotton. Through cloning and analysis of differently methylated DNA sequences, we were also able to identify several genes that may contribute to disease resistance in cotton. Our results revealed the effect of DNA methylation on cotton disease resistance, and also identified genes that played important roles, which may shed light on the future cotton disease-resistant molecular breeding.
Response of Cotton (Gossypium Hirsutum L.) to Nitrogen Phosphorous Fertilizers in Western Kenya
International Nuclear Information System (INIS)
Kouko, W.O; Owino, G.
1999-01-01
The requirements for nitrogen and phosphorous fertilizers for growing cotton (Gossypium hirsutum L.) in Kenya are 26-kg N ha - 1 and 27 kg P ha - 1, respectively. Calcium ammonium nitrate (CAN) was recommended at the rate of 100 kg ha - 1 for black cotton soils while double superphosphate (DSP) was recommended at the rate of 150 kg ha - 1 on reddish brown clays. However, experiments conducted on a major soil types on which cotton is grown in Kenya showed that, soil colour is not the best indicator of nutrients supply power of the soil. It was found that Verto-eutric planosols of National Fibre Research Centres-Kibos requires application of 13-kg ha - 1 as CAN for optimal yields. Ferralo-eurtric Acrisols of Alupe Agricultural Research Sub-Centre, Busia needed 26-kg N ha - 1 and 9 kg P ha - 1 to give high yields. At Siaya FTC 9 kg P ha - 1 was adequate in providing the highest yields without nitrogen. Strict observation of recommended agronomic practices for growing cotton and good soil management practices for growing cotton and good soil management practices were observed a prerequisite for high response and efficient utilisation of fertilizers
Phenotyping Root System Architecture of Cotton (Gossypium barbadense L. Grown Under Salinity
Directory of Open Access Journals (Sweden)
Mottaleb Shady A.
2017-12-01
Full Text Available Soil salinity causes an annual deep negative impact to the global agricultural economy. In this study, the effects of salinity on early seedling physiology of two Egyptian cotton (Gossypium barbadense L. cultivars differing in their salinity tolerance were examined. Also the potential use of a low cost mini-rhizotron system to measure variation in root system architecture (RSA traits existing in both cultivars was assessed. Salt tolerant cotton cultivar ‘Giza 90’ produced significantly higher root and shoot biomass, accumulated lower Na+/K+ ratio through a higher Na+ exclusion from both roots and leaves as well as synthesized higher proline contents compared to salt sensitive ‘Giza 45’ cultivar. Measuring RSA in mini-rhizotrons containing solid MS nutrient medium as substrate proved to be more precise and efficient than peat moss/sand mixture. We report superior values of main root growth rate, total root system size, main root length, higher number of lateral roots and average lateral root length in ‘Giza 90’ under salinity. Higher lateral root density and length together with higher root tissue tolerance of Na+ ions in ‘Giza 90’ give it an advantage to be used as donor genotype for desirable root traits to other elite cultivars.
Directory of Open Access Journals (Sweden)
Carine Lisete Glienke
2010-01-01
Full Text Available The relationship between pasture dynamics and ingestive behavior of female lambs was studied on Italian ryegrass (Lolium multiflorum Lam. plus red clover (Trifolium pratense L. mixture under a range of defoliation intensities. Rotational grazing was used and the grazing interval was determined by the thermal sum of 313 degree days. The initial pre-grazing canopy height disappearance values were 65 (very high, 58 (high, 47 (medium and 37% (low. The sward vertical structure was similar among defoliation intensities. The forage allowance decreased linearly as defoliation intensities increased, with 0.35 bite/minute reduction for each 1% increase in forage allowance. The bite rate and number of bites/feeding station decreased with reduced contribution of leaves in the sward structure. It was associated, respectively, with an increase and a decrease of NDF and CP levels in forage as grazed by female lambs. The pasture cycle proves to be more important than defoliation intensities as a source for changes in feeding stations and displacement patterns of female lambs.Estudou-se a relação entre a dinâmica do pasto e o comportamento ingestivo de cordeiras em pastagem de azevém (Lolium multiflorum Lam. e trevo-vermelho (Trifolium pratense L. em diferentes intensidades de desfolha. O pastejo foi rotacionado e o intervalo entre pastejos foi determinado pela soma térmica de 313 graus-dia. Os valores de desaparecimento da altura do dossel no pré-pastejo foram de 65 (muito alta, 58 (alta, 47 (média e 37% (baixa, respectivamente. A estrutura vertical do pasto foi semelhante entre as intensidades de desfolha testadas. A oferta de forragem diminuiu linearmente com o aumento da intensidade de desfolha, com redução de 0,35 bocado/minuto a cada 1% a mais na oferta de forragem. A taxa de bocados e o número de bocados/estação alimentar reduziram com a diminuição da contribuição de folhas na estrutura da pastagem, acompanhada do aumento do teor de FDN e
Wang, Xiaoxiao; Wang, Yingying; Wang, Chen; Chen, Yu; Chen, Yu; Feng, Shouli; Zhao, Ting; Zhou, Baoliang
2016-10-07
Gossypium anomalum (BB genome) possesses the desirable characteristics of drought tolerance, resistance to diseases and insect pests, and the potential for high quality fibers. However, it is difficult to transfer the genes associated with these desirable traits into cultivated cotton (G. hirsutum, AADD genome). Monosomic alien addition lines (MAALs) can be used as a bridge to transfer desired genes from wild species into G. hirsutum. In cotton, however, the high number and smaller size of the chromosomes has resulted in difficulties in discriminating chromosomes from wild species in cultivated cotton background, the development of cotton MAALs has lagged far behind many other crops. To date, no set of G. hirsutum-G. anomalum MAALs was reported. Here the amphiploid (AADDBB genome) derived from G. hirsutum × G. anomalum was used to generate a set of G. hirsutum-G. anomalum MAALs through a combination of consecutive backcrossing, genomic in situ hybridization (GISH), morphological survey and microsatellite marker identification. We improved the GISH technique used in our previous research by using a mixture of two probes from G. anomalum and G. herbaceum (AA genome). The results indicate that a ratio of 4:3 (G. anomalum : G. herbaceum) is the most suitable for discrimination of chromosomes from G. anomalum and the At-subgenome of G. hirsutum. Using this improved GISH technique, 108 MAAL individuals were isolated. Next, 170 G. hirsutum- and G. anomalum-specific codominant markers were obtained and employed for characterization of these MAAL individuals. Finally, eleven out of 13 MAALs were identified. Unfortunately, we were unable to isolate Chrs. 1B a and 5B a due to their very low incidences in backcrossing generation, as these remained in a condition of multiple additions. The characterized lines can be employed as bridges for the transfer of desired genes from G. anomalum into G. hirsutum, as well as for gene assignment, isolation of chromosome
Directory of Open Access Journals (Sweden)
N'G.D.V. Kouakou
2010-01-01
Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.
Andrabi, Syed Bilal Ahmad; Tahara, Michiru; Matsubara, Ryuma; Toyama, Tomoko; Aonuma, Hiroka; Sakakibara, Hitoshi; Suematsu, Makoto; Tanabe, Kazuyuki; Nozaki, Tomoyoshi; Nagamune, Kisaburo
2018-02-01
Cytokinins are plant hormones that are involved in regulation of cell proliferation, cell cycle progression, and cell and plastid development. Here, we show that the apicomplexan parasites Toxoplasma gondii and Plasmodium berghei, an opportunistic human pathogen and a rodent malaria agent, respectively, produce cytokinins via a biosynthetic pathway similar to that in plants. Cytokinins regulate the growth and cell cycle progression of T. gondii by mediating expression of the cyclin gene TgCYC4. A natural form of cytokinin, trans-zeatin (t-zeatin), upregulated expression of this cyclin, while a synthetic cytokinin, thidiazuron, downregulated its expression. Immunofluorescence microscopy and quantitative PCR analysis showed that t-zeatin increased the genome-copy number of apicoplast, which are non-photosynthetic plastid, in the parasite, while thidiazuron led to their disappearance. Thidiazuron inhibited growth of T. gondii and Plasmodium falciparum, a human malaria parasite, suggesting that thidiazuron has therapeutic potential as an inhibitor of apicomplexan parasites. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
Proteomic profiling of developing cotton fibers from wild and domesticated Gossypium barbadense.
Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Grupp, Kara; Chen, Sixue; Wendel, Jonathan F
2013-10-01
Pima cotton (Gossypium barbadense) is widely cultivated because of its long, strong seed trichomes ('fibers') used for premium textiles. These agronomically advanced fibers were derived following domestication and thousands of years of human-mediated crop improvement. To gain an insight into fiber development and evolution, we conducted comparative proteomic and transcriptomic profiling of developing fiber from an elite cultivar and a wild accession. Analyses using isobaric tag for relative and absolute quantification (iTRAQ) LC-MS/MS technology identified 1317 proteins in fiber. Of these, 205 were differentially expressed across developmental stages, and 190 showed differential expression between wild and cultivated forms, 14.4% of the proteome sampled. Human selection may have shifted the timing of developmental modules, such that some occur earlier in domesticated than in wild cotton. A novel approach was used to detect possible biased expression of homoeologous copies of proteins. Results indicate a significant partitioning of duplicate gene expression at the protein level, but an approximately equal degree of bias for each of the two constituent genomes of allopolyploid cotton. Our results demonstrate the power of complementary transcriptomic and proteomic approaches for the study of the domestication process. They also provide a rich database for mining for functional analyses of cotton improvement or evolution. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Hu, Guanjing; Koh, Jin; Yoo, Mi-Jeong; Pathak, Dharminder; Chen, Sixue; Wendel, Jonathan F
2014-12-01
Comparative proteomic analyses were performed to detail the evolutionary consequences of strong directional selection for enhanced fiber traits in modern upland cotton (Gossypium hirsutum L.). Using two complementary proteomic approaches, 2-DE and iTRAQ LC-MS/MS, fiber proteomes were examined for four representative stages of fiber development. Approximately 1,000 protein features were characterized using each strategy, collectively resulting in the identification and functional categorization of 1,223 proteins. Unequal contributions of homoeologous proteins were detected for over a third of the fiber proteome, but overall expression was balanced with respect to the genome-of-origin in the allopolyploid G. hirsutum. About 30% of the proteins were differentially expressed during fiber development within wild and domesticated cotton. Notably, domestication was accompanied by a doubling of protein developmental dynamics for the period between 10 and 20 days following pollination. Expression levels of 240 iTRAQ proteins and 293 2-DE spots were altered by domestication, collectively representing multiple cellular and metabolic processes, including metabolism, energy, protein synthesis and destination, defense and stress response. Analyses of homoeolog-specific expression indicate that duplicated gene products in cotton fibers can be differently regulated in response to selection. These results demonstrate the power of proteomics for the analysis of crop domestication and phenotypic evolution.
Isolation and characterization of terpene synthases in cotton (Gossypium hirsutum).
Yang, Chang-Qing; Wu, Xiu-Ming; Ruan, Ju-Xin; Hu, Wen-Li; Mao, Yin-Bo; Chen, Xiao-Ya; Wang, Ling-Jian
2013-12-01
Cotton plants accumulate gossypol and related sesquiterpene aldehydes, which function as phytoalexins against pathogens and feeding deterrents to herbivorous insects. However, to date little is known about the biosynthesis of volatile terpenes in this crop. Herein is reported that 5 monoterpenes and 11 sesquiterpenes from extracts of a glanded cotton cultivar, Gossypium hirsutum cv. CCRI12, were detected by gas chromatography-mass spectrometry (GC-MS). By EST data mining combined with Rapid Amplification of cDNA Ends (RACE), full-length cDNAs of three terpene synthases (TPSs), GhTPS1, GhTPS2 and GhTPS3 were isolated. By in vitro assays of the recombinant proteins, it was found that GhTPS1 and GhTPS2 are sesquiterpene synthases: the former converted farnesyl pyrophosphate (FPP) into β-caryophyllene and α-humulene in a ratio of 2:1, whereas the latter produced several sesquiterpenes with guaia-1(10),11-diene as the major product. By contrast, GhTPS3 is a monoterpene synthase, which produced α-pinene, β-pinene, β-phellandrene and trace amounts of other monoterpenes from geranyl pyrophosphate (GPP). The TPS activities were also supported by Virus Induced Gene Silencing (VIGS) in the cotton plant. GhTPS1 and GhTPS3 were highly expressed in the cotton plant overall, whereas GhTPS2 was expressed only in leaves. When stimulated by mechanical wounding, Verticillium dahliae (Vde) elicitor or methyl jasmonate (MeJA), production of terpenes and expression of the corresponding synthase genes were induced. These data demonstrate that the three genes account for the biosynthesis of volatile terpenes of cotton, at least of this Upland cotton. Copyright © 2013 Elsevier Ltd. All rights reserved.
Feng, Bi-Hong; Wu, Bei; Zhang, Chun-Rong; Huang, Xia; Chen, Yun-Feng; Huang, Xue-Lin
2012-01-15
Embryogenic callus (EC) induced from petioles of alfalfa (Medicago sativa L. cv. Jinnan) on B5h medium turned green, compact and non-embryogenic when the kinetin (KN) in the medium was replaced partially or completely by thidiazuron (TDZ). The application of CoCl₂, which is an inhibitor of 1-aminocyclopropane-1-carboxylate oxidase (ACO), counteracted the effect of TDZ. Ethylene has been shown to be involved in the modulation of TDZ-induced morphogenesis responses. However, very little is known about the genes involved in ethylene formation during somatic embryogenesis (SE). To investigate whether ethylene mediated by ACO is involved in the effect of TDZ on inhibition of embryogenic competence of the alfalfa callus. In this study we cloned full-length ACO cDNA from the alfalfa callus, named MsACO, and observed changes in this gene expression during callus formation and induction of SE under treatment with TDZ or TDZ plus CoCl₂. RNA blot analysis showed that during the EC subcultural period, the expression level of MsACO in EC was significantly increased on the 2nd day, rose to the highest level on the 8th day and remained at this high level until the 21st day. However, the ACO expression in the TDZ (0.93 μM)-treated callus was higher than in the EC especially on the 8th day. Moreover the ACO expression level increased with increasing TDZ concentration during the subcultural/maintenance period of the callus. It is worth noting that comparing the treatment with TDZ alone, the treatment with 0.93 μM TDZ plus 50 μM CoCl₂ reduced both of the ACO gene expressions and ACO activity in the treated callus. These results indicate that the effect of TDZ could be counteracted by CoCl₂ either on the ACO gene expression level or ACO activity. Thus, a TDZ inhibitory effect on embryogenic competence of alfalfa callus could be mediated by ACO gene expression. Crown Copyright © 2011. Published by Elsevier GmbH. All rights reserved.
Institute of Scientific and Technical Information of China (English)
SU Ai-guo; LI Shuang-shuang; LIU Guo-zheng; LEI Bin-bin; KANG Ding-ming; LI Zhao-hu; MA Zhi-ying; HUA Jin-ping
2014-01-01
The plant mitochondrial genome displays complex features, particularly in terms of cytoplasmic male sterility (CMS). Therefore, research on the cotton mitochondrial genome may provide important information for analyzing genome evolution and exploring the molecular mechanism of CMS. In this paper, we present a preliminary study on the mitochondrial genome of sea island cotton (Gossypium barbadense) based on positive clones from the bacterial artiifcial chromosome (BAC) library. Thirty-ifve primers designed with the conserved sequences of functional genes and exons of mitochondria were used to screen positive clones in the genome library of the sea island cotton variety called Pima 90-53. Ten BAC clones were obtained and veriifed for further study. A contig was obtained based on six overlapping clones and subsequently laid out primarily on the mitochondrial genome. One BAC clone, clone 6 harbored with the inserter of approximate 115 kb mtDNA sequence, in which more than 10 primers fragments could be ampliifed, was sequenced and assembled using the Solexa strategy. Fifteen mitochondrial functional genes were revealed in clone 6 by gene annotation. The characteristics of the syntenic gene/exon of the sequences and RNA editing were preliminarily predicted.
Genetic diversity of sea-island cotton (Gossypium barbadense) revealed by mapped SSRs.
Wang, X Q; Feng, C H; Lin, Z X; Zhang, X L
2011-12-08
In order to evaluate the genetic diversity of sea-island cotton (Gossypium barbadense), 237 commonly mapped SSR markers covering the cotton genome were used to genotype 56 sea-island cotton accessions. A total of 218 polymorphic primer pairs (91.98%) amplified 361 loci, with a mean of 1.66 loci. Polymorphism information content values of the SSR primers ranged from 0.035 to 0.862, with a mean of 0.320. The highest mean polymorphism information content value for the SSR motifs was from a compound motif (0.402), and for the chromosomes it was Chr10 (0.589); the highest ratio of polymorphic primers in Xinjiang accessions was from Chr21 (83.33%). Genetic diversity was high in Xinjiang accessions. AMOVA showed that variation was 8 and 92% among populations and within populations, respectively. The 56 sea-island accessions were divided into three groups in the UPGMA dendrogram: Xinhai5 was in the first group; accessions from Xinjiang, except the five main ones, were in the second group, and the other 34 accessions were in the third group. Accessions from the former Soviet Union and Xinjiang main accessions were closely related. Both PCA and UPGMA confirmed that Xinhai5 was distinct from the other accessions, and accessions from Xinjiang were in an independent group. Given the differences between principal components analysis and UPGMA results, it is necessary to combine molecular markers and pedigree information so that genetic diversity can be objectively analyzed.
Genome-Wide Analysis of the RNA Helicase Gene Family in Gossypium raimondii
Directory of Open Access Journals (Sweden)
Jie Chen
2014-03-01
Full Text Available The RNA helicases, which help to unwind stable RNA duplexes, and have important roles in RNA metabolism, belong to a class of motor proteins that play important roles in plant development and responses to stress. Although this family of genes has been the subject of systematic investigation in Arabidopsis, rice, and tomato, it has not yet been characterized in cotton. In this study, we identified 161 putative RNA helicase genes in the genome of the diploid cotton species Gossypium raimondii. We classified these genes into three subfamilies, based on the presence of either a DEAD-box (51 genes, DEAH-box (52 genes, or DExD/H-box (58 genes in their coding regions. Chromosome location analysis showed that the genes that encode RNA helicases are distributed across all 13 chromosomes of G. raimondii. Syntenic analysis revealed that 62 of the 161 G. raimondii helicase genes (38.5% are within the identified syntenic blocks. Sixty-six (40.99% helicase genes from G. raimondii have one or several putative orthologs in tomato. Additionally, GrDEADs have more conserved gene structures and more simple domains than GrDEAHs and GrDExD/Hs. Transcriptome sequencing data demonstrated that many of these helicases, especially GrDEADs, are highly expressed at the fiber initiation stage and in mature leaves. To our knowledge, this is the first report of a genome-wide analysis of the RNA helicase gene family in cotton.
Williams, Wyatt I.; Friedman, Jonathan M.; Gaskin, John F.; Norton, Andrew P.
2014-01-01
Evolution has contributed to the successful invasion of exotic plant species in their introduced ranges, but how evolution affects particular control strategies is still under evaluation. For instance, classical biological control, a common strategy involving the utilization of highly specific natural enemies to control exotic pests, may be negatively affected by host hybridization because of shifts in plant traits, such as root allocation or chemical constituents. We investigated introgression between two parent species of the invasive shrub tamarisk (Tamarix spp.) in the western United States, and how differences in plant traits affect interactions with a biological control agent. Introgression varied strongly with latitude of origin and was highly correlated with plant performance. Increased levels of T. ramosissima introgression resulted in both higher investment in roots and tolerance to defoliation and less resistance to insect attack. Because tamarisk hybridization occurs predictably on the western U.S. landscape, managers may be able to exploit this information to maximize control efforts. Genetic differentiation in plant traits in this system underpins the importance of plant hybridization and may explain why some biological control releases are more successful than others.
Zhang, Feng; Zhu, Guozhong; Du, Lei; Shang, Xiaoguang; Cheng, Chaoze; Yang, Bing; Hu, Yan; Cai, Caiping; Guo, Wangzhen
2016-02-03
Cotton is an economically important crop throughout the world, and is a pioneer crop in salt stress tolerance research. Investigation of the genetic regulation of salinity tolerance will provide information for salt stress-resistant breeding. Here, we employed next-generation RNA-Seq technology to elucidate the salt-tolerant mechanisms in cotton using the diploid cotton species Gossypium davidsonii which has superior stress tolerance. A total of 4744 and 5337 differentially expressed genes (DEGs) were found to be involved in salt stress tolerance in roots and leaves, respectively. Gene function annotation elucidated salt overly sensitive (SOS) and reactive oxygen species (ROS) signaling pathways. Furthermore, we found that photosynthesis pathways and metabolism play important roles in ion homeostasis and oxidation balance. Moreover, our studies revealed that alternative splicing also contributes to salt-stress responses at the posttranscriptional level, implying its functional role in response to salinity stress. This study not only provides a valuable resource for understanding the genetic control of salt stress in cotton, but also lays a substantial foundation for the genetic improvement of crop resistance to salt stress.
Characterization of indigenous gossypium arboreum L. genotypes for various fiber quality traits
International Nuclear Information System (INIS)
Iqbal, M. A.; Abbas, A.; Zafar, Y.
2015-01-01
Diploid cotton (Gossypium arboreum L.) being an Old World cultivated cotton species, evolved in Indo-Pak subcontinent, has been known for conferring resistance to biotic and abiotic stresses. To the extent of our knowledge, there is no comprehensive report available on the characterization of G. arboreum germplasm. Hence, the present study was conducted to characterize 26 G. arboreum genotypes by deploying univariate and multivariate analysis in 2010 at NIBGE, Faisalabad. All these genotypes were characterized for boll weight, GOT percentage, micronaire value, staple length, fiber bundle strength and uniformity index. Genotypic variation was significant (p<0.01) for all the analyzed traits except boll weight. Maximum boll weight (2.47g) was observed for genotype 23718. GOT ranged from 18.75% (Haroonabad) to 36.94 percentage (DC-116).The finest fiber was obtained from synthetic (4.37 micro g/inch) and this genotype also exhibited the higher values for staple length (23.81 mm) and fiber bundle strength (27.37 g/tex). Range for uniformity index was observed from 76.19 percentage (Garohill) to 77.98 percentage (212). Principal component analysis (PCA) exhibited that first five components accounted for >63 percentage of the total variability. Cluster analysis identified four groups based on their agronomic properties. Significant relationships among different traits can be useful to select best genotypes having good fiber quality traits. These genotypes may prove a valuable resource to fuel the breeding efforts for not only broadening the genetic base of the newly developed material but can also add synergy to various cotton genomic projects. (author)
Xiao, Yanqing; Chen, Yanli; Ding, Yanpeng; Wu, Jie; Wang, Peng; Yu, Ya; Wei, Xi; Wang, Ye; Zhang, Chaojun; Li, Fuguang; Ge, Xiaoyang
2018-05-01
The WUSCHEL (WUS) gene encodes a plant-specific homeodomain-containing transcriptional regulator, which plays important roles during embryogenesis, as well as in the formation of shoot and flower meristems. Here, we isolated two homologues of Arabidopsis thaliana WUS (AtWUS), GhWUS1a_At and GhWUS1b_At, from upland cotton (Gossypium hirsutum). Domain analysis suggested that the two putative GhWUS proteins contained a highly conserved DNA-binding HOX domain and a WUS-box. Expression profile analysis showed that GhWUSs were predominantly expressed during the embryoid stage. Ectopic expression of GhWUSs in Arabidopsis could induce somatic embryo and shoot formation from seedling root tips. Furthermore, in the absence of exogenous hormone, overexpression of GhWUSs in Arabidopsis could promote shoot regeneration from excised roots, and in the presence of exogenous auxin, excised roots expressing GhWUS could be induced to produce somatic embryo. In addition, expression of the chimeric GhWUS repressor in cotton callus inhibited embryogenic callus formation. Our results show that GhWUS is an important regulator of somatic embryogenesis and shoot regeneration. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Makhdum, M.I.; Pervez, H.; Ashraf, M.
2005-01-01
A field experiment was conducted using four (Gossypium hirsutum l.) cultivars (OM-448, OM-I00, NIAB-Karishma, 5-12) at four rates of potassium (0, 62, 5, 125, 250 kg K ha-1) and with two sources of potassium (K/sub 2/S0/sub 4/, KCI) to determine the effects of potassium (K) fertilizer on fruit production under irrigated conditions. Cultivars differed significantly amongst themselves in production and retention of fruits per unit land area. The cultivars were categorized as OM-448>OM-1100>Karishma>5-12 in order of fruit production. The number of total fruiting positions increased with concurrent levels of K-fertilizer. The shedding of fruit was significantly reduced by application of 250 kg K ha-1 compared to zero K-rate treatment. The addition of K-fertilizer in the form of K/sub 2/S0/sub 4/ showed an edge over KCI in fruit production. A high degree of correlation (r 0.89**,0.91**, -0.8**) was measured between seed cotton yield and number of total fruiting positions, number of intact fruit and fruit shedding percentage respectively. (author)
Directory of Open Access Journals (Sweden)
Rodrigo Amorim Barbosa
2011-05-01
Full Text Available It was evaluated the morphogenic and structural characteristics of guinea grass under rotational at three grazing intervals and two defoliation intensities. Grazing intervals corresponded to the time needed by the forage canopy to reach 90, 95 or 100% of incident light interception during regrowth and they were evaluated combined to two defoliation severities (post-grazing conditions, 25 and 50 cm of height, being allocated to experimental units according to a complete randomized design, with three replicates and 3 × 2 factorial arrangement. The experiment was conducted from July 2003 to May 2004. For evaluation of morphogenetic and structural characteristics, ten tillers per experimental unit were selected. Morphogenetic and structural characteristics were strongly influenced by seasons of the year inasmuch as leaf elongation rate increased 3.5 fold from winter to summer. In addition to year season effect, there was also an effect of defoliation frequencies on tiller population density, which was greater in the defoliation period corresponding to 90% of light interception, especially if evaluated in relation to the interval corresponding to 100% of light interception. Defoliation frequency is determinant in expression of phenotypic plasticit, acting on the control of stem elongation.Foram avaliadas as características morfogênicas e estruturais do capim-tanzânia sob lotação rotativa em três intervalos de pastejo e duas severidades de desfolhação. Os intervalos de pastejo corresponderam aos tempos necessários para que o dossel forrageiro atingisse 90, 95 ou 100% de interceptação da luz incidente, durante a rebrotação e foram avaliados em combinação a duas severidades de desfolhação (condições pós-pastejo, 25 e 50 cm de altura, sendo alocados às unidades experimentais segundo um delineamento de blocos completos casualizados, com três repetições e arranjo fatorial 3 × 2. O experimento foi realizado de julho de 2003 a maio
International Nuclear Information System (INIS)
Makhdum, M.I.; Ashraf, M.
2007-01-01
Field studies were undertaken to determine the interrelationship between potassium (K+) concentration in various organs of plant and phosphorus (P) content as influenced by K-nutrition in cotton. The experiment was conducted on Miani soil series silt loam and classified as Calcaric Cambisols, fine silty, mixed Hyperthermic Fluventic Haplocambids. The treatments consisted .of (a) four cotton (Gossypium hirsutum L.) cultivars (CI.M-448, CIM-IIOO, Karishma, S-12); and (b) four potassium fertilizer doses (0, 62.5, 125.0, 250.0 kg K ha-l). The design of experiment was split plot (main: cultivars, sub-plot: K-doses). The plant samples were collected at five stages of growth, i.e., first flower bud., first flower, peak flowering, first boll split and maturity. The various parts of plants were analyzed for phosphorus and potassium concentration at various stages of growth. Phosphorus concentration in leaves, stems, burs, seed and lint decreased with concurrent increase in K-doses. Crop maintained 0.22% phosphorus concentration in leaf tissues at first flower bud and dropped to 0.11% at maturity. Cultivars differed greatly amongst themselves in terms of maintaining P content in their different parts. Averaged across K-doses, cv. CIM-448 maintained the highest P content in all parts than other cultivars. There was a negative and significant correlation co-efficient between K and P concentration in various parts of the plant. The study demonstrated antagonistic interaction between K+ and P in cotton plant under irrigated conditions. (author)
Directory of Open Access Journals (Sweden)
Adina Cãlugãr
2009-11-01
Full Text Available The author presents in this paper some aspects about the edaphicmicroarthropods from the organic horizon of two forest soils belonging to the Ciurea Forest District, Iasi County: ªanta (mixed stands mainly with oak, chemically treated against defoliating insects and Poieni - Tomesti (Quercus robur and Quercuspetraea stands with integrated treatments. The study of edaphic microarthropods was performed both from qualitative and quantitative point of view. It considered the average of the total density of the microarthropod populations and by each taxonomic group, according to stations and subhorizons, as well as the ratio between thetaxonomical and trophic groups. The investigations concerning edaphic mesofauna consist in inventory and analysis of the mites belonging to Oribatida, Gamasida, Actinedida and Acaridida orders, of the Collembola, as well as other insects; other groups of microarthropods were taken into consideration too (pseudoscorpiones,myriapods etc. The consequences of the treatments against the defoliators on theedaphic mesofauna were performed at four different moments. Generally, lower densities were observed in the case of the chemically treated stands. The communities of the edaphic mesofauna from the integrated management treated stands are more stableduring the time. In the chemically treated stands, the densities of the microartropods vary between large limits; this instability could be assigned to this kind of treatment. The vertical distribution of the mesofauna depends on the textural characteristics of the soil, being at the same time a dynamic parameter that is modifyed according to the variation of the climatic factors.
Directory of Open Access Journals (Sweden)
Peña Olmos Jaime Ernesto
2013-08-01
Full Text Available The chlorophyll content and fluorescence weredetermined in five-year-old grape plants (Vitis vinifera L. cv.Chardonnay that were subjected to early partial defoliation,in Villa de Leyva, Colombia. The experimental design wascompletely randomized, consisting of two treatments (50%defoliation and control, each with four replications of 35 plants. Every two weeks, one of every two recently-emerged leaves was removed from the non-control plants. The determination of total chlorophyll content was carried out on six leaves per plant using a CCM-200 Plus chlorophyll meter, while chlorophyll fluorescence measurements were taken with one darkadapted leaf per plant using a Junior-PAM fluorometer. Initial fluorescence (Fo, maximum fluorescence (Fm, terminal fluorescence (Ft, variable fluorescence (Fv, electron transport rate (ETR, maximum photochemical quantum yield of PSII (Fv/ Fm, effective photochemical quantum yield of photosystem II (Y(II, photochemical fluorescence quenching coefficient (qP, two non-photochemical quenching coefficients (qN and NPQ,quantum yield of light-induced non-photochemical fluorescence quenching (Y(NPQ, and quantum yield of non-light-induced non-photochemical quenching (Y(NO were measured. The chlorophyll concentration index showed higher values in the defoliated plants. There were no significant differences for the values of Fm, Ft and Fv. Fo was higher in the defoliated plants, while ETR, Fv/Fm and Y(II showed higher values in the control plants. It is evident that a reduction in leaf area modifies thepartitioning of excitation energy destined for photochemicaland non-photochemical processes, thus directly influencing the photosynthetic process of the plants evaluated. / Utilizando un diseño completamente aleatorizado,con dos tratamientos (defoliación al 50% y control y cuatrorepeticiones de 35 plantas cada una, se determinó el contenido y la fluorescencia de la clorofila en plantas de uva, sometidas a defoliación parcial
Inisiasi Tunas Ganda Tanaman Manggis Malinau melalui Kultur In Vitro untuk Perbanyakan Klonal
Directory of Open Access Journals (Sweden)
Endang Gati Lestari
2013-10-01
Full Text Available Mangosteen (Garcinia mangostana L. is one of the most promising tropical fruits for export. The major constraint toincrease fruit production of the spesies is the long juvenile period. Seedless, sweet and juicy variety of mangosteen had beenfound in Malinau. In vitro propagation technique offers possibility to produce sufficient number of seedlings any time. Thisresearch was aimed at obtaining the appropriate media formula to enhance shoot proliferation. This research consisted ofshoot induction and multiplication and shoot elongation. The materials were the fresh mangosteen seeds from the Malinaumangosteen trees. The explant used in the trial was seeds which were divided into four slices. The use of 8 to 16 mg BA L-1combined with 0.2 mg thidiazuron L-1 resulted in the best shoot induction of 52 shoot buds per explant at the 6th week afterplanting with the mean height of 0.3 cm. Upon subculturing in to the similar media, the number of shoot tends to increase.For multiplication, low concentration of BA (2 to 4 mg L-1 and thidiazuron 0.05 mg L-1 were applied to increase the numbersof shoots. The total shoot number obtained in the media with 0.05 thidiazuron without BA was 11.25 and in the media with 2mg BA L-1 + 0.05 mg thidiazuron L-1 was 8.7 shoot explant-1. The result showed that the best media for shoot elongation wasMS + 1 mg BA L-1 + 2 mg kinetin L-1. The length of the shoots were in the range of 0.5-0.8 cm.Keywords: BA, Garcinia mangostana, in vitro culture, shoot multiplication, thidiazuron
Directory of Open Access Journals (Sweden)
Min Lin
Full Text Available BACKGROUND: Cotton (Gossypium hirsutum L. is one of the world's most economically-important crops. However, its entire genome has not been sequenced, and limited resources are available in GenBank for understanding the molecular mechanisms underlying leaf development and senescence. METHODOLOGY/PRINCIPAL FINDINGS: In this study, 9,874 high-quality ESTs were generated from a normalized, full-length cDNA library derived from pooled RNA isolated from throughout leaf development during the plant blooming stage. After clustering and assembly of these ESTs, 5,191 unique sequences, representative 1,652 contigs and 3,539 singletons, were obtained. The average unique sequence length was 682 bp. Annotation of these unique sequences revealed that 84.4% showed significant homology to sequences in the NCBI non-redundant protein database, and 57.3% had significant hits to known proteins in the Swiss-Prot database. Comparative analysis indicated that our library added 2,400 ESTs and 991 unique sequences to those known for cotton. The unigenes were functionally characterized by gene ontology annotation. We identified 1,339 and 200 unigenes as potential leaf senescence-related genes and transcription factors, respectively. Moreover, nine genes related to leaf senescence and eleven MYB transcription factors were randomly selected for quantitative real-time PCR (qRT-PCR, which revealed that these genes were regulated differentially during senescence. The qRT-PCR for three GhYLSs revealed that these genes express express preferentially in senescent leaves. CONCLUSIONS/SIGNIFICANCE: These EST resources will provide valuable sequence information for gene expression profiling analyses and functional genomics studies to elucidate their roles, as well as for studying the mechanisms of leaf development and senescence in cotton and discovering candidate genes related to important agronomic traits of cotton. These data will also facilitate future whole-genome sequence
Selectivity and stability of vegetation-applied herbicides in cotton (Gossypium hirsutum L.
Directory of Open Access Journals (Sweden)
T. Barakova
2016-06-01
Full Text Available Abstract. An experiment was carried out during 2013 – 2015 in the experimental field of the Field Crops Institute, Chirpan, with two cotton cultivars − Helius and Darmi (Gossypium hirsutum L.. Herbicides: Goal 2 E, oxyfluorfen (80 ml/da; Linuron 45 SC, linuron (200 ml/da; Wing-P, pendimethalin + dimethenamid (400 ml/da; Merlin 750 WG, isoxaflutol (5 g/da; Bazagran 480 SL, bentazone (150 ml/da were investigated. They were treated separately or combined with growth regulator Amalgerol (500 ml/da or foliar fertilizer Lactofol O (500 ml/da in the budding stage of the cotton. It was established that selectivity is the lowest in the two cotton cultivars with herbicides Linuron 45 CK and Merlin 750 WG. The purpose of this investigation was to establish the selectivity and stability of some herbicides and their tank mixtures on the cotton by influence of different meteorological conditions. It has been found that the highest phytotoxicity on cotton is given the vegetation-applied herbicides Merlin and Linuron. Foliar fertilizer Laktofol O reduces phytotoxicity of herbicides Goal, Wing, Merlin and Bazagran in two cotton cultivars. Herbicides Wing and Bazagran have excellent selectivity for the two cotton cultivars – Helius and Darmi. The highest yield was obtained by vegetation treatment with herbicide Bazagran, followed by herbicides Wing and Goal. Tank mixtures of Goal, Bazagran and Wing with Laktofol, followed by those with Amalgerol are technologically the most valuable. They combine high yield with high stability over the years. Аlone application of herbicides Linuron and Merlin and their tank mixtures with Amalgerol and Laktofol have low estimate.
Shweta; Akhter, Yusuf; Khan, Jawaid Ahmad
2018-01-05
Cotton leaf curl Burewala virus (CLCuBV, genus Begomovirus) causes devastating cotton leaf curl disease. Among various known virus controlling strategies, RNAi-mediated one has shown potential to protect host crop plants. Micro(mi) RNAs, are the endogenous small RNAs and play a key role in plant development and stress resistance. In the present study we have identified cotton (Gossypium hirsutum)-encoded miRNAs targeting the CLCuBV. Based on threshold free energy and maximum complementarity scores of host miRNA-viral mRNA target pairs, a number of potential miRNAs were annotated. Among them, ghr-miR168 was selected as the most potent candidate, capable of targeting several vital genes namely C1, C3, C4, V1 and V2 of CLCuBV genome. In addition, ghr-miR395a and ghr-miR395d were observed to target the overlapping transcripts of C1 and C4 genes. We have verified the efficacy of these miRNA targets against CLCuBV following suppression of RNAi-mediated virus control through translational inhibition or cleavage of viral mRNA. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Thereza Raquel de Lucena Vieira
2010-06-01
Full Text Available Esta pesquisa teve como objetivo avaliar o efeito de dietas de terminação contendo diferentes níveis (0, 20, 30 e 40% de caroço de algodão integral (Gossypium hirsutum sobre os parâmetros físicos e sensoriais da carne de vinte e quatro cordeiros da raça Santa Inês. Foram avaliados os parâmetros de pH, capacidade de retenção de água (CRA, perda de peso por cocção (PPC, textura e cor, além dos parâmetros sensoriais de sabor, aroma, cor e textura. Apenas o parâmetro cor da carne ovina sofreu influência significativa da adição do caroço de algodão integral, observando-se variações para as coordenadas b* e L* (antes da cocção. Verificou-se também que os tratamentos apresentaram influência (p The objective of this research was to evaluate the effect of termination diets containing increasing levels (0, 20, 30, and 40% of whole cotton seed (Gossypium hirsutum on the physical (pH, water holding capacity, cooking losses, texture, colour and sensory parameters (flavour, odour, colour, texture of the lamb meat of twenty four Santa Ines sheep. Only the b* and L* colour parameters of the lamb meat were significantly affected by the addition of different levels of whole cotton seed to the diet. The inclusion of the whole cotton seed in the diet of the Santa Ines sheep also influenced sensory attributes such as natural colour, odour, and characteristic flavour. Based on these observations, considering the physical and sensory attributes of the lamb meat, the use of whole cotton seed at a 40% level for sheep in termination for short periods, i.e., up to 90 days, is recommended.
Pelizza, Sebastian A; Schalamuk, Santiago; Simón, María R; Stenglein, Sebastian A; Pacheco-Marino, Suani G; Scorsetti, Ana C
Rachiplusia nu (Guenée) (Lepidoptera: Noctuidae) is one of the major lepidopteran pests defoliating soybeans (Glycine max Merrill) in Argentina. The combined use of chemical insecticides and entomopathogenic fungi is a promising pest-control option to minimize adverse chemical effects. In this work, we evaluated the interactions between five insecticides-two being considered biorational-and five fungal entomopathogenic strains under laboratory conditions in order to determine the possible usefulness of combinations of these agents against R. nu. The insecticides were tested for compatibility at four doses by in vitro bioassay and for the lethality of R. nu by inoculations at three doses. Fungal strains were applied at 1×10 8 , 1×10 6 , and 1×10 4 conidia/ml. The combinations of those insecticides with Beauveria bassiana (LPSc 1067, LPSc 1082, LPSc 1098), Metarhizium anisopliae (LPSc 907), and Metarhizium robertsii (LPSc 963) caused higher R. nu-larval mortalities than any of the individual agents alone. We observed significant differences in the in vitro conidial viability, vegetative growth, and conidia production of the five strains of entomopathogenic fungi exposed to different doses of the chemical insecticides. The combination gamma-cyhalothrin-LPSc-1067 caused the highest percent mortality of R. nu larvae, with synergism occurring between the two agents at 50% and 25% of the maximum field doses. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Benincore Mauricio
2000-12-01
Full Text Available In order to improve yield and quality of Colombian apple fruits, Thydiazuron (TDZ and Choline Chloride (CC biorregulators were evaluated as supposed stimulants of growth and development of 'Princesa', 'Golden Delicious' y 'Gala' varieties in the «La Calera» zone (2650 masl. 50, lOOand 150 mg-L:' of TDZ were sprayed between 30 and 45 days after blooming (dab and 500, 1000 and 1500 mg-L-' of CC 118 dab, using a completely randomized design for 'Princesa' and 'Golden Delicious' and a completely randomized
block design for 'Gala'. TDZ showed chemical thinning and
cytokinine activity, decreasing the number and acidity of harvested fruits, but increased mean fruit weight, In 'Gala', TDZ increased the harvested fruit number per tree; with 150 mg-L:' fruit color increased while soluble solids (SS concentration declined. On the other side, in 'Gala' apples, CC applications decreased fruit number per tree and showed higher mean weights, volume and SS content of fruits, especially with 500 mg-L:'. In 'Golden Delicious' CC produced oblong fruits with higher SS content and lower flesh firrnness.
Con el fin de mejorar rendimiento y calidad del fruto de la manzana nacional, se evaluaron los biorreguladores Thidiazuron (TDZ y Cloruro de Colina (CC como supuestos estimuladores del crecimiento y desarrollo del fruto en las variedades 'Princesa', 'Golden Delicious' y 'Gala' en la zona de «La Calera» (2650 msnm. Para tal fin, se aplicaron 50, 100 y 150 mg-L" de TDZ entre los 30 y 45 días después de floración (ddt y 500, 1000 y 1500 mg-L-' de CC 118 ddf,
bajo diseño completamente aleatorizado para 'Princesa' y 'Golden Delicious' y bloque completos al azar para 'Gala'. Thidiazuron actuó como agente químico raleante y como citoquinina, disminuyendo en 'Golden Delicious' el número de frutos cosechados y la acidez, pero aumentando el peso promedio del fruto. En 'Gala', TDZ aumentó el número de frutos por árbol, a 150 mg-L-' aumentó la
Roy, K.; Zwieniecki, M.
2017-12-01
Cotton (Gossypium hirsutum L.) is relatively drought resistant and thus is planted widely in many semi-arid and arid parts of the world, many of which are usually deprived of modern water management technologies. Since the productivity of cotton plants depends on water availability, we carried out the present research aiming at testing two different low cost and arid-environment friendly water efficient techniques: application of particle film technology on leaves to reduce the transpiration rate (kaolin dust), and use of organic material to improve the soil water holding capacity (cotton wool). In details, kaolin (3% and 5%; weight:volume) mixed in water was sprayed on the upper surface of the leaves of young plants, and small amounts of cotton wool (0.1%, 0.3% and 0.5%; weight:weight) were mixed into the soils. The study showed that kaolin spray was useful as a transpiration reducing agent only if plants have adequate water in the soil (well irrigated) but not under water stress conditions. In addition, mixing a small amount of cotton wool into the soil can significantly increase the amount of water available to the plants, and extend the benefit of kaolin application on plants.
Santos, Karen B Dos; Meneguim, Ana M; Santos, Walter J Dos; Neves, Pedro M O J; Santos, Rachel B Dos
2010-01-01
The cotton plant, Gossypium hirsutum, hosts various pests that damage different structures. Among these pests, Spodoptera cosmioides (Walker) and Spodoptera eridania (Cramer) (Lepidoptera: Noctuidae) are considered important. The objectives of this study were to characterize and to quantify the potential damage of S. eridania and S. cosmioides feeding on different structures of cotton plants. For this purpose, newly-hatched larvae were reared on the following plant parts: leaf and flower bud; leaf and boll; flower bud or boll; and leaf, flower bud and boll. The survival of S. cosmioides and S. eridania was greater than 80% and 70% for larvae fed on cotton plant parts offered separately or together, respectively. One larva of S. eridania damaged 1.7 flower buds, but did not damage bolls, while one larva of S. cosmioides damaged 5.2 flower buds and 3.0 cotton bolls. Spodoptera eridania and S. cosmioides can be considered species with potential to cause economic damage to cotton plants because they can occur throughout cotton developmental stages causing defoliation and losses of reproductive structures. Therefore, the results validate field observations that these two species of Spodoptera are potential pests for cotton.
Linkage and association mapping reveals the genetic basis of brown fibre (Gossypium hirsutum).
Wen, Tianwang; Wu, Mi; Shen, Chao; Gao, Bin; Zhu, De; Zhang, Xianlong; You, Chunyuan; Lin, Zhongxu
2018-02-24
Brown fibre cotton is an environmental-friendly resource that plays a key role in the textile industry. However, the fibre quality and yield of natural brown cotton are poor, and fundamental research on brown cotton is relatively scarce. To understand the genetic basis of brown fibre cotton, we constructed linkage and association populations to systematically examine brown fibre accessions. We fine-mapped the brown fibre region, Lc 1 , and dissected it into 2 loci, qBF-A07-1 and qBF-A07-2. The qBF-A07-1 locus mediates the initiation of brown fibre production, whereas the shade of the brown fibre is affected by the interaction between qBF-A07-1 and qBF-A07-2. Gh_A07G2341 and Gh_A07G0100 were identified as candidate genes for qBF-A07-1 and qBF-A07-2, respectively. Haploid analysis of the signals significantly associated with these two loci showed that most tetraploid modern brown cotton accessions exhibit the introgression signature of Gossypium barbadense. We identified 10 quantitative trait loci (QTLs) for fibre yield and 19 QTLs for fibre quality through a genome-wide association study (GWAS) and found that qBF-A07-2 negatively affects fibre yield and quality through an epistatic interaction with qBF-A07-1. This study sheds light on the genetics of fibre colour and lint-related traits in brown fibre cotton, which will guide the elite cultivars breeding of brown fibre cotton. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Liu, Xia; Zhao, Bo; Zheng, Hua-Jun; Hu, Yan; Lu, Gang; Yang, Chang-Qing; Chen, Jie-Dan; Chen, Jun-Jian; Chen, Dian-Yang; Zhang, Liang; Zhou, Yan; Wang, Ling-Jian; Guo, Wang-Zhen; Bai, Yu-Lin; Ruan, Ju-Xin; Shangguan, Xiao-Xia; Mao, Ying-Bo; Shan, Chun-Min; Jiang, Jian-Ping; Zhu, Yong-Qiang; Jin, Lei; Kang, Hui; Chen, Shu-Ting; He, Xu-Lin; Wang, Rui; Wang, Yue-Zhu; Chen, Jie; Wang, Li-Jun; Yu, Shu-Ting; Wang, Bi-Yun; Wei, Jia; Song, Si-Chao; Lu, Xin-Yan; Gao, Zheng-Chao; Gu, Wen-Yi; Deng, Xiao; Ma, Dan; Wang, Sen; Liang, Wen-Hua; Fang, Lei; Cai, Cai-Ping; Zhu, Xie-Fei; Zhou, Bao-Liang; Jeffrey Chen, Z; Xu, Shu-Hua; Zhang, Yu-Gao; Wang, Sheng-Yue; Zhang, Tian-Zhen; Zhao, Guo-Ping; Chen, Xiao-Ya
2015-09-30
Of the two cultivated species of allopolyploid cotton, Gossypium barbadense produces extra-long fibers for the production of superior textiles. We sequenced its genome (AD)2 and performed a comparative analysis. We identified three bursts of retrotransposons from 20 million years ago (Mya) and a genome-wide uneven pseudogenization peak at 11-20 Mya, which likely contributed to genomic divergences. Among the 2,483 genes preferentially expressed in fiber, a cell elongation regulator, PRE1, is strikingly At biased and fiber specific, echoing the A-genome origin of spinnable fiber. The expansion of the PRE members implies a genetic factor that underlies fiber elongation. Mature cotton fiber consists of nearly pure cellulose. G. barbadense and G. hirsutum contain 29 and 30 cellulose synthase (CesA) genes, respectively; whereas most of these genes (>25) are expressed in fiber, genes for secondary cell wall biosynthesis exhibited a delayed and higher degree of up-regulation in G. barbadense compared with G. hirsutum, conferring an extended elongation stage and highly active secondary wall deposition during extra-long fiber development. The rapid diversification of sesquiterpene synthase genes in the gossypol pathway exemplifies the chemical diversity of lineage-specific secondary metabolites. The G. barbadense genome advances our understanding of allopolyploidy, which will help improve cotton fiber quality.
Directory of Open Access Journals (Sweden)
Changwei Bi
2016-01-01
Full Text Available Cotton is one of the most important economic crops and the primary source of natural fiber and is an important protein source for animal feed. The complete nuclear and chloroplast (cp genome sequences of G. raimondii are already available but not mitochondria. Here, we assembled the complete mitochondrial (mt DNA sequence of G. raimondii into a circular genome of length of 676,078 bp and performed comparative analyses with other higher plants. The genome contains 39 protein-coding genes, 6 rRNA genes, and 25 tRNA genes. We also identified four larger repeats (63.9 kb, 10.6 kb, 9.1 kb, and 2.5 kb in this mt genome, which may be active in intramolecular recombination in the evolution of cotton. Strikingly, nearly all of the G. raimondii mt genome has been transferred to nucleus on Chr1, and the transfer event must be very recent. Phylogenetic analysis reveals that G. raimondii, as a member of Malvaceae, is much closer to another cotton (G. barbadense than other rosids, and the clade formed by two Gossypium species is sister to Brassicales. The G. raimondii mt genome may provide a crucial foundation for evolutionary analysis, molecular biology, and cytoplasmic male sterility in cotton and other higher plants.
Directory of Open Access Journals (Sweden)
Rehman Iqra
2017-01-01
Full Text Available Cotton Leaf Curl Disease (CLCuD is one of the threatening constrains of cotton production in Pakistan for which no adequate remedy is available until now. Local variety of Gossypium hirsutum (FH-142 was grown in field and infected naturally by CLCuV under variable range of temperature and humidity. Plants showed thickening of veins in lower leaf surface at 34°C and 60% relative humidity at 15days post infection (dpi and curling of leaf margins at 33°C with 58% relative humidity at 30dpi. Remarkable leaf darkening was observed with reduced boll formation at 45dpi at 26°C and 41% relative humidity. Enation developed, severe thickening and curling of leaves intensified and plants showed dwarf growth at 60dpi at 24°C with 52% relative humidity. PCR amplification of Rep associated gene confirmed the presence of CLCuD-associated begomovirus in the infected samples. Quantitative RT-PCR confirmed the amplification and differential expression of a number of pathogen stress responsive genes at different levels of temperature and humidity. This observation predicts that Cotton Leaf Curl Virus (CLCuV interacts with several host genes that are upregulated to make plants susceptible or suppress other genes to overcome host defense responses.
Directory of Open Access Journals (Sweden)
Cássia Regina Yuriko Ide Vieira
2008-03-01
Full Text Available O objetivo do trabalho foi avaliar o efeito do ácido giberélico, thidiazuron e quinmerac na anatomia das bagas de uvas cultivar 'Niagara Rosada', provenientes de vinhedo localizado em Dourados - MS. Realizaram-se três experimentos. No primeiro ensaio, utilizaram-se soluções aquosas de ácido giberélico (AG3 0; 15; 30; 45; 60; 75 e 90 mg.l-1, aplicadas no florescimento e repetidas aos 14 dias após (E1E2 e, no outro tratamento, o mesmo composto e doses aplicados uma única vez aos 14 dias após o florescimento (E2; no segundo experimento, thidiazuron (TDZ 0; 5; 10; 15; 20; 25 e 30 mg.l-1, aplicados quatro dias antes da antese e repetidos aos seis dias após o florescimento (E1E2; e no outro tratamento, o mesmo composto e doses aplicados uma única vez aos seis dias após o florescimento (E2; e, no terceiro, quinmerac 0; 10; 20; 30; 40; 50 e 60 mg.l-1, aplicados no florescimento e repetidos aos 14 dias após (E1E2, e, no outro tratamento, o mesmo composto e doses aplicados uma única vez, 14 dias após o florescimento (E2. As variáveis avaliadas foram: número e dimensões das células das bagas. Pelos resultados obtidos, verificou-se que duas aplicações de ácido giberélico, thidiazuron e quinmerac promoveram a divisão celular, enquanto a expansão celular foi observada com uma única aplicação de thidiazuron e quinmerac.The objective of this investigation was to evaluate the effect of the gibberellic acid, thidiazuron and quinmerac on grape berries anatomy of grapevine 'Niagara Rosada', in a vineyard located in Dourados - MS. Three trials were carried out. In the first trial, it was used gibberellic acid (AG3 0, 15, 30, 45, 60, 75 and 90 mg.l-1, applied in the bloom and repeated 14 days later (E1E2 and in the other treatment, the same compound and doses applied only once, 14 days after the bloom (E2; in the second experiment, thidiazuron (TDZ 0, 5, 10, 15, 20, 25 and 30 mg.l-1, applied four days before antesis and repeated six days
Wang, Ning; Hua, Hanbai; Eneji, A Egrinya; Li, Zhaohu; Duan, Liusheng; Tian, Xiaoli
2012-05-02
A hydroponic culture experiment was conducted to determine genotypic variation in photosynthetic rate and the associated physiological changes in response to potassium (K) deficiency in cotton (Gossypium hirsutum L.) seedlings with contrasting two cotton cultivars in K efficiency. The K-efficient Liaomian18 produced 66.7% more biomass than the K-inefficient NuCOTN99(B) under K deficiency, despite their similar biomass under K sufficiency. Compared with NuCOTN99(B), Liaomian18 showed 19.4% higher net photosynthetic rate (P(n), per unit leaf area) under K deficient solutions and this was associated with higher photochemical efficiency and faster export of soluble sugars from the phloem. The lower net P(n) of NuCOTN99(B) was attributed to higher capacity for nitrate assimilation and lower export of soluble sugars. Furthermore, NuCOTN99(B) showed 38.4% greater ETR/P(n) than Liaomian18 under K deficiency, indicating that more electrons were driven to other sinks. Higher superoxide dismutase (SOD) and lower catalase (CAT) and ascorbate peroxidase (APX) activities resulted in higher levels of reactive oxygen species (ROS; e.g. O(2)(-)and H(2)O(2)) in NuCOTN99(B) relative to Liaomian18. Thus, the K inefficiency of NuCOTN99(B), indicated by lower biomass and net P(n) under K deficiency, was associated with excessively high nitrogen assimilation, lower export of carbon assimilates, and greater ROS accumulation in the leaf. Crown Copyright © 2012. Published by Elsevier B.V. All rights reserved.
Pietrantuono, A L; Moreyra, S; Lozada, M
2017-09-19
Vespula germanica is a social wasp and an opportunistic predator. While foraging, these wasps learn and integrate different kinds of cues. They have successfully invaded many parts of the world, including native Nothofagus and Lophozonia forests located in the Andean-Patagonian region, where they forage on native arthropods. Perzelia arda, a lepidopteron defoliator of Lophozonia obliqua, uses the foliage to hide in and feed on. The purpose of this work is to study whether V. germanica use olfactory cues when foraging on P. arda. To do this, we used a Y-tube olfactometer and established three treatments to compare pairs of all combinations of stimuli (larvae, leaves with larval traces, and leaves without larval traces) and controls. Data were analysed via two developed models that showed decisions made by V. germanica and allowed to establish a scale of preferences between the stimuli. The analysis demonstrates that V. germanica wasps choose P. arda as larval prey and are capable of discriminating between the offered stimuli (deviance information criterion (DIC) null model = 873.97; DIC simple model = 84.5, n = 152). According to the preference scale, V. germanica preferred leaves with traces of larvae, suggesting its ability to associate these traces with the presence of the prey. This may be because, under natural conditions, larvae are never exposed outside their shelters of leaves and therefore V. germanica uses indirect signals. The presence of V. germanica foraging on P. arda highlights the flexible foraging behaviour of this wasp which may also act as a positive biological control, reducing lepidopteran populations.
International Nuclear Information System (INIS)
Hussain, T.; Majeed, A.; Maqbool, A.; Hussain, S.S.; Ali, T.; Riazuddin, S.
2005-01-01
Negative effects on the Water status of plants is one of the most common and deleterious stresses experienced by wild and cultivated plants throughout the World. Our project is designed to identify, clone and characterize gene sequences regulated in response to Water stress (e.g., drought). We used the differential-display reverse transcriptase polymerase chain reaction (DD-RT- PCA) methodology to accomplish our Objectives. Structural and functional characterization of environmental stress-induced genes has contributed to a better understanding of how plants respond and adapt to different abiotic stresses. Differential display was used to compare overall difference in gene expression between draught stressed and unstressed (control) plants of diploid Cotton (Gossypium arboreum). DDRT-PCR product from stressed and unstressed samples resolved side by side on 6% PAGE to compare qualitative and quantitative difference in mRNA expression. A total of 81 primer combinations were tested. DDRT -PCR enabled us to identify differentially expressed transcripts between water stressed and non-stressed cotton seedlings. PAGE revealed a total of 347 DNA transcripts in stressed samples (New Transcripts) while 110 down regulated and 209 up regulated DNA transcripts were also recorded. Similarly. 22 DNA transcripts were identified based on the comparative study of PAGE and Agarose gel electrophoresis. These sequences showed various degree homology With draught tolerant genes in the gene bank. (author)
Propagación clonal in vitro y enraizamiento de estacas de algodón nativo (Gossypium barbadense L.
Directory of Open Access Journals (Sweden)
Consuelo Rojas-Idrogo
2013-12-01
Full Text Available En este trabajo se evalúo el efecto de reguladores de crecimiento en la propagación clonal in vitro y el efecto de diferentes soluciones nutritivas y reguladores de crecimiento en el enraizamiento de estacas de algodón (Gossypium barbadense. En el enraizamiento se evaluó el efecto del agua corriente, las soluciones nutritivas de Knop y Knudson y los reguladores de crecimiento AIA, AIB y floroglucinol sobre estacas obtenidas de las zonas apical, media y basal de la planta. En la combinación ANA 0.1 mg/lt - BAP 1.0 y 2.0 mg/lt, después de 30 días de cultivo in vitro, se alcanzó la mayor elongación de brotes (38.1 y 30.7 mm y número de nudos formados (4.1 y 3.4; el mejor enraizamiento se observó con AIA 0.2 mg/lt formando 3.6 raíces. El enraizamiento de estacas, con brotes formados (40 y 50%, fue mayor cuando se utilizó el tercio medio y superior, tanto en agua corriente como en la solución de Knop y únicamente suplementados con AIB 25 y 50 mg/lt.
Directory of Open Access Journals (Sweden)
Maria Geralda Vilela Rodrigues
2009-09-01
, principalmente no quarto e quinto ciclos. Concluiu-se que desfolha mais acentuada reduziu o potencial produtivo de cachos pela perda de área fotossintética. Assim, a melhor alternativa testada foi a manutenção de 10 a 12 folhas por planta, para se obterem adequado número de frutos e desenvolvimento dos mesmos, a fim de conciliar produção e fitossanidade do bananal.Banana tree defoliation, in a rational way, it is a cultural practice that should be accomplished periodically, aiming at eliminating those leaves whose photosynthetic activity does not assist to the physiological needs of the plant, bringing among other advantages, facilitating the disease control. Concerning to sigatoka spots, the elimination of injured leaves is an important auxiliary tool for its control, for reducing the source of secondary inoculum, however it should be done with criterion to not cause more serious damages than those ones caused by the own disease. It is known that the banana trees of the subgroup Cavendish need 11 and 8 whole leaves in the moment of flowering and harvesting, respectively, to produce the necessary photoassimilates for the stuffing of the bunch, however for banana 'Prata-Anã' this is unknown yet. To avoid misunderstandings in the 'Prata-Anã' management, it was evaluated, for five consecutive productive cycles, the effect of different levels of defloliation on the production, defining a better relationship of defoliation level: production. The handlings consisted of the maintenance of 4, 6, 8, 10, 12 and 14 leaves per plant, besides the control (removal just of the dry and broken leaves. The mass of the bunches was greater in the plants maintained with a minimum of 12 leaves, as well as most of the characteristics related to production. An appropriate number of hands and fingers, as well as most of the hands characteristics, occurred when at least 10 leaves per plant were maintained. More accentuated defoliations, in which were kept 4, 6, 8 or 10 leaves per plant, reducing
Anwaar, Shad Ali; Ali, Shafaqat; Ali, Skhawat; Ishaque, Wajid; Farid, Mujahid; Farooq, Muhammad Ahsan; Najeeb, Ullah; Abbas, Farhat; Sharif, Muhammad
2015-03-01
Silicon (Si) is as an important fertilizer element, which has been found effective in enhancing plant tolerance to variety of biotic and a-biotic stresses. This study investigates the Si potential to alleviate zinc (Zn) toxicity stress in cotton (Gossypium hirsutum L.). Cotton plants were grown in hydroponics and exposed to different Zn concentration, 0, 25, and 50 μM, alone and/or in combination with 1 mM Si. Incremental Zn concentration in growth media instigated the cellular oxidative damage that was evident from elevated levels of hydrogen peroxide (H2O2), electrolyte leakage, and malondialdehyde (MDA) and consequently inhibited cotton growth, biomass, chlorophyll pigments, and photosynthetic process. Application of Si significantly suppressed Zn accumulation in various plant parts, i.e., roots, stems, and leaves and thus promoted biomass, photosynthetic, growth parameters, and antioxidant enzymes activity of Zn-stressed as well unstressed plants. In addition, Si reduced the MDA and H2O2 production and electrolyte leakage suggesting its role in protecting cotton plants from Zn toxicity-induced oxidative damage. Thus, the study indicated that exogenous Si application could improve growth and development of cotton crop experiencing Zn toxicity stress by limiting Zn bioavailability and oxidative damage.
Niu, Erli; Shang, Xiaoguang; Cheng, Chaoze; Bao, Jianghao; Zeng, Yanda; Cai, Caiping; Du, Xiongming; Guo, Wangzhen
2015-01-01
COBRA-Like (COBL) genes, which encode a plant-specific glycosylphosphatidylinositol (GPI) anchored protein, have been proven to be key regulators in the orientation of cell expansion and cellulose crystallinity status. Genome-wide analysis has been performed in A. thaliana, O. sativa, Z. mays and S. lycopersicum, but little in Gossypium. Here we identified 19, 18 and 33 candidate COBL genes from three sequenced cotton species, diploid cotton G. raimondii, G. arboreum and tetraploid cotton G. hirsutum acc. TM-1, respectively. These COBL members were anchored onto 10 chromosomes in G. raimondii and could be divided into two subgroups. Expression patterns of COBL genes showed highly developmental and spatial regulation in G. hirsutum acc. TM-1. Of them, GhCOBL9 and GhCOBL13 were preferentially expressed at the secondary cell wall stage of fiber development and had significantly co-upregulated expression with cellulose synthase genes GhCESA4, GhCESA7 and GhCESA8. Besides, GhCOBL9 Dt and GhCOBL13 Dt were co-localized with previously reported cotton fiber quality quantitative trait loci (QTLs) and the favorable allele types of GhCOBL9 Dt had significantly positive correlations with fiber quality traits, indicating that these two genes might play an important role in fiber development. PMID:26710066
Directory of Open Access Journals (Sweden)
María J Ek-Ramos
Full Text Available Studies of fungi in upland cotton (Gossypium hirsutum cultivated in the United States have largely focused on monitoring and controlling plant pathogens. Given increasing interest in asymptomatic fungal endophytes as potential biological control agents, surveys are needed to better characterize their diversity, distribution patterns and possible applications in integrated pest management. We sampled multiple varieties of cotton in Texas, USA and tested for temporal and spatial variation in fungal endophyte diversity and community composition, as well as for differences associated with organic and conventional farming practices. Fungal isolates were identified by morphological and DNA identification methods. We found members of the genera Alternaria, Colletotrichum and Phomopsis, previously isolated as endophytes from other plant species. Other recovered species such as Drechslerella dactyloides (formerly Arthrobotrys dactyloides and Exserohilum rostratum have not, to our knowledge, been previously reported as endophytes in cotton. We also isolated many latent pathogens, but some species such as Alternaria tennuissima, Epicoccum nigrum, Acremonium alternatum, Cladosporium cladosporioides, Chaetomium globosum and Paecilomyces sp., are known to be antagonists against plant pathogens, insects and nematode pests. We found no differences in endophyte species richness or diversity among different cotton varieties, but did detect differences over time and in different plant tissues. No consistent patterns of community similarity associated with variety, region, farming practice, time of the season or tissue type were observed regardless of the ecological community similarity measurements used. Results indicated that local fungal endophyte communities may be affected by both time of the year and plant tissue, but the specific community composition varies across sites. In addition to providing insights into fungal endophyte community structure, our survey
Directory of Open Access Journals (Sweden)
Huma Lubna Shaheen and Muhammad Shahbaz
2012-11-01
Full Text Available Salinity is a multidimensional stress affecting crop yield and productivity at various levels of plant organization. To assess salt induced adverse effects on cotton (Gossypium hirsutum L., ten cultivars were grown in sand culture supplemented with full strength Hoagland’s nutrients solutions and different salt concentrations (0, 50, 100 and 200 mM NaCl. Salt stress markedly reduced growth attributes, relative water contents, efficiency of photosystem II, net CO2 assimilation rate (A, transpiration rate (E and stomatal conductance in all cultivars. Reduction was maximum at the highest level of salt stress i.e. 200 mM. However, response of cotton cultivars was variable to various levels of salinity and even at various developmental stages. Cultivars RH-510, BH-118 and MNH-770 were ranked as relatively salt tolerant on the basis of their better growth performance and net CO2 assimilation rate whereas cvs. CIM-496, CIM-473 and FH-901 were relatively salt sensitive. Cultivars RH-510, BH-118 and MNH-770 exhibited high shoot fresh and dry weights, photosynthetic rate (A, and Photosystem II (Fv/Fm efficiency at both seedling and maturity growth stages. Results suggest that selection of plants having high photosynthetic rate and biomass at seedling stage may be a good source of high yield at mature stage of growth.
Directory of Open Access Journals (Sweden)
Hongtao Hu
Full Text Available MicroRNAs (miRNAs and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs are two distinct subfamilies of small RNAs (sRNAs that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs are processed from longer RNA precursors by DICER-LIKE proteins (DCLs. Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs and 108 novel lineage-specific miRNAs (ls-miRNAs. Along with miRNAs, 2,033 miRNA variants (isomiRNAs were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers
Hu, Hongtao; Rashotte, Aaron M; Singh, Narendra K; Weaver, David B; Goertzen, Leslie R; Singh, Shree R; Locy, Robert D
2015-01-01
MicroRNAs (miRNAs) and secondary small interfering RNAs (principally phased siRNAs or trans-acting siRNAs) are two distinct subfamilies of small RNAs (sRNAs) that are emerging as key regulators of posttranscriptional gene expression in plants. Both miRNAs and secondary-siRNAs (sec-siRNAs) are processed from longer RNA precursors by DICER-LIKE proteins (DCLs). Gossypium arboreum L., also known as tree cotton or Asian cotton, is a diploid, possibly ancestral relative of tetraploid Gossypium hirsutum L., the predominant type of commercially grown cotton worldwide known as upland cotton. To understand the biological significance of these gene regulators in G. arboreum, a bioinformatics analysis was performed on G. arboreum small RNAs produced from G. arboreum leaf, flower, and boll tissues. Consequently, 263 miRNAs derived from 353 precursors, including 155 conserved miRNAs (cs-miRNAs) and 108 novel lineage-specific miRNAs (ls-miRNAs). Along with miRNAs, 2,033 miRNA variants (isomiRNAs) were identified as well. Those isomiRNAs with variation at the 3'-miRNA end were expressed at the highest levels, compared to other types of variants. In addition, 755 pha-siRNAs derived 319 pha-siRNA gene transcripts (PGTs) were identified, and the potential pha-siRNA initiators were predicted. Also, 2,251 non-phased siRNAs were found as well, of which 1,088 appeared to be produced by so-called cis- or trans-cleavage of the PGTs observed at positions differing from pha-siRNAs. Of those sRNAs, 148 miRNAs/isomiRNAs and 274 phased/non-phased siRNAs were differentially expressed in one or more pairs of tissues examined. Target analysis revealed that target genes for both miRNAs and pha-siRNAs are involved a broad range of metabolic and enzymatic activities. We demonstrate that secondary siRNA production could result from initial cleavage of precursors by both miRNAs or isomiRNAs, and that subsequently produced phased and unphased siRNAs could result that also serve as triggers of a second
Fan, Xinqi; Guo, Qi; Xu, Peng; Gong, YuanYong; Shu, Hongmei; Yang, Yang; Ni, Wanchao; Zhang, Xianggui; Shen, Xinlian
2015-01-01
WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs) in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III), as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.
Directory of Open Access Journals (Sweden)
Xinqi Fan
Full Text Available WRKY transcription factors are plant-specific, zinc finger-type transcription factors. The WRKY superfamily is involved in abiotic stress responses in many crops including cotton, a major fiber crop that is widely cultivated and consumed throughout the world. Salinity is an important abiotic stress that results in considerable yield losses. In this study, we identified 109 WRKY genes (GarWRKYs in a salt-tolerant wild cotton species Gossypium aridum from transcriptome sequencing data to elucidate the roles of these factors in cotton salt tolerance. According to their structural features, the predicted members were divided into three groups (Groups I-III, as previously described for Arabidopsis. Furthermore, 28 salt-responsive GarWRKY genes were identified from digital gene expression data and subjected to real-time quantitative RT-PCR analysis. The expression patterns of most GarWRKY genes revealed by this analysis are in good agreement with those revealed by RNA-Seq analysis. RT-PCR analysis revealed that 27 GarWRKY genes were expressed in roots and one was exclusively expressed in roots. Analysis of gene orthology and motif compositions indicated that WRKY members from Arabidopsis, rice and soybean generally shared the similar motifs within the same subgroup, suggesting they have the similar function. Overexpression-GarWRKY17 and -GarWRKY104 in Arabidopsis revealed that they could positively regulate salt tolerance of transgenic Arabidopsis during different development stages. The comprehensive data generated in this study provide a platform for elucidating the functions of WRKY transcription factors in salt tolerance of G. aridum. In addition, GarWRKYs related to salt tolerance identified in this study will be potential candidates for genetic improvement of cultivated cotton salt stress tolerance.
International Nuclear Information System (INIS)
Munis, M.F.H.; Tu, L.; Ziaf, K; Tan, J.; Deng, F.; Zhang, X.
2010-01-01
Salinity affects the germination, growth and ultimately the yield of cotton (Gossypium hirsutum L.) which demands reliable traits for the evaluation and selection of salt tolerant cultivars. Here, ten major osmotic, ionic and physiological parameters have been studied to distinguish the effect of salinity in two different cultivars of cotton. Plants were grown in hydroponic system and exposed to different salinity levels of NaCl followed by its recovery under non saline conditions. Data was recorded at three different stages i.e., before stress, after stress and after recovery for comparative study. Recovery assay proved to be very helpful in extracting reliable results. Both cultivars showed significantly different response to Na+ and K+ accumulation and phenotypically salt tolerant cultivar (Coker 312) accumulated less Na+ and more K+ in comparison with susceptible (Simian 3). Decrease in leaf area, seed germination and seedling growth were also conclusive to differentiate these cultivars. We also found other physiological parameters like relative leaf water content (RLWC), plant fresh-weight (PFW), plant dry-weight (PDW), relative growth rate (RGR) and stomatal behavior as good indicators of salinity but could not find their significant role to differentiate two closely relevant cultivars regarding salinity tolerance. Our studies revealed that proline accumulation and chlorophyll concentration are not significant to be used as accurate indicators to characterize the sensitivity of cotton cultivars to salinity. We found post-recovery analysis to be very useful in understanding the role and behavior of different indicators of salinity. (author)
Analyses of Fusarium wilt race 3 resistance in Upland cotton (Gossypium hirsutum L.).
Abdullaev, Alisher A; Salakhutdinov, Ilkhom B; Egamberdiev, Sharof Sh; Kuryazov, Zarif; Glukhova, Ludmila A; Adilova, Azoda T; Rizaeva, Sofiya M; Ulloa, Mauricio; Abdurakhmonov, Ibrokhim Y
2015-06-01
Fusarium wilt [Fusarium oxysporum f.sp. vasinfectum (FOV) Atk. Sny & Hans] represents a serious threat to cotton (Gossypium spp.) production. For the last few decades, the FOV pathogen has become a significant problem in Uzbekistan causing severe wilt disease and yield losses of G. hirsutum L. cultivars. We present the first genetic analyses of FOV race 3 resistance on Uzbek Cotton Germplasm with a series of field and greenhouse artificial inoculation-evaluations and inheritance studies. The field experiments were conducted in two different sites: the experimental station in Zangiota region-Environment (Env) 1 and the Institute of Cotton Breeding (Env-2, Tashkent province). The Env-1 was known to be free of FOV while the Env-2 was known to be a heavily FOV infested soil. In both (Env-1 and Env-2) of these sites, field soil was inoculated with FOV race 3. F2 and an F3 Upland populations ("Mebane B1" × "11970") were observed with a large phenotypic variance for plant survival and FOV disease severity within populations and among control or check Upland accessions. Wilt symptoms among studied F2 individuals and F3 families significantly differed depending on test type and evaluation site. Distribution of Mendelian rations of susceptible (S) and resistant (R) phenotypes were 1S:1R field Env-1 and 3S:1R field Env-2 in the F2 population, and 1S:3R greenhouse site in the F3 population. The different segregation distribution of the Uzbek populations may be explained by differences in FOV inoculum level and environmental conditions during assays. However, genetic analysis indicated a recessive single gene action under high inoculum levels or disease pressure for FOV race 3 resistance. Uzbek germplasm may be more susceptible than expected to FOV race 3, and sources of resistance to FOV may be limited under the FOV inoculum levels present in highly-infested fields making the breeding process more complex.
Vibha, J B; Shekhawat, N S; Mehandru, Pooja; Dinesh, Rachana
2014-01-01
An efficient and improved method for in vitro propagation of mature tree of Dalbergia sissoo, an ecologically and commercially important timber yielding species, has been developed through axillary shoot proliferation. Bud breaking occurred from nodal shoot segments derived from rejuvenated shoots produced during early spring from a 20-25-year-old lopped tree, on MS medium containing 8.88 μM benzylaminopurine (BAP). Multiple shoots differentiated (20-21shoots/node) on re-culture of explants on half-strength agar gelled amended MS medium with a combination of 2.22 μM of BAP and 0.002 μM of thidiazuron (TDZ) with 1.0 mM each of Ca(NO3)2, K2SO4, KCl, and NH4(SO4)2. The maximum shoot multiplication (29-30 shoots/node) was achieved on subculturing in the above mentioned but liquid medium. Furthermore, the problem of shoot tip necrosis and defoliation observed on solid medium were overcome by the use of liquid medium. Ex vitro rooting was achieved on soilrite after basal treatment of microshoots with 984 μM of indole-3-butyric acid (IBA) for 2 min. About 90 % microshoots were rooted on soilrite within 2-3 weeks under the greenhouse conditions. From 20 nodal shoot segments, about 435 hardened plants were acclimatized and transplanted. This is the first report for rapid in vitro propagation of mature trees of D. sissoo on liquid medium followed by ex vitro rooting.
Liu, Ji; Pang, Chaoyou; Wei, Hengling; Song, Meizhen; Meng, Yanyan; Ma, Jianhui; Fan, Shuli; Yu, Shuxun
2015-08-03
Male sterility is a common phenomenon in flowering plants, and it has been successfully developed in several crops by taking advantage of heterosis. Cotton (Gossypium hirsutum L.) is an important economic crop, used mainly for the production of textile fiber. Using a space mutation breeding technique, a novel photosensitive genetic male sterile mutant CCRI9106 was isolated from the wild-type upland cotton cultivar CCRI040029. To use CCRI9106 in cotton hybrid breeding, it is of great importance to study the molecular mechanisms of its male sterility. Here, histological and iTRAQ-facilitated proteomic analyses of anthers were performed to explore male sterility mechanisms of the mutant. Scanning and transmission electron microscopy of the anthers showed that the development of pollen wall in CCRI9106 was severely defective with a lack of exine formation. At the protein level, 6121 high-confidence proteins were identified and 325 of them showed differential expression patterns between mutant and wild-type anthers. The proteins up- or down-regulated in MT anthers were mainly involved in exine formation, protein degradation, calcium ion binding,etc. These findings provide valuable information on the proteins involved in anther and pollen development, and contribute to elucidate the mechanism of male sterility in upland cotton. Copyright © 2015. Published by Elsevier B.V.
Yuan, Daojun; Tang, Zhonghui; Wang, Maojun; Gao, Wenhui; Tu, Lili; Jin, Xin; Chen, Lingling; He, Yonghui; Zhang, Lin; Zhu, Longfu; Li, Yang; Liang, Qiqi; Lin, Zhongxu; Yang, Xiyan; Liu, Nian; Jin, Shuangxia; Lei, Yang; Ding, Yuanhao; Li, Guoliang; Ruan, Xiaoan; Ruan, Yijun; Zhang, Xianlong
2015-01-01
Gossypium hirsutum contributes the most production of cotton fibre, but G. barbadense is valued for its better comprehensive resistance and superior fibre properties. However, the allotetraploid genome of G. barbadense has not been comprehensively analysed. Here we present a high-quality assembly of the 2.57 gigabase genome of G. barbadense, including 80,876 protein-coding genes. The double-sized genome of the A (or At) (1.50 Gb) against D (or Dt) (853 Mb) primarily resulted from the expansion of Gypsy elements, including Peabody and Retrosat2 subclades in the Del clade, and the Athila subclade in the Athila/Tat clade. Substantial gene expansion and contraction were observed and rich homoeologous gene pairs with biased expression patterns were identified, suggesting abundant gene sub-functionalization occurred by allopolyploidization. More specifically, the CesA gene family has adapted differentially temporal expression patterns, suggesting an integrated regulatory mechanism of CesA genes from At and Dt subgenomes for the primary and secondary cellulose biosynthesis of cotton fibre in a “relay race”-like fashion. We anticipate that the G. barbadense genome sequence will advance our understanding the mechanism of genome polyploidization and underpin genome-wide comparison research in this genus. PMID:26634818
He, Qiuling; Jones, Don C.; Li, Wei; Xie, Fuliang; Ma, Jun; Sun, Runrun; Wang, Qinglian; Zhu, Shuijin; Zhang, Baohong
2016-01-01
The R2R3-MYB is one of the largest families of transcription factors, which have been implicated in multiple biological processes. There is great diversity in the number of R2R3-MYB genes in different plants. However, there is no report on genome-wide characterization of this gene family in cotton. In the present study, a total of 205 putative R2R3-MYB genes were identified in cotton D genome (Gossypium raimondii), that are much larger than that found in other cash crops with fully sequenced genomes. These GrMYBs were classified into 13 groups with the R2R3-MYB genes from Arabidopsis and rice. The amino acid motifs and phylogenetic tree were predicted and analyzed. The sequences of GrMYBs were distributed across 13 chromosomes at various densities. The results showed that the expansion of the G. Raimondii R2R3-MYB family was mainly attributable to whole genome duplication and segmental duplication. Moreover, the expression pattern of 52 selected GrMYBs and 46 GaMYBs were tested in roots and leaves under different abiotic stress conditions. The results revealed that the MYB genes in cotton were differentially expressed under salt and drought stress treatment. Our results will be useful for determining the precise role of the MYB genes during stress responses with crop improvement. PMID:27009386
Institute of Scientific and Technical Information of China (English)
Wenbo; Shan; Yanqin; Jiang; Jinlei; Han; Kai; Wang
2016-01-01
Cotton is the world’s most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45 S and 5S r DNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.
Directory of Open Access Journals (Sweden)
Wenbo Shan
2016-08-01
Full Text Available Cotton is the world's most important natural fiber crop. It is also a model system for studying polyploidization, genomic organization, and genome-size variation. Integrating the cytological characterization of cotton with its genetic map will be essential for understanding its genome structure and evolution, as well as for performing further genetic-map based mapping and cloning. In this study, we isolated a complete set of bacterial artificial chromosome clones anchored to each of the 52 chromosome arms of the tetraploid cotton Gossypium hirsutum. Combining these with telomere and centromere markers, we constructed a standard karyotype for the G. hirsutum inbred line TM-1. We dissected the chromosome arm localizations of the 45S and 5S rDNA and suggest a centromere repositioning event in the homoeologous chromosomes AT09 and DT09. By integrating a systematic karyotype analysis with the genetic linkage map, we observed different genome sizes and chromosomal structures between the subgenomes of the tetraploid cotton and those of its diploid ancestors. Using evidence of conserved coding sequences, we suggest that the different evolutionary paths of non-coding retrotransposons account for most of the variation in size between the subgenomes of tetraploid cotton and its diploid ancestors. These results provide insights into the cotton genome and will facilitate further genome studies in G. hirsutum.
Zahoor, Rizwan; Zhao, Wenqing; Dong, Haoran; Snider, John L; Abid, Muhammad; Iqbal, Babar; Zhou, Zhiguo
2017-10-01
To investigate whether potassium (K) application enhances the potential of cotton (Gossypium hirsutum L.) plants to maintain physiological functions during drought and recovery, low K-sensitive (Siza 3) and -tolerant (Simian 3) cotton cultivars were exposed to three K rates (0, 150, and 300 K 2 O kg ha -1 ) and either well-watered conditions or severe drought stress followed by a recovery period. Under drought stress, cotton plants showed a substantial decline in leaf water potential, stomatal conductance, photosynthetic rate, and the maximum and actual quantum yield of PSII, resulting in greater non-photochemical quenching and lipid peroxidation as compared to well-watered plants. However, plants under K application not only showed less of a decline in these traits but also displayed greater potential to recover after rewatering as compared to the plants without K application. Plants receiving K application showed lower lipid peroxidation, higher antioxidant enzyme activities, and increased proline accumulation as compared to plants without K application. Significant relationships between rates of photosynthetic recovery and K application were observed. The cultivar Siza 3 exhibited a more positive response to K application than Simian 3. The results suggest that K application enhances the cotton plant's potential to maintain functionality under drought and facilitates recovery after rewatering. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Danaë M A Rozendaal
Full Text Available In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012. Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in
Rozendaal, Danaë M A; Kobe, Richard K
2016-01-01
In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012). Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in temperate closed
International Nuclear Information System (INIS)
Vasti, S.M.
1981-06-01
Disease resistant, high yielding and higher quality cotton varieties were developed. 42 interspecific hybrid progenies of earlier crosses between Gossypium barbadense and Gossypium tomentosum or Gossypium barbadense and Gossypium hirsutum were included. Out of these, 22 progenies in F 3 generation were irradiated by gamma radiation doses of 20 and 25 kR. A list is given of interspecific hybrid progenies, as are the lists of boll rot susceptible and resistant plants in the irradiated and non-irradiated populations and/or successful crosses made between 1977 and 1978
Crown condition dynamics of oak in southern Sweden 1988-1999.
Drobyshev, Igor; Anderson, Stefan; Sonesson, Kerstin
2007-11-01
Crown defoliation of oak (Quercus robur and Q. petraea) was analysed in 808 trees during three forest condition surveys (1988, 1993, and 1999) in the southern Sweden. From 1988 to 1999 crown defoliation increased by more than 20%. Changes in crown defoliation were related to the pH in the upper 20-30 cm of the mineral soils, which was closely connected to other measures of soil fertility (cation exchange capacity, CEC and C/N ratio). Trees growing on soils with a high pH (> or =4.00, in BaCl2 filtrate), high CEC and low C/N ratio had significantly lower crown defoliation than trees growing on more acid soils (pH trees with respect to crown defoliation, indicating that decline in crown condition was not due to an age-related increase in crown transparency. Considering only trees younger than 100 years, a significant interaction was observed between changes in crown defoliation and soil pH. Trees younger than 100 years old growing on more acidic soils had a greater increase in crown transparency than trees on more basic soils between 1988 and 1999. Trees > or =100 years old had significantly higher defoliation on more acidic than on more basic soils, however defoliation dynamics of these trees over 1988-99 was not related to soil acidity. Two biotic agents (insect and fungal leaf infections) evaluated in this study did not prove to be important drivers of defoliation dynamics.
Genetic variation and heritability for cotton seed, fiber and oil traits in gossypium hirsutum
International Nuclear Information System (INIS)
Khan, N.U.; Farhatullah; Batool, S.; Makhdoom, K.; Marwat, K.B.; Hassan, G.; Ahmad, W.; Khan, H.U.
2010-01-01
The research work pertaining to the study of genetic variability, heritability, genetic gain and correlation for cottonseed, fiber and cottonseed oil % in Gossypium hirsutum cultivars was conducted during 2005 at NWFP Agricultural University Peshawar, Pakistan. Analysis of variance manifested highly significant differences among the genotypes for all the traits except seeds per locule. Genetic potential range of eight cotton cultivars for different parameters was recorded i.e. seeds locule-1 (6.33 to 6.60), seeds boll-1 (26.10 to 28.47), seed index (8.61 to 9.69 g), lint index (5.35 to 6.05 g), lint % (35.17 to 38.13 %), seed cotton yield (1200 to 2450 kg ha/sup -1/) and cottonseed oil % (27.52 to 30.15%). Genetic variances were found almost greater than the environmental variances for all the traits except seeds locule-1 and seed index. High broad sense heritability and selection response were also formulated for seeds boll-1 (0.67, 0.84), seed index (0.77, 0.47 g), lint index (0.96, 0.33 g), lint % (0.96, 1.66 %), seed cotton yield (0.98, 643.16 kg) and cottonseed oil % (0.87, 1.28 %), respectively. Correlation of yield with other traits was found positive for majority of traits except seeds locule-1 and cotton seed oil %. Seed cotton yield is our ultimate goal in growing cotton besides lint %. Highest seed cotton yield was recorded in CIM-499 followed by CIM-473, CIM-496 and CIM-506 and were also found as the second and third top scoring genotypes for seeds per boll, seed index, lint % and cottonseed oil %. Cultivar SLH-279 performed better for lint index, lint % and oil %. This type of correlation is rarely found and ultra desirable by the cotton breeders and a little genetic gain in seed and lint traits, and oil content is a great accomplishment. (author)
Snider, John L; Oosterhuis, Derrick M; Collins, Guy D; Pilon, Cristiane; Fitzsimons, Toby R
2013-03-15
Previous investigations have demonstrated that photosystem II (PSII) thermostability acclimates to prior exposure to heat and drought, but contrasting results have been reported for cotton (Gossypium hirsutum). We hypothesized that PSII thermotolerance in G. hirsutum would acclimate to environmental conditions during the growing season and that there would be differences in PSII thermotolerance between commercially-available U.S. cultivars. To this end, three cotton cultivars were grown under dryland conditions in Tifton Georgia, and two under irrigated conditions in Marianna Arkansas. At Tifton, measurements included PSII thermotolerance (T15, the temperature causing a 15% decline in maximum quantum yield), leaf temperatures, air temperatures, midday (1200 to 1400h) leaf water potentials (ΨMD), leaf-air vapor pressure deficit (VPD), actual quantum yield (ΦPSII) and electron transport rate through PSII (ETR) on three sample dates. At Marianna, T15 was measured on two sample dates. Optimal air and leaf temperatures were observed on all sample dates in Tifton, but PSII thermotolerance increased with water deficit conditions (ΨMD=-3.1MPa), and ETR was either unaffected or increased under water-stress. Additionally, T15 for PHY 499 was ∼5°C higher than for the other cultivars examined (DP 0912 and DP 1050). The Marianna site experienced more extreme high temperature conditions (20-30 days Tmax≥35°C), and showed an increase in T15 with higher average Tmax. When average T15 values for each location and sample date were plotted versus average daily Tmax, strong, positive relationships (r(2) from .954 to .714) were observed between Tmax and T15. For all locations T15 was substantially higher than actual field temperature conditions. We conclude that PSII thermostability in G. hirsutum acclimates to pre-existing environmental conditions; PSII is extremely tolerant to high temperature and water-deficit stress; and differences in PSII thermotolerance exist between
Phase-dependent outbreak dynamics of geometrid moth linked to host plant phenology.
Jepsen, Jane U; Hagen, Snorre B; Karlsen, Stein-Rune; Ims, Rolf A
2009-12-07
Climatically driven Moran effects have often been invoked as the most likely cause of regionally synchronized outbreaks of insect herbivores without identifying the exact mechanism. However, the degree of match between host plant and larval phenology is crucial for the growth and survival of many spring-feeding pest insects, suggesting that a phenological match/mismatch-driven Moran effect may act as a synchronizing agent. We analyse the phase-dependent spatial dynamics of defoliation caused by cyclically outbreaking geometrid moths in northern boreal birch forest in Fennoscandia through the most recent massive outbreak (2000-2008). We use satellite-derived time series of the prevalence of moth defoliation and the onset of the growing season for the entire region to investigate the link between the patterns of defoliation and outbreak spread. In addition, we examine whether a phase-dependent coherence in the pattern of spatial synchrony exists between defoliation and onset of the growing season, in order to evaluate if the degree of matching phenology between the moth and their host plant could be the mechanism behind a Moran effect. The strength of regional spatial synchrony in defoliation and the pattern of defoliation spread were both highly phase-dependent. The incipient phase of the outbreak was characterized by high regional synchrony in defoliation and long spread distances, compared with the epidemic and crash phase. Defoliation spread was best described using a two-scale stratified spread model, suggesting that defoliation spread is governed by two processes operating at different spatial scale. The pattern of phase-dependent spatial synchrony was coherent in both defoliation and onset of the growing season. This suggests that the timing of spring phenology plays a role in the large-scale synchronization of birch forest moth outbreaks.
Darrah, Abigail J.; van Riper, Charles
2018-01-01
Biocontrol of invasive tamarisk (Tamarix spp.) in the arid Southwest using the introduced tamarisk beetle (Diorhabda elongata) has been hypothesized to negatively affect some breeding bird species, but no studies to date have documented the effects of beetle-induced defoliation on riparian bird abundance. We assessed the effects of tamarisk defoliation by monitoring defoliation rates, changes in vegetation composition, and changes in density of six obligate riparian breeding bird species at two sites along the Dolores River in Colorado following the arrival of tamarisk beetles. We conducted bird point counts from 2010 to 2014 and modeled bird density as a function of native vegetation density and extent of defoliation using hierarchical distance sampling. Maximum annual defoliation decreased throughout the study period, peaking at 32–37% in 2009–2010 and dropping to 0.5–15% from 2011–2014. Stem density of both tamarisk and native plants declined throughout the study period until 2014. Density of all bird species declined throughout most of the study, with Song Sparrow disappearing from the study sites after 2011. Blue Grosbeak, Yellow-breasted Chat, and Yellow Warbler densities were negatively related to defoliation in the previous year, while Lazuli Bunting exhibited a positive relationship with defoliation. These findings corroborate earlier predictions of species expected to be sensitive to defoliation as a result of nest site selection. Tamarisk defoliation thus had short-term negative impacts on riparian bird species; active restoration may be needed to encourage the regrowth of native riparian vegetation, which in the longer-term may result in increased riparian bird density.
Regeneration and genetic transformation of cowpea (Vigna unguiculata Walp.)
Energy Technology Data Exchange (ETDEWEB)
Filippone, E; Colucci, G; Ciardi, F; Monti, L [Department of Agronomy and Plant Genetics, Univ. of Naples Federico 11, Portici (Italy)
1997-07-01
Regeneration of cowpea (Vigna unguiculata Walp.) was achieved through massive bud formation induced in apical and lateral meristems by the herbicide Thidiazuron (TDZ). The effect of TDZ (5, 10, or 20 {mu}M) was tested in vitro on four different cowpea genotypes. Thidiazuron, even at the highest concentration, had no effect on seed germination. After one month of culture, multiple bud cluster formation was observed in all genotypes tested; about 80% of shoot apices regenerated multiple buds, whilst only 34% of cotyledonary nodes behaved in the same way. Histology of regenerating multiple bud clusters revealed that regeneration initiated from pre-existing meristems in the apex and cotyledonary node. Thidiazuron at 10 {mu}M appeared to be the best concentration to produce clusters with high number of buds, ranging from 5 to 10. Shoot elongation occurred only on MS medium without TDZ. On the same medium, 75% of elongated shoots rooted. For genetic transformation of cowpea, a direct DNA transfer methods in plants under in vivo conditions was tested by electroporation of plasmid DNA into the nodal meristematic cells. Some transformed plants were obtained, and produced T{sub 1} transformed progenies; their transgenic nature was confirmed by Southern analysis. (author). 21 refs, 2 figs, 3 tabs.
Regeneration and genetic transformation of cowpea (Vigna unguiculata Walp.)
International Nuclear Information System (INIS)
Filippone, E.; Colucci, G.; Ciardi, F.; Monti, L.
1997-01-01
Regeneration of cowpea (Vigna unguiculata Walp.) was achieved through massive bud formation induced in apical and lateral meristems by the herbicide Thidiazuron (TDZ). The effect of TDZ (5, 10, or 20 μM) was tested in vitro on four different cowpea genotypes. Thidiazuron, even at the highest concentration, had no effect on seed germination. After one month of culture, multiple bud cluster formation was observed in all genotypes tested; about 80% of shoot apices regenerated multiple buds, whilst only 34% of cotyledonary nodes behaved in the same way. Histology of regenerating multiple bud clusters revealed that regeneration initiated from pre-existing meristems in the apex and cotyledonary node. Thidiazuron at 10 μM appeared to be the best concentration to produce clusters with high number of buds, ranging from 5 to 10. Shoot elongation occurred only on MS medium without TDZ. On the same medium, 75% of elongated shoots rooted. For genetic transformation of cowpea, a direct DNA transfer methods in plants under in vivo conditions was tested by electroporation of plasmid DNA into the nodal meristematic cells. Some transformed plants were obtained, and produced T 1 transformed progenies; their transgenic nature was confirmed by Southern analysis. (author). 21 refs, 2 figs, 3 tabs
Nagler, Pamela; Glenn, Edward P.
2013-01-01
Tamarix leaf beetles (Diorhabda carinulata) have been widely released on western United States rivers to control introduced shrubs in the genus Tamarix, with the goals of saving water through removal of an assumed high water-use plant, and of improving habitat value by removing a competitor of native riparian trees. We review recent studies addressing three questions: (1) to what extent are Tamarix weakened or killed by recurrent cycles of defoliation; (2) can significant water salvage be expected from defoliation; and (3) what are the effects of defoliation on riparian ecology, particularly on avian habit? Defoliation has been patchy at many sites, and shrubs at some sites recover each year even after multiple years of defoliation. Tamarix evapotranspiration (ET) is much lower than originally assumed in estimates of potential water savings, and are the same or lower than possible replacement plants. There is concern that the endangered southwestern willow flycatcher (Empidonax trailli extimus) will be negatively affected by defoliation because the birds build nests early in the season when Tamarix is still green, but are still on their nests during the period of summer defoliation. Affected river systems will require continued monitoring and development of adaptive management practices to maintain or enhance riparian habitat values. Multiplatform remote sensing methods are playing an essential role in monitoring defoliation and rates of ET on affected river systems.
Portes, Maria Teresa; Figueiredo-Ribeiro, Rita de Cássia L; de Carvalho, Maria Angela M
2008-10-09
In addition to the storage function, fructans in Asteraceae from floras with seasonal growth have been associated with drought and freezing tolerance. Vernonia herbacea, native of the Brazilian Cerrado, bears underground reserve organs, rhizophores, accumulating inulin-type fructans. The rhizophore is a cauline branched system with positive geotropic growth, with the apex (distal region) presenting younger tissues; sprouting of new shoots occurs by development of buds located on the opposite end (proximal region). Plants induced to sprouting by excision of the aerial organs present increased 1-fructan exohydrolase (1-FEH) activity in the proximal region, while plants at the vegetative stage present high 1-sucrose:sucrose fructosyltransferase (1-SST) in the distal region. The aim of the present study was to analyze how low temperature (5 degrees C) could affect fructan-metabolizing enzymes and fructan composition in the different regions of the rhizophores of intact and excised plants. 1-SST and 1-fructan:fructan fructosyltransferase (1-FFT) were higher in the distal region decreasing towards the proximal region in intact plants at the vegetative phase, and were drastically diminished when cold and/or excision were imposed. In contrast, 1-FEH increased in the proximal region of treated plants, mainly in excised plants subjected to cold. The ratio fructo-oligo to fructo-polysaccharides was significantly higher in plants exposed to low temperature (1.17 in intact plants and 1.64 in excised plants) than in plants exposed to natural temperature conditions (0.84 in intact vegetative plants and 0.58 in excised plants), suggesting that oligosaccharides are involved in the tolerance of plants to low temperature via 1-FEH, in addition to 1-FFT. Principal component analysis indicated different response mechanisms in fructan metabolism under defoliation and low temperature, which could be interpreted as part of the strategies to undergo unfavorable environmental conditions
Directory of Open Access Journals (Sweden)
Rafael Anzanello
2011-07-01
2006/2007 harvesting. The experiment was disposed in a randomized block design, with four replications and four plants per plot. The following treatments were tested: T1 (no defoliation, T2 (removal of leaves located in the opposite side of the grapes, T3 (removal of leaves located under the grapes and T4 (removal of leaves located under and in the opposite side of the grapes. The Vitis labrusca received an additional treatment (T5 consisting of leaves removed above the grapes. These treatments were applied during the change of berries color for Concord, Cabernet Sauvignon and Merlot grapes and in the beginning of berries softening for Niagara Branca grape. After the harvesting, the grapevine production, cluster weight, total soluble solids, total titratable acidity and pH were evaluated. It was observed that the defoliation until the grapes height did not influence the quantity and quality of grapes. However, when the defoliation was carried out above the clusters, there was a delay in the maturation of american grapes. This condition shows that is not necessary a selective desfolation until the clusters height on grapevines, when it is realized during the initial fruit ripening phase.
Directory of Open Access Journals (Sweden)
B. Deepa
2017-07-01
Full Text Available The organic solvent extracts from the seeds of Erythrina indica were tested for their insecticidal action against Hyblaea puera, the most important defoliator pest of teak. The larvicidal activity of the petroleum ether, chloroform, methanol, ethyl alcohol, ethyl acetate, acetone and water extracts from the seeds of E. indica on the 3rd instar larvae of H. puera showed 100% mortality even with least concentration (0.25%. The ovicidal activity was exhibited by chloroform and ethyl acetate extract. Both the extracts exhibited highest egg hatch inhibition (56% at highest concentration (2%. The least LC50 (1.15% shows that ethyl acetate extract is better than chloroform extract (1.78. Two compounds were isolated from the ethyl acetate extract of the seeds of Erythrina indica by column chromatography. The compounds were identified using HPLC, GC MS, and NMR. Compound 1 was a mixture of linoleic acid and oleic acid. Compound 2 was a mixture of linoleic acid and oleic acid ester with a glycerol unit attached to it. Compounds 1 and 2 were biologically active and exhibited potent insecticidal activity against the 3rd instar larvae of H. puera. The result showed that Compound 2 isolated from E. indica exhibited highest mortality (72% at concentration (0.125%. At highest concentration (0.5% highest mortality (92% was exhibited by Compound 2 which on comparison is on par with the Neemark (Azadirachtin exhibiting highest mortality (100%. The study is complementary with earliar works and proves that the seeds of E. indica has immense potential to be utilized as botanical insecticide.
Directory of Open Access Journals (Sweden)
Di Chen
Full Text Available Speciation is always a contentious and challenging issue following with the presence of gene flow. In Gossypium, there are many valuable resources and wild diploid cotton especially C and B genome species possess some excellent traits which cultivated cotton always lacks. In order to explore character transferring rule from wild cotton to upland tetraploid cotton, the [G. capitis-viridis × (G. hirsutum × G. australe2] triple hybrid was synthesized by interspecies hybridization and chromosome doubling. Morphology comparisons were measured among this hybrid and its parents. It showed that trispecific hybrid F1 had some intermediate morphological characters like leaf style between its parents and some different characters from its parents, like crawl growth characteristics and two kind flower color. It is highly resistant to insects comparing with other cotton species by four year field investigation. By cytogenetic analysis, triple hybrid was further confirmed by meiosis behavior of pollen mother cells. Comparing with regular meiosis of its three parents, it was distinguished by the occurrence of polyads with various numbers of unbalanced microspores and finally generating various abnormal pollen grains. All this phenomenon results in the sterility of this hybrid. This hybrid was further identified by SSR marker from DNA molecular level. It showed that 98 selected polymorphism primers amplified effective bands in this hybrids and its parents. The genetic proportion of three parents in this hybrid is 47.8% from G. hirsutum, 14.3% from G. australe, 7.0% from G. capitis-viridis, and 30.9% recombination bands respectively. It was testified that wild genetic material has been transferred into cultivated cotton and this new germplasm can be incorporated into cotton breeding program.
Interactive effect of herbivory and competition on the invasive plant Mikania micrantha.
Li, Junmin; Xiao, Tao; Zhang, Qiong; Dong, Ming
2013-01-01
A considerable number of host-specific biological control agents fail to control invasive plants in the field, and exploring the mechanism underlying this phenomenon is important and helpful for the management of invasive plants. Herbivory and competition are two of the most common biotic stressors encountered by invasive plants in their recipient communities. We predicted that the antagonistic interactive effect between herbivory and competition would weaken the effect of herbivory on invasive plants and result in the failure of herbivory to control invasive plants. To examine this prediction, thus, we conducted an experiment in which both invasive Mikania micrantha and native Coix lacryma-job i were grown together and subjected to herbivory-mimicking defoliation. Both defoliation and competition had significantly negative effects on the growth of the invader. However, the negative effect of 75% respective defoliation on the above- and below-ground biomass of Mikania micrantha was alleviated by presence of Coix lacryma-jobi. The negative effect of competition on the above- and below-ground biomass was equally compensated at 25%, 50% and 100% defoliation and overcompensated at 75% defoliation. The interactive effect was antagonistic and dependent on the defoliation intensity, with the maximum effect at 75% defoliation. The antagonistic interaction between defoliation and competition appears to be able to release the invader from competition, thus facilitating the invasiveness of Mikania, a situation that might make herbivory fail to inhibit the growth of invasive Mikania in the invaded community.
Micropropagation of PLUCHEA LANCEOLATA (Oliver
Directory of Open Access Journals (Sweden)
M. Kher Mafatlal
2014-09-01
Full Text Available Pluchea lanceolata is an important medicinal plant of Asteraceae family known for its anti-arthritic and anti-inflammatory activity. A protocol was established for micropropagation of P. lanceolata using nodal explants. Nodal explants were inoculated onto Murashige and Skoog (1962 - MS medium supple–mented with 6-benzylaminopurine (BAP, kinetin (Kin, thidiazuron (TDZ and 2iP (2-isopentenyladenine at various concentrations (0.0, 0.5, 1.0, 1.5 and 2.0 mg·dm-3. The highest multiplication rate was obtained for nodal explants cultured on MS medium, supplemented with 0.5 mg·dm-3 thidiazuron (TDZ. In vitro raised shoots were successfully rooted on ½ mineral salt concentration of MS medium supplemented with 1.0 mg dm-3 IBA.
Artico, Sinara; Ribeiro-Alves, Marcelo; Oliveira-Neto, Osmundo Brilhante; de Macedo, Leonardo Lima Pepino; Silveira, Sylvia; Grossi-de-Sa, Maria Fátima; Martinelli, Adriana Pinheiro; Alves-Ferreira, Marcio
2014-10-04
Cotton is a major fibre crop grown worldwide that suffers extensive damage from chewing insects, including the cotton boll weevil larvae (Anthonomus grandis). Transcriptome analysis was performed to understand the molecular interactions between Gossypium hirsutum L. and cotton boll weevil larvae. The Illumina HiSeq 2000 platform was used to sequence the transcriptome of cotton flower buds infested with boll weevil larvae. The analysis generated a total of 327,489,418 sequence reads that were aligned to the G. hirsutum reference transcriptome. The total number of expressed genes was over 21,697 per sample with an average length of 1,063 bp. The DEGseq analysis identified 443 differentially expressed genes (DEG) in cotton flower buds infected with boll weevil larvae. Among them, 402 (90.7%) were up-regulated, 41 (9.3%) were down-regulated and 432 (97.5%) were identified as orthologues of A. thaliana genes using Blastx. Mapman analysis of DEG indicated that many genes were involved in the biotic stress response spanning a range of functions, from a gene encoding a receptor-like kinase to genes involved in triggering defensive responses such as MAPK, transcription factors (WRKY and ERF) and signalling by ethylene (ET) and jasmonic acid (JA) hormones. Furthermore, the spatial expression pattern of 32 of the genes responsive to boll weevil larvae feeding was determined by "in situ" qPCR analysis from RNA isolated from two flower structures, the stamen and the carpel, by laser microdissection (LMD). A large number of cotton transcripts were significantly altered upon infestation by larvae. Among the changes in gene expression, we highlighted the transcription of receptors/sensors that recognise chitin or insect oral secretions; the altered regulation of transcripts encoding enzymes related to kinase cascades, transcription factors, Ca2+ influxes, and reactive oxygen species; and the modulation of transcripts encoding enzymes from phytohormone signalling pathways. These
Directory of Open Access Journals (Sweden)
José C. Zanuncio
2009-03-01
Full Text Available Euselasia eucerus (Hewitson, 1872 (Lepidoptera: Riodinidae is a Brazilian native species commonly found in Eucalyptus plantations. Biotic mortality factors of this defoliator were studied in a Eucalyptus urophylla plantation in Minas Gerais State, Brazil aiming to identify natural enemies and their impact on this insect. Euselasia eucerus had biotic mortality factors during all development stages. The most important were Trichogramma maxacalii Voegelé and Pointel, 1980 (Hymenoptera: Trichogrammatidae during egg stage (48.9%, a tachinid fly (Diptera: Tachinidae during larval stages (10% and Itoplectis sp. (Hymenoptera: Ichneumonidae during pupal stage (52.2%. The parasitism rate was higher in the basal part of the plant canopy (37.8%.Euselasia eucerus (Hewitson, 1872 (Lepidoptera: Riodinidae é uma espécie brasileira nativa, comumente encontrada em plantios de Eucalyptus. Um estudo da mortalidade por fatores bióticos desse desfolhador foi feito em um plantio de Eucalyptus urophylla no Estado de Minas Gerais, Brasil, com o objetivo de identificar os inimigos naturais e seu impacto sobre esse lepidóptero. Euselasia eucerus possui fatores bióticos de mortalidade durante todas as suas fases de desenvolvimento. Os mais importantes foram Trichogramma maxacalii Voegelé e Pointel, 1980 (Hymenoptera: Trichogrammatidae durante a fase de ovo (48,9%, um Diptera: Tachinidae durante a fase de larva (10% e Itoplectis sp. (Hymenoptera: Ichneumonidae durante a fase pupal (52,2%. A taxa de parasitismo foi mais elevada na parte basal de plantas de eucalipto (37,8%.
A forester's look at the application of image manipulation techniques to multitemporal Landsat data
Williams, D. L.; Stauffer, M. L.; Leung, K. C.
1979-01-01
Registered, multitemporal Landsat data of a study area in central Pennsylvania were analyzed to detect and assess changes in the forest canopy resulting from insect defoliation. Images taken July 19, 1976, and June 27, 1977, were chosen specifically to represent forest canopy conditions before and after defoliation, respectively. Several image manipulation and data transformation techniques, developed primarily for estimating agricultural and rangeland standing green biomass, were applied to these data. The applicability of each technique for estimating the severity of forest canopy defoliation was then evaluated. All techniques tested had highly correlated results. In all cases, heavy defoliation was discriminated from healthy forest. Areas of moderate defoliation were confused with healthy forest on northwest (NW) aspects, but were distinct from healthy forest conditions on southeast (SE)-facing slopes.
Chen, Eryong; Zhang, Xueyan; Yang, Zhaoen; Wang, Xiaoqian; Yang, Zuoren; Zhang, Chaojun; Wu, Zhixia; Kong, Depei; Liu, Zhao; Zhao, Ge; Butt, Hamama Islam; Zhang, Xianlong; Li, Fuguang
2017-06-01
HD-ZIP IV proteins belong to the homeodomain-leucine zipper (HD-ZIP) transcription factor family and are involved in trichome development and drought stress in plants. Although some functions of the HD-ZIP IV group are well understood in Arabidopsis, little is known about their function in cotton. In this study, HD-ZIP genes were identified from three Gossypium species (G. arboreum, G. raimondii and G. hirsutum) and clustered into four families (HD-ZIP I, II, III and IV) to separate HD-ZIP IV from the other three families. Systematic analyses of phylogeny, gene structure, conserved domains, and expression profiles in different plant tissues and the expression patterns under osmotic stress in leaves were further conducted in G. arboreum. More importantly, ectopic overexpression of GaHDG11, a representative of the HD-ZIP IV family, confers enhanced osmotic tolerance in transgenic Arabidopsis plants, possibly due to elongated primary root length, lower water loss rates, high osmoprotectant proline levels, significant levels of antioxidants CAT, and/or SOD enzyme activity with reduced levels of MDA. Taken together, these observations may lay the foundation for future functional analysis of cotton HD-ZIP IV genes to unravel their biological roles in cotton.
Hulse-Kemp, Amanda M; Ashrafi, Hamid; Zheng, Xiuting; Wang, Fei; Hoegenauer, Kevin A; Maeda, Andrea B V; Yang, S Samuel; Stoffel, Kevin; Matvienko, Marta; Clemons, Kimberly; Udall, Joshua A; Van Deynze, Allen; Jones, Don C; Stelly, David M
2014-10-30
Cotton (Gossypium spp.) is the largest producer of natural fibers for textile and is an important crop worldwide. Crop production is comprised primarily of G. hirsutum L., an allotetraploid. However, elite cultivars express very small amounts of variation due to the species monophyletic origin, domestication and further bottlenecks due to selection. Conversely, wild cotton species harbor extensive genetic diversity of prospective utility to improve many beneficial agronomic traits, fiber characteristics, and resistance to disease and drought. Introgression of traits from wild species can provide a natural way to incorporate advantageous traits through breeding to generate higher-producing cotton cultivars and more sustainable production systems. Interspecific introgression efforts by conventional methods are very time-consuming and costly, but can be expedited using marker-assisted selection. Using transcriptome sequencing we have developed the first gene-associated single nucleotide polymorphism (SNP) markers for wild cotton species G. tomentosum, G. mustelinum, G. armourianum and G. longicalyx. Markers were also developed for a secondary cultivated species G. barbadense cv. 3-79. A total of 62,832 non-redundant SNP markers were developed from the five wild species which can be utilized for interspecific germplasm introgression into cultivated G. hirsutum and are directly associated with genes. Over 500 of the G. barbadense markers have been validated by whole-genome radiation hybrid mapping. Overall 1,060 SNPs from the five different species have been screened and shown to produce acceptable genotyping assays. This large set of 62,832 SNPs relative to cultivated G. hirsutum will allow for the first high-density mapping of genes from five wild species that affect traits of interest, including beneficial agronomic and fiber characteristics. Upon mapping, the markers can be utilized for marker-assisted introgression of new germplasm into cultivated cotton and in
Wei, Hengling; Li, Wei; Sun, Xiwei; Zhu, Shuijin; Zhu, Jun
2013-01-01
Plant disease resistance genes are a key component of defending plants from a range of pathogens. The majority of these resistance genes belong to the super-family that harbors a Nucleotide-binding site (NBS). A number of studies have focused on NBS-encoding genes in disease resistant breeding programs for diverse plants. However, little information has been reported with an emphasis on systematic analysis and comparison of NBS-encoding genes in cotton. To fill this gap of knowledge, in this study, we identified and investigated the NBS-encoding resistance genes in cotton using the whole genome sequence information of Gossypium raimondii. Totally, 355 NBS-encoding resistance genes were identified. Analyses of the conserved motifs and structural diversity showed that the most two distinct features for these genes are the high proportion of non-regular NBS genes and the high diversity of N-termini domains. Analyses of the physical locations and duplications of NBS-encoding genes showed that gene duplication of disease resistance genes could play an important role in cotton by leading to an increase in the functional diversity of the cotton NBS-encoding genes. Analyses of phylogenetic comparisons indicated that, in cotton, the NBS-encoding genes with TIR domain not only have their own evolution pattern different from those of genes without TIR domain, but also have their own species-specific pattern that differs from those of TIR genes in other plants. Analyses of the correlation between disease resistance QTL and NBS-encoding resistance genes showed that there could be more than half of the disease resistance QTL associated to the NBS-encoding genes in cotton, which agrees with previous studies establishing that more than half of plant resistance genes are NBS-encoding genes. PMID:23936305
Fawzy, Manal; Nasr, Mahmoud; Nagy, Heba; Helmi, Shacker
2018-02-01
In this study, batch biosorption experiments were conducted to determine the removal efficiency of Cd(II) ion from aqueous solutions by Gossypium barbadense waste. The biosorbent was characterized by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM) connected with energy dispersive X-ray (EDX). The sorption mechanism was described by complexation/chelation of Cd 2+ with the functional groups of O-H, C=O, -COO-, and C-O, as well as, cation-exchange with Mg 2+ and K + . At initial Cd(II) ion concentration (C o ), 50 mg/L, the adsorption equilibrium of 89.2% was achieved after 15 min under the optimum experimental factors of pH 6.0, biosorbent dosage 10 g/L, and particle diameter 0.125-0.25 mm. Both Langmuir and Freundlich models fitted well to the sorption data, suggesting the co-existence of monolayer coverage along with heterogenous surface biosorption. Artificial neural network (ANN) with a structure of 5-10-1 was performed to predict the Cd(II) ion removal efficiency. The ANN model provided high fit (R 2 0.923) to the experimental data and indicated that C o was the most influential input. A pure-quadratic model was developed to determine the effects of experimental factors on Cd(II) ion removal efficiency, which indicated the limiting nature of pH and biosorbent dosage on Cd(II) adsorption. Based on the regression model (R 2 0.873), the optimum experimental factors were pH 7.61, biosorbent dosage 24.74 g/L, particle size 0.125-0.25 mm, and adsorption time 109.77 min, achieving Cd 2+ removal of almost 100% at C o 50 mg/L.
Directory of Open Access Journals (Sweden)
Jinhuan Pang
Full Text Available Gossypiumbarbadense is a cultivated cotton species and possesses many desirable traits, including high fiber quality and resistance to pathogens, especially Verticilliumdahliae (a devastating pathogen of Gossypium hirsutum, the main cultivated species. These elite traits are difficult to be introduced into G. hirsutum through classical breeding methods. In addition, genetic transformation of G. barbadense has not been successfully performed. It is therefore important to develop methods for evaluating the function and molecular mechanism of genes in G. barbadense. In this study, we had successfully introduced a virus-induced gene silencing (VIGS system into three cultivars of G. barbadense by inserting marker genes into the tobacco rattle virus (TRV vector. After we optimized the VIGS conditions, including light intensity, photoperiod, seedling age and Agrobacterium strain, 100% of plants agroinfiltrated with the GaPDS silencing vector showed white colored leaves. Three other marker genes, GaCLA1, GaANS and GaANR, were employed to further test this VIGS system in G. barbadense. The transcript levels of the endogenous genes in the silenced plants were reduced by more than 99% compared to control plants; these plants presented phenotypic symptoms 2 weeks after inoculation. We introduced a fusing sequence fragment of GaPDS and GaANR gene silencing vectors into a single plant, which resulted in both photobleaching and brownish coloration. The extent of silencing in plants agroinfiltrated with fusing two-gene-silencing vector was consistent with plants harboring a single gene silencing vector. The development of this VIGS system should promote analysis of gene function in G. barbadense, and help to contribute desirable traits for breeding of G. barbadense and G. hirsutum.
Directory of Open Access Journals (Sweden)
Tingting Lu
2017-08-01
Full Text Available Calcineurin B-like (CBL proteins, as calcium sensors, play pivotal roles in plant responses to diverse abiotic stresses and in growth and development through interaction with CBL-interacting protein kinases (CIPKs. However, knowledge about functions and evolution of CBLs in Gossypium plants is scarce. Here, we conducted a genome-wide survey and identified 13, 13 and 22 CBL genes in the progenitor diploid Gossypium arboreum and Gossypium raimondii, and the cultivated allotetraploid Gossypium hirsutum, respectively. Analysis of physical properties, chromosomal locations, conserved domains and phylogeny indicated rather conserved nature of CBLs among the three Gossypium species. Moreover, these CBLs have closer genetic evolutionary relationship with the CBLs from cocoa than with those from other plants. Most CBL genes underwent evolution under purifying selection in the three Gossypium plants. Additionally, nearly all G. hirsutum CBL (GhCBL genes were expressed in the root, stem, leaf, flower and fiber. Many GhCBLs were preferentially expressed in the flower while several GhCBLs were mainly expressed in roots. Expression patterns of GhCBL genes in response to potassium deficiency were also studied. The expression of most GhCBLs were moderately induced in roots after treatments with low-potassium stress. Yeast two-hybrid experiments indicated that GhCBL1-2, GhCBL1-3, GhCBL4-4, GhCBL8, GhCBL9 and GhCBL10-3 interacted with GhCIPK23, respectively. Our results provided a comprehensive view of the CBLs and valuable information for researchers to further investigate the roles and functional mechanisms of the CBLs in Gossypium.
Bekircan, Tuba; Yaşar, Ahmet; Yıldırım, Sercan; Sökmen, Münevver; Sökmen, Atalay
2018-03-01
An efficient in vitro multiplication protocol was designed to Thymus leucotrichus , a subshrub and perennial herb growing naturally in the Northwest of Turkey. Of all basal media studied, Murashige and Skoog medium was found to be superior to the others, providing higher shoot formation and the maximum shoot length. Varying concentrations of cytokinins, i.e., 6-benzyladenine, thidiazuron, 2-isopentenyladenine and kinetin were supplemented in the nutrient media to observe their effects on shoot development and biomass. Rosmarinic acid content and volatile compositions of both naturally growing plants and in vitro multiplied plantlets were also evaluated. 6-benzyladenine (1.0 mg/L) and kinetin (0.5 mg/L) were found to be optimum for shoot number and shoot elongation, respectively. Thidiazuron (1.0 mg/L) was superior for biomass production. Rosmarinic acid content of in vitro multiplied plants was found to be higher than that of wild plants, reaching a maximum with 0.5 mg/L 2-isopentenyladenine, which yielded 10.15 mg/g dry weight. The highest thymol content was obtained with 1.0 mg/L kinetin (55.82%), while thidiazuron (0.1 mg/L) increased carvacrol production (12.53%). Overall, Murashige and Skoog medium supplemented with 1.0 mg/L kinetin was determined to be the most favorable medium studied.
Directory of Open Access Journals (Sweden)
M. Velayati
2011-01-01
Full Text Available Abstract Weeds are problematic plants in agroecosystems as a competitor for crops. In order to evaluate effects of cotton (Gossypium hirsutum and common lambsquarter (Chenopodium album densities on some crop growth indices, a study was conducted during 2006 in Experimental Station of Faculty of Agriculture, The University of Birjand as factorial experiment based on complete randomized block design with four replications. Three densities of cotton (6, 9 and 12 Pl.m-2 and four weed densities (0, 6, 9 and 12 Pl.m-2 were used to provide different weed interference levels. Indeed, three plots in each replication were intended to cultivation of lambsquarter alone at 6, 9 or 12 Pl.m-2. Results showed that crop growth rate (CGR of cotton was influenced by weed density, and its relative growth rate (RGR and net assimilation rate (NAR indicated a declining trend as weed density increased. Dry matter accumulation of cotton also was affected negatively by weed densities, as interference of lambsquarter at 6, 9 and 12 Pl.m-2 resulted to 35, 42 and 48 percent dry matter reduction, respectively, than weed-free treatment. Increasing of cotton density could partly compensate for negative impact of weed attendance on cotton growth. Thus, it seems higher plant densities can be used as a managing tool against weeds in cotton fields to avoid reduction of yield. Keywords: Cotton, Density, Weed, competition, Growth analysis
Directory of Open Access Journals (Sweden)
Qian Yan
Full Text Available Basic/helix-loop-helix (bHLH proteins comprise one of the largest transcription factor families and play important roles in diverse cellular and molecular processes. Comprehensive analyses of the composition and evolution of the bHLH family in cotton are essential to elucidate their functions and the molecular basis of cotton development. By searching bHLH homologous genes in sequenced diploid cotton genomes (Gossypium raimondii and G. arboreum, a set of cotton bHLH reference genes containing 289 paralogs were identified and named as GobHLH001-289. Based on their phylogenetic relationships, these cotton bHLH proteins were clustered into 27 subfamilies. Compared to those in Arabidopsis and cacao, cotton bHLH proteins generally increased in number, but unevenly in different subfamilies. To further uncover evolutionary changes of bHLH genes during tetraploidization of cotton, all genes of S5a and S5b subfamilies in upland cotton and its diploid progenitors were cloned and compared, and their transcript profiles were determined in upland cotton. A total of 10 genes of S5a and S5b subfamilies (doubled from A- and D-genome progenitors maintained in tetraploid cottons. The major sequence changes in upland cotton included a 15-bp in-frame deletion in GhbHLH130D and a long terminal repeat retrotransposon inserted in GhbHLH062A, which eliminated GhbHLH062A expression in various tissues. The S5a and S5b bHLH genes of A and D genomes (except GobHLH062 showed similar transcription patterns in various tissues including roots, stems, leaves, petals, ovules, and fibers, while the A- and D-genome genes of GobHLH110 and GobHLH130 displayed clearly different transcript profiles during fiber development. In total, this study represented a genome-wide analysis of cotton bHLH family, and revealed significant changes in sequence and expression of these genes in tetraploid cottons, which paved the way for further functional analyses of bHLH genes in the cotton genus.
DESFOLHAÇÃO DE PERFILHOS EM PASTO DE CAPIM-BRAQUIÁRIA SOB LOTAÇÃO CONTÍNUA
Directory of Open Access Journals (Sweden)
MANOEL EDUARDO ROZALINO SANTOS
2011-06-01
Full Text Available The objective of this study was to evaluate the number oftillers with different levels of defoliation and theircharacteristics on the Brachiaria decumbens cv. Basilisk pasture. Three different areas on the pasture (undergrazed, with proper grazing and overgrazed and three tiller categories (without defoliation, withdefoliation and without shoot apical meristem were evaluated. Randomized block design with three repetitions was used. The B. decumbens pasture was managed under the continuous stocking system with cattle, and the grass height was kept at about 25cm. Thenumber of tillers showing defoliation was higher (1,333 tillers/m² for the overgrazed area compared to the area with proper grazing and the undergrazed area. Inverse response pattern was observed for the tillers without defoliation. On the other hand, the number of tillerswithout the shoot apical meristem was higher in the areas with proper grazing (395 tillers/m². Tillers without defoliation showed a lower pseudoculm length (10.3cmand a smaller number of dead leaves (0.22 when compared to the other categories. The length of the leafblade did not change for the tiller categories evaluated. The number of grazed leaves was lower for tillers without the shoot apical meristem in relation to the ones showing or not defoliation. Lower leaf area for the tillers that had the shoot apical meristem removed was observed. Tillers without the shoot apical meristem showed a lowerpercentage of green leaf blade (GLB, higher percentages of both live culm (LC and dead leaf blade (DLB as well as a lower relation of the GLB/LC and weight comparing to the tillers showing or not defoliation. Those last ones did not differ regarding their morphological composition. There is indeed spatial variability of the vegetation andtiller diversity with varying levels of defoliation on Brachiaria decumbens cv. Basilisk pastures under continuous grazing.
Chloroplast DNA Structural Variation, Phylogeny, and Age of Divergence among Diploid Cotton Species
Li, Pengbo; Liu, Fang; Wang, Yumei; Xu, Qin; Shang, Mingzhao; Zhou, Zhongli; Cai, Xiaoyan; Wang, Xingxing; Wendel, Jonathan F.; Wang, Kunbo
2016-01-01
The cotton genus (Gossypium spp.) contains 8 monophyletic diploid genome groups (A, B, C, D, E, F, G, K) and a single allotetraploid clade (AD). To gain insight into the phylogeny of Gossypium and molecular evolution of the chloroplast genome in this group, we performed a comparative analysis of 19 Gossypium chloroplast genomes, six reported here for the first time. Nucleotide distance in non-coding regions was about three times that of coding regions. As expected, distances were smaller within than among genome groups. Phylogenetic topologies based on nucleotide and indel data support for the resolution of the 8 genome groups into 6 clades. Phylogenetic analysis of indel distribution among the 19 genomes demonstrates contrasting evolutionary dynamics in different clades, with a parallel genome downsizing in two genome groups and a biased accumulation of insertions in the clade containing the cultivated cottons leading to large (for Gossypium) chloroplast genomes. Divergence time estimates derived from the cpDNA sequence suggest that the major diploid clades had diverged approximately 10 to 11 million years ago. The complete nucleotide sequences of 6 cpDNA genomes are provided, offering a resource for cytonuclear studies in Gossypium. PMID:27309527
International Nuclear Information System (INIS)
Shaukat, S.; Khan, T.M.; Ijaz, S.
2013-01-01
Combining ability was studied for identification of potential cultivars and hybrids in upland cotton (Gossypium hirsutum L.) in a 6x6 set of diallel crosses among six genotypes of cotton, i.e., VH-232, CRS-2007, SB-149, GR-156, FH-207, and MARVI carried out on fiber length, fiber fineness, fiber elongation, fiber strength, ginning out tern (GOT) and seed cotton yield. Analysis of variance revealed highly significant (p < 0.01) differences among the genotypes for all traits. Combining ability studies showed that the mean squares, due to general combining ability (GCA), specific combining ability (SCA) and reciprocal effects were highly significant in F1 generation. Genetic components, due to GCA and SCA, revealed that traits, such as, fiber length, strength and fineness, showed high proportion of additive type of gene action in F1 generation because of greater GCA variances were greater than SCA variance. GR-156 was the best combiner for lint percentage and fiber length. FH-207 was the best combiner for fiber fineness. FH-207, MARVI and SB-149 were the best general combiners for fiber character and were suggested to be used in future breeding programme to improve fiber quality traits. CRS-2007 x GR-156, CRS-2007 x MARVI, SB-149 x MARVI and VH-232 x SB-149 had higher specific combining ability and reciprocal effects and they can be used for future breeding programme to improve fiber quality. (author)
Carnicer, Jofre; Coll, Marta; Ninyerola, Miquel; Pons, Xavier; Sánchez, Gerardo; Peñuelas, Josep
2011-01-25
Climate change is progressively increasing severe drought events in the Northern Hemisphere, causing regional tree die-off events and contributing to the global reduction of the carbon sink efficiency of forests. There is a critical lack of integrated community-wide assessments of drought-induced responses in forests at the macroecological scale, including defoliation, mortality, and food web responses. Here we report a generalized increase in crown defoliation in southern European forests occurring during 1987-2007. Forest tree species have consistently and significantly altered their crown leaf structures, with increased percentages of defoliation in the drier parts of their distributions in response to increased water deficit. We assessed the demographic responses of trees associated with increased defoliation in southern European forests, specifically in the Iberian Peninsula region. We found that defoliation trends are paralleled by significant increases in tree mortality rates in drier areas that are related to tree density and temperature effects. Furthermore, we show that severe drought impacts are associated with sudden changes in insect and fungal defoliation dynamics, creating long-term disruptive effects of drought on food webs. Our results reveal a complex geographical mosaic of species-specific responses to climate change-driven drought pressures on the Iberian Peninsula, with an overwhelmingly predominant trend toward increased drought damage.
Influence of plant growth regulators on somatic embryos induction ...
African Journals Online (AJOL)
TANOH
2013-04-17
Theobroma cacao L.) using Thidiazuron. In vitro Cell Dev. Biol. 34:293-299. Michaux-Ferrière N, Carron MP (1989). Histology of early somatic embryogenesis in Hevea brasiliensis. The importance of timing of subculturing. Plant Cell Tiss ...
Bateman, H.L.; Merritt, D.M.; Glenn, E.P.; Nagler, P.L.
2014-01-01
The biological control agent (tamarisk leaf beetle, Diorhabda spp.) is actively being used to defoliate exotic saltcedar or tamarisk (Tamarix spp.) in riparian ecosystems in western USA. The Virgin River in Arizona and Nevada is a system where tamarisk leaf beetle populations are spreading. Saltcedar biocontrol, like other control methods, has the potential to affect non-target species. Because amphibians and reptiles respond to vegetation changes in habitat and forage in areas where beetles are active, herpetofauna are model taxa to investigate potential impacts of biocontrol defoliation. Our objectives related herpetofauna abundance to vegetation cover and indices (normalized difference vegetation index, NDVI; enhanced vegetation index, EVI) and timing of biocontrol defoliation. We captured herpetofauna and ground-dwelling arthropods in trap arrays and measured vegetation using remotely sensed images and on-the-ground measurements at 16–21 sites 2 years before (2009–2010) and 2 years following (2011–2012) biocontrol defoliation. Following defoliation, riparian stands (including stands mixed with native and exotic trees and stands of monotypic exotic saltcedar) had significantly lower NDVI and EVI values and fewer captures of marked lizards. Total captures of herpetofauna (toads, lizards, and snakes) were related to higher vegetation cover and sites with a lower proportion of saltcedar. Our results suggest that effects of biocontrol defoliation are likely to be site-specific and depend upon the proportion of native riparian trees established prior to biocontrol introduction and defoliation. The mechanisms by which habitat structure, microclimate, and ultimately vertebrate species are affected by exotic plant biocontrol riparian areas should be a focus of natural-resource managers.
Zhang, Zhen; Li, Junwen; Muhammad, Jamshed; Cai, Juan; Jia, Fei; Shi, Yuzhen; Gong, Juwu; Shang, Haihong; Liu, Aiying; Chen, Tingting; Ge, Qun; Palanga, Koffi Kibalou; Lu, Quanwei; Deng, Xiaoying; Tan, Yunna; Li, Wei; Sun, Linyang; Gong, Wankui; Yuan, Youlu
2015-01-01
Cotton (Gossypium hirsutum L.) is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL) mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs) from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.
Plant regeneration of Lotononis bainesii Baker (Fabaceae) through ...
African Journals Online (AJOL)
María Laura Vidoz
2012-05-22
May 22, 2012 ... than are synthetic fertilizers due to their ability to fix .... have observed that these compounds have also failed to ... 4-amino-3,5,6-trichloropicolinic acid; TDZ, thidiazuron, 1-phenyl-3-(1,2,3- thiadiazol-5- ..... Characterization of.
Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen
2011-04-01
Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.
Ma, Rendi; Yuan, Hali; An, Jing; Hao, Xiaoyun; Li, Hongbin
2018-01-01
GDSL lipase (GLIP) plays a pivotal role in plant cell growth as a multifunctional hydrolytic enzyme. Herein, a cotton (Gossypium hirsutum L. cv Xuzhou 142) GDSL lipase gene (GhGLIP) was obtained from developing ovules and fibers. The GhGLIP cDNA contained an open reading frame (ORF) of 1,143 base pairs (bp) and encodes a putative polypeptide of 380 amino acid residues. Sequence alignment indicated that GhGLIP includes four enzyme catalytic amino acid residue sites of Ser (S), Gly (G), Asn (N) and His (H), located in four conserved blocks. Phylogenetic tree analysis showed that GhGLIP belongs to the typical class IV lipase family with potential functions in plant secondary metabolism. Subcellular distribution analysis demonstrated that GhGLIP localized to the nucleus, cytoplasm and plasma membrane. GhGLIP was expressed predominantly at 5-15 day post anthesis (dpa) in developing ovules and elongating fibers, measured as mRNA levels and enzyme activity. Ectopic overexpression of GhGLIP in Arabidopsis plants resulted in enhanced seed development, including length and fresh weight. Meanwhile, there was increased soluble sugar and protein storage in transgenic Arabidopsis plants, coupled with the promotion of lipase activity. Moreover, the expression of cotton GhGLIP is induced by ethylene (ETH) treatment in vitro. A 1,954-bp GhGLIP promoter was isolated and expressed high activity in driving green fluorescence protein (GFP) expression in tobacco leaves. Cis-acting element analysis of the GhGLIP promoter (pGhGLIP) indicated the presence of an ethylene-responsive element (ERE), and transgenic tobacco leaves with ectopic expression of pGhGLIP::GFP-GUS showed increased GUS activity after ETH treatment. In summary, these results suggest that GhGLIP is a functional enzyme involved in ovule and fiber development and performs significant roles in seed development.
Ganesan, M; Jayabalan, N
2004-10-01
Somatic embryogenesis in cotton (Gossypium hirsutum L.) is accelerated when the plant regeneration medium is supplemented with haemoglobin (erythrogen). In cotton SVPR 2 lines, a higher frequency of embryoid formation was observed when the medium contained 400 mg/l haemoglobin. Fresh weight of the callus, rate of embryoid induction, number of embryoids formed and the percentage of plant regeneration from somatic embryos were increased. Among the two different cultivars tested, MCU 11 showed no response to the presence of haemoglobin when compared to SVPR 2, and embryogenic callus formation was completely absent in the former. Medium containing MS salts, 100 mg/l myo-inositol , 0.3 mg/l thiamine-HCL, 0.3 mg/l Picloram (PIC), 0.1 mg/l kinetin and 400 mg/l haemoglobin effected a better response with respect to embryogenic callus induction. After 8 weeks of culture, a high frequency of embryoid induction was observed on medium containing MS basal salts, 100 mg/l myo-inositol, 0.3 mg/l PIC , 0.1 mg/l isopentenyl adenine, 1.0 g/l NH4NO3 and 400 mg/l haemoglobin. Plant regeneration was observed in 75.8% of the mature somatic embryos, and whole plant regeneration was achieved within 6-7 months of culture. The regenerated plantlets were fertile and similar to in vivo-grown, seed-derived plants except that they were phenotypically smaller. A positive influence of haemoglobin was observed at concentrations up to 400 mg/l at all stages of somatic embryogenesis. The increase in the levels of antioxidant enzyme activities, for example superoxide dismutase and peroxidase, indicated the presence of excess oxygen uptake and the stressed condition of the plant tissues that arose from haemoglobin supplementation. This increased oxygen uptake and haemoglobin-mediated stress appeared to accelerate somatic embryogenesis in cotton.
LTR-retrotransposons-based molecular markers in cultivated ...
African Journals Online (AJOL)
GRACE
2006-07-03
Jul 3, 2006 ... LTR-retrotransposons represent a standard component of the Gossypium Genome (Zaki and Abdel Ghany,. 2003). The analysis of the molecular existence and distribution of ancient and active LTR-retrotransposons, therefore, provides a comprehensive evaluation of the evolutionary history of Gossypium.
Satya, Pratik; Paswan, Pramod Kumar; Ghosh, Swagata; Majumdar, Snehalata; Ali, Nasim
2016-06-01
Cross-species transferability is a quick and economic method to enrich SSR database, particularly for minor crops where little genomic information is available. However, transferability of SSR markers varies greatly between species, genera and families of plant species. We assessed confamiliar transferability of SSR markers from cotton (Gossypium hirsutum) and jute (Corchorus olitorius) to 22 species distributed in different taxonomic groups of Malvaceae. All the species selected were potential industrial crop species having little or no genomic resources or SSR database. Of the 14 cotton SSR loci tested, 13 (92.86 %) amplified in G. arboreum and 71.43 % exhibited cross-genera transferability. Nine out of 11 jute SSRs (81.81 %) showed cross-transferability across genera. SSRs from both the species exhibited high polymorphism and resolving power in other species. The correlation between transferability of cotton and jute SSRs were highly significant (r = 0.813). The difference in transferability among species was also significant for both the marker groups. High transferability was observed at genus, tribe and subfamily level. At tribe level, transferability of jute SSRs (41.04 %) was higher than that of cotton SSRs (33.74 %). The tribe Byttnerieae exhibited highest SSR transferability (48.7 %). The high level of cross-genera transferability (>50 %) in ten species of Malvaceae, where no SSR resource is available, calls for large scale transferability testing from the enriched SSR databases of cotton and jute.
Optimal management strategies in variable environments: Stochastic optimal control methods
Williams, B.K.
1985-01-01
Dynamic optimization was used to investigate the optimal defoliation of salt desert shrubs in north-western Utah. Management was formulated in the context of optimal stochastic control theory, with objective functions composed of discounted or time-averaged biomass yields. Climatic variability and community patterns of salt desert shrublands make the application of stochastic optimal control both feasible and necessary. A primary production model was used to simulate shrub responses and harvest yields under a variety of climatic regimes and defoliation patterns. The simulation results then were used in an optimization model to determine optimal defoliation strategies. The latter model encodes an algorithm for finite state, finite action, infinite discrete time horizon Markov decision processes. Three questions were addressed: (i) What effect do changes in weather patterns have on optimal management strategies? (ii) What effect does the discounting of future returns have? (iii) How do the optimal strategies perform relative to certain fixed defoliation strategies? An analysis was performed for the three shrub species, winterfat (Ceratoides lanata), shadscale (Atriplex confertifolia) and big sagebrush (Artemisia tridentata). In general, the results indicate substantial differences among species in optimal control strategies, which are associated with differences in physiological and morphological characteristics. Optimal policies for big sagebrush varied less with variation in climate, reserve levels and discount rates than did either shadscale or winterfat. This was attributed primarily to the overwintering of photosynthetically active tissue and to metabolic activity early in the growing season. Optimal defoliation of shadscale and winterfat generally was more responsive to differences in plant vigor and climate, reflecting the sensitivity of these species to utilization and replenishment of carbohydrate reserves. Similarities could be seen in the influence of both
Directory of Open Access Journals (Sweden)
Renesh Bedre
Full Text Available Aflatoxins are toxic and potent carcinogenic metabolites produced from the fungi Aspergillus flavus and A. parasiticus. Aflatoxins can contaminate cottonseed under conducive preharvest and postharvest conditions. United States federal regulations restrict the use of aflatoxin contaminated cottonseed at >20 ppb for animal feed. Several strategies have been proposed for controlling aflatoxin contamination, and much success has been achieved by the application of an atoxigenic strain of A. flavus in cotton, peanut and maize fields. Development of cultivars resistant to aflatoxin through overexpression of resistance associated genes and/or knocking down aflatoxin biosynthesis of A. flavus will be an effective strategy for controlling aflatoxin contamination in cotton. In this study, genome-wide transcriptome profiling was performed to identify differentially expressed genes in response to infection with both toxigenic and atoxigenic strains of A. flavus on cotton (Gossypium hirsutum L. pericarp and seed. The genes involved in antifungal response, oxidative burst, transcription factors, defense signaling pathways and stress response were highly differentially expressed in pericarp and seed tissues in response to A. flavus infection. The cell-wall modifying genes and genes involved in the production of antimicrobial substances were more active in pericarp as compared to seed. The genes involved in auxin and cytokinin signaling were also induced. Most of the genes involved in defense response in cotton were highly induced in pericarp than in seed. The global gene expression analysis in response to fungal invasion in cotton will serve as a source for identifying biomarkers for breeding, potential candidate genes for transgenic manipulation, and will help in understanding complex plant-fungal interaction for future downstream research.
Chen, Yu; Wang, Yingying; Zhao, Ting; Yang, Jianwei; Feng, Shouli; Nazeer, Wajad; Zhang, Tianzhen; Zhou, Baoliang
2015-01-01
Gossypium arboreum, a cultivated cotton species (2n = 26, AA) native to Asia, possesses invaluable characteristics unavailable in the tetraploid cultivated cotton gene pool, such as resistance to pests and diseases and tolerance to abiotic stresses. However, it is quite difficult to transfer favorable traits into Upland cotton through conventional methods due to the cross-incompatibility of G. hirsutum (2n = 52, AADD) and G. arboreum. Here, we improved an embryo rescue technique to overcome the cross-incompatibility between these two parents for transferring favorable genes from G. arboreum into G. hirsutum. Our results indicate that MSB2K supplemented with 0.5 mgl-1 kinetin and 250 mg-1 casein hydrolysate is an efficient initial medium for rescuing early (3 d after pollination) hybrid embryos. Eight putative hybrids were successfully obtained, which were further verified and characterized by cytology, molecular markers and morphological analysis. The putative hybrids were subsequently treated with different concentrations of colchicine solution to double their chromosomes. The results demonstrate that four putative hybrid plants were successfully chromosome-doubled by treatment with 0.1% colchicine for 24 h and become amphiploid, which were confirmed by cytological observation, self-fertilization and backcrossing. Preliminary assessments of resistance at seedling stage indicate that the synthetic amphiploid showed highly resistant to Verticillium and drought. The synthetic amphiploid between G. hirsutum × G. arboreum would lay the foundation for developing G. arboreum-introgressed lines with the uniform genetic background of G. hirsutum acc TM-1, which would greatly enhance and simplify the mining, isolation, characterization, cloning and use of G. arboreum-specific desirable genes in future cotton breeding programs. PMID:26061996
Energy Technology Data Exchange (ETDEWEB)
Gennadios, Heather A.; Gonzalez, Veronica; Di Costanzo, Luigi; Li, Amang; Yu, Fanglei; Miller, David J.; Allemann, Rudolf K.; Christianson, David W.; (UPENN); (Cardiff); (UC)
2009-09-11
(+)-{delta}-Cadinene synthase (DCS) from Gossypium arboreum (tree cotton) is a sesquiterpene cyclase that catalyzes the cyclization of farnesyl diphosphate in the first committed step of the biosynthesis of gossypol, a phytoalexin that defends the plant from bacterial and fungal pathogens. Here, we report the X-ray crystal structure of unliganded DCS at 2.4 {angstrom} resolution and the structure of its complex with three putative Mg{sup 2+} ions and the substrate analogue inhibitor 2-fluorofarnesyl diphosphate (2F-FPP) at 2.75 {angstrom} resolution. These structures illuminate unusual features that accommodate the trinuclear metal cluster required for substrate binding and catalysis. Like other terpenoid cyclases, DCS contains a characteristic aspartate-rich D{sup 307}DTYD{sup 311} motif on helix D that interacts with Mg{sub A}{sup 2+} and Mg{sub C}{sup 2+}. However, DCS appears to be unique among terpenoid cyclases in that it does not contain the 'NSE/DTE' motif on helix H that specifically chelates Mg{sub B}{sup 2+}, which is usually found as the signature sequence (N,D)D(L,I,V)X(S,T)XXXE (boldface indicates Mg{sub B}{sup 2+} ligands). Instead, DCS contains a second aspartate-rich motif, D{sup 451}DVAE{sup 455}, that interacts with Mg{sub B}{sup 2+}. In this regard, DCS is more similar to the isoprenoid chain elongation enzyme farnesyl diphosphate synthase, which also contains two aspartate-rich motifs, rather than the greater family of terpenoid cyclases. Nevertheless, the structure of the DCS-2F-FPP complex shows that the structure of the trinuclear magnesium cluster is generally similar to that of other terpenoid cyclases despite the alternative Mg{sub B}{sup 2+} binding motif. Analyses of DCS mutants with alanine substitutions in the D{sup 307}DTYD{sup 311} and D{sup 451}DVAE{sup 455} segments reveal the contributions of these segments to catalysis.
Adventitious shoot regeneration from leaf explants of the valuable ...
African Journals Online (AJOL)
The objective of this study was to develop an efficient protocol for adventitious shoot regeneration for Plectranthus barbatus Andrews using leaf explants. The explants were cultured on MS (Murashige and Skoog, 1962) medium containing various concentration of kinetin (KN), 6-benzylaminopurine (BAP) and thidiazuron ...
Directory of Open Access Journals (Sweden)
Zhen Zhang
Full Text Available Cotton (Gossypium hirsutum L. is an important agricultural crop that provides renewable natural fiber resources for the global textile industry. Technological developments in the textile industry and improvements in human living standards have increased the requirement for supplies and better quality cotton. Upland cotton 0-153 is an elite cultivar harboring strong fiber strength genes. To conduct quantitative trait locus (QTL mapping for fiber quality in 0-153, we developed a population of 196 recombinant inbred lines (RILs from a cross between 0-153 and sGK9708. The fiber quality traits in 11 environments were measured and a genetic linkage map of chromosome 25 comprising 210 loci was constructed using this RIL population, mainly using simple sequence repeat markers and single nucleotide polymorphism markers. QTLs were identified across diverse environments using the composite interval mapping method. A total of 37 QTLs for fiber quality traits were identified on chromosome 25, of which 17 were stably expressed in at least in two environments. A stable fiber strength QTL, qFS-chr25-4, which was detected in seven environments and was located in the marker interval between CRI-SNP120491 and BNL2572, could explain 6.53%-11.83% of the observed phenotypic variations. Meta-analysis also confirmed the above QTLs with previous reports. Application of these QTLs could contribute to improving fiber quality and provide information for marker-assisted selection.
Wegier, A; Piñeyro-Nelson, A; Alarcón, J; Gálvez-Mariscal, A; Alvarez-Buylla, E R; Piñero, D
2011-10-01
Over 95% of the currently cultivated cotton was domesticated from Gossypium hirsutum, which originated and diversified in Mexico. Demographic and genetic studies of this species at its centre of origin and diversification are lacking, although they are critical for cotton conservation and breeding. We investigated the actual and potential distribution of wild cotton populations, as well as the contribution of historical and recent gene flow in shaping cotton genetic diversity and structure. We evaluated historical gene flow using chloroplast microsatellites and recent gene flow through the assessment of transgene presence in wild cotton populations, exploiting the fact that genetically modified cotton has been planted in the North of Mexico since 1996. Assessment of geographic structure through Bayesian spatial analysis, BAPS and Genetic Algorithm for Rule-set Production (GARP), suggests that G. hirsutum seems to conform to a metapopulation scheme, with eight distinct metapopulations. Despite evidence for long-distance gene flow, genetic variation among the metapopulations of G. hirsutum is high (He = 0.894 ± 0.01). We identified 46 different haplotypes, 78% of which are unique to a particular metapopulation, in contrast to a single haplotype detected in cotton cultivars. Recent gene flow was also detected (m = 66/270 = 0.24), with four out of eight metapopulations having transgenes. We discuss the implications of the data presented here with respect to the conservation and future breeding of cotton populations and genetic diversity at its centre of crop origin. © 2011 Blackwell Publishing Ltd.
Tegeder, M; Kohn, H; Nibbe, M; Schieder, O; Pickardt, T
1996-11-01
Protoplasts ofVicia narbonensis isolated from epicotyls and shoot tips of etiolated seedlings were embedded in 1.4% sodium-alginate at a final density of 2.5×10(5) protoplasts/ml and cultivated in Kao and Michayluk-medium containing 0.5 mg/I of each of 2,4- dichlorophenoxyacetic acid, naphthylacetic acid and 6 -benzylaminopurine. A division frequency of 36% and a plating efficiency of 0.40-0.5% were obtained. Six weeks after embedding, protoplast-derived calluses were transferred onto gelrite-solidified Murashige and Skoog-media containing various growth regulators. Regeneration of plants was achieved via two morphologically distinguishable pathways. A two step protocol (initially on medium with a high auxin concentration followed by a culture phase with lowered auxin amount) was used to regenerate somatic embryos, whereas cultivation on medium containing thidiazuron and naphthylacetic acid resulted in shoot morphogenesis. Mature plants were recovered from both somatic embryos as well as from thidiazuron-induced shoots.
He, Peng; Zhao, Peng; Wang, Limin; Zhang, Yuzhou; Wang, Xiaosi; Xiao, Hui; Yu, Jianing; Xiao, Guanghui
2017-07-03
Cell elongation and expansion are significant contributors to plant growth and morphogenesis, and are often regulated by environmental cues and endogenous hormones. Auxin is one of the most important phytohormones involved in the regulation of plant growth and development and plays key roles in plant cell expansion and elongation. Cotton fiber cells are a model system for studying cell elongation due to their large size. Cotton is also the world's most utilized crop for the production of natural fibers for textile and garment industries, and targeted expression of the IAA biosynthetic gene iaaM increased cotton fiber initiation. Polar auxin transport, mediated by PIN and AUX/LAX proteins, plays a central role in the control of auxin distribution. However, very limited information about PIN-FORMED (PIN) efflux carriers in cotton is known. In this study, 17 PIN-FORMED (PIN) efflux carrier family members were identified in the Gossypium hirsutum (G. hirsutum) genome. We found that PIN1-3 and PIN2 genes originated from the At subgenome were highly expressed in roots. Additionally, evaluation of gene expression patterns indicated that PIN genes are differentially induced by various abiotic stresses. Furthermore, we found that the majority of cotton PIN genes contained auxin (AuxREs) and salicylic acid (SA) responsive elements in their promoter regions were significantly up-regulated by exogenous hormone treatment. Our results provide a comprehensive analysis of the PIN gene family in G. hirsutum, including phylogenetic relationships, chromosomal locations, and gene expression and gene duplication analyses. This study sheds light on the precise roles of PIN genes in cotton root development and in adaption to stress responses.
Minimizing the hyperhydricity associated with in vitro growth and ...
African Journals Online (AJOL)
Hyperhydricity or glassiness is considered as a frequent problem associated with the in vitro growth and development of watermelon (Citrulus lanatus, cv. Giza 1). Explants were cultured on MS (Murashige and Skoog, 1962) medium containing 6-bensyladenine (BA), kinetin (Kin) or thidiazuron (N-phenyl N 1,2 ...
Root proliferation in native perennial grasses of arid Patagonia, Argentina
Institute of Scientific and Technical Information of China (English)
Yanina A. TORRES; Mara M. MUJICA; Sandra S. BAIONI; Jos ENTO; Mara N. FIORETTI; Guillermo TUCAT; Carlos A. BUSSO; Oscar A. MONTENEGRO; Leticia ITHURRART; Hugo D. GIORGETTI; Gustavo RODRGUEZ; Diego BENTIVEGNA; Roberto E. BREVEDAN; Osvaldo A. FERNNDEZ
2014-01-01
Pappophorum vaginatum is the most abundant C4 perennial grass desirable to livestock in rangelands of northeastern Patagonia, Argentina. We hypothesized that (1) defoliation reduce net primary productivity, and root length density and weight in the native species, and (2) root net primary productivity, and root length density and weight, are greater in P. vaginatum than in the other, less desirable, native species (i.e., Aristida spegazzinii, A. subulata and Sporobolus cryptandrus). Plants of all species were either exposed or not to a severe defoliation twice a year during two growing seasons. Root proliferation was measured using the cylinder method. Cylindrical, iron structures, wrapped up using nylon mesh, were buried diagonally from the periphery to the center on individual plants. These structures, initially filled with soil without any organic residue, were dug up from the soil on 25 April 2008, after two successive defoliations in mid-spring 2007. During the second growing season (2008-2009), cylinders were destructively harvested on 4 April 2009, after one or two defoliations in mid-and/or late-spring, respectively. Roots grown into the cylinders were obtained after washing the soil manually. Defoliation during two successive years did reduce the study variables only after plants of all species were defoliated twice, which supported the first hypothesis. The greater root net primary productivity, root length den-sity and weight in P. vaginatum than in the other native species, in support of the second hypothesis, could help to explain its greater abundance in rangelands of Argentina.
Nagler, Pamela L.; Nguyen, Uyen; Bateman, Heather L.; Jarchow, Christopher; Glenn, Edward P.; Waugh, William J.; van Riper, Charles
2018-01-01
Northern tamarisk beetles (Diorhabda carinulata) were released in the Upper Colorado River Basin in the United States in 2004–2007 to defoliate introduced tamarisk shrubs (Tamarix spp.) in the region’s riparian zones. The primary purpose was to control the invasive shrub and reduce evapotranspiration (ET) by tamarisk in an attempt to increase stream flows. We evaluated beetle–tamarisk interactions with MODIS and Landsat imagery on 13 river systems, with vegetation indices used as indicators of the extent of defoliation and ET. Beetles are widespread and exhibit a pattern of colonize–defoliate–emigrate, so that riparian zones contain a mosaic of completely defoliated, partially defoliated, and refoliated tamarisk stands. Based on satellite data and ET algorithms, mean ET before beetle release (2000–2006) was 416 mm/year compared to postrelease (2007–2015) ET of 355 mm/year (pprojections that ET would be reduced by 300–460 mm/year. Reasons for the lower-than-expected ET reductions are because baseline ET rates are lower than initially projected, and percentage ET reduction is low because tamarisk stands tend to regrow new leaves after defoliation and other plants help maintain canopy cover. Overall reductions in tamarisk green foliage during the study are 21%. However, ET in the Upper Basin has shown a steady decline since 2007 and equilibrium has not yet been reached. Defoliation is now proceeding from the Upper Basin into the Lower Basin at a rate of 40 km/year, much faster than initially projected.
Directory of Open Access Journals (Sweden)
Gregory N. Thyssen
2016-06-01
Full Text Available Cotton seed trichomes are the most important source of natural fibers globally. The major fiber thickness properties influence the price of the raw material, and the quality of the finished product. The recessive immature fiber (im gene reduces the degree of fiber cell wall thickening by a process that was previously shown to involve mitochondrial function in allotetraploid Gossypium hirsutum. Here, we present the fine genetic mapping of the im locus, gene expression analysis of annotated proteins near the locus, and association analysis of the linked markers. Mapping-by-sequencing identified a 22-bp deletion in a pentatricopeptide repeat (PPR gene that is completely linked to the immature fiber phenotype in 2837 F2 plants, and is absent from all 163 cultivated varieties tested, although other closely linked marker polymorphisms are prevalent in the diversity panel. This frame-shift mutation results in a transcript with two long open reading frames: one containing the N-terminal transit peptide that targets mitochondria, the other containing only the RNA-binding PPR domains, suggesting that a functional PPR protein cannot be targeted to mitochondria in the im mutant. Taken together, these results suggest that PPR gene Gh_A03G0489 is involved in the cotton fiber wall thickening process, and is a promising candidate gene at the im locus. Our findings expand our understanding of the molecular mechanisms that modulate cotton fiber fineness and maturity, and may facilitate the development of cotton varieties with superior fiber attributes.
Directory of Open Access Journals (Sweden)
Xueyan Zhang
Full Text Available The cotton diploid species, Gossypium arboreum, shows important properties of stress tolerance and good genetic stability. In this study, through mRNA-seq, we de novo assembled the unigenes of multiple samples with 3h H(2O, NaCl, or PEG treatments in leaf, stem and root tissues and successfully obtained 123,579 transcripts of G. arboreum, 89,128 of which were with hits through BLAST against known cotton ESTs and draft genome of G. raimondii. About 36,961 transcripts (including 1,958 possible transcription factor members were identified with differential expression under water stresses. Principal component analysis of differential expression levels in multiple samples suggested tissue selective signalling responding to water stresses. Venn diagram analysis showed the specificity and intersection of transcripts' response to NaCl and PEG treatments in different tissues. Self-organized mapping and hierarchical cluster analysis of the data also revealed strong tissue selectivity of transcripts under salt and osmotic stresses. In addition, the enriched gene ontology (GO terms for the selected tissue groups were differed, including some unique enriched GO terms such as photosynthesis and tetrapyrrole binding only in leaf tissues, while the stem-specific genes showed unique GO terms related to plant-type cell wall biogenesis, and root-specific genes showed unique GO terms such as monooxygenase activity. Furthermore, there were multiple hormone cross-talks in response to osmotic and salt stress. In summary, our multidimensional mRNA sequencing revealed tissue selective signalling and hormone crosstalk in response to salt and osmotic stresses in G. arboreum. To our knowledge, this is the first such report of spatial resolution of transcriptome analysis in G. arboreum. Our study will potentially advance understanding of possible transcriptional networks associated with water stress in cotton and other crop species.
Rapp, Ryan A; Haigler, Candace H; Flagel, Lex; Hovav, Ran H; Udall, Joshua A; Wendel, Jonathan F
2010-11-15
Understanding the evolutionary genetics of modern crop phenotypes has a dual relevance to evolutionary biology and crop improvement. Modern upland cotton (Gossypium hirsutum L.) was developed following thousands of years of artificial selection from a wild form, G. hirsutum var. yucatanense, which bears a shorter, sparser, layer of single-celled, ovular trichomes ('fibre'). In order to gain an insight into the nature of the developmental genetic transformations that accompanied domestication and crop improvement, we studied the transcriptomes of cotton fibres from wild and domesticated accessions over a developmental time course. Fibre cells were harvested between 2 and 25 days post-anthesis and encompassed the primary and secondary wall synthesis stages. Using amplified messenger RNA and a custom microarray platform designed to interrogate expression for 40,430 genes, we determined global patterns of expression during fibre development. The fibre transcriptome of domesticated cotton is far more dynamic than that of wild cotton, with over twice as many genes being differentially expressed during development (12,626 versus 5273). Remarkably, a total of 9465 genes were diagnosed as differentially expressed between wild and domesticated fibres when summed across five key developmental time points. Human selection during the initial domestication and subsequent crop improvement has resulted in a biased upregulation of components of the transcriptional network that are important for agronomically advanced fibre, especially in the early stages of development. About 15% of the differentially expressed genes in wild versus domesticated cotton fibre have no homology to the genes in databases. We show that artificial selection during crop domestication can radically alter the transcriptional developmental network of even a single-celled structure, affecting nearly a quarter of the genes in the genome. Gene expression during fibre development within accessions and expression
Lacape, Jean-Marc; Llewellyn, Danny; Jacobs, John; Arioli, Tony; Becker, David; Calhoun, Steve; Al-Ghazi, Yves; Liu, Shiming; Palaï, Oumarou; Georges, Sophie; Giband, Marc; de Assunção, Henrique; Barroso, Paulo Augusto Vianna; Claverie, Michel; Gawryziak, Gérard; Jean, Janine; Vialle, Michèle; Viot, Christopher
2010-06-28
Cotton fibers (produced by Gossypium species) are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb) and G. hirsutum (Gh), differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh x Gb recombinant inbred line (RIL) population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2), 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents) and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes) where an effective co-localization of unidirectional (similar sign of additivity) QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Meta-analysis provided a reliable means of integrating phenotypic and genetic mapping data across multiple populations and
Distribution of 14C-photosynthetate in the shoot of Vitis vinifera L. cv Cabernet Sauvignon: Pt. II
International Nuclear Information System (INIS)
Hunter, J.J.; Visser, J.H.
1988-01-01
The effect of partial defoliation of Vitis vinifera L. cv Cabernet Sauvignon on the distribution of photosynthetates, originating in leaves in different positions on the shoot at berry set, pea size, veraison and ripeness stages, was investigated. Partial defoliation (33% and 66%) resulted in a higher apparent photosynthetic effectivity for all the remaining leaves on the shoot. The pattern of distribution of photosynthetates would seem to stay the same between the defoliation treatments. The control vines were found to carry excess foliage. Optimal photosynthetic activity of all the leaves on the vine was therefore not reached
Root rot diseases of sugarbeet (Beta vulgaris L as affected by defloliation intensity
Directory of Open Access Journals (Sweden)
Karadimos Dimitros A.
2006-01-01
Full Text Available The aim of this work was to study the effect of sugar beet re-growth after water stress defoliation on root rots of three cultivars (Europa, Rival Corsica, which were spring sown in Thessaly, central Greece, for two growing seasons (2003-04. At the beginning of July, sugar beets were subjected to water deficit with irrigation withholding. A month later, three defoliation levels (control - C, moderate - MD, severe - SD and irrigation were applied. Thus, sugar beets were forced to re-grow and three harvests (15, 30 and 40 days after defoliation - DAD were conducted. Rotted roots per hectare were counted and pathogens were identified. Data were analyzed as a four-factor randomized complete block design with years, defoliation levels, sampling times and cultivars as main factors. The number of rotted roots was increased with the defoliation level and was significantly higher for SD sugar beets (3748 roots ha–1. No significant differences were found between C and MD treatments (1543 and 2116 roots ha–1, respectively. Rival was the most susceptible cultivar to root rots. Sugar beets were more susceptible to rotting 15 and 40 DAD (2778 and 2998 roots ha–1. The causal agents of root rots were the fungi, Fusarium spp., Rhizopus stolonifer, Macrophomina phaseolina and Rhizoctonia solani.
Sun, Xiang; Gong, Si-Ying; Nie, Xiao-Ying; Li, Yang; Li, Wen; Huang, Geng-Qing; Li, Xue-Bao
2015-07-01
Secondary cell wall (SCW) is an important industrial raw material for pulping, papermaking, construction, lumbering, textiles and potentially for biofuel production. The process of SCW thickening of cotton fibers lays down the cellulose that will constitute the bulk (up to 96%) of the fiber at maturity. In this study, a gene encoding a MYB-domain protein was identified in cotton (Gossypium hirsutum) and designated as GhMYBL1. Quantitative real-time polymerase chain reaction (RT-PCR) analysis revealed that GhMYBL1 was specifically expressed in cotton fibers at the stage of secondary wall deposition. Further analysis indicated that this protein is a R2R3-MYB transcription factor, and is targeted to the cell nucleus. Overexpression of GhMYBL1 in Arabidopsis affected the formation of SCW in the stem xylem of the transgenic plants. The enhanced SCW thickening also occurred in the interfascicular fibers, xylary fibers and vessels of the GhMYBL1-overexpression transgenic plants. The expression of secondary wall-associated genes, such as CesA4, CesA7, CesA8, PAL1, F5H and 4CL1, were upregulated, and consequently, cellulose and lignin biosynthesis were enhanced in the GhMYBL1 transgenic plants. These data suggested that GhMYBL1 may participate in modulating the process of secondary wall biosynthesis and deposition of cotton fibers. © 2014 Scandinavian Plant Physiology Society.
Nagler, P. L.; Brown, T.; Dennison, P. E.; Hultine, K. R.; Glenn, E. P.
2009-12-01
Tamarisk is an introduced shrub/tree that is now widespread in western U.S. riparian corridors. There is concern that tamarisk displaces native vegetation and consumes large amounts of water from riparian aquifers. Consequently, the saltcedar leaf beetle (Diorhabda carinulata) has been introduced into the western US to control the spread of tamarisk. We studied the phenology and water use of tamarisk in two adjacent, beetle infested stands on the Dolores River, in southeastern Utah. A 10 m tower was erected in each tamarisk stand (“orchard” and “gauge”) prior to the 2008 growing season. Beetle damage was measured using fractional cover from images taken from the tower-mounted visible and infrared cameras (“phenocams”) starting in mid-May 2008 and again in mid-May 2009 through the growing season of each year. Tamarisk plants developed fresh leaves ca. mid-April and dense canopies by late-May. In 2008, defoliation became significant by June, whereas in 2009, defoliation became significant by mid-July (orchard) to late-July (gauge). In 2007, cameras were not installed, however defoliation occurred in July. Partial refoliation occurred approximately six weeks after the tamarisk trees were completely defoliated. Time-lapse image sets from the cameras were compared with fine-scale estimates of water use using stem sap flow measurements conducted over three growing seasons (2007-2009). Damage at an intermediate scale was measured with Aster imagery (15 m resolution) and at a coarse scale with MODIS imagery (250 m resolution). Vegetation indices (VIs) from the fine scale (tower phenocams) were comparable to VIs from satellite imagery at the intermediate and coarse scale. Plant transpiration fell dramatically during or shortly after the defoliated period, but recovered when new leaves were produced each year. Potential water salvage was constrained to the relatively brief period of defoliation. At the intermediate scale of measurement, beetle damage was seen to
The fungal pathogen, Diplocarpon rosae Wolf, infects only roses (Rosa spp.) and leads to rose black spot disease. Rose black spot is the most problematic disease of outdoor grown roses worldwide, due to the potential for rapid leaf yellowing and defoliation. Plants repeatedly defoliated from black ...
Rose black spot disease, caused by the pathogen Diplocarpon rosae Wolf, is one of the most widespread and serious diseases of outdoor-grown roses worldwide. Defoliation caused by the disease compromises ornamental value, and repeated defoliation events weakens plants and can lead to plant death. Bot...
Lambret-Frotté, Julia; Artico, Sinara; Muniz Nardeli, Sarah; Fonseca, Fernando; Brilhante Oliveira-Neto, Osmundo; Grossi-de-Sá, Maria Fatima; Alves-Ferreira, Marcio
2016-01-01
Cotton is one of the most economically important cultivated crops. It is the major source of natural fiber for the textile industry and an important target for genetic modification for both biotic stress and herbicide tolerance. Therefore, the characterization of genes and regulatory regions that might be useful for genetic transformation is indispensable. The isolation and characterization of new regulatory regions is of great importance to drive transgene expression in genetically modified crops. One of the major drawbacks in cotton production is pest damage; therefore, the most promising, cost-effective, and sustainable method for pest control is the development of genetically resistant cotton lines. Considering this scenario, our group isolated and characterized the promoter region of a MCO (multicopper oxidase) from Gossypium hirsutum, named GhAO-like1 (ascorbate oxidase-like1). The quantitative expression, together with the in vivo characterization of the promoter region reveals that GhAO-like1 has a flower- and fruit-specific expression pattern. The GUS activity is mainly observed in stamens, as expected considering that the GhAO-like1 regulatory sequence is enriched in cis elements, which have been characterized as a target of reproductive tissue specific transcription factors. Both histological and quantitative analyses in Arabidopsis thaliana have confirmed flower (mainly in stamens) and fruit expression of GhAO-like1. In the present paper, we isolated and characterized both in silico and in vivo the promoter region of the GhAO-like1 gene. The regulatory region of GhAO-like1 might be useful to confer tissue-specific expression in genetically modified plants.
Directory of Open Access Journals (Sweden)
Leandro Galzerano
2014-06-01
Full Text Available The aim of this study was to evaluate CO2 emission, canopy characteristics and herbage accumulation in pastures of pensacola bahiagrass under frequencies of defoliation. The experiment was conducted at the Universidade Estadual Paulista "Julio de Mesquita Filho", Faculty of Agrarian Sciences and Veterinary of UNESP, Jaboticabal, São Paulo, Brasil. The experimental period was from May 3rd to July 26th 2012. The experimental area comprised 28 m2 of pensacola bahiagrass (Paspalum notatum Flügge, divided into 10 plots for allocation of treatment (frequencies of defoliation = 2 or 4 weeks. The following variables were studied: canopy height, light interception, leaf area index, herbage accumulation, tiller density, CO2 emissions, soil temperature and moisture. The frequencies of defoliation in the months of May, June and July slightly affect pensacola bahiagrass characteristics. CO2, soil temperature and moisture are more associated to environmental conditions (months of evaluation than to the frequencies of defoliation imposed to the canopies.
Improving adventitious shoot regeneration from cultured leaf ...
African Journals Online (AJOL)
The effect of various concentrations of thidiazuron (TDZ) with or without 2.7 μM of α-naphthalene acetic acid (NAA) on adventitious shoot formation of two Petunia hybrida cultivars was studied. Seeds from 'Daddy Blue' and 'Dreams White' cultivars were germinated in vitro. Expanded leaves from both seedlings and ...
TDZ-induced plant regeneration in Astragalus cicer L. | Basalma ...
African Journals Online (AJOL)
We developed a regeneration protocol using thidiazuron (TDZ) with a high frequency in vitro root induction in Astragalus cicer. High in vitro germination ratio (75%) for hard-seeds of A. cicer was also achieved. For this, hypocotyl and cotyledon explants were cultured on Murashige and Skoog medium supplemented with ...
Thidiazuron: A multi-dimensional plant growth regulator
African Journals Online (AJOL)
Jane
2011-08-17
Aug 17, 2011 ... recently, the morpho-regulatory potential of the chemical has led to its application in ..... The structure of TDZ is totally different from naturally occurring ..... some researches on plant melatonin and serotonin focused on their ...
Zhao, Jun; Gao, Yulong; Zhang, Zhiyuan; Chen, Tianzi; Guo, Wangzhen; Zhang, Tianzhen
2013-08-06
Cotton (Gossypium spp.) is widely cultivated due to the important economic value of its fiber. However, extreme environmental degradation impedes cotton growth and production. Receptor-like kinase (RLK) proteins play important roles in signal transduction and participate in a diverse range of processes in response to plant hormones and environmental cues. Here, we introduced an RLK gene (GbRLK) from cotton into Arabidopsis and investigated its role in imparting abiotic stress tolerance. GbRLK transcription was induced by exogenously supplied abscisic acid (ABA), salicylic acid, methyl jasmonate, mock drought conditions and high salinity. We cloned the promoter sequence of this gene via self-formed adaptor PCR. Sequence analysis revealed that the promoter region contains many cis-acting stress-responsive elements such as ABRE, W-Box, MYB-core, W-Box core, TCA-element and others. We constructed a vector containing a 1,890-bp sequence in the 5' region upstream of the initiation codon of this promoter and transformed it into Arabidopsis thaliana. GUS histochemical staining analysis showed that GbRLK was expressed mainly in leaf veins, petioles and roots of transgenic Arabidopsis, but not in the cotyledons or root hairs. GbRLK promoter activity was induced by ABA, PEG, NaCl and Verticillium dahliae. Transgenic Arabidopsis with constitutive overexpression of GbRLK exhibited a reduced rate of water loss in leaves in vitro, along with improved salinity and drought tolerance and increased sensitivity to ABA compared with non-transgenic Col-0 Arabidopsis. Expression analysis of stress-responsive genes in GbRLK Arabidopsis revealed that there was increased expression of genes involved in the ABA-dependent signaling pathway (AtRD20, AtRD22 and AtRD26) and antioxidant genes (AtCAT1, AtCCS, AtCSD2 and AtCSD1) but not ion transporter genes (AtNHX1, AtSOS1). GbRLK is involved in the drought and high salinity stresses pathway by activating or participating in the ABA signaling
Nagler, Pamela L.; Nguyen, Uyen; Bateman, Heather L.; Jarchow, Christopher; Glenn, Edward P.; Waugh, William J.; van Riper, Charles
2018-01-01
Northern tamarisk beetles (Diorhabda carinulata) were released in the Upper Colorado River Basin in the United States in 2004–2007 to defoliate introduced tamarisk shrubs (Tamarix spp.) in the region’s riparian zones. The primary purpose was to control the invasive shrub and reduce evapotranspiration (ET) by tamarisk in an attempt to increase stream flows. We evaluated beetle–tamarisk interactions with MODIS and Landsat imagery on 13 river systems, with vegetation indices used as indicators of the extent of defoliation and ET. Beetles are widespread and exhibit a pattern of colonize–defoliate–emigrate, so that riparian zones contain a mosaic of completely defoliated, partially defoliated, and refoliated tamarisk stands. Based on satellite data and ET algorithms, mean ET before beetle release (2000–2006) was 416 mm/year compared to postrelease (2007–2015) ET of 355 mm/year (p<0.05) for a net reduction of 61 mm/year. This is lower than initial literature projections that ET would be reduced by 300–460 mm/year. Reasons for the lower-than-expected ET reductions are because baseline ET rates are lower than initially projected, and percentage ET reduction is low because tamarisk stands tend to regrow new leaves after defoliation and other plants help maintain canopy cover. Overall reductions in tamarisk green foliage during the study are 21%. However, ET in the Upper Basin has shown a steady decline since 2007 and equilibrium has not yet been reached. Defoliation is now proceeding from the Upper Basin into the Lower Basin at a rate of 40 km/year, much faster than initially projected.
Nagler, P. L.; Nguyen, U.; Bateman, H. L.; Jarchow, C.; van Riper, C., III; Waugh, W.; Glenn, E.
2016-12-01
Northern saltcedar beetles (Diorhabda carinata) have spread widely in riparian zones on the Colorado Plateau since their initial release in 2002. One goal of the releases was to reduce water consumption by saltcedar in order to conserve water through reduction of evapotranspiration (ET). The beetle moved south on the Virgin River and reached Big Bend State Park in Nevada in 2014, an expansion rate of 60 km/year. This is important because the beetle's photoperiod requirement for diapause was expected to prevent them from moving south of 37°N latitude, where endangered southwest willow flycatcher habitat occurs. In addition to focusing on the rate of dispersal of the beetles, we used remote sensing estimates of ET at 13 sites on the Colorado, San Juan, Virgin and Dolores rivers and their tributaries to estimate riparian zone ET before and after beetle releases. We estimate that water savings from 2007-2015 was 31.5 million m3/yr (25,547 acre-ft/yr), amounting to 0.258 % of annual river flow from the Upper Colorado River Basin to the Lower Basin. Reasons for the relatively low potential water savings are: 1) baseline ET before beetle release was modest (0.472 m/yr); 2) reduction in ET was low (0.061 m/yr) because saltcedar stands tended to recover after defoliation; 3) riparian ET even in the absence of beetles was only 1.8 % of river flows, calculated as the before beetle average annual ET (472 mm/yr) times the total area of saltcedar (51,588 ha) divided by the combined total average annual flows (1964-2015) from the upper to lower catchment areas of the Colorado River Basin at the USGS gages (12,215 million m3/yr or 9.90 million acre-ft). Further research is suggested to concentrate on the ecological impacts (both positive and negative) of beetles on riparian zones and on identifying management options to maximize riparian health.
Directory of Open Access Journals (Sweden)
Caroline da Cruz Vasconcelos
2017-03-01
Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.
Directory of Open Access Journals (Sweden)
José F. Negrón
2014-12-01
Full Text Available An outbreak of the Douglas-fir tussock moth, Orgyia pseudotsugata McDunnough, occurred in the South Platte River drainage on the Pike-San Isabel National Forest in the Colorado Front Range attacking Douglas-fir, Pseudotsuga menziesii (Mirb. Franco. Stocking levels, species composition, and tree size in heavily and lightly defoliated stands were similar. Douglas-fir tussock moth defoliation resulted in significant Douglas-fir mortality in the heavily defoliated stands, leading to a change in dominance to ponderosa pine, Pinus ponderosa Lawson. Douglas-fir beetle, Dendroctonus pseudotsuqae Hopkins, populations increased following the defoliation event but caused less mortality, and did not differ between heavily and lightly defoliated stands. Douglas-fir tussock moth-related mortality was greatest in trees less than 15 cm dbh (diameter at 1.4 m above the ground that grew in suppressed and intermediate canopy positions. Douglas-fir beetle-related mortality was greatest in trees larger than 15 cm dbh that grew in the dominant and co-dominant crown positions. Although both insects utilize Douglas-fir as its primary host, stand response to infestation is different. The extensive outbreak of the Douglas-fir tussock moth followed by Douglas-fir beetle activity may be associated with a legacy of increased host type growing in overstocked conditions as a result of fire exclusion.
Siberian Moth: Potential New Pest
Yuri Baranchikov; Michael Montgomery; Daniel Kucera
1997-01-01
The Siberian moth, Dendrolimus superans Butler (Family Lasiocampidae), is the most destructive defoliator of conifer forests in Northern Asia. Outbreaks defoliate millions of acres and occur at intervals of 8 to 11 years. The larvae feed on most conifers in the pine family, but outbreaks occur in fir, spruce, Siberian pine, and larch forests. The...
Yi, Xiao-Ping; Zhang, Ya-Li; Yao, He-Sheng; Han, Ji-Mei; Chow, Wah Soon; Fan, Da-Yong; Zhang, Wang-Feng
2018-01-01
To clarify the influence of water deficit on the functionality of the photosynthetic apparatus of cotton plants, leaf gas exchange, chlorophyll a fluorescence, and P700 redox state were examined in field-grown cotton Gossypium hirsutum L. cv. Xinluzao 45. In addition, we measured changes in the P515 signal and analyzed the activity of ATP synthase and the trans-thylakoid proton gradient (ΔpH). With increasing water deficit, the net CO 2 assimilation rate (A N ) and stomatal conductance (g s ) significantly decreased, but the maximum quantum efficiency of PSII photochemistry (F v /F m ) did not change. The photochemical activity of photosystem II (PSII) was reflected by the photochemical quenching coefficient (qP), quantum efficiency of photosystem II [Y(II)], and electron transport rate through PSII [ETR(II)], while the activity of photosystem I (PSI) was reflected by the quantum efficiency of photosystem I [Y(I)] and the electron transport rate through PSI [ETR(I)]. Both activities were maintained under mild water deficit, but were slightly decreased under moderate water deficit. Under moderate water deficit, cyclic electron flow (CEF), the fraction of absorbed light dissipated thermally via the ΔpH- and xanthophyll-regulated process [Y(NPQ)], and the fraction of P700 oxidized under a given set of conditions [Y(ND)] increased. Our results suggest that the activities of both photosystems are stable under mild water deficit and decrease only slightly under moderate water deficit. Moderate water deficit stimulates CEF, and the stimulation of CEF is essential for protecting PSI and PSII against photoinhibition. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Giband Marc
2010-06-01
Full Text Available Abstract Background Cotton fibers (produced by Gossypium species are the premier natural fibers for textile production. The two tetraploid species, G. barbadense (Gb and G. hirsutum (Gh, differ significantly in their fiber properties, the former having much longer, finer and stronger fibers that are highly prized. A better understanding of the genetics and underlying biological causes of these differences will aid further improvement of cotton quality through breeding and biotechnology. We evaluated an inter-specific Gh × Gb recombinant inbred line (RIL population for fiber characteristics in 11 independent experiments under field and glasshouse conditions. Sites were located on 4 continents and 5 countries and some locations were analyzed over multiple years. Results The RIL population displayed a large variability for all major fiber traits. QTL analyses were performed on a per-site basis by composite interval mapping. Among the 651 putative QTLs (LOD > 2, 167 had a LOD exceeding permutation based thresholds. Coincidence in QTL location across data sets was assessed for the fiber trait categories strength, elongation, length, length uniformity, fineness/maturity, and color. A meta-analysis of more than a thousand putative QTLs was conducted with MetaQTL software to integrate QTL data from the RIL and 3 backcross populations (from the same parents and to compare them with the literature. Although the global level of congruence across experiments and populations was generally moderate, the QTL clustering was possible for 30 trait x chromosome combinations (5 traits in 19 different chromosomes where an effective co-localization of unidirectional (similar sign of additivity QTLs from at least 5 different data sets was observed. Most consistent meta-clusters were identified for fiber color on chromosomes c6, c8 and c25, fineness on c15, and fiber length on c3. Conclusions Meta-analysis provided a reliable means of integrating phenotypic and
Lee, Mi-Kyung; Zhang, Yang; Zhang, Meiping; Goebel, Mark; Kim, Hee Jin; Triplett, Barbara A; Stelly, David M; Zhang, Hong-Bin
2013-03-28
Cotton, one of the world's leading crops, is important to the world's textile and energy industries, and is a model species for studies of plant polyploidization, cellulose biosynthesis and cell wall biogenesis. Here, we report the construction of a plant-transformation-competent binary bacterial artificial chromosome (BIBAC) library and comparative genome sequence analysis of polyploid Upland cotton (Gossypium hirsutum L.) with one of its diploid putative progenitor species, G. raimondii Ulbr. We constructed the cotton BIBAC library in a vector competent for high-molecular-weight DNA transformation in different plant species through either Agrobacterium or particle bombardment. The library contains 76,800 clones with an average insert size of 135 kb, providing an approximate 99% probability of obtaining at least one positive clone from the library using a single-copy probe. The quality and utility of the library were verified by identifying BIBACs containing genes important for fiber development, fiber cellulose biosynthesis, seed fatty acid metabolism, cotton-nematode interaction, and bacterial blight resistance. In order to gain an insight into the Upland cotton genome and its relationship with G. raimondii, we sequenced nearly 10,000 BIBAC ends (BESs) randomly selected from the library, generating approximately one BES for every 250 kb along the Upland cotton genome. The retroelement Gypsy/DIRS1 family predominates in the Upland cotton genome, accounting for over 77% of all transposable elements. From the BESs, we identified 1,269 simple sequence repeats (SSRs), of which 1,006 were new, thus providing additional markers for cotton genome research. Surprisingly, comparative sequence analysis showed that Upland cotton is much more diverged from G. raimondii at the genomic sequence level than expected. There seems to be no significant difference between the relationships of the Upland cotton D- and A-subgenomes with the G. raimondii genome, even though G
Reliability assessment of selected indicators of tree health
Pawel M. Lech
2000-01-01
The measurements of electrical resistance of near-cambium tissues, selected biometric features of needles and shoots, and the annual radial increment as well as visual estimates of crown defoliation were performed on about 100 Norway spruce trees in three 60- to 70-year-old stands located in the Western Sudety Mountains. The defoliation, electrical resistance, and...
Preparation, characterization and biological activity of C8-substituted cytokinins
Czech Academy of Sciences Publication Activity Database
Zahajská, Lenka; Nisler, Jaroslav; Voller, Jiří; Gucký, Tomáš; Pospíšil, Tomáš; Spíchal, Lukáš; Strnad, Miroslav
2017-01-01
Roč. 135, MAR (2017), s. 115-127 ISSN 0031-9422 Institutional support: RVO:61389030 Keywords : potential purine antagonists * arabidopsis-thaliana * nucleosides * derivatives * thidiazuron * specificity * receptors * kinetin * Organic synthesis * Cytokinin bioassay * AHK3 and CRE1/AHK4 bacterial receptor assay * C8-substituted cytokinin Subject RIV: CE - Biochemistry OBOR OECD: Organic chemistry Impact factor: 3.205, year: 2016
Davis, Richard F.; Kemerait, Robert C.
2010-01-01
The southern root-knot nematode (Meloidogyne incognita) is a major parasite of cotton in the U.S., and management tactics for this nematode attempt to minimize population levels. We compared three post-harvest practices for their ability to reduce nematode population levels in the field, thereby reducing initial nematode population for the next year's crop. The three practices tested were: 1) chemical defoliation before harvest plus cutting cotton stalks after harvest, 2) chemical defoliation plus applying a herbicide to kill plants prior to cutting the stalks, and 3) chemical defoliation without cutting stalks. Experiments were conducted in both the greenhouse and in the field. The greenhouse experiments demonstrated that M. incognita reproduction (measured as egg counts and root gall rating indices) was significantly greater when stalks were not cut. Cutting stalks plus applying herbicide to kill cotton roots did not significantly reduce nematode reproduction compared to cutting stalks alone. In field experiments, cutting stalks reduced egg populations and root galling compared to defoliation without stalk cutting. In a greenhouse bioassay which used soil from the field plots, plants grown in soil from the defoliation only treatment had greater root gall ratings and egg counts than in the stalk cutting plus herbicide treatment. Therefore, we conclude that cutting cotton stalks immediately after harvest effectively reduces M. incognita reproduction, and may lead to a lower initial population density of this nematode in the following year. PMID:22736845
Indian Academy of Sciences (India)
2015-03-12
Mar 12, 2015 ... measurement used to compare diversity between two or more ... Each individual genotype is represented by a line partitioned in five coloured segments that .... protein, the addition of more markers to catalogue multi-.
Grazing patterns on signalgrass pasture according to location of cattle feces
Directory of Open Access Journals (Sweden)
Manoel Eduardo Rozalino Santos
2012-04-01
Full Text Available This study was conducted to evaluate the defoliation patterns on B. decumbens cv. Basilisk (signalgrass tiller as a function of influence of feces deposited naturally by cattle. The signalgrass was managed with an average height of 25 cm, under continuous stocking and variable stocking rate. Interval and intensity of defoliation, grazing efficiency and forage loss were evaluated in two sites on pasture - one close and the other distant from feces. The completely randomized block design with three replications was adopted. The defoliation rate of the pasture site close to feces was 40% lower than at that distant from feces. This response pattern was similar to defoliation intensity of leaf blade. The leaf blade of the tiller close to feces also achieved lower de foliation (1.64 than that in the tiller distant from feces (3.97. The relative number of grazed leaf per tiller in the tillers distant from feces was approximately 185% higher than those close to feces. The grazing efficiency was lower in the local close to feces compared with that distant, unlike forage loss. The natural deposition of feces by cattle modifies the grazing and use patterns of B. decumbens under continuous stocking.
Lv, Yuanda; Zhao, Liang; Xu, Xiaoyang; Wang, Lei; Wang, Cheng; Zhang, Tianzhen; Guo, Wangzhen
2013-03-13
Cotton is the leading fiber crop worldwide. Gossypium barbadense is an important species of cotton because of its extra-long staple fibers with superior luster and silkiness. However, a systematic analysis and utilization of cDNA sequences from G. barbadense fiber development remains understudied. A total of 21,079 high quality sequences were generated from two non-normalized cDNA libraries prepared by using a mixture of G. barbadense Hai7124 fibers and ovules. After assembly processing, a set of 8,653 unigenes were obtained. Of those, 7,786 were matched to known proteins and 7,316 were assigned to functional categories. The molecular functions of these unigenes were mostly related to binding and catalytic activity, and carbohydrate, amino acid, and energy metabolisms were major contributors among the subsets of metabolism. Sequences comparison between G. barbadense and G. hirsutum revealed that 8,245 unigenes from G. barbadense were detected the similarity with those released publicly in G. hirsutum, however, the remaining 408 sequences had no hits against G. hirsutum unigenes database. Furthermore, 13,275 putative ESTs InDels loci involved in the orthologous and/or homoeologous differences between/within G. barbadense and G. hirsutum were discovered by in silico analyses, and 2,160 InDel markers were developed by ESTs with more than five insertions or deletions. By gel electrophoresis combined with sequencing verification, 71.11% candidate InDel loci were reconfirmed orthologous and/or homoeologous loci polymorphisms using G. hirsutum acc TM-1 and G. barbadense cv Hai7124. Blastx result showed among 2,160 InDel loci, 81 with significant function similarity with known genes associated with secondary wall synthesis process, indicating the important roles in fiber quality in tetraploid cultivated cotton species. Sequence comparisons and InDel markers development will lay the groundwork for promoting the identification of genes related to superior agronomic traits
Thidiazuron-induced shoot organogenesis of Cleome viscosa (L ...
African Journals Online (AJOL)
MBA
2014-02-26
Feb 26, 2014 ... J. Vijayakumar1*, G. Shobana Rathi1, S. M. Bhuvaneshwari1, B. D. ... propagation through callus culture of C. viscosa (Anburaj et al., 2011a,b), micropropagation and shoot organo- genesis from different explants of Cleome spinosa .... Figure 1. Effect of MS basal medium strength (a) and and GA, (b).
40 CFR 180.403 - Thidiazuron; tolerances for residues.
2010-07-01
... metabolites in or on the following food commodities: Commodity Parts per million Cattle, fat 0.4 Cattle, meat 0.4 Cattle, meat byproducts 0.4 Cotton, gin byproducts 24.0 Cotton, undelinted seed 0.3 Goat, fat 0.4 Goat, meat 0.4 Goat, meat byproducts 0.4 Hog, fat 0.4 Hog, meat 0.4 Hog, meat byproducts 0.4 Horse...
Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase
Czech Academy of Sciences Publication Activity Database
Nisler, Jaroslav; Kopečný, D.; Končitíková, R.; Zatloukal, Marek; Bazgier, Václav; Berka, K.; Zalabák, D.; Briozzo, P.; Strnad, Miroslav; Spíchal, Lukáš
2016-01-01
Roč. 92, 1-2 (2016), s. 235-248 ISSN 0167-4412 R&D Projects: GA MŠk(CZ) LO1204; GA ČR GA15-22322S Institutional support: RVO:61389030 Keywords : Cytokinin oxidase/dehydrogenase * Crystal structure * Molecular docking Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.356, year: 2016
Gonz?lez-Chang, Mauricio; Boyer, St?phane; Lefort, Marie-Caroline; Nboyine, Jerry; Wratten, Steve D.
2017-01-01
Background Melolonthinae beetles, comprising different white grub species, are a globally-distributed pest group. Their larvae feed on roots of several crop and forestry species, and adults can cause severe defoliation. In New Zealand, the endemic scarab pest Costelytra zealandica (White) causes severe defoliation on different horticultural crops, including grape vines (Vitis vinifera). Understanding flight and landing behaviours of this pest can help inform pest management decisions. Methods...
Akmal, Mohd; Baig, Mirza S; Khan, Jawaid A
2017-12-10
Cotton leaf curl disease (CLCuD), a major factor resulting in the enormous yield losses in cotton crop, is caused by a distinct monopartite begomovirus in association with Cotton leaf curl Multan betasatellite (CLCuMB). Micro(mi)RNAs are known to regulate gene expression in eukaryotes, including antiviral defense in plants. In a previous study, we had computationally identified a set of cotton miRNAs, which were shown to have potential targets in the genomes of Cotton leaf curl Multan virus (CLCuMuV) and CLCuMB at multiple loci. In the current study, effect of Gossypium arboreum-encoded miRNAs on the genome of CLCuMuV and CLCuMB was investigated in planta. Two computationally predicted cotton-encoded miRNAs (miR398 and miR2950) that showed potential to bind multiple Open Reading Frames (ORFs; C1, C4, V1, and non- coding intergenic region) of CLCuMuV, and (βC1) of CLCuMB were selected. Functional validation of miR398 and miR2950 was done by overexpression approach in G. hirsutum var. HS6. A total of ten in vitro cotton plants were generated from independent events and subjected to biological and molecular analyses. Presence of the respective Precursor (pre)-miRNA was confirmed through PCR and Southern blotting, and their expression level was assessed by semi quantitative RT-PCR, Real Time quantitative PCR and northern hybridization in the PCR-positive lines. Southern hybridization revealed 2-4 copy integration of T-DNA in the genome of the transformed lines. Remarkably, expression of pre-miRNAs was shown up to 5.8-fold higher in the transgenic (T 0 ) lines as revealed by Real Time PCR. The virus resistance was monitored following inoculation of the transgenic cotton lines with viruliferous whitefly (Bemisia tabaci) insect vector. After inoculation, four of the transgenic lines remained apparently symptom free. While a very low titre of viral DNA could be detected by Rolling circle amplification, betasatellite responsible for symptom induction could not be detected
Forest health status in the Carpahian Mountains over the period 1997-2001
International Nuclear Information System (INIS)
Badea, Ovidiu; Tanase, Mihai; Georgeta, Jianu; Anisoara, Lazar; Peiov, Agata; Uhlirova, Hana; Pajtik, Josef; Wawrzoniak, Jerzy; Shparyk, Yuri
2004-01-01
The results of forest health status assessments in the Carpathian Mountains from the monitoring networks developed by the European Union Scheme on the Protection of Forest Against Atmospheric Pollution (EU Scheme) and International Co-operative Programme on Assessment and Monitoring of Air Pollution Effects on Forests (ICP-Forests), have led to a better understanding of the impact of air pollution and other stressors on forests at the regional scale. During the period 1997-2001, forests in the Carpathian Mountains were severely affected by air pollution and natural stresses with 29.7-34.9% of the trees included in defoliation classes 2-4. The broadleaves were slightly healthier than the conifers, and European beech (Fagus sylvatica) was the least affected species. Norway spruce (Picea abies) has poor health status, with 42.9-46.6% of the trees damaged (2-4% defoliation classes). Silver fir (Abies alba) damage was also high, with 46.0-50.9% in defoliation classes 2-4. Pines (primarily Pinus sylvestris) were the least affected of the conifers, with 24.9-33.8% in defoliation classes 2-4. The results from the transnational networks (16x16 km) show that the Carpathian forests are slightly more damaged than the average for the entire Europe. The correlative studies performed in individual European countries show the relationships between air pollution stressors with trends in defoliation and a possible effect of natural stresses at each site. More specific, effects of tree age, drought, ozone and acid deposition critical level exceedances were demonstrated to affect crown condition. - About 1/3 of the Carpathian forest trees are damaged by natural stressors and air pollution
Sutra, Lydie; Prior, P.; Perlemoine, K.; Risede,; Cao-Van, P.; Gardan, Louis
1999-01-01
In spring 1995, symptoms of partial defoliation were observed an Erythrina indica var. fastigiata trees, commonly used as windbreaks in banana plantations in Martinique (French West Indies). Browning of the bark surface was consistently observed at the base of defoliated branches. Bacteria were isolated as nearly pure cultures from typical necrotic lesions an the bark. Results of Gram stain, staining of flagella and biochemical tests indicated that all isolates belonged to the Enterobacteriac...
Shyama Ranjani Weerakoon
2010-01-01
Direct and indirect somatic embryogenesis (SE) from petiole and leaf explants of Scaevola aemula R. Br. cv. 'Purple Fanfare' was achieved. High frequency of somatic embryos was obtained directly from petiole and leaf explants using an inductive plant growth regulator signal thidiazuron (TDZ). Petiole explants were more responsive to SE than leaves. Plants derived from somatic embryos of petiole explants germinated more readily into plants. SE occurred more efficiently in ...
Ulloa, M; Wang, C; Saha, S; Hutmacher, R B; Stelly, D M; Jenkins, J N; Burke, J; Roberts, P A
2016-04-01
Chromosome substitution (CS) lines in plants are a powerful genetic resource for analyzing the contribution of chromosome segments to phenotypic variance. In this study, a series of interspecific cotton (Gossypium spp.) CS lines were used to identify a new germplasm resource, and to validate chromosomal regions and favorable alleles associated with nematode or fungal disease resistance traits. The CS lines were developed in the G. hirsutum L. TM-1 background with chromosome or chromosome segment substitutions from G. barbadense L. Pima 3-79 or G. tomentosum. Root-knot nematode (Meloidogyne incognita) and fusarium wilt (Fusarium oxysporum f. sp. vasinfectum) (races 1 and 4) resistance alleles and quantitative trait loci (QTL) previously placed on cotton chromosomes using SSR markers in two interspecific recombinant inbred line populations were chosen for testing. Phenotypic responses of increased resistance or susceptibility in controlled inoculation and infested field assays confirmed the resistance QTLs, based on substitution with the positive or negative allele for resistance. Lines CS-B22Lo, CS-B04, and CS-B18 showed high resistance to nematode root-galling, confirming QTLs on chromosomes 4 and 22 (long arm) with resistance alleles from Pima 3-79. Line CS-B16 had less fusarium race 1-induced vascular root staining and higher percent survival than the TM-1 parent, confirming a major resistance QTL on chromosome 16. Lines CS-B(17-11) and CS-B17 had high fusarium race 4 vascular symptoms and low survival due to susceptible alleles introgressed from Pima 3-79, confirming the localization on chromosome 17 of an identified QTL with resistance alleles from TM1 and other resistant lines. Analyses validated regions on chromosomes 11, 16, and 17 harboring nematode and fusarium wilt resistance genes and demonstrated the value of CS lines as both a germplasm resource for breeding programs and as a powerful genetic analysis tool for determining QTL effects for disease
Directory of Open Access Journals (Sweden)
Iwan Herdiawan
2014-06-01
Full Text Available The low rainfall and high temperature greatly affect the decline in production and quality of forage in general. The experiment was arranged in a completely randomized design with two factors and four replications. The first factor consisted of 3 level of drought stress namely: 100% field capacity (FC (control, 50% FC, and 25% FC. The second factor comprised of 3 defoliation interval i.e. interval defoliations of 60, 90 and 120 days. The observed variables were nutrient content (crude protein (CP, crude fibre (CF, Gross energy, lignin, selulose, neutral/acid detergent fibre (NDF/ADF, in vitro dry matter and organic matter digestibility (IVMD/IVOMD, Ash, Ca and P and anti-nutrient content (Tannin and Saponin. Data were analyzed by ANOVA and the differences between treatments were tested by LSD. The results shows that there were interactions (P<0.05 between drought stress and defoliations interval on CP, CF, energy, cellulose, lignine, NDF/ADF, IVMD and IVOMD, but not to ash, Ca, P, saponin and tannin content. Drought treatment significantly (P<0.05 decreased CP, energy, IVMD and IVOMD, but CF, lignin, cellulose, ND/ADF, IVDMD/IVOMD, saponin and tannin increases. Defoliation interval significantly (P<0.05 decreases on CP, CF, energy, lignin, cellulose, NDF/ADF, and IVDMD/IVOMD, but saponin and tannin content did not affected.
Venkatesh; Krishna, V; Kumar, K Girish; Pradeepa, K; Kumar, S R Santosh; Kumar, R Shashi
2013-07-01
An efficient protocol was standardized for screening of panama wilt resistant Musa paradisiaca cv. Puttabale clones, an endemic cultivar of Karnataka, India. The synergistic effect of 6-benzyleaminopurine (2 to 6 mg/L) and thidiazuron (0.1 to 0.5 mg/L) on MS medium provoked multiple shoot induction from the excised meristem. An average of 30.10 +/- 5.95 shoots was produced per propagule at 4 mg/L 6-benzyleaminopurine and 0.3 mg/L thidiazuron concentrations. Elongation of shoots observed on 5 mg/L BAP augmented medium with a mean length of 8.38 +/- 0.30 shoots per propagule. For screening of disease resistant clones, multiple shoot buds were mutated with 0.4% ethyl-methane-sulfonate and cultured on MS medium supplemented with Fusarium oxysporum f. sp. cubense (FOC) culture filtrate (5-15%). Two month old co-cultivated secondary hardened plants were used for screening of disease resistance against FOC by the determination of biochemical markers such as total phenol, phenylalanine ammonia lyase, oxidative enzymes like peroxidase, polyphenol oxidase, catalase and PR-proteins like chitinase, beta-1-3 glucanase activities. The mutated clones of M. paradisiaca cv. Puttabale cultured on FOC culture filtrate showed significant increase in the levels of biochemical markers as an indicative of acquiring disease resistant characteristics to FOC wilt.
Effect of ionization radiation (γ-rays 60Co) on germination of cotton
International Nuclear Information System (INIS)
Lall, S.B.; Bhute, M.G.
1974-01-01
Effect of ionization radiation (γ-rays 60 Co) on germination of cotton varieties viz. AK 235 and 197/3, also B 147 and B 296-7 belonging to Gossypium arboreum and Gossypium hirsutum respectively under field and laboratory conditions were studied. Materials under study were tried in two radiation doses i.e. 10,000 r and 20,000 r in two (R1 and R2) generations. In laboratory and field condition, both doses (10,000r and 20,000r) depressed the germination percentage in R1 generation of radiation to greater degree in almost all the varieties of cotton. Maximum depression was noted under field condition in both the varieties belonging to Gossypium arboreum species in R1 generation under 20,000 r. In R2 generation, depressing effect on germination capacity of seed is reduced to much extent in field condition in almost of all the varieties. The germination percentage has increased over control in R2 generation in both doses in laboratory conditions in all the varieties used in this experiment. (author)
Suppression of hop looper (Lepidoptera: Noctuidae) by the fungicide pyraclostrobin.
Woods, J L; Gent, D H
2014-04-01
The hop looper, Hypena humuli Harris, is a reemergent pest of hop that often requires treatment to mitigate crop damage. In 4 yr of field trials, plots treated with fungicides were observed to sustain less hop looper defoliation compared with nontreated plots. Further investigation revealed that abundance of hop looper and associated defoliation were reduced when the fungicide pyraclostrobin was applied in late July to early August. Two other fungicides possessing active ingredients in the same chemical family (quinone outside inhibitor) did not reduce abundance of hop looper or its defoliation. Pyraclostrobin is efficacious against powdery mildew diseases, and the application timing evaluated in these studies corresponds with a period of juvenile susceptibility of hop cones to the disease. Use of fungicides containing pyraclostrobin at this time may have the ancillary benefit of reducing hop looper damage, potentially obviating the need for broad-spectrum insecticides later in the season. Follow-up studies are warranted to determine whether pyraclostrobin may inhibit other lepidopteran species.
GARDEN PLANTS: PROBLEMS CAUSED BY AN UNEXPECTED VISITOR
Directory of Open Access Journals (Sweden)
M. A. Oliveira
2014-09-01
Full Text Available Scarabaeidae defoliators are considered of great importance in Brazil because they seriously damage the leaf system of several plant species. The objective of this study was to report the occurrence of the defoliating beetle Bolax campicola Machatschke, 1974 (Coleoptera: Scarabaeidae attacking ornamental plants in the urban area of municipality of Forestal, Minas Gerais State, Brazil. The initial attack was observed on the ornamental palm species Dypsis lutescens (Arecaceae whose leaves were completely consumed, and then these insects began to feed on Canna indica (Cannaceae, another ornamental species, which was found near to the first. However, in the same location newly planted fruit tree seedlings of Plinia trunciflora (Myrtaceae, Averrhoa carambola (Oxalidaceae and Malpighia emarginata (Malpighiaceae were attacked and completely defoliated. This report of damage to plants in urban areas by B. flavolineatus demonstrates the need for studies on the behavior and feeding preference of these insects, and even their ability to adapt to different host plants.
Indian Academy of Sciences (India)
dell
Improvement of cotton fiber yield and quality is challenging due to the narrow ... The polymorphic information content (PIC) values ranged from 0.371 to ... Several DNA marker systems have been developed and applied to assess the genetic.
Jamison, Levi R.; van Riper, Charles
2018-05-01
Throughout the Southwestern United States, riparian systems contain narrow belts of vegetation along streams and rivers. Although only a small percentage of the total land cover, this ecosystem is important for maintaining high species diversity and population densities of birds. Anthropogenic changes to Western riverine systems have enhanced their susceptibility to invasion by introduced plant species, in particular, ornamental plants from the genus Tamarix (or saltcedar), which can establish itself in dry, salty conditions and spread rapidly. Recently, the central Asian saltcedar leaf beetle (Diorhabda carinulata) was released as a biocontrol for tamarisk. Since its release on the Colorado Plateau, tamarisk beetle populations in Nevada, Utah, Colorado, and Wyoming have widely expanded, leading to widespread tamarisk defoliation, and concerns from land managers regarding the consequences of the environmental impact. Defoliation can also negatively impact avian communities in the short term by decreasing insect abundance and nesting success, owing to increased solar radiation or loss of camouflage. This report details two studies that examine the spread of the introduced tamarisk beetle over parts of the Southwestern United States. The first chapter documents plant phenology and beetle abundance and movement along the Dolores and San Juan Rivers, two major tributaries of the Colorado River. This study demonstrates that D. carinulata population-movement patterns can be highly influenced by the availability of beetle food resources and that local beetle “boom and bust” events are common. The second study demonstrates that the extent and timing of tamarisk defoliation are predictable on the basis of (1) abiotic cues for D. carinulata activity, (2) spatial distributions and abundances of D. carinulata across a site, and (3) movement of D. carinulata as a result of available tamarisk foliage. A significant positive correlation exists between the
Carbon allocation to growth and storage in two evergreen species of contrasting successional status.
Piper, Frida I; Sepúlveda, Paulina; Bustos-Salazar, Angela; Zúñiga-Feest, Alejandra
2017-05-01
A prevailing hypothesis in forest succession is that shade-tolerant species grow more slowly than shade-intolerant species, across light conditions, because they prioritize carbon (C) allocation to storage. We examined this hypothesis in a confamilial pair of species, including one of the fastest-growing tree species in the world ( Eucalyptus globulus ) and a shade-tolerant, slow-growing species ( Luma apiculata ). Seedlings were subjected to one out of four combinations of light (high vs. low) and initial defoliation (90% defoliated vs. nondefoliated) for four months. Growth, C storage concentration in different organs, leaf shedding, and lateral shoot formation were measured at the end of the experiment. Eucalyptus globulus grew faster than L. apiculata in high light, but not in low light. Both species had lower C storage concentration in low than in high light, but similar C storage concentrations in each light condition. Defoliation had no effect on C storage, except in the case of the old leaves of both species, which showed lower C storage levels in response to defoliation. Across treatments, leaf shedding was 96% higher in E. globulus than in L. apiculata while, in contrast, lateral shoot formation was 87% higher in L. apiculata . In low light, E. globulus prioritized C storage instead of growth, whereas L. apiculata prioritized growth and lateral branching. Our results suggest that shade tolerance depends on efficient light capture rather than C conservation traits. © 2017 Botanical Society of America.
Directory of Open Access Journals (Sweden)
Carla S. N. Ribeiro
2010-04-01
Full Text Available Propôs-se, com esta pesquisa, avaliar a indução de multibrotações nos genótipos de mamona BRS Nordestina e CSRN 142, no explante gema apical, determinando-se o melhor tratamento com o fitorregulador Tiadiazuron (TDZ e indicar a concentração satisfatória do ácido-3-indolacético (AIA para o enraizamento ex vitro. Utilizou-se o meio Murashige e Skoog, suplementado com TDZ nas concentrações 0 (testemunha 0,5; 1,0; 2,0; 5,0 e 10,0 mg L-1, com três explantes por frasco, em um delineamento inteiramente casualizado. As avaliações foram realizadas após 45 dias de cultivo analisando-se o número de brotos por explante e a porcentagem de necrose. No enraizamento ex vitro fez-se uso do AIA, nas concentrações 0; 0,125; 0,25; 0,5 e 1,0 g L-1 e do substrato de aclimatação (turfa + vermiculita. Observou-se que a concentração de 0,5 mg L-1 de TDZ proporcionou a melhor proliferação in vitro, alcançando até 16,9 brotos por explante. No enraizamento ex vitro o tratamento mais promissor foi turfa + vermiculita + 0,125 g L-1 de AIA, com 75% de plantas enraizadas. Verificou-se que o TDZ induz o superbrotamento nos dois genótipos e o enraizamento ex vitro é uma alternativa viável aos programas de melhoramento vegetal.The objective of this research was to evaluate the effectiveness to induce the multiplication of shoots in the BRS Nordestina and CSRN 142 castor bean genotypes, in the explant apical meristem, determining the best treatment with the thidiazuron (TDZ growth regulator and to indicate the satisfactory concentration of the indoleacetic acid (AIA for the ex vitro rooting. The Murashige and Skoog medium, was used supplemented with TDZ in the concentrations 0 (control; 0.5, 1.0, 2.0, 5.0 e 10.0 mg L-1, with three explants per flask, in randomized blocks. The evaluations were made after 45 days of cultivation, being analyzed the number of brunches for explant and the percentage of necrosis. In the ex vitro rooting, the use of AIA was
Energy Technology Data Exchange (ETDEWEB)
Ahonen-Jonnarth, U.
1996-04-01
In this work, nickel and copper exposure on Scots pine (Pinus sylvestris L.) was studied experimentally under field conditions. The significance of some biotic factors was also studied. We wanted to test whether the understorey lichen layer has a protective role against nickel exposure, and whether it has any effects on pine seedlings. Effects of defoliation, simulating sawfly grazing, were also examined, since the reduced photosynthesis can be assumed to affect root growth and ectomycorrhiza negatively. Ectomycorrhizal colonization has been found to decrease in pinyon pine due to defoliation. 19 refs
Zhao, Ge; Song, Yun; Wang, Caixiang; Butt, Hamama Islam; Wang, Qianhua; Zhang, Chaojun; Yang, Zuoren; Liu, Zhao; Chen, Eryong; Zhang, Xueyan; Li, Fuguang
2016-12-01
Jasmonates control many aspects of plant biological processes. They are important for regulating plant responses to various biotic and abiotic stresses, including drought, which is one of the most serious threats to sustainable agricultural production. However, little is known regarding how jasmonate ZIM-domain (JAZ) proteins mediate jasmonic acid signals to improve stress tolerance in cotton. This represents the first comprehensive comparative study of TIFY transcription factors in both diploid A, D and tetraploid AD cotton species. In this study, we identified 21 TIFY family members in the genome of Gossypium arboretum, 28 members from Gossypium raimondii and 50 TIFY genes in Gossypium hirsutum. The phylogenetic analyses indicated the TIFY gene family could be divided into the following four subfamilies: TIFY, PPD, ZML, and JAZ subfamilies. The cotton TIFY genes have expanded through tandem duplications and segmental duplications compared with other plant species. Gene expression profile revealed temporal and tissue specificities for TIFY genes under simulated drought conditions in Gossypium arboretum. The JAZ subfamily members were the most highly expressed genes, suggesting that they have a vital role in responses to drought stress. Over-expression of GaJAZ5 gene decreased water loss, stomatal openings, and the accumulation of H 2 O 2 in Arabidopsis thaliana. Additionally, the results of drought tolerance assays suggested that this subfamily might be involved in increasing drought tolerance. Our study provides new data regarding the genome-wide analysis of TIFY gene families and their important roles in drought tolerance in cotton species. These data may form the basis of future studies regarding the relationship between drought and jasmonic acid.
Directory of Open Access Journals (Sweden)
Hidetoshi Goto
Full Text Available Insect-protected soybean (Glycine max (L. Merr. was developed to protect against foliage feeding by certain Lepidopteran insects. The assessment of potential consequences of transgene introgression from soybean to wild soybean (Glycine soja Seib. et Zucc. is required as one aspect of the environmental risk assessment (ERA in Japan. A potential hazard of insect-protected soybean may be hypothesized as transfer of a trait by gene flow to wild soybean and subsequent reduction in foliage feeding by Lepidopteran insects that result in increased weediness of wild soybean in Japan. To assess this potential hazard two studies were conducted. A three-year survey of wild soybean populations in Japan was conducted to establish basic information on foliage damage caused by different herbivores. When assessed across all populations and years within each prefecture, the total foliage from different herbivores was ≤ 30%, with the lowest levels of defoliation (< 2% caused by Lepidopteran insects. A separate experiment using five levels of simulated defoliation (0%, 10%, 25%, 50% and 100% was conducted to assess the impact on pod and seed production and time to maturity of wild soybean. The results indicated that there was no decrease in wild soybean plants pod or seed number or time to maturity at defoliation rates up to 50%. The results from these experiments indicate that wild soybean is not limited by lepidopteran feeding and has an ability to compensate for defoliation levels observed in nature. Therefore, the potential hazard to wild soybean from the importation of insect-protected soybean for food and feed into Japan is negligible.
Remote sensing of forest insect disturbances: Current state and future directions.
Senf, Cornelius; Seidl, Rupert; Hostert, Patrick
2017-08-01
Insect disturbance are important agents of change in forest ecosystems around the globe, yet their spatial and temporal distribution and dynamics are not well understood. Remote sensing has gained much attention in mapping and understanding insect outbreak dynamics. Consequently, we here review the current literature on the remote sensing of insect disturbances. We suggest to group studies into three insect types: bark beetles, broadleaved defoliators, and coniferous defoliators. By so doing, we systematically compare the sensors and methods used for mapping insect disturbances within and across insect types. Results suggest that there are substantial differences between methods used for mapping bark beetles and defoliators, and between methods used for mapping broadleaved and coniferous defoliators. Following from this, we highlight approaches that are particularly suited for each insect type. Finally, we conclude by highlighting future research directions for remote sensing of insect disturbances. In particular, we suggest to: 1) Separate insect disturbances from other agents; 2) Extend the spatial and temporal domain of analysis; 3) Make use of dense time series; 4) Operationalize near-real time monitoring of insect disturbances; 5) Identify insect disturbances in the context of coupled human-natural systems; and 6) Improve reference data for assessing insect disturbances. Since the remote sensing of insect disturbances has gained much interest beyond the remote sensing community recently, the future developments identified here will help integrating remote sensing products into operational forest management. Furthermore, an improved spatiotemporal quantification of insect disturbances will support an inclusion of these processes into regional to global ecosystem models.
Chen, Yu; Wang, Yingying; Chen, Jinjin; Zhang, Tianzhen; Zhou, Baoliang
2015-01-01
Gossypium herbaceum, a cultivated diploid cotton species (2n = 2x = 26, A1A1), has favorable traits such as excellent drought tolerance and resistance to sucking insects and leaf curl virus. G. australe, a wild diploid cotton species (2n = 2x = 26, G2G2), possesses numerous economically valuable characteristics such as delayed pigment gland morphogenesis (which is conducive to the production of seeds with very low levels of gossypol as a potential food source for humans and animals) and resistance to insects, wilt diseases and abiotic stress. Creating synthetic allotetraploid cotton from these two species would lay the foundation for simultaneously transferring favorable genes into cultivated tetraploid cotton. Here, we crossed G. herbaceum (as the maternal parent) with G. australe to produce an F1 interspecific hybrid and doubled its chromosome complement with colchicine, successfully generating a synthetic tetraploid. The obtained tetraploid was confirmed by morphology, cytology and molecular markers and then self-pollinated. The S1 seedlings derived from this tetraploid gradually became flavescent after emergence of the fifth true leaf, but they were rescued by grafting and produced S2 seeds. The rescued S1 plants were partially fertile due to the existence of univalents at Metaphase I of meiosis, leading to the formation of unbalanced, nonviable gametes lacking complete sets of chromosomes. The S2 plants grew well and no flavescence was observed, implying that interspecific incompatibility, to some extent, had been alleviated in the S2 generation. The synthetic allotetraploid will be quite useful for polyploidy evolutionary studies and as a bridge for transferring favorable genes from these two diploid species into Upland cotton through hybridization. PMID:25879660
Historical Gypsy Moth Defoliation Frequency
U.S. Environmental Protection Agency — Gypsy moth populations may exist for many years at low densities such that it may be difficult to find any life stages. Then, for reasons that are not completely...
Federal Laboratory Consortium — The Udall lab is interested in genome evolution and cotton genomics.The cotton genus ( Gossypium) is an extraordinarily diverse group with approximately 50 species...
Charlet, Laurence D; Knodel, Janet J
2003-06-01
The sunflower beetle, Zygogramma exclamationis (F.), is the major defoliating pest of sunflower (Helianthus annuus L.). Planting date was evaluated as a potential management tool in a variety of production regions throughout North Dakota from 1997 to 1999, for its impact on sunflower beetle population density of both adults and larvae, defoliation caused by both feeding stages, seed yield, oil content, and larval parasitism in cultivated sunflower. Results from this 3-yr study revealed that sunflower beetle adult and larval populations decreased as planting date was delayed. Delayed planting also reduced defoliation from adult and larval feeding, which is consistent with the lower numbers of the beetles present in the later seeded plots. Even a planting delay of only 1 wk was sufficient to significantly reduce feeding damage to the sunflower plant. Yield reduction caused by leaf destruction of the sunflower beetle adults and larvae was clearly evident in the first year of the study. The other component of sunflower yield, oil content, did not appear to be influenced by beetle feeding. The tachinid parasitoid, Myiopharus macellus (Rheinhard), appeared to be a significant mortality factor of sunflower beetle larvae at most locations regardless of the dates of planting, and was able to attack and parasitize the beetle at various larval densities. The results of this investigation showed the potential of delayed planting date as an effective integrated pest management tactic to reduce sunflower beetle adults, larvae, and their resulting defoliation. In addition, altering planting dates was compatible with biological control of the beetle, because delaying the planting date did not reduce the effectiveness of the parasitic fly, M. macellus, which attacks the sunflower beetle larvae.
International Nuclear Information System (INIS)
Panzer, K.F.; Hassan, I.A.; Vellisariou, D.A.
1996-01-01
Under the geneva convention on long-range transboundary air pollution, an international cooperative programme on 'Assessment and monitoring of Air effects' had been set-up in 1985. of the 34 signatory states of the convention, 28 participate in the implementation of the programme. The objective is to assess effects of air pollution on forests in europe, using a common survey method in order to assure comparability of survey results. In 1987, 20 countries conducted harmonized forest health surveys based on the assessment of two visible symptoms, loss and/or discoloration of foliage. harmonization of the surveys was quickly achieved because of the simplicity of the methodical approach. The price of rapidly obtaining large-area information on defoliation of forests is, that no distinction can be made in the assessment process between defoliation caused by air pollution and defoliation caused by natural, biotic or a biotic causes. Further improvements of the interpretability of survey results can be expected if additional visible symptoms can be defined for the major species in the different european regions. Possibilities and constraints of incorporating differentiating symptoms into the annual health surveys are discussed. 1 fig., 2 tabs
Cotton (Gossypium hirsutum L.).
Rathore, Keerti S; Campbell, LeAnne M; Sherwood, Shanna; Nunes, Eugenia
2015-01-01
Cotton continues to be a crop of great economic importance in many developing and some developed countries. Cotton plants expressing the Bt gene to deter some of the major pests have been enthusiastically and widely accepted by the farmers in three of the major producing countries, i.e., China, India, and the USA. Considering the constraints related to its production and the wide variety of products derived from the cotton plant, it offers several target traits that can be improved through genetic engineering. Thus, there is a great need to accelerate the application of biotechnological tools for cotton improvement. This requires a simple, yet robust gene delivery/transformant recovery system. Recently, a protocol, involving large-scale, mechanical isolation of embryonic axes from germinating cottonseeds followed by direct transformation of the meristematic cells has been developed by an industrial laboratory. However, complexity of the mechanical device and the patent restrictions are likely to keep this method out of reach of most academic laboratories. In this chapter, we describe the method developed in our laboratory that has undergone further refinements and involves Agrobacterium-mediated transformation of cotton cells, selection of stable transgenic callus lines, and recovery of plants via somatic embryogenesis.
(Gossypium barbadense) germplasm resources
Indian Academy of Sciences (India)
QI MA
and JILIAN LI1∗. 1Cotton Research Institute, Xinjiang Academy of Agricultural and Reclamation ... respectively, are the two main methods used for studying ... ized plot design with a single-row plot and 80 individuals .... The mixed linear model.
Regeneração in vitro de louro-pardo (Cordia trichotoma (Vellozo) Arrabida ex Steudel)
Nilton César Mantovani; Elci Terezinha Henz Franco; Silvane Vestena
2001-01-01
A regeneração in vitro foi desenvolvida para louro-pardo (Cordia trichotoma (Vellozo) Arrabida ex Steudel). Segmentos nodais foram desinfestados e inoculados em dois meios básicos de cultura: WPM (Wood Plant Médium, 1981) e MS (Murashige & Skoog, 1962) suplementados com BAP (6-Benzilaminopurina), TDZ (Thidiazuron), ANA (Ácido-1-Naftaleno Acético), GA3 (Ácido Giberélico), AIB (Ácido Indol-3-Butírico) e CA (Carvão Ativado) em diferentes combinações e concentrações para cada fase de desenvolvime...
African Journals Online (AJOL)
DELL
Ife Journal of Science vol. 20, no. 1 (2018) ... INTRODUCTION. The cotton genus Gossypium (Family Malvaceae) .... substrate to evaluate the antioxidative activity of antioxidants. .... Lagos Teaching Hospital, Idi-Araba, Lagos. Antimicrobial ...
Vilela, Alejandra E.; Agüero, Paola R.; Ravetta, Damián; González-Paleo, Luciana
2016-01-01
Prosopis denudans, an extreme xerophyte shrub, is consumed by ungulates and threatened by firewood gathering, because it is one of the preferred species used by Mapuche indigenous people of Patagonia. In a scenario of uncontrolled use of vegetation, it is very difficult to develop a conservation plan that jointly protects natural resources and its users. We performed a field experiment to assess the impact of defoliation on growth, reproduction and stores of a wild population of P. denudans. We imposed four levels of defoliation (removal of 100, 66, 33 and 0% of leaves) and evaluated the short- and long-term (3 years) effects of this disturbance. Seasonal changes in shoot carbohydrates suggested that they support leaf-flush and blooming. Severely defoliated individuals also used root reserves to support growth and leaf-flush after clipping. Vegetative growth was not affected by defoliation history. Leaf mass area increased after the initial clipping, suggesting the development of structural defenses. The depletion of root reserves at the end of the first year affected inflorescence production the following spring. We conclude that P. denudans shrubs could lose up to one-third of their green tissues without affecting growth or inflorescence production. The removal of a higher proportion of leaves will diminish stores, which in turn, will reduce or completely prevent blooming and, therefore, fruit production the following seasons. Very few studies integrate conservation and plant physiology, and we are not aware, so far, of any work dealing with long-term plant carbon economy of a long-lived perennial shrub as an applied tool in conservation. These results might help the development of management strategies that consider both the use and the conservation of wild populations of P. denudans. PMID:27293747
Directory of Open Access Journals (Sweden)
Gabriela Hermann Pötter
2010-09-01
Full Text Available A desfolha no vinhedo tem como principais objetivos aumentar a radiação solar e a aeração na região dos frutos, para melhorar a coloração e a maturação das uvas tintas, além de reduzir a incidência de podridões, visando, com isso, obter vinhos de qualidade superior. O principal objetivo deste trabalho foi avaliar o efeito da desfolha nos parâmetros físico-químicos das uvas e dos vinhos Cabernet Sauvignon de Dom Pedrito, região da Campanha, Rio Grande do Sul (RS. As uvas foram colhidas em março de 2008, sendo provenientes de um vinhedo comercial cultivado em espaldeira. A desfolha foi realizada na base dos ramos, somente no lado que recebe o sol da manhã, com intensidade de aproximadamente 20%, no estádio fenológico grão "ervilha". As microvinificações foram feitas com controle de temperatura, em tanques de vidro em triplicata, com oito dias de maceração. Os resultados mostraram que o tratamento com desfolha apresentou mostos com pH significativamente mais baixo e maior acidez total. As cascas das uvas e os vinhos do tratamento com desfolha apresentaram aumento significativo no teor de polifenóis totais. A desfolha também propiciou vinhos com maior intensidade de cor, antocianinas totais, extrato seco e açúcar redutor, e menor teor de nitrogênio. Nos vinhos, não foram observadas diferenças significativas entre os tratamentos para acidez total e volátil, pH, álcool, densidade, extrato seco reduzido e teor de potássio. Conclui-se que a prática da desfolha em vinhedos da região da Campanha melhora a qualidade dos vinhos.The practice of partial defoliation in vineyards has as main objectives increase sunlight and ventilation for the fruit, aiming to improve color and maturity in red grapes and helping to reduce fungal diseases, which should result in better wine quality. The main aim of this research was to evaluate the effects of partial defoliation on the quality of Cabernet Sauvignon grapes and wines from Dom
Directory of Open Access Journals (Sweden)
Dirceu Pratissoli
2002-01-01
Full Text Available Biological characteristics of Nipteria panacea Thierry-Mieg (Lepidoptera, Geometridae, an avocado tree defoliator, in highlands areas of Espírito Santo, Brazil. The objective of this research was to evaluate some biological characteristics of the avocado tree defoliator, Nipteria panacea Thiery-Mieg, in laboratory. This species showed the mean development cycle of 58.1 days, embryonic period of eight days and egg viability 56.3%. Pos-embryonic development lasted 36.5 days with viability of 48.2%, pupal period 11.6 days with viability of 76.0%, and mean longevity of females was 19.5 days with a production of 177 eggs per female. Other parameters were also observed and discussed.
Cottonseed oil and yield assessment via economic heterosis and ...
African Journals Online (AJOL)
user
2010-11-01
Nov 1, 2010 ... ISSN 1684–5315 ©2010 Academic Journals. Full Length ... Key words: Hybrid vigor, inbreeding depression, cottonseed traits, cottonseed oil, Gossypium hirsutum. ... in yield and superior performance than well-adapted.
African Journal of Biotechnology - Vol 10, No 3 (2011)
African Journals Online (AJOL)
Isolation and identification of differentially expressed genes between Gossypium ... The effects of nitrogen deficiencies on the lipid and protein contents of Spirulina ... Nutritional evaluation of cookies produced from pigeon pea, cocoyam and ...
Directory of Open Access Journals (Sweden)
Cristina Schetino Bastos
2007-09-01
Full Text Available
O objetivo deste trabalho foi o de avaliar a adaptabilidade e a estabilidade de cultivares de algodão (Gossypium hirsutum L., utilizando a metodologia proposta por Eberhart & Russell (1966. Para tanto, onze variedades de algodão foram avaliadas em sete locais do Estado do Mato Grosso, Brasil, em dois anos agrícolas (2002/2003 e 2003/2004. O delineamento experimental empregado foi o de blocos casualizados com quatro repetições e as características avaliadas foram a produtividade de algodão em caroço e a porcentagem de fibra. Com relação à produção de algodão em caroço, as cultivares BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá e Delta Opal demonstraram ampla adaptabilidade e estabilidade para as regiões produtoras do Estado. Entretanto, considerando a porcentagem de fibra, não foram encontradas cultivares de algodão com ampla adaptabilidade e estabilidade nos ambientes estudados.
PALAVRAS-CHAVE: Gossypium hirsutum; fibra; estabilidade.
The objective of this work was to evaluate the stability and adaptability of cotton (Gossypium hirsutum L. cultivars using the method of Eberhart & Russell (1966. Eleven varieties of cotton were tested at seven locations in Mato Grosso State, Brazil, in two growing seasons (2002/2003 and 2003/2004. The experimental design was the randomized complete blocks with four replications and the evaluated traits were lint percentage and seed cotton yield. For seed cotton yield, BRS Aroeira, BRS Ipê, BRS Cedro, BRS Jatobá and Delta Opal showed broad adaptability and stability in Mato Grosso State. However, for lint percentage there were not found cotton cultivars with both broad adaptability and stability for the studied environments.
2012-01-01
Background Cotton is the world’s most important natural textile fiber and a significant oilseed crop. Decoding cotton genomes will provide the ultimate reference and resource for research and utilization of the species. Integration of high-density genetic maps with genomic sequence information will largely accelerate the process of whole-genome assembly in cotton. Results In this paper, we update a high-density interspecific genetic linkage map of allotetraploid cultivated cotton. An additional 1,167 marker loci have been added to our previously published map of 2,247 loci. Three new marker types, InDel (insertion-deletion) and SNP (single nucleotide polymorphism) developed from gene information, and REMAP (retrotransposon-microsatellite amplified polymorphism), were used to increase map density. The updated map consists of 3,414 loci in 26 linkage groups covering 3,667.62 cM with an average inter-locus distance of 1.08 cM. Furthermore, genome-wide sequence analysis was finished using 3,324 informative sequence-based markers and publicly-available Gossypium DNA sequence information. A total of 413,113 EST and 195 BAC sequences were physically anchored and clustered by 3,324 sequence-based markers. Of these, 14,243 ESTs and 188 BACs from different species of Gossypium were clustered and specifically anchored to the high-density genetic map. A total of 2,748 candidate unigenes from 2,111 ESTs clusters and 63 BACs were mined for functional annotation and classification. The 337 ESTs/genes related to fiber quality traits were integrated with 132 previously reported cotton fiber quality quantitative trait loci, which demonstrated the important roles in fiber quality of these genes. Higher-level sequence conservation between different cotton species and between the A- and D-subgenomes in tetraploid cotton was found, indicating a common evolutionary origin for orthologous and paralogous loci in Gossypium. Conclusion This study will serve as a valuable genomic resource
Nagler, Pamela L.; Pearlstein, Susanna; Glenn, Edward P.; Brown, Tim B.; Bateman, Heather L.; Bean, Dan W.; Hultine, Kevin R.
2013-01-01
We measured the rate of dispersal of saltcedar leaf beetles (Diorhabda carinulata), a defoliating insect released on western rivers to control saltcedar shrubs (Tamarix spp.), on a 63 km reach of the Virgin River, U.S. Dispersal was measured by satellite imagery, ground surveys and phenocams. Pixels from the Moderate Resolution Imaging Spectrometer (MODIS) sensors on the Terra satellite showed a sharp drop in NDVI in midsummer followed by recovery, correlated with defoliation events as revealed in networked digital camera images and ground surveys. Ground surveys and MODIS imagery showed that beetle damage progressed downstream at a rate of about 25 km yr−1 in 2010 and 2011, producing a 50% reduction in saltcedar leaf area index and evapotranspiration by 2012, as estimated by algorithms based on MODIS Enhanced Vegetation Index values and local meteorological data for Mesquite, Nevada. This reduction is the equivalent of 10.4% of mean annual river flows on this river reach. Our results confirm other observations that saltcedar beetles are dispersing much faster than originally predicted in pre-release biological assessments, presenting new challenges and opportunities for land, water and wildlife managers on western rivers. Despite relatively coarse resolution (250 m) and gridding artifacts, single MODIS pixels can be useful in tracking the effects of defoliating insects in riparian corridors.
International Nuclear Information System (INIS)
Cardenas, A.; Lewinsohn, J.; Auger, C.; Downs, J.L.; Cadwell, L.L.; Burrows, R.
1997-09-01
The Hanford Site contains one of the few remaining contiguous areas of shrub-steppe habitat left in Washington State. This habitat is home to many native plant and wildlife species, some of which are threatened with extinction or are unique to the Site. The importance of the Hanford Site increases as other lands surrounding the Site are developed, and these native species and habitats are lost. Stands of Wyoming big sagebrush (Artemisia tridentata ssp. wyomingensis) on the Site are a particularly important component of shrub-steppe habitat, because a number of wildlife require big sagebrush for food and cover. Since 1993, researchers and field biologists have made anecdotal observations of dying and declining sagebrush in stands of shrubs near the 100 Areas. This study was initiated to delineate and document the general boundary where sagebrush stands appear to be declining. We mapped the areal extent of the die-off using a global positioning system and found that the central portion of the die-off encompasses 280 hectares. Shrub stand defoliation was estimated to be near or greater than 80% in this area. The remainder of the die-off area exhibits varying mixtures of completely defoliated, partially defoliated, and healthy-looking stands. Declining sagebrush stands comprise a total of 1776 hectares
Energy Technology Data Exchange (ETDEWEB)
Cardenas, A.; Lewinsohn, J.; Auger, C.; Downs, J.L.; Cadwell, L.L.; Burrows, R.
1997-09-01
The Hanford Site contains one of the few remaining contiguous areas of shrub-steppe habitat left in Washington State. This habitat is home to many native plant and wildlife species, some of which are threatened with extinction or are unique to the Site. The importance of the Hanford Site increases as other lands surrounding the Site are developed, and these native species and habitats are lost. Stands of Wyoming big sagebrush (Artemisia tridentata ssp. wyomingensis) on the Site are a particularly important component of shrub-steppe habitat, because a number of wildlife require big sagebrush for food and cover. Since 1993, researchers and field biologists have made anecdotal observations of dying and declining sagebrush in stands of shrubs near the 100 Areas. This study was initiated to delineate and document the general boundary where sagebrush stands appear to be declining. We mapped the areal extent of the die-off using a global positioning system and found that the central portion of the die-off encompasses 280 hectares. Shrub stand defoliation was estimated to be near or greater than 80% in this area. The remainder of the die-off area exhibits varying mixtures of completely defoliated, partially defoliated, and healthy-looking stands. Declining sagebrush stands comprise a total of 1776 hectares.
African Journal of Biotechnology - Vol 2, No 5 (2003)
African Journals Online (AJOL)
Bioinformatic tools and guideline for PCR primer design · EMAIL FREE FULL TEXT ... shoot regeneration and localization of transgene expression in greenhouse ... in cotton Gossypium Spp. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
African Journals Online (AJOL)
User
formulated were cotton-seed Gossypium spp. meal replaced fish meal at graded levels of. 20%, 30%, 40% ... from capture fisheries, which has still not been able to ..... Marine Resource Occasional. ... Symposium on Tilapia in Aquaculture, Rio.
Lifescience Database Archive (English)
Full Text Available GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 432 e-121 sp|O24339|CATA_SOLAP Catalase OS=Soldanella al...t: 181 ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFH 225 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina
Forest report 2014; Waldzustandsbericht 2014
Energy Technology Data Exchange (ETDEWEB)
NONE
2014-07-01
This forest report of Hesse (Germany) contains the following topics: weather and climate, forest protection, crown defoliation, infiltrated substances, environmental monitoring, insects and fungi, and water quality of forest streams.
Carry-over effect of Thidiazuron on banana in vitro proliferation at ...
African Journals Online (AJOL)
USER
2010-05-24
May 24, 2010 ... proliferation at different culture cycles and light incubation conditions ... The results further showed dark conditions enhanced higher proliferation rates than light conditions in some ... the equatorial belt of Africa stretching from East to West. (Hallam ..... working on eastern black walnut (Juglans nigra) cotyle-.
Energy Technology Data Exchange (ETDEWEB)
Van Schip, W.M.; Towill, W.D.; Zago, T.
1990-12-31
The objective of this study was to determine whether balsam fir stands, thinned to different levels of basal area, differ in their susceptibility and vulnerability to damage created by infestations of spruce budworm. In 1976-77, the investigators thinned two relatively pure, juvenile, second-growth balsam fir stands in northwestern Ontario to four levels of basal area by girdling or felling. The stands were assessed in 1988. Annual aerial and ground monitoring of the study sites indicated that one area experienced a moderate to severe defoliation by spruce budworm during 1984-86, while the other area experienced moderate to severe defoliation by budworm during 1980-86. This report presents results of the study and discusses the relation between thinning, budworm damage, and stand productivity.
African Journals Online (AJOL)
Items 101 - 150 of 775 ... ... (watermelon) extract against lipid oxidation in fish during cooking, Abstract PDF ... Vol 8, No 2 (2015), Assessment of cotton-seed (Gossypium ... to Vigna unguiculata l (beans) grown on crude oil contaminated soil ...
Aerial spray trials for pear thrips management fall 1988
H. Brenton Teillon; Bruce L. Parker
1991-01-01
The defoliation from pear thrips, Taeniothrips inconsequens (Uzel), in 1988 caused a great deal of public concern throughout the entire State of Vermont and the New England region (Parker et al. 1988).
Spectral discrimination of two pigweeds from cotton with different leaf colors
To implement strategies to control Palmer amaranth (Amaranthus palmeri S. Wats.) and redroot pigweed (Amaranthus retroflexus L.) infestations in cotton (Gossypium hirsutum L.) production systems, managers need effective techniques to identify the weeds. Leaf light reflectance measurements have shown...
Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.
2001-01-01
The effects of feeding Spodoptera littoralis(Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor (Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar
Responses of reniform nematode and browntop millet to tillage, cover crop, and herbicides in cotton
Cropping practices that reduce competition from reniform nematode (Rotylenchulus reniformis) and browntop millet (Urochlora ramosum) may help minimize losses in cotton (Gossypium hirsutum). The impacts of tillage, rye cover crop, and preemergence and postemergence herbicides on cotton yields, renifo...
Doyle, T.W.; Smith, T. J.; Robblee, M.B.
1995-01-01
On August 24, 1992, Hurricane Andrew downed and defoliated an extensive swath of mangrove trees across the lower Florida peninsula. Permanent field sites were established to assess the extent of forest damage and to monitor the rate and process of forest recovery. Canopy trees suffered the highest mortality particularly for sites within and immediately north of the storm's eyewall. The type and extent of site damage, windthrow, branch loss, and defoliation generally decreased exponentially with increasing distance from the storm track. Forest damage was greater for sites in the storm's right quadrant than in the left quadrant tor the same given distance from the storm center. Stand exposure, both horizontally and vertically, increased the susceptibility and probability of forest damage and accounted for much of the local variability. Slight species differences were found. Laguncularia racemosa exceeded Avicennia germinans and Rhizophora mangle in damage tendency under similar wind conditions. Azimuths of downed trees were strongly correlated with maximum wind speed and vector based on a hurricane simulation of the storm. Lateral branch loss and leaf defoliation on sites without windthrow damage indicated a degree of crown thinning and light penetration equivalent to treefall gaps under normally intact forest conditions. Mangrove species and forests are susceptible to catastrophic disturbance by hurricanes; the impacts of which are significant to changes in forest structure and function.
Directory of Open Access Journals (Sweden)
Julio Pedro Laca-Buendia
1985-12-01
Full Text Available Com a finalidade de estudar a mistura de tanque mais eficiente com cyanazine em aplicação de pré-emergência na cultura algodoeira (Gossypium hirsutum L. , foram estudados os seguintes tratamentos: cyanazine + diuron nas doses de 0,8 + 0,8 kg i.a/ha e 1,0 + 1,0 kg i.a/ha; cyanazine+ oryzalin , nas do sés de 1,2 + 0,8 kg i.a/ha e 1,6 + 1,2 kg i.a/h a; cyanazyne + metol a chlor, nas doses de 1,4 + 2,0 kg i.a/ha e 1,75 + 2,52 kg i.a/ ha;cianazine na dose de 1,75 kg i.a /ha; oryzalin na dose de 1,12 kg i.a/ha; metol achlor na dose de 2,52 kg i.a /ha e diuron na dose de 1,6 kg i.a /ha. Para efeito de comparação, utilizou-se uma testemunha sem capina e outra com capina manual. Nenhum tratamento apresentou injúria para as plantas de algodão e não houve diferenças significativas para o "stand" inicial. Já no "stand" final, a testemunha sem capina apresentou o menor número de plantas, sendo que não houve diferenças significativas dos outros tratamentos com a testemunha capinada. Para o rendimento, a mistura cyanazine + metolachior em ambas as doses estudadas, não apresentaram diferenças significativas da testemunha capinada. Quanto à altura da planta, peso de 100 sementes, porcentagem e índice de fibras não houve diferenças significativas entre os tratamentos estudados, somente o peso do capulho foi afetado pelo oryzalin. Pela avaliação visual (EWRC 1 a 9*, os herbicidas apres entaram um controle satisfatório somente até os 30 dias após aplicação, sendo que a mistura cyanazine + metolachlor foi efici ente quanto a testemunha capinada. No controle da Portulaca oleracea , a mistura cyanazine + oryzalin na maior dose e oryzalin apresentaram 71,4% de controle ate os 30 dias e 79,4% e 82,4%, respectivamente, até 45 dias da aplicação. Para Amaranthus sp., à exceção da cyanazine e cyanazine + diuron nas doses menores, não apresentaram nenhum controle, sendo que os outros herbicidas controlaram com eficiência superior a 70
Dicty_cDB: Contig-U04458-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available um L. Gossypium hi... 36 7.6 2 ( FG288839 ) 1108793284722 New World Screwworm Egg 9261 ESTs C... 28 7.7 4 ( ... 32 8.5 3 ( FG283787 ) 1108770637102 New World Screwworm Egg 9261 ESTs C... 28 8.
Construction of microsatellite-based linkage map and mapping of ...
Indian Academy of Sciences (India)
Gossypium tomentosum, a wild tetraploid cotton species with AD genomes, possesses genes conferring strong fibers and high heat tolerance. ... State Key Laboratory of Crop Genetics and Germplasm Enhancement, Cotton Research Institute, Nanjing Agricultural University, Nanjing 210095, People's Republic of China ...
Regulation of auxin on secondary cell wall cellulose biosynthesis in developing cotton fibers
Cotton (Gossypium hirsutum L.) fibers are unicellular trichomes that differentiate from epidermal cells of developing cotton ovules. Mature fibers exhibit thickened secondary walls composed of nearly pure cellulose. Cotton fiber development is divided into four overlapping phases, 1) initiation sta...
Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.
2001-01-01
The effects of feeding Spodoptera a littoralis (Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor ((Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar
Reproduction and pathogenicity of endemic populations of Rotylenchulus reniformis on cotton
The reniform nematode (Rotylenchulus reniformis) is the predominant parasitic nematode of upland cotton (Gossypium hirsutum) in the southern United States. Little is known about variability in geographic isolates of reniform nematode. In order to evaluate the comparative reproduction and pathogenici...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 2e-27 ...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 5e-27 ...
Arabidopsis CDS blastp result: AK242585 [KOME
Lifescience Database Archive (English)
Full Text Available AK242585 J090010M20 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 1e-123 ...
Arabidopsis CDS blastp result: AK242890 [KOME
Lifescience Database Archive (English)
Full Text Available AK242890 J090079L19 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-48 ...
Arabidopsis CDS blastp result: AK242601 [KOME
Lifescience Database Archive (English)
Full Text Available AK242601 J090014G03 At4g24000.1 68417.m03449 cellulose synthase family protein similar to cellulose... synthase from Gossypium hirsutum [gi:1706956], cellulose synthase-5 from Zea mays [gi:9622882] 4e-25 ...
Lifescience Database Archive (English)
Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le
Earthworm populations are affected from Long-Term Crop Sequences and Bio-Covers under No-Tillage
Earthworms are crucial for improving soil biophysical properties in cropping systems. Consequently, effects of cropping rotation and bio-covers were assessed on earthworm populations under no-tillage sites. Main effects of 6 different cropping sequences [corn (Zea mays), cotton (Gossypium hirsutum),...
It's the Kd, StupidZ Practical Observations Concerning U.S. Drug Policy and Plan Columbia
National Research Council Canada - National Science Library
Grotke, Mark
2001-01-01
.... The operative idea for Plan Colombia is that US military and non-military aid will allow the Colombian authorities to defoliate thousands of acres of land now under cultivation to produce cocaine and heroin...
Banko, Paul C.; Peck, Robert W.; Yelenik, Stephanie G.; Paxton, Eben H.; Bonaccorso, Frank J.; Montoya-Aiona, Kristina; Foote, David
2014-01-01
A massive outbreak of the koa moth (Geometridea: Scotorythra paludicola) defoliated more than a third of the koa (Acacia koa) forest on Hawai‘i Island during 2013−2014. This was the largest koa moth outbreak ever recorded and the first on the island since 1953. The outbreak spread to sites distributed widely around the island between 800−2,000 m elevation and in wet rainforest to dry woodland habitats. We monitored the outbreak at two windward forest sites (Laupāhoehoe and Saddle Road Kīpuka) and one leeward forest site (Kona), and we studied the dynamics of the outbreak and its impacts on the forest ecosystem at Hakalau Forest National Wildlife Refuge, our higher elevation windward site. Study sites at Hakalau included two stands of koa that were planted (reforestation stands) in former cattle pastureland about 20 years earlier and two stands of koa that were dominated by ‘ōhi‘a (Metrosideros polymorpha) and that were naturally recovering from cattle grazing (forest stands). We observed one outbreak at Hakalau, multiple outbreaks at the two other windward sites, but no outbreak at the leeward site. Caterpillars at Hakalau reached peak estimated abundances of more than 250,000 per tree and 18,000,000 per hectare, and they removed between 64−93% of the koa canopy in managed forest stands. Defoliation was more extensive in naturally recovering forest, where ‘ōhi‘a dominated and koa was less abundant, compared to the planted stands, where koa density was high. Koa trees were still growing new foliage six months after being defoliated, and leaves were produced in greater proportion to phyllodes, especially by small koa (≤ 8 cm dbh) and by larger trees in forest stands, where light levels may have remained relatively low after defoliation due to the high cover of ‘ōhi‘a. Small branches of many trees apparently died, and canopy regrowth was absent or low in 9% of koa trees and seedlings, which indicates the likely level of mortality. Between 2
Methylation sensitive amplified polymorphism (MSAP) reveals that ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... Key words: Salt stress, alkali stress, Gossypium hirsutum L., DNA methylation, methylation sensitive amplified polymorphism (MSAP). INTRODUCTION. DNA methylation is one of the key epigenetic mecha- nisms among eukaryotes that can modulate gene expression without the changes of DNA sequence.
The declining saturated thickness of the Ogallala Aquifer combined with the unpredictability of precipitation during the growing season in the Southern High Plains has resulted in elevated production risks associated with short-term crop water deficits. Cotton (Gossypium spp.) cultivars that can use...
Crop response to biochar under differing irrigation levels in the southeastern USA
Application of biochar to soils is hypothesized to increase crop yield. Crop productivity impacts of biochar application in Southeastern cropping systems consisting of peanut (Arachis hypogaea L.), corn (Zea mays L.), and cotton (Gossypium hirsutum L.) produced under varying rates of irrigation have...
Detecting cotton boll rot with an electronic nose
South Carolina Boll Rot is an emerging disease of cotton, Gossypium hirsutum L., caused by the opportunistic bacteria, Pantoea agglomerans (Ewing and Fife). Unlike typical fungal diseases, bolls infected with P. agglomerans continue to appear normal externally, complicating early and rapid detectio...
Airborne multispectral detection of regrowth cotton fields
Regrowth of cotton, Gossypium hirsutum L., can provide boll weevils, Anthonomus grandis Boheman, with an extended opportunity to feed and reproduce beyond the production season. Effective methods for timely areawide detection of these potential host plants are critically needed to achieve eradicati...
The southern green stink bug, Nezara viridula (L.) (Hemiptera: Pentatomidae), is a cosmopolitan pest of high-value cash crops, including cotton (Gossypium hirsutum L.; Malvales: Malvaceae). The pest can ingest and transmit disease-causing bacterial and fungal pathogens of cotton. We hypothesized t...
Genetic diversity in reproductive abiotic stress tolerance has been reported for cotton [Gossypium hirsutum (L.)] based upon the percentage of anther dehiscence of mature pollen in adverse environments. This study investigated the abiotic stress tolerance of mature pollen and identified genetic vari...
Relationship between NDVI at early bloom and yield in germplasm evaluation trials
The use of high-throughput phenotyping (HTP) equipment is expanding as it offers the potential to increase the efficiency of making selections in cotton (Gossypium hirsutum L.) improvement programs. Measurements often being collected on HTP field equipment include normalized difference vegetative in...
Cotton (Gossypium hirsutum L.) producers in Alabama and across the Cotton Belt are faced with a rapidly expanding problem that decreases yields and increases production costs: herbicide-resistant weeds. Producers are increasingly relying on production methods that raise production costs, such as add...
The plasma membrane intrinsic proteins (PIP) are one of the five aquaporin protein subfamilies. Aquaporin proteins are known to facilitate water transport through biological membranes. In order to identify NIP aquaporin gene candidates in cotton (Gossypium hirsutum L.), in silico and molecular clon...
Lifescience Database Archive (English)
Full Text Available 04 sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum G... 376 e-104 sp|O24339|CATA_SOLAP Catala...ALKPNPKSHIQENWRILDFFSHHP 180 Query: 619 ESMHMFSW 642 ES+HMF++ Sbjct: 181 ESLHMFTF 188 >sp|O24339|CATA_SOLAP
IDENTIFICATION AND CHARACTERIZATION OF NEW miRNAs IN ...
African Journals Online (AJOL)
Pathmanaban
2012-09-20
Sep 20, 2012 ... simplest and rapid method of identification of miRNAs is relied on in silico analysis. ... (NRs), are available for several plant species and can be used for ... Currently, there are 89 miRNAs deposited under. Gossypium at Plant ...
Directory of Open Access Journals (Sweden)
Xiaoyan Wang
Full Text Available Extensive studies on floral transition in model species have revealed a network of regulatory interactions between proteins that transduce and integrate developmental and environmental signals to promote or inhibit the transition to flowering. Previous studies indicated FLOWERING PROMOTING FACTOR 1 (FPF1 gene was involved in the promotion of flowering, but the molecular mechanism was still unclear. Here, FPF1 homologous sequences were screened from diploid Gossypium raimondii L. (D-genome, n = 13 and Gossypium arboreum L. genome (A-genome, n = 13 databases. Orthologous genes from the two species were compared, suggesting that distinctions at nucleic acid and amino acid levels were not equivalent because of codon degeneracy. Six FPF1 homologous genes were identified from the cultivated allotetraploid Gossypium hirsutum L. (AD-genome, n = 26. Analysis of relative transcripts of the six genes in different tissues revealed that this gene family displayed strong tissue-specific expression. GhFPF1, encoding a 12.0-kDa protein (Accession No: KC832319 exerted more transcripts in floral apices of short-season cotton, hinting that it could be involved in floral regulation. Significantly activated APETALA 1 and suppressed FLOWERING LOCUS C expression were induced by over-expression of GhFPF1 in the Arabidopsis Columbia-0 ecotype. In addition, transgenic Arabidopsis displayed a constitutive shade-avoiding phenotype that is characterized by long hypocotyls and petioles, reduced chlorophyll content, and early flowering. We propose that GhFPF1 may be involved in flowering time control and shade-avoidance responses.
Wubben, Martin J; Callahan, Franklin E; Jenkins, Johnie N; Deng, Dewayne D
2016-09-01
Genetic analysis of MIC-3 transgene with RKN resistance QTLs provides insight into the resistance regulatory mechanism and provides a framework for testing additional hypotheses. Resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. The MIC-3 (Meloidogyne Induced Cotton3) protein accumulates specifically within the immature galls of RKN-resistant plants that possess these QTLs. Recently, we showed that MIC-3 overexpression in an RKN-susceptible cotton genotype suppressed RKN egg production but not RKN-induced root galling. In this study, the MIC-3 overexpression construct T-DNA in the single-copy transgenic line '14-7-1' was converted into a codominant molecular marker that allowed the marker assisted selection of F2:3 cotton lines, derived from a cross between 14-7-1 and M-240 RNR, having all possible combinations of the chromosomes 11 and 14 QTLs with and without the MIC-3 overexpression construct. Root-knot nematode reproduction (eggs g(-1) root) and severity of RKN-induced root galling were assessed in these lines. We discovered that the addition of MIC-3 overexpression suppressed RKN reproduction in lines lacking both resistance QTLs and in lines having only the chromosome 14 QTL, suggesting an additive effect of the MIC-3 construct with this QTL. In contrast, MIC-3 overexpression did not improve resistance in lines having the single chromosome 11 QTL or in lines having both resistance QTLs, suggesting an epistatic interaction between the chromosome 11 QTL and the MIC-3 construct. Overexpression of MIC-3 did not affect the severity of RKN-induced root galling regardless of QTL genotype. These data provide new insights into the relative order of action of the chromosomes 11 and 14 QTLs and their potential roles in regulating MIC-3 expression as part of the RKN resistance response.
Missing cycles: Effect of climate change on population dynamics
Indian Academy of Sciences (India)
population dynamics of the larch budmoth – an insect pest which causes massive defoliation of entire larch forests ... hypothesized that global warming has led to the collapse of the cycles ... When temperatures increase after winter, and the.
Demonstration of the gypsy moth energy budget microclimate model
D. E. Anderson; D. R. Miller; W. E. Wallner
1991-01-01
The use of a "User friendly" version of "GMMICRO" model to quantify the local environment and resulting core temperature of GM larvae under different conditions of canopy defoliation, different forest sites, and different weather conditions was demonstrated.
Insecticide use and practices among cotton farmers in northern ...
African Journals Online (AJOL)
Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...
The boll weevil, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), has been the most important pest of cotton (Gossypium spp.) wherever it occurs. Although eradication programs in the U.S. have reduced the range of this pest, the weevil remains an intractable problem in subtropical Tex...
Status of the boll weevil, Anthonomus grandis grandis Boheman, as a pest of cotton (Gossypium spp.) in the United States has diminished because of progress by eradication programs. However, this pest remains of critical importance in South America, and intractable populations in extreme South Texas ...
• Actin polymerizes to form the cytoskeleton and organize polar growth in all eukaryotic cells. Species with numerous actin genes are especially useful for the dissection of actin molecular function due to redundancy and neofunctionalization. Here, we investigated the role of a cotton (Gossypium hi...
Linkage disequilibrium and association mapping of drought ...
African Journals Online (AJOL)
Drought stress is a major abiotic stress that limits crop production. Molecular association mapping techniques through linkage disequilibrium (LD) can be effectively used to tag genomic regions involved in drought stress tolerance. With the association mapping approach, 90 genotypes of cotton Gossypium hirsutum, from ...
Determination of environmental influence on seed traits is critical for genetic improvement of seed quality in Upland cotton (Gossypium hirsutum L.). The objective of this study was to analyze the relative contribution of environment and genotype (G) for seed oil, nitrogen (N), and gossypol content...
Xia, J.
1997-01-01
Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on
Evaluation of various substrates and supplements for biological ...
African Journals Online (AJOL)
An experiment was conducted to determine the effects of different substrates namely wheat straw (Triticum aestivum), maize stover (Zea mays L), thatch grass (Hyparrhenia filipendula) and oil/protein rich supplements (maize bran, cottonseed hull [Gossypium hirsutum]) on biological efficiency of two oyster mushroom ...
Locally severe outbreaks of Fusarium wilt of cotton (Gossypium spp.) in South Georgia raised concerns about the genotypes of the causal pathogen, Fusarium oxysporum f. sp. vasinfectum. Vegetative complementation tests and DNA sequence analysis were used to determine genetic diversity among 492 F. ox...
Cotton Leaf Curl virus Disease (CLCuD) has caused enormous losses in cotton (Gossypium hirsutum) production in Pakistan. RNA interference (RNAi) is an emerging technique that could knock out CLCuD by targeting different regions of the pathogen genome that are important for replication, transcription...
Irrigation water availability is decreasing due to declining water sources and greater competition. Many producers must now comply with annual pumping restrictions that may limit overall productivity of crops like corn (Zea mays L.). Cotton [Gossypium hirsutum (L.)] water demand is less than corn, b...
Identification of resistance to Aspergillus flavus infection in cotton germplasm
Natural resistance of in cottonseed to Aspergillus flavus infection has not been explored to date. A green fluorescent protein (GFP) expressing -70 strain was used to assess the resistance of seed from thirty five35 cotton varieties including representatives from Gossypium arboreum, G. barbadense, a...
Dicty_cDB: Contig-U09533-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5
VAM populations in relation to grass invasion associated with forest decline.
Vosatka, M; Cudlin, P; Mejstrik, V
1991-01-01
Spruce stands in Northern Bohemia forests, damaged to various degrees by industrial pollution, have shown establishment of grass cover following tree defoliation. Populations of vesicular-arbuscular mycorrhizal (VAM) fungi were studied under this grass cover in four permanent plots with spruce under different levels of pollution stress. Soil and root samples were collected in April and June within each plot as follows: (1) sites without grass, (2) sites with initial stages of grass invasion, and (3) sites with fully developed grass cover. In all plots, the highest number of propagules were recovered from samples taken from sites having full grass cover. Mycorrhizal infection of grass was highest in the plot with the severest pollution damage and lowest in the least damaged plot. The development of grass cover and VAM infection of grass increased with tree defoliation caused by air pollution.
Forest report 2013; Waldzustandsbericht 2013
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-07-01
This forest report of Lower Saxony (Germany) contains the following topics: weather and climate, forest protection, crown defoliation, infiltrated substances, environmental monitoring, insects and fungi, forest soil survey and forest site mapping, and nutritional status of beech on loess.
Directory of Open Access Journals (Sweden)
Telma Fátima Vieira Batista
2013-06-01
Full Text Available The objective of this research was to describe the biological and morphometric aspects of the parica tree defoliator, Syssphinx molina (Cramer, and make recommendations about the insect rearing. The life cycle was 62.9 days with mean periods for the egg, larval, pre-pupal and pupal stages of 5.6, 31.1, 2.2 and 16.6 days respectively. The pupal viability was 60.5% for females and 48.6% for males. The sexual ratio was 0.5 with mean production of 182.3 ± 2.2 eggs per female and egg viability of 24.3%. The mean longevity was 7.9 ± 2 and 8.1 ± 3 days for females and males respectively. Other parameters were also observed and compared with description of other Saturniidae species.O objetivo desse trabalho foi descrever os aspectos biológicos e morfométricos da lagarta desfolhadora do paricá, Syssphinx molina (Cramer, e fazer recomendações para a criação do inseto. O ciclo de vida foi de 62,9 dias com períodos médios para as fases de ovo, lagarta, pré-pupa e pupa de 5,6; 31,1; 2,2 e 16,6 dias, respectivamente. A viabilidade das pupas foi de 60,5% para fêmeas e 48,6% nos machos. A razão sexual foi de 0,5 e a produção média de 182,3 ± 2,2 ovos por fêmea com viabilidade de ovos de 24,3%. A longevidade média foi de 7,9 ± 2 e 8,1 ± 3 dias para fêmeas e machos, respectivamente. Outros parâmetros foram igualmente observados e comparados com a descrição de outras espécies de Saturniidae.
Application of mixed models for the assessment genotype and ...
African Journals Online (AJOL)
Application of mixed models for the assessment genotype and environment interactions in cotton ( Gossypium hirsutum ) cultivars in Mozambique. ... The cultivars ISA 205, STAM 42 and REMU 40 showed superior productivity when they were selected by the Harmonic Mean of Genotypic Values (HMGV) criterion in relation ...
Yield response and economics of shallow subsurface drip irrigation systems
Field tests were conducted using shallow subsurface drip irrigation (S3DI) on cotton (Gossypium hirsutum, L.), corn (Zea mays, L.), and peanut (Arachis hypogeae, L.) in rotation to investigate yield potential and economic sustainability of this irrigation system technique over a six year period. Dri...
High levels of resistance to root-knot nematode (RKN) (Meloidogyne incognita) in Upland cotton (Gossypium hirsutum) is mediated by two major quantitative trait loci (QTL) located on chromosomes 11 and 14. We had previously determined that MIC-3 expression played a direct role in suppressing RKN egg...
Development of DNA barcodes of genus Lygus Hahn (Hemiptera: Miridae)
The genus Lygus (Hemiptera: Miridae) is an important group of insects that contains 43 known species worldwide. Some species within this genus are important agricultural pests in North America. Annual economic impacts in cotton, Gossypium hirsutum L., from Lygus spp. due to yield losses and control ...
Effect of different light quality on DNA methylation variation for brown ...
African Journals Online (AJOL)
DNA methylation plays an important role in regulating gene expression during plant development. We studied the effects of different light quality on DNA methylation patterns of brown cotton (Gossypium hirstum) by using the methylation sensitive amplified polymorphism (MSAP). We selected 66 pairs of MSAP selective ...
Cui, J.J.; Luo, J.Y.; Werf, van der W.; Ma, Y.; Xia, J.Y.
2011-01-01
Transgenic cotton (Gossypium hirsutum L.) varieties, adapted to China, have been bred that express two genes for resistance to insects. the Cry1Ac gene from Bacillus thuringiensis (Berliner) (Bt), and a trypsin inhibitor gene from cowpea (CpTI). Effectiveness of the double gene modification in
African Journal of Biotechnology - Vol 10, No 38 (2011)
African Journals Online (AJOL)
Lowering virus attack with improved yield and fiber quality in different cotton genotypes by early sown cotton (Gossypium hirsutum L.) EMAIL FREE FULL TEXT ... typhimurium in rainbow trout stored under aerobic, modified atmosphere and vacuum packed conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Borssum Waalkes, van J.
1966-01-01
The Malvaceae have always enjoyed a vivid interest from botanists, in particular on account of the fact that many species have showy flowers and are appreciated as ornamentals throughout the world. In addition many species are of outstanding economical value, e.g. in the genera Gossypium and
Long-term effects of conservation systems on productivity for the old rotation
Winter legumes in cotton (Gossypium hirsutum L.) production is not new to the Southeast. In 1896, the Old Rotation experiment at Auburn University was established to study the feasibility of producing cotton in crop rotations with winter legumes managed as a green manure crop. Throughout the experim...
Recent studies have suggested that cottonseed (Gossypium spp.) has the potential to contribute to the effort against world hunger, particularly by providing a high-quality protein source. This report analyzed the diversity in protein content and other seed quality factors in the U.S. National Cotton...
Effects of 1,1-Dimethylpiperidinium Chloride on the Pests and Allelochemicals of Cotton and Pecan.
P. A. Hedin; J. N. Jenkins; J. C. McCarty; J. E. Mulrooney; W. L. Parrott; A. Borazjani; C. H. Graves; T. H. Filer
1984-01-01
The growth regulator, PIX (mepiquat chloride - 1,1-dimethyl-piperdinium chloride), when applied to cotton (Gossypium hirsutum L.) and pecan (Carya illinoensis Koch), caused internode shortening. PIX did not elicit an increase in resistance in cotton to the tobacco budworm (Heliothis virescens (Fab.)], or in pecan...
Sugar alcohols-induced oxidative metabolism in cotton callus culture
African Journals Online (AJOL)
Sugar alcohols (mannitol and sorbitol) may cause oxidative damage in plants if used in higher concentration. Our present experiment was undertaken to study physiological and metabolic responses in cotton (Gossypium hirsutum L.) callus against mannitol and sorbitol higher doses. Both markedly declined mean values of ...
Huang, Yu; Wei, Xiaoyang; Zhou, Shiguang; Liu, Mingyong; Tu, Yuanyuan; Li, Ao; Chen, Peng; Wang, Yanting; Zhang, Xuewen; Tai, Hongzhong; Peng, Liangcai; Xia, Tao
2015-04-01
In this study, steam explosion pretreatment was performed in cotton stalks, leading to 5-6 folds enhancements on biomass enzymatic saccharification distinctive in Gossypium barbadense and Gossypium hirsutum species. Sequential 1% H2SO4 pretreatment could further increase biomass digestibility of the steam-exploded stalks, and also cause the highest sugar-ethanol conversion rates probably by releasing less inhibitor to yeast fermentation. By comparison, extremely high concentration alkali (16% NaOH) pretreatment with raw stalks resulted in the highest hexoses yields, but it had the lowest sugar-ethanol conversion rates. Characterization of wall polymer features indicated that biomass saccharification was enhanced with steam explosion by largely reducing cellulose DP and extracting hemicelluloses. It also showed that cellulose crystallinity and arabinose substitution degree of xylans were the major factors on biomass digestibility in cotton stalks. Hence, this study has provided the insights into cell wall modification and biomass process technology in cotton stalks and beyond. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Jawdat, D.; Karajoli, I.
2007-05-01
Seeds from six varieties of Gossypium hirusutum and from one variety of Gossypium barbadense were cultured in plastic containers (20 x 60 x 30 cm) with compost (Terfgroup, Netherlands). Germination readings were taken 14 days after culture, where plants with first true leaf was chosen for readings. The highest percentages of germinations were 83.3 (C6040) and 80 % (Rakka 5). Seeds of Rakka 5 were subjected to gamma radiation (60 C o) with radiation activity of 4 kci using the Gamma cell (Isolvated, made in Russia) at the Radiation Technology department at the AECS. The following doses were used in a rate of 1.8548 KGry/h: 100,150, 200, 250, 300, 350,400 and 500 Gry. On the other hand, seeds of C6040 were subjected to 100,150,200, 250 and 300 Gry. The results indicated the effects of gamma radiation doses on germination rate, plant height, distance between cotyledons leaves and first true leaf and flowering time.(author)
Sex pheromone of the baldcypress leafroller (Lepidoptera: Tortricidae)
Brian T. Sullivan; Jeremy D. Allison; Richard A. Goyer; William P. Shepherd
2015-01-01
The baldcypress leafroller, Archips goyerana Kruse (Lepidoptera: Tortricidae), is a specialist on Taxodium distichum (L.) Richard and has caused serious defoliation in swamps of southeastern Louisiana, accelerating decline of baldcypress forests concurrently suffering from nutrient depletion, prolonged flooding, and saltwater...
Terrence J. Rogers
1996-01-01
This paper describes life histories, defoliation problems and other activities of insects associated with forest tree species growing along high elevation streams and river banks. In addition, examples of insects and diseases associated with lower elevation riparian areas are given.
Effectiveness of a biological control agent Palexorista gilvoides in ...
African Journals Online (AJOL)
Widespread defoliation of plantation forests by insect pests causes economic losses worldwide. Successful pest outbreak management requires knowledge of effective pest management options. Currently, such knowledge is inadequate for Gonometa podocarpi an indigenous pest that has devastated conifer plantations in ...
Phaeocryptopus gaeumannii is a widespread foliar parasite of Douglas-fir. Although normally innocuous, the fungus also causes the defoliating disease Swiss needle cast in heavily infected needles. The extent of P. gaeumannii colonization in Douglas-fir foliage was estimated wit...
Correlation between agronomic and stem borer resistant traits in ...
African Journals Online (AJOL)
SARAH
2015-06-30
Jun 30, 2015 ... Resistant traits had negative correlations with most agronomic traits including grain yield. (GY). .... on a scale of 1-9 with 1 = clean plant without leaf defoliation and 9 .... Negative signs indicate direction of relationship. Table 3 ...
Aerial electrostatic spray deposition and canopy penetration in cotton
Spray deposition on abaxial and adaxial leaf surfaces along with canopy penetration are essential for insect control and foliage defoliation in cotton production agriculture. Researchers have reported that electrostatically charged sprays have increased spray deposit onto these surfaces under widel...
A Tobacco rattle virus (TRV) based virus-induced gene silencing (VIGS) assay was employed as a reverse genetic approach to study gene function in cotton (Gossypium hirsutum). This approach was used to investigate the function of Enoyl-CoA reductase (GhECR) in pathogen defense. Amino acid sequence al...
Molecular cloning, structural analysis and expression of a zinc ...
African Journals Online (AJOL)
The results of prokaryotic expression of ZnBP and overexpression of the ZnBP gene in A. thaliana improve our understanding of the function of this gene. Future studies should investigate the molecular mechanisms involved in gland morphogenesis in cotton. Key words: Gossypium hirsutum, pigment gland, zinc binding ...
Review: Genetic diversity and population structure of cotton ...
African Journals Online (AJOL)
Cotton (Gossypium spp.) is the world's leading natural fiber crop and is cultivated in diverse temperate and tropical areas. In this sense, molecular markers are important tools for polymorphism identification in genetic diversity analyses. The objective of this study was to evaluate genetic diversity and population structure in ...
The boll weevil, Anthonomus grandis grandis Boheman, is an important pest of cotton (Gossypium spp.) in South America, Mexico, and southernmost Texas in the United States. A key factor in the persistence of the boll weevil is its ability to survive the non-cotton season. Mechanisms facilitating this...
Crop yield response to increasing biochar rates
The benefit or detriment to crop yield from biochar application varies with biochar type/rate, soil, crop, or climate. The objective of this research was to identify yield response of cotton (Gossypium hirsutum L.), corn (Zea mayes L.), and peanut (Arachis hypogaea L.) to hardwood biochar applied at...
Potentials for Use of Medicinal Plants in Female Reproductive ...
African Journals Online (AJOL)
USER
canadensis L.), and Chaste tree fruits (Vitex agnus- castus L.) are listed in the U. S. Pharmacopoeia and are available as dietary supplements to be used for premenstrual stress syndrome, as emmenagogue agents, and for gynaecological problems. Castor oil (Ricinus communis L.)18 and cotton bark root (Gossypium.