Rational Verification in Iterated Electric Boolean Games

Directory of Open Access Journals (Sweden)

Youssouf Oualhadj

2016-07-01

Full Text Available Electric boolean games are compact representations of games where the players have qualitative objectives described by LTL formulae and have limited resources. We study the complexity of several decision problems related to the analysis of rationality in electric boolean games with LTL objectives. In particular, we report that the problem of deciding whether a profile is a Nash equilibrium in an iterated electric boolean game is no harder than in iterated boolean games without resource bounds. We show that it is a PSPACE-complete problem. As a corollary, we obtain that both rational elimination and rational construction of Nash equilibria by a supervising authority are PSPACE-complete problems.

Race, Ethnicity, Psychosocial Factors, and Telomere Length in a Multicenter Setting.

Science.gov (United States)

Lynch, Shannon M; Peek, M K; Mitra, Nandita; Ravichandran, Krithika; Branas, Charles; Spangler, Elaine; Zhou, Wenting; Paskett, Electra D; Gehlert, Sarah; DeGraffinreid, Cecilia; Rebbeck, Timothy R; Riethman, Harold

2016-01-01

Leukocyte telomere length(LTL) has been associated with age, self-reported race/ethnicity, gender, education, and psychosocial factors, including perceived stress, and depression. However, inconsistencies in associations of LTL with disease and other phenotypes exist across studies. Population characteristics, including race/ethnicity, laboratory methods, and statistical approaches in LTL have not been comprehensively studied and could explain inconsistent LTL associations. LTL was measured using Southern Blot in 1510 participants from a multi-ethnic, multi-center study combining data from 3 centers with different population characteristics and laboratory processing methods. Main associations between LTL and psychosocial factors and LTL and race/ethnicity were evaluated and then compared across generalized estimating equations(GEE) and linear regression models. Statistical models were adjusted for factors typically associated with LTL(age, gender, cancer status) and also accounted for factors related to center differences, including laboratory methods(i.e., DNA extraction). Associations between LTL and psychosocial factors were also evaluated within race/ethnicity subgroups (Non-hispanic Whites, African Americans, and Hispanics). Beyond adjustment for age, gender, and cancer status, additional adjustments for DNA extraction and clustering by center were needed given their effects on LTL measurements. In adjusted GEE models, longer LTL was associated with African American race (Beta(β)(standard error(SE)) = 0.09(0.04), p-value = 0.04) and Hispanic ethnicity (β(SE) = 0.06(0.01), p-value = 0.02) compared to Non-Hispanic Whites. Longer LTL was also associated with less than a high school education compared to having greater than a high school education (β(SE) = 0.06(0.02), p-value = 0.04). LTL was inversely related to perceived stress (β(SE) = -0.02(0.003), pethnic circumstances and could impact future health disparity studies.

Research on vehicles and cargos matching model based on virtual logistics platform

Science.gov (United States)

Zhuang, Yufeng; Lu, Jiang; Su, Zhiyuan

2018-04-01

Highway less than truckload (LTL) transportation vehicles and cargos matching problem is a joint optimization problem of typical vehicle routing and loading, which is also a hot issue of operational research. This article based on the demand of virtual logistics platform, for the problem of the highway LTL transportation, the matching model of the idle vehicle and the transportation order is set up and the corresponding genetic algorithm is designed. Then the algorithm is implemented by Java. The simulation results show that the solution is satisfactory.

Deciding as Intentional Action: Control over Decisions

Science.gov (United States)

Shepherd, Joshua

2015-01-01

Common-sense folk psychology and mainstream philosophy of action agree about decisions: these are under an agent's direct control, and are thus intentional actions for which agents can be held responsible. I begin this paper by presenting a problem for this view. In short, since the content of the motivational attitudes that drive deliberation and decision remains open-ended until the moment of decision, it is unclear how agents can be thought to exercise control over what they decide at the moment of deciding. I note that this problem might motivate a non-actional view of deciding—a view that decisions are not actions, but are instead passive events of intention acquisition. For without an understanding of how an agent might exercise control over what is decided at the moment of deciding, we lack a good reason for maintaining commitment to an actional view of deciding. However, I then offer the required account of how agents exercise control over decisions at the moment of deciding. Crucial to this account is an understanding of the relation of practical deliberation to deciding, an understanding of skilled deliberative activity, and the role of attention in the mental action of deciding. PMID:26321765

Race, Ethnicity, Psychosocial Factors, and Telomere Length in a Multicenter Setting.

Directory of Open Access Journals (Sweden)

Shannon M Lynch

Full Text Available Leukocyte telomere length(LTL has been associated with age, self-reported race/ethnicity, gender, education, and psychosocial factors, including perceived stress, and depression. However, inconsistencies in associations of LTL with disease and other phenotypes exist across studies. Population characteristics, including race/ethnicity, laboratory methods, and statistical approaches in LTL have not been comprehensively studied and could explain inconsistent LTL associations.LTL was measured using Southern Blot in 1510 participants from a multi-ethnic, multi-center study combining data from 3 centers with different population characteristics and laboratory processing methods. Main associations between LTL and psychosocial factors and LTL and race/ethnicity were evaluated and then compared across generalized estimating equations(GEE and linear regression models. Statistical models were adjusted for factors typically associated with LTL(age, gender, cancer status and also accounted for factors related to center differences, including laboratory methods(i.e., DNA extraction. Associations between LTL and psychosocial factors were also evaluated within race/ethnicity subgroups (Non-hispanic Whites, African Americans, and Hispanics.Beyond adjustment for age, gender, and cancer status, additional adjustments for DNA extraction and clustering by center were needed given their effects on LTL measurements. In adjusted GEE models, longer LTL was associated with African American race (Beta(β(standard error(SE = 0.09(0.04, p-value = 0.04 and Hispanic ethnicity (β(SE = 0.06(0.01, p-value = 0.02 compared to Non-Hispanic Whites. Longer LTL was also associated with less than a high school education compared to having greater than a high school education (β(SE = 0.06(0.02, p-value = 0.04. LTL was inversely related to perceived stress (β(SE = -0.02(0.003, p<0.001. In subgroup analyses, there was a negative association with LTL in African Americans with a high

Patterns for a log-based strengthening of declarative compliance models

NARCIS (Netherlands)

Schunselaar, Dennis M.M.; Maggi, Fabrizio M.; Sidorova, Natalia

2012-01-01

LTL-based declarative process models are very effective when modelling loosely structured processes or working in environments with a lot of variability. A process model is represented by a set of constraints that must be satisfied during the process execution. An important application of such

Smoking habits and leukocyte telomere length dynamics among older adults: Results from the ESTHER cohort.

Science.gov (United States)

Müezzinler, Aysel; Mons, Ute; Dieffenbach, Aida Karina; Butterbach, Katja; Saum, Kai-Uwe; Schick, Matthias; Stammer, Hermann; Boukamp, Petra; Holleczek, Bernd; Stegmaier, Christa; Brenner, Hermann

2015-10-01

Leukocyte telomere length (LTL) shortens with age and short LTL has been associated with increased mortality and increased risk for some age-related outcomes. This study aims to analyse the associations of smoking habits with LTL and rate of LTL change per year in older adults. LTL was measured by quantitative PCR at baseline in 3600 older adults, who were enrolled in a population-based cohort study in Germany. For longitudinal analyses, measurements were repeated in blood samples obtained at 8-year follow-up from 1000 participants. Terminal Restriction Fragment analysis was additionally performed in a sub-sample to obtain absolute LTL in base pairs. Multivariate linear regression models were used to estimate associations of smoking habits with baseline LTL and changes in LTL over time. LTL was inversely associated with age (r=-0.090, pSmoking was inversely associated with LTL. On average, current smokers had 73 base pairs (BP) shorter LTL compared to never smokers. Smoking intensity and pack-years of smoking were also inversely associated with LTL, and a positive association was observed with years since smoking cessation. Slower LTL attrition rates were observed in ever smokers over 8years of follow-up. Our cross-sectional analysis supports suggestions that smoking might contribute to shortening of LTL but this relationship could not be shown longitudinally. The overall rather small effect sizes observed for smoking-related variables suggest that LTL reflects smoking-related health hazards only to a very limited extent. Copyright © 2015 Elsevier Inc. All rights reserved.

Parametric Linear Dynamic Logic

Directory of Open Access Journals (Sweden)

Peter Faymonville

2014-08-01

Full Text Available We introduce Parametric Linear Dynamic Logic (PLDL, which extends Linear Dynamic Logic (LDL by temporal operators equipped with parameters that bound their scope. LDL was proposed as an extension of Linear Temporal Logic (LTL that is able to express all ω-regular specifications while still maintaining many of LTL's desirable properties like an intuitive syntax and a translation into non-deterministic Büchi automata of exponential size. But LDL lacks capabilities to express timing constraints. By adding parameterized operators to LDL, we obtain a logic that is able to express all ω-regular properties and that subsumes parameterized extensions of LTL like Parametric LTL and PROMPT-LTL. Our main technical contribution is a translation of PLDL formulas into non-deterministic Büchi word automata of exponential size via alternating automata. This yields a PSPACE model checking algorithm and a realizability algorithm with doubly-exponential running time. Furthermore, we give tight upper and lower bounds on optimal parameter values for both problems. These results show that PLDL model checking and realizability are not harder than LTL model checking and realizability.

Serum Folate, Vitamin B-12, Vitamin A, γ-Tocopherol, α-Tocopherol, and Carotenoids Do Not Modify Associations between Cadmium Exposure and Leukocyte Telomere Length in the General US Adult Population.

Science.gov (United States)

Nomura, Sarah Jo; Robien, Kim; Zota, Ami R

2017-04-01

Background: Leukocyte telomere length (LTL) is a biomarker of the aging process and is associated with the risk of chronic disease. Higher exposure to cadmium may be associated with shorter LTL, and adequate nutrient concentrations may be associated with longer LTL; however, the potential interaction between metals and nutrients on LTL has yet to be examined. Objectives: The objective of this study was to evaluate whether serum concentrations of vitamins and carotenoids were associated with LTL, and whether they modified the association between blood cadmium and LTL in the US NHANES (1999-2002). Methods: We evaluated cross-sectional associations between LTL and serum concentrations of vitamin A, γ-tocopherol, α-tocopherol, folate, and vitamin B-12 (1999-2002; n = 7458) and α-carotene, β-carotene, β-cryptoxanthin, lutein + zeaxanthin, and lycopene (2001-2002; n = 4018) in a nationally representative sample of US adults (≥20 y of age) with the use of multivariable linear regression. We further investigated whether vitamin and carotenoid concentrations modified associations between blood cadmium and LTL with models stratified by serum nutrient concentrations and the inclusion of an interaction term. Results: Blood cadmium was inversely associated with LTL (percentage of LTL difference per 1 μg/L = -3.74; 95% CI: -5.35, -2.10). Serum vitamin A was positively associated (percentage of LTL difference per 1 μg/L = 4.01; 95% CI: 0.26, 7.90) and γ-tocopherol was inversely associated (percentage of LTL difference per 1 μg/dL = -2.49; 95% CI: -4.21, -0.73) with LTL. Serum folate ( P -trend = 0.06) and α-tocopherol ( P -trend = 0.10) were marginally positively associated with LTL, whereas vitamin B-12 ( P -trend = 0.78) was not associated with LTL. Serum carotenoids were generally positively associated with LTL. Serum vitamin and carotenoid concentrations did not modify blood cadmium and LTL associations ( P -interaction > 0.10). Conclusions: Results from this

Serum Folate, Vitamin B-12, Vitamin A, γ-Tocopherol, α-Tocopherol, and Carotenoids Do Not Modify Associations between Cadmium Exposure and Leukocyte Telomere Length in the General US Adult Population123

Science.gov (United States)

2017-01-01

Background: Leukocyte telomere length (LTL) is a biomarker of the aging process and is associated with the risk of chronic disease. Higher exposure to cadmium may be associated with shorter LTL, and adequate nutrient concentrations may be associated with longer LTL; however, the potential interaction between metals and nutrients on LTL has yet to be examined. Objectives: The objective of this study was to evaluate whether serum concentrations of vitamins and carotenoids were associated with LTL, and whether they modified the association between blood cadmium and LTL in the US NHANES (1999–2002). Methods: We evaluated cross-sectional associations between LTL and serum concentrations of vitamin A, γ-tocopherol, α-tocopherol, folate, and vitamin B-12 (1999–2002; n = 7458) and α-carotene, β-carotene, β-cryptoxanthin, lutein + zeaxanthin, and lycopene (2001–2002; n = 4018) in a nationally representative sample of US adults (≥20 y of age) with the use of multivariable linear regression. We further investigated whether vitamin and carotenoid concentrations modified associations between blood cadmium and LTL with models stratified by serum nutrient concentrations and the inclusion of an interaction term. Results: Blood cadmium was inversely associated with LTL (percentage of LTL difference per 1 μg/L = −3.74; 95% CI: −5.35, −2.10). Serum vitamin A was positively associated (percentage of LTL difference per 1 μg/L = 4.01; 95% CI: 0.26, 7.90) and γ-tocopherol was inversely associated (percentage of LTL difference per 1 μg/dL = −2.49; 95% CI: −4.21, −0.73) with LTL. Serum folate (P-trend = 0.06) and α-tocopherol (P-trend = 0.10) were marginally positively associated with LTL, whereas vitamin B-12 (P-trend = 0.78) was not associated with LTL. Serum carotenoids were generally positively associated with LTL. Serum vitamin and carotenoid concentrations did not modify blood cadmium and LTL associations (P-interaction > 0.10). Conclusions: Results from

Tú decides

OpenAIRE

Antonio Coronado Hijón

2008-01-01

El programa Tú decides, primera fase del proyecto PROA que tiene su continuación en el último curso de la Educación Secundaria Obligatoria, enlaza teóricamente con el “Modelo de Activación para el Desarrollo Vocacional y Personal”. La fundamentación teórica se circunscribe a la zona de intersección que delimitan los modelos de “Educación para la elección de la Carrera” (Career education) y de “Desarrollo de la Madurez Vocacional”, adoptando una concepción operatoria y evolutiva...

PLQP & Company: Decidable Logics for Quantum Algorithms

Science.gov (United States)

Baltag, Alexandru; Bergfeld, Jort; Kishida, Kohei; Sack, Joshua; Smets, Sonja; Zhong, Shengyang

2014-10-01

We introduce a probabilistic modal (dynamic-epistemic) quantum logic PLQP for reasoning about quantum algorithms. We illustrate its expressivity by using it to encode the correctness of the well-known quantum search algorithm, as well as of a quantum protocol known to solve one of the paradigmatic tasks from classical distributed computing (the leader election problem). We also provide a general method (extending an idea employed in the decidability proof in Dunn et al. (J. Symb. Log. 70:353-359, 2005)) for proving the decidability of a range of quantum logics, interpreted on finite-dimensional Hilbert spaces. We give general conditions for the applicability of this method, and in particular we apply it to prove the decidability of PLQP.

Sports and Exercise at Different Ages and Leukocyte Telomere Length in Later Life--Data from the Berlin Aging Study II (BASE-II).

Science.gov (United States)

Saßenroth, Denise; Meyer, Antje; Salewsky, Bastian; Kroh, Martin; Norman, Kristina; Steinhagen-Thiessen, Elisabeth; Demuth, Ilja

2015-01-01

Physical activity and sports have repeatedly been reported to be associated with telomere length. We studied the association of different types of sports across different stages of life on relative leukocyte telomere length (rLTL) in advanced age.815 participants (397 men) from the Berlin Aging Study II aged over 61 years were included in the analysis. rLTL was measured by real time PCR and physical activity was determined retrospectively by questionnaire, assessing type and duration of sports in the past as well as currently. Five separate multiple linear regression models adjusted for various control variables were performed. 67.3% of participants exercised currently, whereas 19.4% performed sports only between the age of 20 and 30. rLTL was higher in subjects who stated to exercise currently (N = 456), and in subjects who engaged in endurance (N = 138) or intensive activity sports (N = 32). Current physical activity was positively associated with rLTL in the risk factor adjusted regression model (β = 0.26, p sports for a minimum of 10 years preceding the assessment had a significant effect on rLTL (β = 0.39, p = 0.011). The highest impact was seen for intensive activity sports (β = 0.79, p sports at all (β = -0.16, p = 0.21). Physical activity is clearly associated with longer rLTL. The effect is seen with longer periods of physical activity (at least 10 years), with intensive sports activities having the greatest impact on rLTL. Our data suggest that regular physical activity for at least 10 years is necessary to achieve a sustained effect on rLTL.

Do leukocyte telomere length dynamics depend on baseline telomere length? An analysis that corrects for ‘regression to the mean’

International Nuclear Information System (INIS)

Verhulst, Simon; Aviv, Abraham; Benetos, Athanase; Berenson, Gerald S.; Kark, Jeremy D.

2013-01-01

Leukocyte telomere length (LTL) shortens with age. Longitudinal studies have reported accelerated LTL attrition when baseline LTL is longer. However, the dependency of LTL attrition on baseline LTL might stem from a statistical artifact known as regression to the mean (RTM). To our knowledge no published study of LTL dynamics (LTL and its attrition rate) has corrected for this phenomenon. We illustrate the RTM effect using replicate LTL measurements, and show, using simulated data, how the RTM effect increases with a rise in stochastic measurement variation (representing LTL measurement error), resulting in spurious increasingly elevated dependencies of attrition on baseline values. In addition, we re-analyzed longitudinal LTL data collected from four study populations to test the hypothesis that LTL attrition depends on baseline LTL. We observed that the rate of LTL attrition was proportional to baseline LTL, but correction for the RTM effect reduced the slope of the relationship by 57 % when measurement error was low (coefficient of variation ∼2 %). A modest but statistically significant effect remained however, indicating that high baseline LTL is associated with higher LTL attrition even when correcting for the RTM effect. Baseline LTL explained 1.3 % of the variation in LTL attrition, but this effect, which differed significantly between the study samples, appeared to be primarily attributable to the association in men (3.7 %)

Pharmacy career deciding: making choice a "good fit".

Science.gov (United States)

Willis, Sarah Caroline; Shann, Phillip; Hassell, Karen

2009-01-01

The purpose of this article is to explore factors influencing career deciding amongst pharmacy students and graduates in the U.K. Group interviews were used to devise a topic guide for five subsequent focus groups with pharmacy students and graduates. Focus groups were tape-recorded, recordings transcribed, and transcripts analysed. Key themes and interlinking factors relating to pharmacy career deciding were identified in the transcripts, following a constructivist approach. Participants' described making a "good fit" between themselves, their experiences, social networks etc. and pharmacy. Central to a coherent career deciding narrative were: having a job on graduation; and the instrumental advantage of studying a vocational course. Focusing on career deciding of UK pharmacy students and graduates may limit the study's generalisability to other countries. However, our findings are relevant to those interested in understanding students' motivations for healthcare careers, since our results suggest that making a "good fit" describes a general process of matching between a healthcare career and personal experience. As we have found that pharmacy career deciding was not, usually, a planned activity, career advisors and those involved in higher education recruitment should take into account the roles played by personal preferences and values in choosing a degree course. A qualitative study like this can illustrate how career deciding occurs and provide insight into the process from a student's perspective. This can help inform guidance processes, selection to healthcare professions courses within the higher education sector, and stimulate debate amongst those involved with recruitment of healthcare workers about desirable motivators for healthcare careers.

Efficient Multi-Valued Bounded Model Checking for LTL over Quasi-Boolean Algebras

OpenAIRE

Andrade, Jefferson O.; Kameyama, Yukiyoshi

2012-01-01

Multi-valued Model Checking extends classical, two-valued model checking to multi-valued logic such as Quasi-Boolean logic. The added expressivity is useful in dealing with such concepts as incompleteness and uncertainty in target systems, while it comes with the cost of time and space. Chechik and others proposed an efficient reduction from multi-valued model checking problems to two-valued ones, but to the authors' knowledge, no study was done for multi-valued bounded model checking. In thi...

14 CFR 302.207 - Cases to be decided on written submissions.

Science.gov (United States)

2010-01-01

... administrative law judge is otherwise required by the public interest. (b) The standards employed in deciding... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cases to be decided on written submissions....207 Cases to be decided on written submissions. (a) Applications under this subpart will be decided on...

Efficient Multi-Valued Bounded Model Checking for LTL over Quasi-Boolean Algebras

Science.gov (United States)

Andrade, Jefferson O.; Kameyama, Yukiyoshi

Multi-valued Model Checking extends classical, two-valued model checking to multi-valued logic such as Quasi-Boolean logic. The added expressivity is useful in dealing with such concepts as incompleteness and uncertainty in target systems, while it comes with the cost of time and space. Chechik and others proposed an efficient reduction from multi-valued model checking problems to two-valued ones, but to the authors' knowledge, no study was done for multi-valued bounded model checking. In this paper, we propose a novel, efficient algorithm for multi-valued bounded model checking. A notable feature of our algorithm is that it is not based on reduction of multi-values into two-values; instead, it generates a single formula which represents multi-valuedness by a suitable encoding, and asks a standard SAT solver to check its satisfiability. Our experimental results show a significant improvement in the number of variables and clauses and also in execution time compared with the reduction-based one.

Leukocyte telomere dynamics in the elderly

DEFF Research Database (Denmark)

Steenstrup, Troels; Hjelmborg, Jacob V B; Mortensen, Laust H

2013-01-01

Limited data suggest that leukocytes of the elderly display ultra-short telomeres. It was reported that in some elderly persons leukocyte telomere length (LTL) shows age-dependent elongation. Using cross-sectional and longitudinal models, we characterized LTL dynamics in participants...

Behavioural equivalence for infinite systems - Partially decidable!

DEFF Research Database (Denmark)

Sunesen, Kim; Nielsen, Mogens

1996-01-01

languages with two generalizations based on traditional approaches capturing non-interleaving behaviour, pomsets representing global causal dependency, and locality representing spatial distribution of events. We first study equivalences on Basic Parallel Processes, BPP, a process calculus equivalent...... of processes between BPP and TCSP, not only are the two equivalences different, but one (locality) is decidable whereas the other (pomsets) is not. The decidability result for locality is proved by a reduction to the reachability problem for Petri nets....

Aberrant leukocyte telomere length in Birdshot Uveitis.

Science.gov (United States)

Vazirpanah, Nadia; Verhagen, Fleurieke H; Rothova, Anna; Missotten, Tom O A R; van Velthoven, Mirjam; Den Hollander, Anneke I; Hoyng, Carel B; Radstake, Timothy R D J; Broen, Jasper C A; Kuiper, Jonas J W

2017-01-01

Birdshot Uveitis (BU) is an archetypical chronic inflammatory eye disease, with poor visual prognosis, that provides an excellent model for studying chronic inflammation. BU typically affects patients in the fifth decade of life. This suggests that it may represent an age-related chronic inflammatory disease, which has been linked to increased erosion of telomere length of leukocytes. To study this in detail, we exploited a sensitive standardized quantitative real-time polymerase chain reaction to determine the peripheral blood leukocyte telomere length (LTL) in 91 genotyped Dutch BU patients and 150 unaffected Dutch controls. Although LTL erosion rates were very similar between BU patients and healthy controls, we observed that BU patients displayed longer LTL, with a median of log (LTL) = 4.87 (= 74131 base pair) compared to 4.31 (= 20417 base pair) in unaffected controls (PRTEL1. These findings suggest that BU is accompanied by significantly longer LTL.

Genetic determinants of leucocyte telomere length in children: a neglected and challenging field.

Science.gov (United States)

Stathopoulou, Maria G; Petrelis, Alexandros M; Buxton, Jessica L; Froguel, Philippe; Blakemore, Alexandra I F; Visvikis-Siest, Sophie

2015-03-01

Telomere length is associated with a large range of human diseases. Genome-wide association studies (GWAS) have identified genetic variants that are associated with leucocyte telomere length (LTL). However, these studies are limited to adult populations. Nevertheless, childhood is a crucial period for the determination of LTL, and the assessment of age-specific genetic determinants, although neglected, could be of great importance. Our aim was to provide insights and preliminary results on genetic determinants of LTL in children. Healthy children (n = 322, age range = 6.75-17 years) with available GWAS data (Illumina Human CNV370-Duo array) were included. The LTL was measured using multiplex quantitative real-time polymerase chain reaction. Linear regression models adjusted for age, gender, parental age at child's birth, and body mass index were used to test the associations of LTL with polymorphisms identified in adult GWAS and to perform a discovery-only GWAS. The previously GWAS-identified variants in adults were not associated with LTL in our paediatric sample. This lack of association was not due to possible interactions with age or gene × gene interactions. Furthermore, a discovery-only GWAS approach demonstrated six novel variants that reached the level of suggestive association (P ≤ 5 × 10(-5)) and explain a high percentage of children's LTL. The study of genetic determinants of LTL in children may identify novel variants not previously identified in adults. Studies in large-scale children populations are needed for the confirmation of these results, possibly through a childhood consortium that could better handle the methodological challenges of LTL genetic epidemiology field. © 2015 John Wiley & Sons Ltd.

Short leukocyte telomere length is associated with obesity in American Indians: the Strong Heart Family study.

Science.gov (United States)

Chen, Shufeng; Yeh, Fawn; Lin, Jue; Matsuguchi, Tet; Blackburn, Elizabeth; Lee, Elisa T; Howard, Barbara V; Zhao, Jinying

2014-05-01

Shorter leukocyte telomere length (LTL) has been associated with a wide range of age-related disorders including cardiovascular disease (CVD) and diabetes. Obesity is an important risk factor for CVD and diabetes. The association of LTL with obesity is not well understood. This study for the first time examines the association of LTL with obesity indices including body mass index, waist circumference, percent body fat, waist-to-hip ratio, and waist-to-height ratio in 3,256 American Indians (14-93 years old, 60% women) participating in the Strong Heart Family Study. Association of LTL with each adiposity index was examined using multivariate generalized linear mixed model, adjusting for chronological age, sex, study center, education, lifestyle (smoking, alcohol consumption, and total energy intake), high-sensitivity C-reactive protein, hypertension and diabetes. Results show that obese participants had significantly shorter LTL than non-obese individuals (age-adjusted P=0.0002). Multivariate analyses demonstrate that LTL was significantly and inversely associated with all of the studied obesity parameters. Our results may shed light on the potential role of biological aging in pathogenesis of obesity and its comorbidities.

Aberrant leukocyte telomere length in Birdshot Uveitis.

Directory of Open Access Journals (Sweden)

Nadia Vazirpanah

Full Text Available Birdshot Uveitis (BU is an archetypical chronic inflammatory eye disease, with poor visual prognosis, that provides an excellent model for studying chronic inflammation. BU typically affects patients in the fifth decade of life. This suggests that it may represent an age-related chronic inflammatory disease, which has been linked to increased erosion of telomere length of leukocytes.To study this in detail, we exploited a sensitive standardized quantitative real-time polymerase chain reaction to determine the peripheral blood leukocyte telomere length (LTL in 91 genotyped Dutch BU patients and 150 unaffected Dutch controls.Although LTL erosion rates were very similar between BU patients and healthy controls, we observed that BU patients displayed longer LTL, with a median of log (LTL = 4.87 (= 74131 base pair compared to 4.31 (= 20417 base pair in unaffected controls (P<0.0001. The cause underpinning the difference in LTL could not be explained by clinical parameters, immune cell-subtype distribution, nor genetic predisposition based upon the computed weighted genetic risk score of genotyped validated variants in TERC, TERT, NAF1, OBFC1 and RTEL1.These findings suggest that BU is accompanied by significantly longer LTL.

Polymorphisms in Telomere Length Associated TERC and TERT predispose for Ischemic Stroke in a Chinese Han population.

Science.gov (United States)

Zhang, Shuo; Ji, Guofa; Liang, Yiqian; Zhang, Rui; Shi, Puyu; Guo, Dangshe; Li, Chunqi; Feng, Jing; Liu, Feng; Peng, Rong; Chen, Mingwei

2017-01-06

The role of telomere in genomic stability is an established fact. Variation in leukocyte telomere length (LTL) has been considered a crucial factor that associated with age-associated diseases. To elucidate the association between LTL variation and ischemic stroke (IS) risk, we selected ten single nucleotide polymorphisms (SNPs) in three genes (TERC, TERT and RTEL1) that previously reported link to LTL, and genotyped SNPs of these genes in a case-control study. The association between polymorphisms and IS risk were tested by Chi squared test and haplotype analysis. In allele association analysis, allele "C" in rs10936599 of TERC gene and allele "G" in rs2853677 of TERT gene were found to have an increased risk of IS when compared with allele "T" and "A", respectively. Model association analysis showed that genotype "G/A" in the overdominant model and genotypes "G/A" and "A/A" in the dominant model of rs2242652 presented a more likelihood to have IS. Another TERT locus (rs2853677) with genotype "G" was also found IS-related risky in the log-additive model. Taken together, our results suggest a potential association between LTL related TERC, TERT gene variants and ischemic stroke risk.

Deciding for Others Reduces Loss Aversion

DEFF Research Database (Denmark)

Andersson, Ola; Holm, Håkan J.; Tyran, Jean-Robert Karl

2016-01-01

We study risk taking on behalf of others, both when choices involve losses and when they do not. A large-scale incentivized experiment with subjects randomly drawn from the Danish population is conducted. We find that deciding for others reduces loss aversion. When choosing between risky prospects...... when losses loom. This finding is consistent with an interpretation of loss aversion as a bias in decision making driven by emotions and that these emotions are reduced when making decisions for others....... for which losses are ruled out by design, subjects make the same choices for themselves as for others. In contrast, when losses are possible, we find that the two types of choices differ. In particular, we find that subjects who make choices for themselves take less risk than those who decide for others...

Who Should Decide How Machines Make Morally Laden Decisions?

Science.gov (United States)

Martin, Dominic

2017-08-01

Who should decide how a machine will decide what to do when it is driving a car, performing a medical procedure, or, more generally, when it is facing any kind of morally laden decision? More and more, machines are making complex decisions with a considerable level of autonomy. We should be much more preoccupied by this problem than we currently are. After a series of preliminary remarks, this paper will go over four possible answers to the question raised above. First, we may claim that it is the maker of a machine that gets to decide how it will behave in morally laden scenarios. Second, we may claim that the users of a machine should decide. Third, that decision may have to be made collectively or, fourth, by other machines built for this special purpose. The paper argues that each of these approaches suffers from its own shortcomings, and it concludes by showing, among other things, which approaches should be emphasized for different types of machines, situations, and/or morally laden decisions.

Formal verification of automated teller machine systems using SPIN

Science.gov (United States)

Iqbal, Ikhwan Mohammad; Adzkiya, Dieky; Mukhlash, Imam

2017-08-01

Formal verification is a technique for ensuring the correctness of systems. This work focuses on verifying a model of the Automated Teller Machine (ATM) system against some specifications. We construct the model as a state transition diagram that is suitable for verification. The specifications are expressed as Linear Temporal Logic (LTL) formulas. We use Simple Promela Interpreter (SPIN) model checker to check whether the model satisfies the formula. This model checker accepts models written in Process Meta Language (PROMELA), and its specifications are specified in LTL formulas.

Effects of size at birth, childhood growth patterns and growth hormone treatment on leukocyte telomere length.

Directory of Open Access Journals (Sweden)

Carolina C J Smeets

Full Text Available Small size at birth and rapid growth in early life are associated with increased risk of cardiovascular disease in later life. Short children born small for gestational age (SGA are treated with growth hormone (GH, inducing catch-up in length. Leukocyte telomere length (LTL is a marker of biological age and shorter LTL is associated with increased risk of cardiovascular disease.To investigate whether LTL is influenced by birth size, childhood growth and long-term GH treatment.We analyzed LTL in 545 young adults with differences in birth size and childhood growth patterns. Previously GH-treated young adults born SGA (SGA-GH were compared to untreated short SGA (SGA-S, SGA with spontaneous catch-up to a normal body size (SGA-CU, and appropriate for gestational age with a normal body size (AGA-NS. LTL was measured using a quantitative PCR assay.We found a positive association between birth length and LTL (p = 0.04, and a trend towards a positive association between birth weight and LTL (p = 0.08, after adjustments for gender, age, gestational age and adult body size. Weight gain during infancy and childhood and fat mass percentage were not associated with LTL. Female gender and gestational age were positively associated with LTL, and smoking negatively. After adjustments for gender, age and gestational age, SGA-GH had a similar LTL as SGA-S (p = 0.11, SGA-CU (p = 0.80, and AGA-NS (p = 0.30.Larger size at birth is positively associated with LTL in young adulthood. Growth patterns during infancy and childhood are not associated with LTL. Previously GH-treated young adults born SGA have similar LTL as untreated short SGA, SGA with spontaneous catch-up and AGA born controls, indicating no adverse effects of GH-induced catch-up in height on LTL.

Propositional interval neighborhood logics: Expressiveness, decidability, and undecidable extensions

DEFF Research Database (Denmark)

Bresolin, Davide; Goranko, Valentin; Montanari, Angelo

2009-01-01

In this paper, we investigate the expressiveness of the variety of propositional interval neighborhood logics (PNL), we establish their decidability on linearly ordered domains and some important subclasses, and we prove the undecidability of a number of extensions of PNL with additional modalities...... over interval relations. All together, we show that PNL form a quite expressive and nearly maximal decidable fragment of Halpern–Shoham’s interval logic HS....

Luteolin Inhibits Tumorigenesis and Induces Apoptosis of Non-Small Cell Lung Cancer Cells via Regulation of MicroRNA-34a-5p

Directory of Open Access Journals (Sweden)

Ze-Qun Jiang

2018-02-01

Full Text Available Luteolin (LTL exerts remarkable tumor suppressive activity on various types of cancers, including non-small cell lung cancer (NSCLC. However, it is not completely understood whether the mechanism of its action against NSCLC is related to microRNAs (miRNAs. In the present study, we investigated the anti-tumor effects of LTL on NSCLC in vitro and in vivo. The results revealed that LTL could inhibit cell proliferation and induce apoptosis in both A549 and H460 cells. In a H460 xenograft tumor model of nude mice, LTL significantly suppressed tumor growth, inhibited cell proliferation, and induced apoptosis. miRNA microarray and quantitative PCR (qPCR analysis indicated that miR-34a-5p was dramatically upregulated upon LTL treatment in tumor tissues. Furthermore, MDM4 was proved to be a direct target of miR-34a-5p by luciferase reporter gene assay. LTL treatment was associated with increased p53 and p21 protein expressions and decreased MDM4 protein expression in both NSCLC cells and tumor tissues. When miR-34a-5p was inhibited in vitro, the protein expressions of Bcl-2 and MDM4 were recovered, while that of p53, p21, and Bax were attenuated. Moreover, caspase-3 and caspase-9 activation induced by LHL treatment in vitro were also suppressed by miR-34a-5p inhibition. Overall, LTL could inhibit tumorigenesis and induce apoptosis of NSCLC cells by upregulation of miR-34a-5p via targeting MDM4. These findings provide novel insight into the molecular functions of LTL that suggest its potential as a therapeutic agent for human NSCLC.

Deciding on Tax Evasion

DEFF Research Database (Denmark)

Boll, Karen

2015-01-01

Purpose – The purpose of this paper is to analyse everyday reasoning in public administration. This is done by focusing on front line tax inspectors’ decisions about tax evasion. Design/methodology/approach – The paper presents ethnography of bureaucracy and field audits. The material stems from...... fieldwork conducted in the Central Customs and Tax Administration. Findings – The paper shows that the tax inspectors reason about tax evasion in a casuistic manner. They pay attention to similar cases and to particular circumstances of the individual cases. In deciding on tax evasion, the inspectors do...

Deciding WQO for factorial languages

KAUST Repository

Atminas, Aistis; Lozin, Vadim V.; Moshkov, Mikhail

2013-01-01

A language is factorial if it is closed under taking factors (i.e. contiguous subwords). Every factorial language can be described by an antidictionary, i.e. a minimal set of forbidden factors. We show that the problem of deciding whether a factorial language given by a finite antidictionary is well-quasi-ordered under the factor containment relation can be solved in polynomial time. © 2013 Springer-Verlag Berlin Heidelberg.

Deciding WQO for factorial languages

KAUST Repository

Atminas, Aistis

2013-04-05

A language is factorial if it is closed under taking factors (i.e. contiguous subwords). Every factorial language can be described by an antidictionary, i.e. a minimal set of forbidden factors. We show that the problem of deciding whether a factorial language given by a finite antidictionary is well-quasi-ordered under the factor containment relation can be solved in polynomial time. © 2013 Springer-Verlag Berlin Heidelberg.

Helping Youth Decide: A Workshop Guide.

Science.gov (United States)

Duquette, Donna Marie; Boo, Katherine

This guide was written to complement the publication "Helping Youth Decide," a manual designed to help parents develop effective parent-child communication and help their children make responsible decisions during the adolescent years. The workshop guide is intended to assist people who work with families to provide additional information and…

On Decidable Growth-Rate Properties of Imperative Programs

Directory of Open Access Journals (Sweden)

Amir M. Ben-Amram

2010-05-01

Full Text Available In 2008, Ben-Amram, Jones and Kristiansen showed that for a simple "core" programming language - an imperative language with bounded loops, and arithmetics limited to addition and multiplication - it was possible to decide precisely whether a program had certain growth-rate properties, namely polynomial (or linear bounds on computed values, or on the running time. This work emphasized the role of the core language in mitigating the notorious undecidability of program properties, so that one deals with decidable problems. A natural and intriguing problem was whether more elements can be added to the core language, improving its utility, while keeping the growth-rate properties decidable. In particular, the method presented could not handle a command that resets a variable to zero. This paper shows how to handle resets. The analysis is given in a logical style (proof rules, and its complexity is shown to be PSPACE-complete (in contrast, without resets, the problem was PTIME. The analysis algorithm evolved from the previous solution in an interesting way: focus was shifted from proving a bound to disproving it, and the algorithm works top-down rather than bottom-up.

Tracking and fixed ranking of leukocyte telomere length across the adult life course

DEFF Research Database (Denmark)

Benetos, Athanase; Kark, Jeremy D; Susser, Ezra

2013-01-01

whether age-dependent LTL attrition during adulthood can substantially affect individuals' LTL ranking (e.g., longer or shorter LTL) in relation to their peers. We measured LTL in samples donated 12 years apart on average by 1156 participants in four longitudinal studies. We observed correlations of 0.......91-0.96 between baseline and follow-up LTLs. Ranking individuals by deciles revealed that 94.1% (95% confidence interval of 92.6-95.4%) showed no rank change or a 1 decile change over time. We conclude that in adults, LTL is virtually anchored to a given rank with the passage of time. Accordingly, the links...... of LTL with atherosclerosis and longevity appear to be established early in life. It is unlikely that lifestyle and its modification during adulthood exert a major impact on LTL ranking....

Deciding Security for a Fragment of ASLan

DEFF Research Database (Denmark)

Mödersheim, Sebastian Alexander

2012-01-01

situations in security such as the interaction between the workflow of a system with its access control policies. While even the transition relation is undecidable for ASLan in general, we show the security problem is decidable for a large and useful fragment that we call TASLan, as long as we bound......ASLan is the input language of the verification tools of the AVANTSSAR platform, and an extension of the AVISPA Intermediate Format IF. One of ASLan's core features over IF is to integrate a transition system with Horn clauses that are evaluated at every state. This allows for modeling many common...... the number of steps of honest participants. The restriction of TASLan is that all messages and predicates must be in a certain sense unambiguous in their interpretation, excluding “type-confusions” similar to some tagging results for security protocols....

Decidability of uniform recurrence of morphic sequences

OpenAIRE

Durand , Fabien

2012-01-01

We prove that the uniform recurrence of morphic sequences is decidable. For this we show that the number of derived sequences of uniformly recurrent morphic sequences is bounded. As a corollary we obtain that uniformly recurrent morphic sequences are primitive substitutive sequences.

Learning Markov models for stationary system behaviors

DEFF Research Database (Denmark)

Chen, Yingke; Mao, Hua; Jaeger, Manfred

2012-01-01

to a single long observation sequence, and in these situations existing automatic learning methods cannot be applied. In this paper, we adapt algorithms for learning variable order Markov chains from a single observation sequence of a target system, so that stationary system properties can be verified using......Establishing an accurate model for formal verification of an existing hardware or software system is often a manual process that is both time consuming and resource demanding. In order to ease the model construction phase, methods have recently been proposed for automatically learning accurate...... the learned model. Experiments demonstrate that system properties (formulated as stationary probabilities of LTL formulas) can be reliably identified using the learned model....

Sedentary behavior, physical activity and cardiorespiratory fitness on leukocyte telomere length.

Science.gov (United States)

Edwards, Meghan K; Loprinzi, Paul D

2017-01-01

Background: Emerging work is starting to investigate the cumulative effects of moderate-to-vigorous physical activity (MVPA), sedentary behavior and cardiorespiratory fitness on health. The objective of this study was to examine the cumulative and independent associations of MVPA, sedentary behavior and cardiorespiratory fitness on leukocyte telomere length (LTL). Methods: Data from the 1999-2002 National Health and Nutrition Examination Survey (NHANES) were used (N = 1868 adults 20+ years); analyzed in 2016. Sedentary behavior and MVPA were subjectively assessed with cardiorespiratory fitness determined from a submaximal treadmill-based test; participants were classified as above or below the median values for each of these three parameters. A blood sample was obtained from each participant to assess LTL via quantitative polymerase chain reaction, with participants grouped into LTL tertiles. Results: Participants who engaged in higher MVPA, sat less and had higher cardiorespiratory fitness had an increased odds (ranging from 85% to 105%) of being in LTL tertile 3 (vs. 1). In an extended adjusted multinomial logistic regression model, only MVPA was positively associated with LTL (odds ration [OR] = 1.37; 95% CI: 0.99-1.90; P = 0.05). Conclusion: All three behavior characteristics, but particularly MVPA, may be important in preserving LTLs.

Childhood Personality, Betrayal Trauma, and Leukocyte Telomere Length in Adulthood: A Lifespan Perspective on Conscientiousness and Betrayal Traumas as Predictors of a Biomarker of Cellular Aging.

Science.gov (United States)

Edmonds, Grant W; Hampson, Sarah E; Côté, Hélène C F; Hill, Patrick L; Klest, Bridget

2016-01-01

Conscientiousness is associated with longevity. As such, identifying the biological pathways linking personality to mortality is important. This study employs longitudinal data spanning >40 years to test prospective associations with Leukocyte Telomere Length (LTL), a potential marker of cellular aging. Because telomeres shorten over time, and are sensitive to oxidative stress, shorter LTL may reflect cumulative damage associated with negative health behaviors and past stressful events. We investigated childhood conscientiousness as a protective factor, expecting an association with longer LTL in adulthood, possibly reflecting slower LTL shortening. Potential lifespan pathways involving childhood trauma, smoking behaviors, and Body Mass Index (BMI) were explored. Childhood conscientiousness showed a small raw association with LTL ( r = .08, p = .04), although this effect did not persist when controlling for age and sex. Despite this lack of a direct effect on LTL, we detected an indirect effect operating jointly through BMI and smoking. Higher rates of childhood betrayal trauma were associated with shorter LTL. Contrary to our hypothesis that conscientiousness would buffer this effect, we found evidence for an interaction with childhood betrayal traumas where the association between childhood betrayal traumas and LTL was larger for those higher on conscientiousness in childhood.

Depressive and anxiety disorders and short leukocyte telomere length: mediating effects of metabolic stress and lifestyle factors.

Science.gov (United States)

Révész, D; Verhoeven, J E; Milaneschi, Y; Penninx, B W J H

2016-08-01

Depressive and anxiety disorders are associated with shorter leukocyte telomere length (LTL), an indicator of cellular aging. It is, however, unknown which pathways underlie this association. This study examined the extent to which lifestyle factors and physiological changes such as inflammatory or metabolic alterations mediate the relationship. We applied mediation analysis techniques to data from 2750 participants of the Netherlands Study of Depression and Anxiety. LTL was assessed using quantitative polymerase chain reaction. Independent variables were current depressive (30-item Inventory of Depressive Symptoms - Self Report) and anxiety (21-item Beck's Anxiety Inventory) symptoms and presence of a depressive or anxiety disorder diagnosis based on DSM-IV; mediator variables included physiological stress systems, metabolic syndrome components and lifestyle factors. Short LTL was associated with higher symptom severity (B = -2.4, p = 0.002) and current psychiatric diagnosis (B = -63.3, p = 0.024). C-reactive protein, interleukin-6, waist circumference, triglycerides, high-density lipoprotein cholesterol and cigarette smoking were significant mediators in the relationship between psychopathology and LTL. When all significant mediators were included in one model, the effect sizes of the relationships between LTL and symptom severity and current diagnosis were reduced by 36.7 and 32.7%, respectively, and the remaining direct effects were no longer significant. Pro-inflammatory cytokines, metabolic alterations and cigarette smoking are important mediators of the association between depressive and anxiety disorders and LTL. This calls for future research on intervention programs that take into account lifestyle changes in mental health care settings.

BEHAVIOR QUALITY DECIDES OUR CONDITIONS OF SURVIVAL AND DEVELOPMENT

Directory of Open Access Journals (Sweden)

Tu Runsheng

2013-06-01

Full Text Available Background of the topic: The unusual significance of quality has been found, attribute quality concept (quality is the general nature of its supporter has been found, the quality exchange law and the standard to one's liking with quality have been advanced in the process that present wit research the connotation of quality and the value of quality. (2 Current issue: The theory of knowledge economy, the theory of quality first, the theory of distribution according to work and the subjective quality concept all have theirs aggravated limitation. (3 the purpose of this research: Propel the theory of quality forward strengthen the confidence of quality people, spur them to apply quality knowledge and improve their behavior quality in their work, quicken the tempo human to raise the living quality finally. (4 Research method and conclusion: The conclusion of "behavior quality decides resources created, owned and disposed and can further decide the living state and the developing state of personality, organization, nationality and county" has been epitomized out by analyzing the connotation of quality concept, the value of quality and society law; the theory of quality world have obtained. The main reasons that behavior quality decides resources appropriated and disposed are the action of natural law, society law, the system of society value. The specific important reasons still are: the consciousness of protecting good and punishing inferior, popular feeling is partial to the things of high quality; Behavior is controlled by the ideology (thinking of fair deal; Behavior quality decides the efficiency of work; Quality has value; the latent rule about mankind to continue and excellent.

I-DECIDE: An Online Intervention Drawing on the Psychosocial Readiness Model for Women Experiencing Domestic Violence.

Science.gov (United States)

Tarzia, Laura; Murray, Elizabeth; Humphreys, Cathy; Glass, Nancy; Taft, Angela; Valpied, Jodie; Hegarty, Kelsey

2016-01-01

Domestic violence (DV) perpetrated by men against women is a pervasive global problem with significant physical and emotional consequences. Although some face-to-face interventions in health care settings have shown promise, there are barriers to disclosure to health care practitioners and women may not be ready to access or accept help, reducing uptake. Similar to the mental health field, interventions from clinical practice can be adapted to be delivered by technology. This article outlines the theoretical and conceptual development of I-DECIDE, an online healthy relationship tool and safety decision aid for women experiencing DV. The article explores the use of the Psychosocial Readiness Model (PRM) as a theoretical framework for the intervention and evaluation. This is a theoretical article drawing on current theory and literature around health care and online interventions for DV. The article argues that the Internet as a method of intervention delivery for DV might overcome many of the barriers present in health care settings. Using the PRM as a framework for an online DV intervention may help women on a pathway to safety and well-being for themselves and their children. This hypothesis will be tested in a randomized, controlled trial in 2015/2016. This article highlights the importance of using a theoretical model in intervention development and evaluation. Copyright © 2016 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.

Criteria for deciding about forestry research programs

Science.gov (United States)

Robert Z. Callaham

1981-01-01

In early 1979, the Forest Service, U.S. Department of Agriculture, was required to decide several significant issues affecting its future research program. These decisions were in response to requirements of the Forest and Rangeland Renewable Resources Planning Act of 1974 (RPA). The decisions required information that was not either available or assembled. Most...

Childhood Conscientiousness and Leukocyte Telomere Length 40 Years Later in Adult Women--Preliminary Findings of a Prospective Association.

Directory of Open Access Journals (Sweden)

Grant W Edmonds

Full Text Available Leukocyte telomere length (LTL shortens with age, and is a prospective marker of mortality related to cardiovascular disease. Many health behaviors and social environmental factors have been found to be associated with LTL. Several of these are also associated with conscientiousness, a dispositional personality trait. Conscientiousness is a propensity to be planful, adhere to social norms, and inhibit pre-potent responses. Like LTL, conscientiousness is prospectively related to mortality, possibly through cumulative effects on health over the life course via multiple pathways. As a result, we hypothesized that childhood levels of conscientiousness would predict LTL prospectively in adulthood. We selected a sample of 60 women in the Hawaii Personality and Health Cohort; 30 described by their teachers as high on conscientiousness in childhood and 30 described as low on the trait. Dried blood spot samples collected in adulthood 40 years later were used as sources of DNA for the LTL assay. Conscientiousness was associated with longer LTL (p = .02. Controlling for age did not account for this association. Controlling for education and physiological dysregulation partially attenuated the association, and the effect remained significant when accounting for differences in LTL across cultural groups. These results represent the first evidence that childhood personality prospectively predicts LTL 40 years later in adulthood. Our findings would be consistent with a mediation hypothesis whereby conscientiousness predicts life paths and trajectories of health that are reflected in rates of LTL erosion across the lifespan.

The effect of the severity of obstructive sleep apnea syndrome on telomere length.

Science.gov (United States)

Tempaku, Priscila Farias; Mazzotti, Diego Robles; Hirotsu, Camila; Andersen, Monica Levy; Xavier, Gabriela; Maurya, Pawan Kumar; Rizzo, Lucas Bortolotto; Brietzke, Elisa; Belangero, Sintia Iole; Bittencourt, Lia; Tufik, Sergio

2016-10-25

Aging is associated with an increase in the prevalence of obstructive sleep apnea syndrome (OSAS) as well as the shortening of telomeres. It is known that OSAS-related factors are stimuli that can contribute to the acceleration of cellular senescence. Thus, the present study aimed to compare the leukocyte telomere length (LTL) between OSAS patients and controls, as well as to verify the correlation between LTL and sleep parameters. We used DNA extracted of 928 individuals from EPISONO to measure the LTL by the quantitative real-time polymerase chain reaction. All individuals were subjected to one full-night polysomnography. LTL was significantly shorter in OSAS patients compared to controls. The results showed negative correlations between LTL and the following variables: apnea-hypopnea index, respiratory disturbance index, desaturation index and wake after sleep onset. LTL was positively correlated with sleep efficiency, total sleep time, basal, minimum and maximum oxygen saturation. Lastly, it was observed that OSAS severity was associated with shorter LTL even after adjusting for sex, age, years of schooling, body mass index, diabetes, stroke and heart attack. In conclusion, our study indicates the presence of an association between LTL and OSAS and a significant impact of severity of OSAS in telomeres shortening.

The heritability of leucocyte telomere length dynamics

DEFF Research Database (Denmark)

Hjelmborg, Jacob B; Dalgård, Christine; Möller, Sören

2015-01-01

variation among adults. A number of studies have estimated the heritability of LTL, but none has assessed the heritability of age-dependent LTL attrition. METHODS: We examined the heritability of LTL dynamics based on a longitudinal evaluation (an average follow-up of 12 years) in 355 monozygotic and 297...... dizygotic same-sex twins (aged 19-64 years at baseline). RESULTS: Heritability of LTL at baseline was estimated at 64% (95% CI 39% to 83%) with 22% (95% CI 6% to 49%) of shared environmental effects. Heritability of age-dependent LTL attrition rate was estimated at 28% (95% CI 16% to 44%). Individually...

Twin correlations of telomere length metrics

DEFF Research Database (Denmark)

Hjelmborg, Jacob B; Dalgård, Christine; Möller, Sören

2015-01-01

variation among adults. A number of studies have estimated the heritability of LTL, but none has assessed the heritability of age-dependent LTL attrition. METHODS: We examined the heritability of LTL dynamics based on a longitudinal evaluation (an average follow-up of 12 years) in 355 monozygotic and 297...... dizygotic same-sex twins (aged 19-64 years at baseline). RESULTS: Heritability of LTL at baseline was estimated at 64% (95% CI 39% to 83%) with 22% (95% CI 6% to 49%) of shared environmental effects. Heritability of age-dependent LTL attrition rate was estimated at 28% (95% CI 16% to 44%). Individually...

WQO is Decidable for Factorial Languages

KAUST Repository

Atminas, Aistis

2017-08-08

A language is factorial if it is closed under taking factors, i.e. contiguous subwords. Every factorial language can be described by an antidictionary, i.e. a minimal set of forbidden factors. We show that the problem of deciding whether a factorial language given by a finite antidictionary is well-quasi-ordered under the factor containment relation can be solved in polynomial time. We also discuss possible ways to extend our solution to permutations and graphs.

20 CFR 405.340 - Deciding a claim without a hearing before an administrative law judge.

Science.gov (United States)

2010-04-01

....340 Deciding a claim without a hearing before an administrative law judge. (a) Decision wholly... the decision is based. (b) You do not wish to appear. The administrative law judge may decide a claim... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Deciding a claim without a hearing before an...

Genome-wide association identifies OBFC1 as a locus involved in human leukocyte telomere biology.

Science.gov (United States)

Levy, Daniel; Neuhausen, Susan L; Hunt, Steven C; Kimura, Masayuki; Hwang, Shih-Jen; Chen, Wei; Bis, Joshua C; Fitzpatrick, Annette L; Smith, Erin; Johnson, Andrew D; Gardner, Jeffrey P; Srinivasan, Sathanur R; Schork, Nicholas; Rotter, Jerome I; Herbig, Utz; Psaty, Bruce M; Sastrasinh, Malinee; Murray, Sarah S; Vasan, Ramachandran S; Province, Michael A; Glazer, Nicole L; Lu, Xiaobin; Cao, Xiaojian; Kronmal, Richard; Mangino, Massimo; Soranzo, Nicole; Spector, Tim D; Berenson, Gerald S; Aviv, Abraham

2010-05-18

Telomeres are engaged in a host of cellular functions, and their length is regulated by multiple genes. Telomere shortening, in the course of somatic cell replication, ultimately leads to replicative senescence. In humans, rare mutations in genes that regulate telomere length have been identified in monogenic diseases such as dyskeratosis congenita and idiopathic pulmonary fibrosis, which are associated with shortened leukocyte telomere length (LTL) and increased risk for aplastic anemia. Shortened LTL is observed in a host of aging-related complex genetic diseases and is associated with diminished survival in the elderly. We report results of a genome-wide association study of LTL in a consortium of four observational studies (n = 3,417 participants with LTL and genome-wide genotyping). SNPs in the regions of the oligonucleotide/oligosaccharide-binding folds containing one gene (OBFC1; rs4387287; P = 3.9 x 10(-9)) and chemokine (C-X-C motif) receptor 4 gene (CXCR4; rs4452212; P = 2.9 x 10(-8)) were associated with LTL at a genome-wide significance level (P a gene associated with LTL (P = 1.1 x 10(-5)). The identification of OBFC1 through genome-wide association as a locus for interindividual variation in LTL in the general population advances the understanding of telomere biology in humans and may provide insights into aging-related disorders linked to altered LTL dynamics.

25 CFR 39.133 - Who decides how Language Development funds can be used?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Who decides how Language Development funds can be used... INDIAN SCHOOL EQUALIZATION PROGRAM Indian School Equalization Formula Language Development Programs § 39.133 Who decides how Language Development funds can be used? Tribal governing bodies or local school...

[Effect of sucralfate on cytokines in rat with paraquat poisoning].

Science.gov (United States)

Zhu, Junbo; Yu, Yongtao; Li, Hongbo; Zheng, Fenshuang; Lin, Ruyun; Yang, Chun'ai

2018-03-01

To explore the effect of sucralfate on cytokines in rats with paraquat (PQ) poisoning. Seventy-two healthy male Sprague-Dawley (SD) rats were randomly divided into PQ model group, sodium bicarbonate intervention group (SB group) and sucralfate suspension gel group (LTL group), with 24 rats in each group. The rat model of PQ poisoning was reproduced by one-time intragastric administration of PQ solution 25 mg/kg. The rats in SB group and LTL group were intragastricly administrated with 5 mL×kg -1 ×d -1 of 100 g/L sodium bicarbonate or 200 g/L sucralfate at 2 hours after exposing to PQ, and the rats in PQ model group were given the same amount of sterile saline. The abdominal aortic blood of rats was collected at 1, 3, 6, and 10 days after PQ poisoning, and the levels of serum tumor necrosis factor-α (TNF-α), interleukin-10 (IL-10) and transforming growth factor-β1 (TGF-β1) were determined by enzyme-linked immunosorbent assay (ELISA). The left lung tissue was harvested, and lung wet/dry weight (W/D) ratio was assessed. With prolonged exposure, lung W/D ratios in all the groups were increased gradually, reached the peak at 10 days, but in the SB group and LTL group, the amplitude of increase was obviously reduced, the ratios were significantly decreased at 6 days and 10 days as compared with those in PQ model group (SB group vs. PQ model group: 4.99±0.79 vs. 6.98±0.86 at 6 days, 5.61±0.36 vs. 7.36±0.95 at 10 days; LTL group vs. PQ model group: 4.61±0.24 vs. 6.98±0.86 at 6 days, 4.24±0.20 vs. 7.36±0.95 at 10 days, all P 0.05). After PQ poisoning, the levels of TNF-α, IL-10 and TGF-β1 were elevated, and reached the peak at 3 days and then decreased gradually. Compared with the PQ model group, serum TNF-α, IL-10 and TGF-β1 levels in SB group and LTL group were decreased significantly [SB group vs. PQ model group: 3-day TNF-α (ng/L) was 147.6±12.3 vs. 168.2±11.3, 3-day IL-10 (ng/L) was 65.4±3.2 vs. 115.1±9.2, 3-day TGF-β1 (ng/L) was 356.3±50.3 vs

DECIDE: a Decision Support Tool to Facilitate Parents' Choices Regarding Genome-Wide Sequencing.

Science.gov (United States)

Birch, Patricia; Adam, S; Bansback, N; Coe, R R; Hicklin, J; Lehman, A; Li, K C; Friedman, J M

2016-12-01

We describe the rationale, development, and usability testing for an integrated e-learning tool and decision aid for parents facing decisions about genome-wide sequencing (GWS) for their children with a suspected genetic condition. The online tool, DECIDE, is designed to provide decision-support and to promote high quality decisions about undergoing GWS with or without return of optional incidental finding results. DECIDE works by integrating educational material with decision aids. Users may tailor their learning by controlling both the amount of information and its format - text and diagrams and/or short videos. The decision aid guides users to weigh the importance of various relevant factors in their own lives and circumstances. After considering the pros and cons of GWS and return of incidental findings, DECIDE summarizes the user's responses and apparent preferred choices. In a usability study of 16 parents who had already chosen GWS after conventional genetic counselling, all participants found DECIDE to be helpful. Many would have been satisfied to use it alone to guide their GWS decisions, but most would prefer to have the option of consulting a health care professional as well to aid their decision. Further testing is necessary to establish the effectiveness of using DECIDE as an adjunct to or instead of conventional pre-test genetic counselling for clinical genome-wide sequencing.

20 CFR 416.1448 - Deciding a case without an oral hearing before an administrative law judge.

Science.gov (United States)

2010-04-01

... § 416.1448 Deciding a case without an oral hearing before an administrative law judge. (a) Decision... the decision is based. (b) Parties do not wish to appear. (1) The administrative law judge may decide... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Deciding a case without an oral hearing...

20 CFR 404.948 - Deciding a case without an oral hearing before an administrative law judge.

Science.gov (United States)

2010-04-01

....948 Deciding a case without an oral hearing before an administrative law judge. (a) Decision wholly... is based. (b) Parties do not wish to appear. (1) The administrative law judge may decide a case on... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Deciding a case without an oral hearing...

Profiling biopharmaceutical deciding properties of absorption of lansoprazole enteric-coated tablets using gastrointestinal simulation technology.

Science.gov (United States)

Wu, Chunnuan; Sun, Le; Sun, Jin; Yang, Yajun; Ren, Congcong; Ai, Xiaoyu; Lian, He; He, Zhonggui

2013-09-10

The aim of the present study was to correlate in vitro properties of drug formulation to its in vivo performance, and to elucidate the deciding properties of oral absorption. Gastrointestinal simulation technology (GST) was used to simulate the in vivo plasma concentration-time curve and was implemented by GastroPlus™ software. Lansoprazole, a typical BCS class II drug, was chosen as a model drug. Firstly, physicochemical and pharmacokinetic parameters of lansoprazole were determined or collected from literature to construct the model. Validation of the developed model was performed by comparison of the predicted and the experimental plasma concentration data. We found that the predicted curve was in a good agreement with the experimental data. Then, parameter sensitivity analysis (PSA) was performed to find the key parameters of oral absorption. The absorption was particularly sensitive to dose, solubility and particle size for lansoprazole enteric-coated tablets. With a single dose of 30 mg and the solubility of 0.04 mg/ml, the absorption was complete. A good absorption could be achieved with lansoprazole particle radius down to about 25 μm. In summary, GST is a useful tool for profiling biopharmaceutical deciding properties of absorption of lansoprazole enteric-coated tablets and guiding the formulation optimization. Crown Copyright © 2013. Published by Elsevier B.V. All rights reserved.

43 CFR 30.239 - How will the judge decide a petition for rehearing?

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will the judge decide a petition for... the judge decide a petition for rehearing? (a) If proper grounds are not shown, or if the petition is not timely filed, the judge will: (1) Issue an order denying the petition for rehearing and including...

43 CFR 30.243 - How will the judge decide my petition for reopening?

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will the judge decide my petition for... the judge decide my petition for reopening? (a) If the judge finds that proper grounds are not shown, the judge will issue an order denying the petition for reopening and giving the reasons for the denial...

Synthesizing Dynamic Programming Algorithms from Linear Temporal Logic Formulae

Science.gov (United States)

Rosu, Grigore; Havelund, Klaus

2001-01-01

The problem of testing a linear temporal logic (LTL) formula on a finite execution trace of events, generated by an executing program, occurs naturally in runtime analysis of software. We present an algorithm which takes an LTL formula and generates an efficient dynamic programming algorithm. The generated algorithm tests whether the LTL formula is satisfied by a finite trace of events given as input. The generated algorithm runs in linear time, its constant depending on the size of the LTL formula. The memory needed is constant, also depending on the size of the formula.

E-DECIDER Rapid Response to the M 6.0 South Napa Earthquake

Science.gov (United States)

Glasscoe, M. T.; Parker, J. W.; Pierce, M. E.; Wang, J.; Eguchi, R. T.; Huyck, C. K.; Hu, Z.; Chen, Z.; Yoder, M. R.; Rundle, J. B.; Rosinski, A.

2014-12-01

E-DECIDER initiated rapid response mode when the California Earthquake Clearinghouse was activated the morning following the M6 Napa earthquake. Data products, including: 1) rapid damage and loss estimates, 2) deformation magnitude and slope change maps, and 3) aftershock forecasts were provided to the Clearinghouse partners within 24 hours of the event via XchangeCore Web Service Data Orchestration sharing. NASA data products were provided to end-users via XchangeCore, EERI and Clearinghouse websites, and ArcGIS online for Napa response, reaching a wide response audience. The E-DECIDER team helped facilitate rapid delivery of NASA products to stakeholders and participated in Clearinghouse Napa earthquake briefings to update stakeholders on product information. Rapid response products from E-DECIDER can be used to help prioritize response efforts shortly after the event has occurred. InLET (Internet Loss Estimation Tool) post-event damage and casualty estimates were generated quickly after the Napa earthquake. InLET provides immediate post-event estimates of casualties and building damage by performing loss/impact simulations using USGS ground motion data and FEMA HAZUS damage estimation technology. These results were provided to E-DECIDER by their collaborators, ImageCat, Inc. and the Community Stakeholder Network (CSN). Strain magnitude and slope change maps were automatically generated when the Napa earthquake appeared on the USGS feed. These maps provide an early estimate of where the deformation has occurred and where damage may be localized. Using E-DECIDER critical infrastructure overlays with damage estimates, decision makers can direct response effort that can be verified later with field reconnaissance and remote sensing-based observations. Earthquake aftershock forecast maps were produced within hours of the event. These maps highlight areas where aftershocks are likely to occur and can also be coupled with infrastructure overlays to help direct response

Polynomial Time Decidability of Weighted Synchronization under Partial Observability

DEFF Research Database (Denmark)

Kretínsky, Jan; Larsen, Kim Guldstrand; Laursen, Simon

2015-01-01

We consider weighted automata with both positive and negative integer weights on edges and study the problem of synchronization using adaptive strategies that may only observe whether the current weight-level is negative or nonnegative. We show that the synchronization problem is decidable...

What Else Is Decidable about Integer Arrays?

OpenAIRE

Habermehl, Peter; Iosif, Radu; Vojnar, Tomáš

2008-01-01

International audience; We introduce a new decidable logic for reasoning about infinite arrays of integers. The logic is in the ∃ * ∀ * first-order fragment and allows (1) Presburger constraints on existentially quantified variables, (2) difference constraints as well as periodicity constraints on universally quantified indices, and (3) difference constraints on values. In particular, using our logic, one can express constraints on consecutive elements of arrays (e.g. ∀i. 0 ≤ i < n → a[i + 1]...

Deciding between compensated volume balance and real time transient models for pipeline leak detection system

Energy Technology Data Exchange (ETDEWEB)

Baptista, Renan Martins [PETROBRAS, Rio de Janeiro, RJ (Brazil). Centro de Pesquisas. Div. de Explotacao]. E-mail: renan@cenpes.petrobras.com.br

2000-07-01

This paper describes a technical procedure to assess a software based leak detection system (LDS), by deciding between a simpler low cost, less effective product, having a fast installation and tuning, and a complex one with high cost and efficiency, which however takes a long time to be properly installed. This is a common decision among the pipeline operating companies, considering that the majority of the lines are short, with single phase liquid flow (which may include batches), basic communication system and instrumentation. Service companies offer realistic solutions for liquid flow, but usually designed to big pipeline networks, flowing multiple batches and allowing multiple fluid entrances and deliveries. Those solutions are sometimes impractical to short pipelines, due to its high cost, as well as long tuning procedures, complex instrumentation, communication and computer requirements. It is intended to approach here the best solution according to its cost. In a practical sense, it means to differentiate the various LDS techniques. Those techniques are available in a considerable number, and they are still spreading, according to the different scenarios. However, two most known and worldwide implemented techniques hold the majority of the market: the Compensated Volume Balance (CVB), which is less accurate, reliable and robust, but cheaper, simpler and faster to install, and the Real Time Transient Model (RTTM), which is very reliable, accurate and robust, but expensive and complex. This work will describe a way to define whether one can use or not a CVB in a pipeline. (author)

Heritability of telomere length in a study of long-lived families

DEFF Research Database (Denmark)

Honig, Lawrence S; Kang, Min Suk; Cheng, Rong

2015-01-01

in a given age group, it has been hypothesized to be a marker of biological aging. However, the principal basis for the variation of human LTL has not been established, although various studies have reported heritability. Here, we use a family-based study of longevity to study heritability of LTL in 3037...... individuals. We show that LTL is shorter in older individuals, and in males, and has a high heritability (overall h(2) = 0.54). In the offspring generation, who are in middle-life, we find an ordinal relationship: persons more-closely-related to elderly probands have longer LTL than persons less...

Automata-Based Verification of Temporal Properties on Running Programs

Science.gov (United States)

Giannakopoulou, Dimitra; Havelund, Klaus; Lan, Sonie (Technical Monitor)

2001-01-01

This paper presents an approach to checking a running program against its Linear Temporal Logic (LTL) specifications. LTL is a widely used logic for expressing properties of programs viewed as sets of executions. Our approach consists of translating LTL formulae to finite-state automata, which are used as observers of the program behavior. The translation algorithm we propose modifies standard LTL to Buchi automata conversion techniques to generate automata that check finite program traces. The algorithm has been implemented in a tool, which has been integrated with the generic JPaX framework for runtime analysis of Java programs.

Decidable Fragments of a Higher Order Calculus with Locations

DEFF Research Database (Denmark)

Bundgaard, Mikkel; Godskesen, Jens Christian; Huttel, Hans

2009-01-01

Homer is a higher order process calculus with locations. In this paper we study Homer in the setting of the semantic finite control property, which is a finite reachability criterion that implies decidability of barbed bisimilarity. We show that strong and weak barbed bisimilarity are undecidable...

Relative Leukocyte Telomere Length, Hematological Parameters and Anemia - Data from the Berlin Aging Study II (BASE-II).

Science.gov (United States)

Meyer, Antje; Salewsky, Bastian; Buchmann, Nikolaus; Steinhagen-Thiessen, Elisabeth; Demuth, Ilja

2016-01-01

The length of the chromosome ends, telomeres, is widely accepted as a biomarker of aging. However, the dynamic of the relationship between telomere length and hematopoietic parameters in the normal aging process, which is of particular interest with respect to age-related anemia, is not well understood. We have analyzed the relationship between relative leukocyte telomere length (rLTL) and several hematological parameters in the older group of the Berlin Aging Study II (BASE-II) participants. This paper also compares rLTL between both BASE-II age groups (22-37 and 60-83 years). Genomic DNA was extracted from peripheral blood leukocytes of BASE-II participants and used to determine rLTL by a quantitative PCR protocol. Standard methods were used to determine blood parameters, and the WHO criteria were used to identify anemic participants. Telomere length data were available for 444 younger participants (28.4 ± 3.1 years old; 52% women) and 1,460 older participants (68.2 ± 3.7 years old; 49.4% women). rLTL was significantly shorter in BASE-II participants of the older group (p = 3.7 × 10-12) and in women (p = 4.2 × 10-31). rLTL of older men exhibited a statistically significant, positive partial correlation with mean corpuscular hemoglobin (MCH; p = 0.012) and MCH concentration (p = 0.002). While these correlations were only observed in men, the rLTL of older women was negatively correlated with the number of thrombocytes (p = 0.015) in the same type of analysis. Among all older participants, 6% met the criteria to be categorized as 'anemic'; however, there was no association between anemia and rLTL. In the present study, we have detected isolated correlations between rLTL and hematological parameters; however, in all cases, rLTL explained only a small part of the variation of the analyzed parameters. In disagreement with some other studies showing similar data, we interpret the association between rLTL and some of the hematological parameters studied here to be

Multiple measures of adiposity are associated with mean leukocyte telomere length in the northern Finland birth cohort 1966.

Directory of Open Access Journals (Sweden)

Jessica L Buxton

Full Text Available Studies of leukocyte telomere length (LTL and adiposity have produced conflicting results, and the relationship between body mass index (BMI and telomere length throughout life remains unclear. We therefore tested association of adult LTL measured in 5,598 participants with: i childhood growth measures (BMI and age at adiposity rebound (AR; ii change in BMI from childhood to adulthood and iii adult BMI, waist-to-hip ratio (WHR, body adiposity index (BAI. Childhood BMI at AR was positively associated with LTL at 31 years in women (P = 0.041. Adult BMI and WHR in both men (P = 0.025 and P = 0.049, respectively and women (P = 0.029 and P = 0.008, respectively, and BAI in women (P = 0.021 were inversely associated with LTL at 31 years. An increase in standardised BMI between early childhood and adulthood was associated with shorter adult LTL in women (P = 0.008. We show that LTL is inversely associated with multiple measures of adiposity in both men and women. Additionally, BMI increase in women from childhood to adulthood is associated with shorter telomeres at age 31, potentially indicating accelerated biological ageing.

A short leucocyte telomere length is associated with development of insulin resistance

DEFF Research Database (Denmark)

Verhulst, Simon; Dalgård, Christine; Labat, Carlos

2016-01-01

AIMS/HYPOTHESIS: A number of studies have shown that leucocyte telomere length (LTL) is inversely associated with insulin resistance and type 2 diabetes mellitus. The aim of the present longitudinal cohort study, utilising a twin design, was to assess whether shorter LTL predicts insulin resistance...... and insulin resistance over an average of 12 years were performed in a subset of the Registry consisting of 338 (184 monozygotic and 154 dizygotic) same-sex twin pairs. RESULTS: Age at baseline examination was 37.4 ± 9.6 (mean ± SD) years. Baseline insulin resistance was not associated with age......-dependent changes in LTL (attrition) over the follow-up period, whereas baseline LTL was associated with changes in insulin resistance during this period. The shorter the LTL at baseline, the more pronounced was the increase in insulin resistance over the follow-up period (p 

Sufficient and Necessary Condition to Decide Compatibility for a Class of Interorganizational Workflow Nets

Directory of Open Access Journals (Sweden)

Guanjun Liu

2015-01-01

Full Text Available Interorganizational Workflow nets (IWF-nets can well model many concurrent systems such as web service composition, in which multiple processes interact via sending/receiving messages. Compatibility of IWF-nets is a crucial criterion for the correctness of these systems. It guarantees that a system has no deadlock, livelock, or dead tasks. In our previous work we proved that the compatibility problem is PSPACE-complete for safe IWF-nets. This paper defines a subclass of IWF-nets that can model many cases about interactions. Necessary and sufficient condition is presented to decide their compatibility, and it depends on the net structures only. Finally, an algorithm is developed based on the condition.

Prenatal exposure to perfluoroalkyl and polyfluoroalkyl substances affects leukocyte telomere length in female newborns.

Science.gov (United States)

Liu, Han; Chen, Qian; Lei, Lei; Zhou, Wei; Huang, Lisu; Zhang, Jun; Chen, Dan

2018-04-01

Evidence has shown that leukocyte telomere length (LTL) at birth is related to the susceptibility to various diseases in later life and the setting of newborn LTL is influenced by the intrauterine environment. Perfluoroalkyl and polyfluoroalkyl substances (PFASs), as a kind of persistent organic pollutants, are commonly used in commercial and domestic applications and are capable of crossing the maternal-fetal barrier during pregnancy. We hypothesized that intrauterine exposure to PFASs may affect fetal LTL by increasing oxidative stress. To verify this hypothesis, LTL, concentrations of PFASs and reactive oxygen species (ROS) were measured in umbilical cord blood of 581 newborns from a prospective cohort. Our results showed that there were interactions between PFOS/PFDA and sex on LTL and ROS. The LTL was significantly shorter (0.926 ± 0.053 vs 0.945 ± 0.054, P = .023 for PFOS; 0.919 ± 0.063 vs 0.940 ± 0.059, P = .011 for PFDA) and the ROS levels were extremely higher (252.9 ± 60.5 [M] vs 233.5 ± 53.6 [M], P = .031 for PFOS; 255.2 ± 62.9 [M] vs 232.9 ± 58.3 [M], P = .011 for PFDA) in the female newborns whose PFOS or PFDA concentrations fell in the upmost quartile compared with those in the lowest quartile after adjusting for potential confounders. ROS levels were inversely associated with LTL in female newborns (β = -1.42 × 10 -4 , P = .022). 13% of the effect of PFOS on female LTL was mediated through ROS approximately by the mediation analyses. However, in male newborns, no relationships among PFASs, ROS and LTL were observed. Our findings suggest a "programming" role of PFASs on fetal telomere biology system in females in intrauterine stage. Copyright © 2018 Elsevier Ltd. All rights reserved.

Deciding Security for a Fragment of ASLan

DEFF Research Database (Denmark)

Mödersheim, Sebastian Alexander

situations in security such as the interaction between the work ow of a system with its access control policies. While even the transition relation is undecidable for ASLan in general, we show the security problem is decidable for a large and useful fragment that we call TASLan, as long as we bound...... the number of steps of honest participants. The restriction of TASLan is that all messages and predicates must be in a certain sense unambiguous in their interpretation, excluding \\type-confusions" similar to some tagging results for security protocols....

Metric Propositional Neighborhood Logics: Expressiveness, Decidability, and Undecidability

DEFF Research Database (Denmark)

Bresolin, Davide; Della Monica, Dario; Goranko, Valentin

2010-01-01

Metric Propositional Neighborhood Logic (MPNL) over natural numbers. MPNL features two modalities referring, respectively, to an interval that is “met by” the current one and to an interval that “meets” the current one, plus an infinite set of length constraints, regarded as atomic propositions...... that MPNL is decidable in double exponential time and expressively complete with respect to a well-defined subfragment of the two-variable fragment FO2[N, =,...

Emotions and family interactions in childhood: Associations with leukocyte telomere length emotions, family interactions, and telomere length.

Science.gov (United States)

Robles, Theodore F; Carroll, Judith E; Bai, Sunhye; Reynolds, Bridget M; Esquivel, Stephanie; Repetti, Rena L

2016-01-01

Conceptualizations of links between stress and cellular aging in childhood suggest that accumulating stress predicts shorter leukocyte telomere length (LTL). At the same time, several models suggest that emotional reactivity to stressors may play a key role in predicting cellular aging. Using intensive repeated measures, we tested whether exposure or emotional "reactivity" to conflict and warmth in the family were related to LTL. Children (N=39; 30 target children and 9 siblings) between 8 and 13 years of age completed daily diary questionnaires for 56 consecutive days assessing daily warmth and conflict in the marital and the parent-child dyad, and daily positive and negative mood. To assess exposure to conflict and warmth, diary scale scores were averaged over the 56 days. Mood "reactivity" was operationalized by using multilevel modeling to generate estimates of the slope of warmth or conflict scores (marital and parent-child, separately) predicting same-day mood for each individual child. After diary collection, a blood sample was collected to determine LTL. Among children aged 8-13 years, a stronger association between negative mood and marital conflict, suggesting greater negative mood reactivity to marital conflict, was related to shorter LTL (B=-1.51, pfamily and marital conflict and warmth, and positive and negative mood over a two-month period. To our knowledge, these findings, although cross-sectional, represent the first evidence showing that link between children's affective responses and daily family interactions may have implications for telomere length. Copyright © 2015 Elsevier Ltd. All rights reserved.

42 CFR 83.16 - How will the Secretary decide the outcome(s) of a petition?

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false How will the Secretary decide the outcome(s) of a... AS MEMBERS OF THE SPECIAL EXPOSURE COHORT UNDER THE ENERGY EMPLOYEES OCCUPATIONAL ILLNESS... Secretary decide the outcome(s) of a petition? (a) The Director of NIOSH will propose a decision to add or...

Leukocyte telomere length and mortality among U.S. adults: Effect modification by physical activity behaviour.

Science.gov (United States)

Loprinzi, Paul D; Loenneke, Jeremy P

2018-01-01

The purpose of this study was to examine the association between leukocyte telomere length (LTL) and mortality (outcome variable), with consideration by physical activity behaviour. Data from the 1999-2002 National Health and Nutrition Examination Survey were employed (N = 6,611; 20-85 yrs), with follow-up mortality assessment through 31 December 2006. DNA was extracted from whole blood to assess LTL via quantitative polymerase chain reaction. Compared to those in the first LTL tertile, the adjusted hazard ratio for all-cause mortality for those in the 2 nd and 3 rd LTL tertiles, respectively, was 0.82 (95% CI: 0.60-1.12; P = .22) and 0.76 (95% CI: 0.50-1.14; P = .18). However, after adjustments, LTL tertile 3 (vs. 1) was associated with all-cause mortality (HR = 0.37; 95% CI: 0.14-0.93; P = .03) for those who engaged in moderate-intensity exercise. Similarly, LTL was associated with CVD-specific mortality for those who engaged in moderate-intensity exercise (HR = 0.17; 95% CI: 0.04-0.73; P = .02). Longer telomeres are associated with increased survival, particularly among men and those who are active, underscoring the importance of promotion of physical activity behaviour.

High-resolution MR imaging of the proximal zone of the lunotriquetral ligament with a microscopy coil

International Nuclear Information System (INIS)

Yoshioka, Hiroshi; Carrino, John A.; Lang, Philipp; Winalski, Carl S.; Tanaka, Toshikazu; Ueno, Teruko; Shindo, Masashi

2006-01-01

To evaluate high-resolution MRI of the proximal zone of the lunotriquetral ligament (LTL) using a microscopy surface coil with a 1.5 T scanner. The proximal zone of the LTL was reviewed in 90 subjects (23 asymptomatic normal volunteers and 67 patients with suspicion of triangular fibrocartilage complex injury) with high-resolution MRI using a 47-mm microscopy surface coil. High-resolution MR images were obtained with gradient recalled echo (GRE) T2*-weighted sequence and short tau inversion recovery imaging, with a 1- to 1.5-mm slice thickness, a 50-mm field of view, an imaging matrix of 140-224 x 512 using zero fill interpolation, and 3-4 excitations. As a qualitative analysis, the LTL was classified in shape and signal intensity. The triangle-shaped low-signal-intensity LTL was identified in 77 of 90 subjects (85.6%) on GRE images. The triangle was classified as regular (41.1%), broad-based (20.0%), narrow-based (6.7%), or asymmetrical (17.8%). The bar-shaped ligament was seen in one patient, and unclassified ligaments were seen in 12 patients. All volunteers showed triangle-shaped LTL. The MR signal intensity of the proximal zone in the LTL was characterized as homogeneously low intensity (type 1; 33.8%). (orig.)

High-resolution MR imaging of the proximal zone of the lunotriquetral ligament with a microscopy coil

Energy Technology Data Exchange (ETDEWEB)

Yoshioka, Hiroshi; Carrino, John A.; Lang, Philipp; Winalski, Carl S. [Brigham and Women' s Hospital, Department of Radiology, Boston, MA (United States); Tanaka, Toshikazu [Tsukuba Memorial Hospital, Department of Orthopedic Surgery, Tsukuba (Japan); Ueno, Teruko [University of Tsukuba, Department of Radiology, Tsukuba (Japan); Shindo, Masashi [Tsukuba University Hospital, Tsukuba (Japan)

2006-05-15

To evaluate high-resolution MRI of the proximal zone of the lunotriquetral ligament (LTL) using a microscopy surface coil with a 1.5 T scanner. The proximal zone of the LTL was reviewed in 90 subjects (23 asymptomatic normal volunteers and 67 patients with suspicion of triangular fibrocartilage complex injury) with high-resolution MRI using a 47-mm microscopy surface coil. High-resolution MR images were obtained with gradient recalled echo (GRE) T2*-weighted sequence and short tau inversion recovery imaging, with a 1- to 1.5-mm slice thickness, a 50-mm field of view, an imaging matrix of 140-224 x 512 using zero fill interpolation, and 3-4 excitations. As a qualitative analysis, the LTL was classified in shape and signal intensity. The triangle-shaped low-signal-intensity LTL was identified in 77 of 90 subjects (85.6%) on GRE images. The triangle was classified as regular (41.1%), broad-based (20.0%), narrow-based (6.7%), or asymmetrical (17.8%). The bar-shaped ligament was seen in one patient, and unclassified ligaments were seen in 12 patients. All volunteers showed triangle-shaped LTL. The MR signal intensity of the proximal zone in the LTL was characterized as homogeneously low intensity (type 1; 33.8%). (orig.)

Telomere Shortening in Neurological Disorders: An Abundance of Unanswered Questions

OpenAIRE

Eitan, Erez; Hutchison, Emmette R.; Mattson, Mark P.

2014-01-01

Telomeres, ribonucleoprotein complexes that cap eukaryotic chromosomes, typically shorten in leukocytes with aging. Aging is a primary risk factor for neurodegenerative disease (ND), and a common assumption has arisen that leukocyte telomere length (LTL) can serve as a predictor of neurological disease. However, the evidence for shorter LTL in Alzheimer’s and Parkinson’s patients is inconsistent. The diverse causes of telomere shortening may explain variability in LTL between studies and indi...

Safety verification of non-linear hybrid systems is quasi-decidable

Czech Academy of Sciences Publication Activity Database

Ratschan, Stefan

2014-01-01

Roč. 44, č. 1 (2014), s. 71-90 ISSN 0925-9856 R&D Projects: GA ČR GCP202/12/J060 Institutional support: RVO:67985807 Keywords : hybrid system s * safety verification * decidability * robustness Subject RIV: IN - Informatics, Computer Science Impact factor: 0.875, year: 2014

Applying Model Checking to Industrial-Sized PLC Programs

CERN Document Server

AUTHOR|(CDS)2079190; Darvas, Daniel; Blanco Vinuela, Enrique; Tournier, Jean-Charles; Bliudze, Simon; Blech, Jan Olaf; Gonzalez Suarez, Victor M

2015-01-01

Programmable logic controllers (PLCs) are embedded computers widely used in industrial control systems. Ensuring that a PLC software complies with its specification is a challenging task. Formal verification has become a recommended practice to ensure the correctness of safety-critical software but is still underused in industry due to the complexity of building and managing formal models of real applications. In this paper, we propose a general methodology to perform automated model checking of complex properties expressed in temporal logics (\\eg CTL, LTL) on PLC programs. This methodology is based on an intermediate model (IM), meant to transform PLC programs written in various standard languages (ST, SFC, etc.) to different modeling languages of verification tools. We present the syntax and semantics of the IM and the transformation rules of the ST and SFC languages to the nuXmv model checker passing through the intermediate model. Finally, two real cases studies of \\CERN PLC programs, written mainly in th...

Review/decide and inquiry/decide. Two approaches to decision making. Report from a team syntegrity meeting. Project RISCOM

International Nuclear Information System (INIS)

Andersson, Kjell

1998-01-01

The meeting addressed the question how it is possible to make decision processes and risk assessment for deep repository development more transparent. The two dominant decision approaches used in Sweden and the UK, review/decide(r/d) and inquiry/decide(i/d), were discussed. The main conclusions from group discussions were: It was acknowledged that the concept of transparency includes three equally important aspects: factual issues, value issues, and stake holder's authenticity. There is a need in both countries to bring in the best aspects of both the r/d and the i/d approaches. Both approaches seem to offer possibilities and suffer limitations with respect to the segregation of facts, uncertainties and value judgements, and some sort of combination of the two may present a valuable development. However, neither the i/d nor the r/d approach seems to provide a good framework for clarification of the value issue. Experts have dominated the decision process in both countries. There is a need for a more genuine consultation process. The Swedish EIA is evolving in this direction. The regulator should take part in the process, also at an early stage. It is important that the integrity of the regulator is maintained. Rules and responsibilities of implementers, regulators, planning authorities and other decision-makers should be established early in the process. The public should know that they have access to a process that clarifies value judgements, facts, uncertainties and questions. It is necessary for the public to know what the technical issues are, and to have the means to evaluate the authenticity of the experts. It is important that political decisions are not taken without due consideration of scientific and technical arguments. There are factors beside safety assessments which are completely legitimate to consider. An approach with intense interaction between politicians, experts and the public is needed

Review/decide and inquiry/decide. Two approaches to decision making. Report from a team syntegrity meeting. Project RISCOM

Energy Technology Data Exchange (ETDEWEB)

Andersson, Kjell [ed.] [Karinta-Konsult, Taeby (Sweden)

1998-01-01

The meeting addressed the question how it is possible to make decision processes and risk assessment for deep repository development more transparent. The two dominant decision approaches used in Sweden and the UK, review/decide(r/d) and inquiry/decide(i/d), were discussed. The main conclusions from group discussions were: It was acknowledged that the concept of transparency includes three equally important aspects: factual issues, value issues, and stake holder`s authenticity. There is a need in both countries to bring in the best aspects of both the r/d and the i/d approaches. Both approaches seem to offer possibilities and suffer limitations with respect to the segregation of facts, uncertainties and value judgements, and some sort of combination of the two may present a valuable development. However, neither the i/d nor the r/d approach seems to provide a good framework for clarification of the value issue. Experts have dominated the decision process in both countries. There is a need for a more genuine consultation process. The Swedish EIA is evolving in this direction. The regulator should take part in the process, also at an early stage. It is important that the integrity of the regulator is maintained. Rules and responsibilities of implementers, regulators, planning authorities and other decision-makers should be established early in the process. The public should know that they have access to a process that clarifies value judgements, facts, uncertainties and questions. It is necessary for the public to know what the technical issues are, and to have the means to evaluate the authenticity of the experts. It is important that political decisions are not taken without due consideration of scientific and technical arguments. There are factors beside safety assessments which are completely legitimate to consider. An approach with intense interaction between politicians, experts and the public is needed.

Food Security and Leukocyte Telomere Length in Adult Americans

Directory of Open Access Journals (Sweden)

Mohsen Mazidi

2017-01-01

Full Text Available Background and Purpose. Leukocyte telomere length (LTL is a biomarker of biologic age. Whether food security status modulates LTL is still unknown. We investigated the association between food security and LTL in participants of the 1999–2002 US National Health and Nutrition Examination Survey (NHANES. Methods. Analysis of covariance (ANCOVA was used to evaluate the association between food security categories and LTL controlling for sex, race, and education and accounting for the survey design and sample weights. Results. We included 10,888 participants with 5228 (48.0% being men. They were aged on average 44.1 years. In all, 2362 (21.7% had less than high school, 2787 (25.6% had achieved high school, while 5705 (52.5% had done more than high school. In sex-, race-, and education-adjusted ANCOVA, average LTL (T/S ratio for participants with high food security versus those with marginal, low, or very low food security was 1.32 versus 1.20 for the age group 25–35 years and 1.26 versus 1.11 for the 35–45 years, (p<0.001. Conclusion. The association between food insecurity and LTL shortening in young adults suggest that some of the future effects of food insecurity on chronic disease risk in this population could be mediated by telomere shortening.

Dysregulated physiological stress systems and accelerated cellular aging.

Science.gov (United States)

Révész, Dóra; Verhoeven, Josine E; Milaneschi, Yuri; de Geus, Eco J C N; Wolkowitz, Owen M; Penninx, Brenda W J H

2014-06-01

Exposure to chronic stressors is associated with accelerated biological aging as indicated by reduced leukocyte telomere length (LTL). This impact could be because of chronic overactivation of the body's physiological stress systems. This study examined the associations between LTL and the immune system, hypothalamic-pituitary-adrenal axis and autonomic nervous system. LTL was assessed in 2936 adults from the Netherlands Study of Depression and Anxiety. Inflammation markers (interleukin-6, c-reactive protein, tumor necrosis factor-alpha), hypothalamic-pituitary-adrenal-axis indicators (salivary cortisol awakening curve [area under the curve indicators, with respect to the ground and increase], evening levels, 0.5 mg dexamethasone cortisol suppression ratio), and autonomic nervous system measures (heart rate, respiratory sinus arrhythmia, pre-ejection period) were determined. Linear regression analyses were performed and adjusted for sociodemographic, lifestyle and clinical factors. Shorter LTL was significantly associated with higher c-reactive protein, interleukin-6, area under the curve with respect to increase, and heart rate. A cumulative index score was calculated based on the number of highest tertiles of these 4 stress markers. LTL demonstrated a significant gradient within subjects ranging from having zero (5528 base pairs) to having 4 elevated stress markers (5371 base pairs, p for trend = 0.002), corresponding to a difference of 10 years of accelerated biological aging. Contrary to the expectations, shorter LTL was also associated with longer pre-ejection period, indicating lower sympathetic tone. This large-scale study showed that inflammation, high awakening cortisol response, and increased heart rate are associated with shorter LTL, especially when they are dysregulated cumulatively. Copyright © 2014 Elsevier Inc. All rights reserved.

Leukocyte telomere length and personality: associations with the Big Five and Type D personality traits.

Science.gov (United States)

Schoormans, D; Verhoeven, J E; Denollet, J; van de Poll-Franse, L; Penninx, B W J H

2018-04-01

Backgrounds Accelerated cellular ageing, which can be examined by telomere length (TL), may be an overarching mechanism underlying the association between personality and adverse health outcomes. This 6-year longitudinal study examined the relation between personality and leukocyte telomere length (LTL) across time among adults with a wide age-range. Data from the Netherlands Study of Depression and Anxiety were used and included patients with a depression and/or anxiety disorder and healthy controls. Overall, 2936 persons (18-65 years, 66% female) had data on LTL at baseline and 1883 persons had LTL at 6-year follow-up. The Big Five personality traits (neuroticism, extraversion, openness to experience, agreeableness, and conscientiousness) and Type D personality were assessed. Neuroticism was negatively (B = -2.11, p = 0.03) and agreeableness was positively (B = 3.84, p = 0.03) related to LTL measured across two time points, which became just non-significant after adjusting for somatic health, lifestyle factors, and recent life stress (B = -1.99, p = 0.06; and B = 3.01, p = 0.10). Type D personality was negatively (B = -50.16, p Big Five traits high neuroticism and low agreeableness, and Type D personality were associated with shorter LTL measured across a 6-year period. Associations with the Big Five traits became non-significant after controlling for somatic health, lifestyle factors, and recent life stress, yet similar trends were observed. Type D personality remained independently associated with shorter LTL after full adjustment.

Accumulative effects of indoor air pollution exposure on leukocyte telomere length among non-smokers.

Science.gov (United States)

Lin, Nan; Mu, Xinlin; Wang, Guilian; Ren, Yu'ang; Su, Shu; Li, Zhiwen; Wang, Bin; Tao, Shu

2017-08-01

Indoor air pollution is an important environmental factor that contributes to the burden of various diseases. Long-term exposure to ambient air pollution is associated with telomere shortening. However, the association between chronic indoor air pollution from household fuel combustion and leukocyte telomere length has not been studied. In our study, 137 cancer-free non-smokers were recruited. Their exposure levels to indoor air pollution from 1985 to 2014 were assessed using a face-to-face interview questionnaire, and leukocyte telomere length (LTL) was measured using a monochrome multiplex quantitative PCR method. Accumulative exposure to solid fuel usage for cooking was negatively correlated with LTL. The LTL of residents who were exposed to solid fuel combustion for three decades (LTL = 0.70 ± 0.17) was significantly shorter than that of other populations. In addition, education and occupation were related to both exposure to solid fuel and LTL. Sociodemographic factors may play a mediating role in the correlation between leukocyte telomere length and environmental exposure to indoor air pollution. In conclusion, long-term exposure to indoor air pollution may cause LTL dysfunction. Copyright © 2017 Elsevier Ltd. All rights reserved.

Unifying proof methodologies of duration calculus and timed linear temporal logic

DEFF Research Database (Denmark)

Liu, Zhiming; Ravn, Anders P.; Li, Xioshan

2004-01-01

to the basic DC allows us to unify the methods from DC and LTL for formal real-time systems development: Requirements and high level design decisions are interval properties and are therefore specified and reasoned about in DC, while properties of an implementation, as well as the refinement relation between...... two implementations, are specified and verified compositionally and inductively in LTL. Implementation properties are related to requirement and design properties by rules for lifting LTL formulas to DC formulas. The method is illustrated by the Gas Burner case study....

[A systematic review of decided litigated cases on adverse drug events in Japan: classification of decided cases appearing in law reports].

Science.gov (United States)

Eguchi, Rika; Kato, Masahisa; Kaneko, Erina; Kusaba, Kenji; Yoshikawa, Manabu; Yamano, Toru; Seo, Takashi; Hagihara, Akihito

2015-01-01

Much of the damage to health caused by drugs could be prevented by appropriate care. A well-defined duty of care and further information are required for healthcare professionals. Although there are many litigation cases to use as references, neither the extent of the duty of care nor the obligation to explain medication according to the type of drug prescribed has yet been fully established. Thus, we systematically collected decided cases of adverse drug events, and assessed the degree of the duties of care and information. Specifically, we collected decided cases in which physicians, dentists, pharmacists, nurses, or hospitals had been sued. Data were derived from Bessatsu Jurist Iryo-kago Hanrei Hyakusen, Hanrei Jihou, and Hanrei Times from 1989 to November 2013, and information on precedents in the records of the Supreme Court of Japan from 2001 to November 2013. We analyzed the cases, and assessed the following according to the type of drug: (1) standards and explanations when dealing with drugs that were critical issues in litigation, and (2) the degree of the physician's or pharmacist's duties of care and information. In total, 126 cases were collected. The number of drug categories classified was 27, and 9 were considered of practical importance. After this systematic review, we found a trend in the degree of the required level of care and information on several drugs. With respect to duties of care and information, the gap between the required level and actual practice suggests that healthcare professionals must improve their care and explanations.

Superior Reproducibility of the Leading to Leading Edge and Inner to Inner Edge Methods in the Ultrasound Assessment of Maximum Abdominal Aortic Diameter.

Science.gov (United States)

Borgbjerg, Jens; Bøgsted, Martin; Lindholt, Jes S; Behr-Rasmussen, Carsten; Hørlyck, Arne; Frøkjær, Jens B

2018-02-01

Controversy exists regarding optimal caliper placement in ultrasound assessment of maximum abdominal aortic diameter. This study aimed primarily to determine reproducibility of caliper placement in relation to the aortic wall with the three principal methods: leading to leading edge (LTL), inner to inner edge (ITI), and outer to outer edge (OTO). The secondary aim was to assess the mean difference between the OTO, ITI, and LTL diameters and estimate the impact of using either of these methods on abdominal aortic aneurysm (AAA) prevalence in a screening program. Radiologists (n=18) assessed the maximum antero-posterior abdominal aortic diameter by completing repeated caliper placements with the OTO, LTL, and ITI methods on 50 still abdominal aortic images obtained from an AAA screening program. Inter-observer reproducibility was calculated as the limit of agreement with the mean (LoA), which represents expected deviation of a single observer from the mean of all observers. Intra-observer reproducibility was assessed averaging the LoA for each observer with their repeated measurements. Based on data from an AAA screening trial and the estimated mean differences between the three principal methods, AAA prevalence was estimated using each of the methods. The inter-observer LoA of the OTO, ITI, and LTL was 2.6, 1.9, and 1.9 mm, whereas the intra-observer LoA was 2.0, 1.6, and 1.5 mm, respectively. Mean differences of 5.0 mm were found between OTO and ITI measurements, 2.6 mm between OTO and LTL measurements, and 2.4 mm between LTL and ITI measurements. The prevalence of AAA almost doubled using OTO instead of ITI, while the difference between ITI and LTL was minor (3.3% vs. 4.0% AAA). The study shows superior reproducibility of LTL and ITI compared with the OTO method of caliper placement in ultrasound determination of maximum abdominal aortic diameter, and the choice of caliper placement method significantly affects the prevalence of AAAs in screening programs

Telomerase RNA Component (TERC) genetic variants interact with the mediterranean diet modifying the inflammatory status and its relationship with aging: CORDIOPREV study

Science.gov (United States)

Background: Leukocyte telomere length (LTL) attrition has been associated with age-related diseases. Telomerase RNA Component (TERC) genetic variants have been associated with LTL; whereas fatty acids (FAs) can interact with genetic factors and influence in aging. We explore whether variability at t...

Dysregulated physiological stress systems and accelerated cellular aging

NARCIS (Netherlands)

Révész, D.; Verhoeven, J.; Milaneschi, Y.; de Geus, E.J.C.; Wolkowitz, O.M.; Penninx, B.W.J.H.

2014-01-01

Exposure to chronic stressors is associated with accelerated biological aging as indicated by reduced leukocyte telomere length (LTL). This impact could be because of chronic overactivation of the body's physiological stress systems. This study examined the associations between LTL and the immune

Accumulative effects of indoor air pollution exposure on leukocyte telomere length among non-smokers

International Nuclear Information System (INIS)

Lin, Nan; Mu, Xinlin; Wang, Guilian; Ren, Yu'ang; Su, Shu; Li, Zhiwen; Wang, Bin; Tao, Shu

2017-01-01

Indoor air pollution is an important environmental factor that contributes to the burden of various diseases. Long-term exposure to ambient air pollution is associated with telomere shortening. However, the association between chronic indoor air pollution from household fuel combustion and leukocyte telomere length has not been studied. In our study, 137 cancer-free non-smokers were recruited. Their exposure levels to indoor air pollution from 1985 to 2014 were assessed using a face-to-face interview questionnaire, and leukocyte telomere length (LTL) was measured using a monochrome multiplex quantitative PCR method. Accumulative exposure to solid fuel usage for cooking was negatively correlated with LTL. The LTL of residents who were exposed to solid fuel combustion for three decades (LTL = 0.70 ± 0.17) was significantly shorter than that of other populations. In addition, education and occupation were related to both exposure to solid fuel and LTL. Sociodemographic factors may play a mediating role in the correlation between leukocyte telomere length and environmental exposure to indoor air pollution. In conclusion, long-term exposure to indoor air pollution may cause LTL dysfunction. - Highlights: • This is the first study to investigate a clear association between indoor air pollution and leukocyte telomere length. • Chronic exposure to household solid fuel combustion and leukocyte telomere length presented a negative correlation. • Shortest leukocyte telomere length belonged to population cooking for longest time. • Education and occupation were remarkably associated with leukocyte telomere length via relating with indoor air pollution. - Long-term exposure to household solid fuel combustion is negatively associated with LTL.

Efficient Semantics-Based Compliance Checking Using LTL Formulae and Unfolding

Directory of Open Access Journals (Sweden)

Liang Song

2013-01-01

Full Text Available Business process models are required to be in line with frequently changing regulations, policies, and environments. In the field of intelligent modeling, organisations concern automated business process compliance checking as the manual verification is a time-consuming and inefficient work. There exist two key issues for business process compliance checking. One is the definition of a business process retrieval language that can be employed to capture the compliance rules, the other concerns efficient evaluation of these rules. Traditional syntax-based retrieval approaches cannot deal with various important requirements of compliance checking in practice. Although a retrieval language that is based on semantics can overcome the drawback of syntax-based ones, it suffers from the well-known state space explosion. In this paper, we define a semantics-based process model query language through simplifying a property specification pattern system without affecting its expressiveness. We use this language to capture semantics-based compliance rules and constraints. We also propose a feasible approach in such a way that the compliance checking will not suffer from the state space explosion as much as possible. A tool is implemented to evaluate the efficiency. An experiment conducted on three model collections illustrates that our technology is very efficient.

Psychiatric disorders and leukocyte telomere length: Underlying mechanisms linking mental illness with cellular aging.

Science.gov (United States)

Lindqvist, Daniel; Epel, Elissa S; Mellon, Synthia H; Penninx, Brenda W; Révész, Dóra; Verhoeven, Josine E; Reus, Victor I; Lin, Jue; Mahan, Laura; Hough, Christina M; Rosser, Rebecca; Bersani, F Saverio; Blackburn, Elizabeth H; Wolkowitz, Owen M

2015-08-01

Many psychiatric illnesses are associated with early mortality and with an increased risk of developing physical diseases that are more typically seen in the elderly. Moreover, certain psychiatric illnesses may be associated with accelerated cellular aging, evidenced by shortened leukocyte telomere length (LTL), which could underlie this association. Shortened LTL reflects a cell's mitotic history and cumulative exposure to inflammation and oxidation as well as the availability of telomerase, a telomere-lengthening enzyme. Critically short telomeres can cause cells to undergo senescence, apoptosis or genomic instability, and shorter LTL correlates with poorer health and predicts mortality. Emerging data suggest that LTL may be reduced in certain psychiatric illnesses, perhaps in proportion to exposure to the psychiatric illnesses, although conflicting data exist. Telomerase has been less well characterized in psychiatric illnesses, but a role in depression and in antidepressant and neurotrophic effects has been suggested by preclinical and clinical studies. In this article, studies on LTL and telomerase activity in psychiatric illnesses are critically reviewed, potential mediators are discussed, and future directions are suggested. A deeper understanding of cellular aging in psychiatric illnesses could lead to re-conceptualizing them as systemic illnesses with manifestations inside and outside the brain and could identify new treatment targets. Copyright © 2015 Elsevier Ltd. All rights reserved.

DCAF4, a novel gene associated with leucocyte telomere length

DEFF Research Database (Denmark)

Mangino, Massimo; Christiansen, Lene; Stone, Rivka

2015-01-01

BACKGROUND: Leucocyte telomere length (LTL), which is fashioned by multiple genes, has been linked to a host of human diseases, including sporadic melanoma. A number of genes associated with LTL have already been identified through genome-wide association studies. The main aim of this study was t...

How to Decide on Modeling Details: Risk and Benefit Assessment.

Science.gov (United States)

Özilgen, Mustafa

Mathematical models based on thermodynamic, kinetic, heat, and mass transfer analysis are central to this chapter. Microbial growth, death, enzyme inactivation models, and the modeling of material properties, including those pertinent to conduction and convection heating, mass transfer, such as diffusion and convective mass transfer, and thermodynamic properties, such as specific heat, enthalpy, and Gibbs free energy of formation and specific chemical exergy are also needed in this task. The origins, simplifying assumptions, and uses of model equations are discussed in this chapter, together with their benefits. The simplified forms of these models are sometimes referred to as "laws," such as "the first law of thermodynamics" or "Fick's second law." Starting to modeling a study with such "laws" without considering the conditions under which they are valid runs the risk of ending up with erronous conclusions. On the other hand, models started with fundamental concepts and simplified with appropriate considerations may offer explanations for the phenomena which may not be obtained just with measurements or unprocessed experimental data. The discussion presented here is strengthened with case studies and references to the literature.

Flowchart Programs, Regular Expressions, and Decidability of Polynomial Growth-Rate

OpenAIRE

Ben-Amram, Amir M.; Pineles, Aviad

2014-01-01

We present a new method for inferring complexity properties for a class of programs in the form of flowcharts annotated with loop information. Specifically, our method can (soundly and completely) decide if computed values are polynomially bounded as a function of the input; and similarly for the running time. Such complexity properties are undecidable for a Turing-complete programming language, and a common work-around in program analysis is to settle for sound but incomplete solutions. In ...

Development of Learning to Learn Skills in Primary School

Science.gov (United States)

Vainikainen, Mari-Pauliina; Wüstenberg, Sascha; Kupiainen, Sirkku; Hotulainen, Risto; Hautamäki, Jarkko

2015-01-01

In Finland, schools' effectiveness in fostering the development of transversal skills is evaluated through large-scale learning to learn (LTL) assessments. This article presents how LTL skills--general cognitive competences and learning-related motivational beliefs--develop during primary school and how they predict pupils' CPS skills at the end…

12 CFR 617.7610 - What should the System institution do when it decides to sell acquired agricultural real estate?

Science.gov (United States)

2010-01-01

... decides to sell acquired agricultural real estate? 617.7610 Section 617.7610 Banks and Banking FARM CREDIT... institution do when it decides to sell acquired agricultural real estate? (a) Notify the previous owner, (1) Within 15 days of the System institution's decision to sell acquired agricultural real estate, it must...

12 CFR 617.7615 - What should the System institution do when it decides to lease acquired agricultural real estate?

Science.gov (United States)

2010-01-01

... decides to lease acquired agricultural real estate? 617.7615 Section 617.7615 Banks and Banking FARM... the System institution do when it decides to lease acquired agricultural real estate? (a) Notify the... real estate at a rate equivalent to the appraised rental value of the property. (1) Within 15 days...

12 CFR 617.7620 - What should the System institution do when it decides to sell acquired agricultural real estate...

Science.gov (United States)

2010-01-01

... decides to sell acquired agricultural real estate at a public auction? 617.7620 Section 617.7620 Banks and... What should the System institution do when it decides to sell acquired agricultural real estate at a public auction? System institutions electing to sell or lease acquired agricultural real estate or a...

Deciding Not to Un-Do the "I Do:" Therapy Experiences of Women Who Consider Divorce But Decide to Remain Married.

Science.gov (United States)

Kanewischer, Erica J W; Harris, Steven M

2015-07-01

This study explores women's experience of marital therapy while they navigated decision making around divorce. A qualitative method was used to gain a deeper understanding of the participants' therapy and relationship decision-making experiences. How are women's decisions whether or not to exit their marriage affected by therapy? The researchers interviewed 15 women who had considered initiating divorce before they turned 40 and had attended at least five marital therapy sessions but ultimately decided not to divorce. In general, participants reported that the therapy was helpful to them, their decision-making process and their marriages. Five main themes emerged from the interviews: Women Initiated Therapy, Therapist Was Experienced as Unbiased, Therapy was Helpful, Importance of Extra-therapeutic Factors, and Gradual Process. © 2014 American Association for Marriage and Family Therapy.

The post-arthro-CT of the wrist: clinical evaluation

International Nuclear Information System (INIS)

Scheurecker, G.

2001-03-01

To compare the diagnostic effectiveness of post-arthro-CT (PACT) and 3-compartment wrist arthrography (AG) both separate and combined versus wrist arthroscopy for scapho-lunate ligament (SLL), luno-triquetral ligament (LTL) and triangular fibrocartilage (TFC) defects and chondromalacia of the carpal bones. Material and methods: In 58 patients (16-69 years) the affected wrist was examined initially by conventional 3-compartment wrist arthrography with digital subtraction technique during injection followed by digital stress images. Afterwards spiral arthro-CT was performed in the semi-coronal and axial plane with 1 mm slice thickness and secondary true-coronal and sagittal reconstructions. Within 1 month arthroscopy was performed in general anesthesia utilizing standard joint entry points combined with routine digital picture archiving. All examinations were evaluated for SLL, LTL and TFC defects, PACT and AS for ChM too. Results: AG versus AS: The following detection rates were observed (AG and AS positive/AG negative - AS positive/AG positive - AS negative/ AG and AS negative): SLL: 16/8/0/34, LTL: 13/4/8/33, TFC: 28/5/1/24. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity (%) values: SLL 67/100, LTL 76/80, TFC 85/96. PACT versus AS: The following detection rates were observed (PACT and AS positive/PACT negative - AS positive/PACT positive - AS negative/ PACT and AS negative): SLL: 18/6/0/34, LTL: 15/2/8/33, TFC: 31/2/2/23, ChM: 20/15/3/20. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity (%) values: SLL 75/100, LTL 88/80, TFC 94/92, ChM 57/87. AG+PACT versus AS: The following detection rates were observed (AG+PACT and AS positive/AG+PACT negative - AS positive/AG+PACT positive - AS negative/ AG+PACT and AS negative): SLL: 19/5/0/34, LTL: 15/2/8/33, TFC: 31/2/2/23, ChM 20/15/3/20. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity

The post-arthro-CT of the wrist: clinical evaluation

International Nuclear Information System (INIS)

Scheurecker, G.

2001-03-01

To compare the diagnostic effectiveness of post-arthro-CT (PACT) and 3-compartment wrist arthrography (AG) both separate and combined versus wrist arthroscopy for scapho-lunate ligament (SLL), luno-triquetral ligament (LTL) and triangular fibrocartilage (TFC) defects and chondromalacia of the carpal bones. Material and methods: in 58 patients (16-69 years) the affected wrist was examined initially by conventional 3-compartment wrist arthrography with digital subtraction technique during injection followed by digital stress images. Afterwards spiral arthro-CT was performed in the semi-coronal and axial plane with 1 mm slice thickness and secondary true-coronal and sagittal reconstructions. Within 1 month arthroscopy was performed in general anesthesia utilizing standard joint entry points combined with routine digital picture archiving. All examinations were evaluated for SLL, LTL and TFC defects, PACT and AS for ChM too. Results: AG versus AS: the following detection rates were observed (AG and AS positive/AG negative - AS positive/AG positive - AS negative/ AG and AS negative): SLL: 16/8/0/34, LTL: 13/4/8/33, TFC: 28/5/1/24. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity (%) values: SLL 67/100, LTL 76/80, TFC 85/96. PACT versus AS: the following detection rates were observed (PACT and AS positive/PACT negative - AS positive/PACT positive - AS negative/ PACT and AS negative): SLL: 18/6/0/34, LTL: 15/2/8/33, TFC: 31/2/2/23, ChM: 20/15/3/20. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity (%) values: SLL 75/100, LTL 88/80, TFC 94/92, ChM 57/87. AG+PACT versus AS: the following detection rates were observed (AG+PACT and AS positive/AG+PACT negative - AS positive/AG+PACT positive - AS negative/ AG+PACT and AS negative): SLL: 19/5/0/34, LTL: 15/2/8/33, TFC: 31/2/2/23, ChM 20/15/3/20. Using AS as the 'gold standard' this translates into following sensitivity (%) and specificity

Improving Breast Cancer Surgical Treatment Decision Making: The iCanDecide Randomized Clinical Trial.

Science.gov (United States)

Hawley, Sarah T; Li, Yun; An, Lawrence C; Resnicow, Kenneth; Janz, Nancy K; Sabel, Michael S; Ward, Kevin C; Fagerlin, Angela; Morrow, Monica; Jagsi, Reshma; Hofer, Timothy P; Katz, Steven J

2018-03-01

Purpose This study was conducted to determine the effect of iCanDecide, an interactive and tailored breast cancer treatment decision tool, on the rate of high-quality patient decisions-both informed and values concordant-regarding locoregional breast cancer treatment and on patient appraisal of decision making. Methods We conducted a randomized clinical trial of newly diagnosed patients with early-stage breast cancer making locoregional treatment decisions. From 22 surgical practices, 537 patients were recruited and randomly assigned online to the iCanDecide interactive and tailored Web site (intervention) or the iCanDecide static Web site (control). Participants completed a baseline survey and were mailed a follow-up survey 4 to 5 weeks after enrollment to assess the primary outcome of a high-quality decision, which consisted of two components, high knowledge and values-concordant treatment, and secondary outcomes (decision preparation, deliberation, and subjective decision quality). Results Patients in the intervention arm had higher odds of making a high-quality decision than did those in the control arm (odds ratio, 2.00; 95% CI, 1.37 to 2.92; P = .0004), which was driven primarily by differences in the rates of high knowledge between groups. The majority of patients in both arms made values-concordant treatment decisions (78.6% in the intervention arm and 81.4% in the control arm). More patients in the intervention arm had high decision preparation (estimate, 0.18; 95% CI, 0.02 to 0.34; P = .027), but there were no significant differences in the other decision appraisal outcomes. The effect of the intervention was similar for women who were leaning strongly toward a treatment option at enrollment compared with those who were not. Conclusion The tailored and interactive iCanDecide Web site, which focused on knowledge building and values clarification, positively affected high-quality decisions largely by improving knowledge compared with static online

Putting hydrological modelling practice to the test

NARCIS (Netherlands)

Melsen, Lieke Anna

2017-01-01

Six steps can be distinguished in the process of hydrological modelling: the perceptual model (deciding on the processes), the conceptual model (deciding on the equations), the procedural model (get the code to run on a computer), calibration (identify the parameters), evaluation (confronting

20 CFR 670.200 - Who decides where Job Corps centers will be located?

Science.gov (United States)

2010-04-01

... for making decisions concerning the establishment, relocation, expansion, or closing of contract... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who decides where Job Corps centers will be located? 670.200 Section 670.200 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF...

Re-Imagining Specialized STEM Academies: Igniting and Nurturing "Decidedly Different Minds", by Design

Science.gov (United States)

Marshall, Stephanie Pace

2010-01-01

This article offers a personal vision and conceptual design for reimagining specialized science, technology, engineering, and mathematics (STEM) academies designed to nurture "decidedly different" STEM minds and ignite a new generation of global STEM talent, innovation, and entrepreneurial leadership. This design enables students to engage…

Flowchart Programs, Regular Expressions, and Decidability of Polynomial Growth-Rate

Directory of Open Access Journals (Sweden)

Amir M. Ben-Amram

2016-07-01

Full Text Available We present a new method for inferring complexity properties for a class of programs in the form of flowcharts annotated with loop information. Specifically, our method can (soundly and completely decide if computed values are polynomially bounded as a function of the input; and similarly for the running time. Such complexity properties are undecidable for a Turing-complete programming language, and a common work-around in program analysis is to settle for sound but incomplete solutions. In contrast, we consider a class of programs that is Turing-incomplete, but strong enough to include several challenges for this kind of analysis. For a related language that has well-structured syntax, similar to Meyer and Ritchie's LOOP programs, the problem has been previously proved to be decidable. The analysis relied on the compositionality of programs, hence the challenge in obtaining similar results for flowchart programs with arbitrary control-flow graphs. Our answer to the challenge is twofold: first, we propose a class of loop-annotated flowcharts, which is more general than the class of flowcharts that directly represent structured programs; secondly, we present a technique to reuse the ideas from the work on tructured programs and apply them to such flowcharts. The technique is inspired by the classic translation of non-deterministic automata to regular expressions, but we obviate the exponential cost of constructing such an expression, obtaining a polynomial-time analysis. These ideas may well be applicable to other analysis problems.

Model-checking dense-time Duration Calculus

DEFF Research Database (Denmark)

Fränzle, Martin

2004-01-01

Since the seminal work of Zhou Chaochen, M. R. Hansen, and P. Sestoft on decidability of dense-time Duration Calculus [Zhou, Hansen, Sestoft, 1993] it is well-known that decidable fragments of Duration Calculus can only be obtained through withdrawal of much of the interesting vocabulary...... of this logic. While this was formerly taken as an indication that key-press verification of implementations with respect to elaborate Duration Calculus specifications were also impossible, we show that the model property is well decidable for realistic designs which feature natural constraints...... suitably sparser model classes we obtain model-checking procedures for rich subsets of Duration Calculus. Together with undecidability results also obtained, this sheds light upon the exact borderline between decidability and undecidability of Duration Calculi and related logics....

A multi-paradigm language for reactive synthesis

Directory of Open Access Journals (Sweden)

Ioannis Filippidis

2016-02-01

Full Text Available This paper proposes a language for describing reactive synthesis problems that integrates imperative and declarative elements. The semantics is defined in terms of two-player turn-based infinite games with full information. Currently, synthesis tools accept linear temporal logic (LTL as input, but this description is less structured and does not facilitate the expression of sequential constraints. This motivates the use of a structured programming language to specify synthesis problems. Transition systems and guarded commands serve as imperative constructs, expressed in a syntax based on that of the modeling language Promela. The syntax allows defining which player controls data and control flow, and separating a program into assumptions and guarantees. These notions are necessary for input to game solvers. The integration of imperative and declarative paradigms allows using the paradigm that is most appropriate for expressing each requirement. The declarative part is expressed in the LTL fragment of generalized reactivity(1, which admits efficient synthesis algorithms, extended with past LTL. The implementation translates Promela to input for the Slugs synthesizer and is written in Python. The AMBA AHB bus case study is revisited and synthesized efficiently, identifying the need to reorder binary decision diagrams during strategy construction, in order to prevent the exponential blowup observed in previous work.

Corona protein composition and cytotoxicity evaluation of ultra-small zeolites synthesized from template free precursor suspensions

NARCIS (Netherlands)

Laurent, S.; Ng, E. -P.; Thirifays, C.; Lakiss, L.; Goupil, G. -M.; Mintova, S.; Burtea, C.; Oveisi, E.; Hebert, C.; de Vries, M.; Motazacker, M. M.; Rezaee, F.; Mahmoudi, M.

2013-01-01

The toxicity of two types of ultra-small zeolites (8-18 nm) with LTL-and EMT-type structures is reported. Both the LTL- and EMT-type zeolites belong to the same group of molecular sieves; they have large pores (7.1-7.5 angstrom) and low silica content (Si/Al = 1.2-2.3). The zeolites are prepared by

Investigation of telomere length and psychological stress in rape victims.

Science.gov (United States)

Malan, Stefanie; Hemmings, Sian; Kidd, Martin; Martin, Lindi; Seedat, Soraya

2011-12-21

Women are at an increased risk of depression and other mental health problems following rape. Various etiological factors for depression, including predisposing genetic factors, have been identified. Telomeres are repetitive nucleoprotein structures located at chromosomal ends that protect them from premature degradation. Telomeres reduce in length with each cell division, resulting in cellular senescence and apoptosis. Relative quantification of telomeric repeats using qPCR was performed to investigate whether shorter relative leukocyte telomere length (LTL) in a cohort of 64 rape victims was associated with resilience, the development of rape trauma-related major depressive disorder (MDD) or the development of posttraumatic stress disorder (PTSD) after 3 months. Out of the 64 participants, 23 participants were diagnosed with MDD at baseline and 31 after 3 months. Nine participants were diagnosed with PTSD (MDD and PTSD specifically related to the trauma). No significant associations were observed between relative LTL and resilience or the development of MDD at either baseline or after 3 months in this cohort. However, a marginally significant association was evident between relative LTL and PTSD status. The significant association between relative LTL and PTSD suggests that shorter relative LTL might have acted as a predisposing factor in the development of PTSD after a severely traumatic event. The results of this study indicate that telomere shortening may be an important marker of PTSD risk, with implications for early intervention and timely treatment, and as such warrant replication in a larger cohort. © 2011 Wiley Periodicals, Inc.

30 CFR 204.208 - May a State decide that it will or will not allow one or both of the relief options under this...

Science.gov (United States)

2010-07-01

... MARGINAL PROPERTIES Accounting and Auditing Relief § 204.208 May a State decide that it will or will not allow one or both of the relief options under this subpart? (a) A State may decide in advance that it... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May a State decide that it will or will not...

32 CFR 37.1015 - How do I decide who must sign the TIA if the recipient is an unincorporated consortium?

Science.gov (United States)

2010-07-01

... 32 National Defense 1 2010-07-01 2010-07-01 false How do I decide who must sign the TIA if the recipient is an unincorporated consortium? 37.1015 Section 37.1015 National Defense Department of Defense... Executing the Award The Award Document § 37.1015 How do I decide who must sign the TIA if the recipient is...

Research on Investment Estimation when Deciding to Start a new Business.

OpenAIRE

Guga, L.

2014-01-01

An entrepreneur has to follow several steps when deciding to start a new business. Starting a business involves planning, making key financial decisions, completing a series of legal activities, hiring reliable employees and after all of this the success of the new firm is determined by a few steps, which every manager must take into account. One of these steps is adopting a company name, the calling card of the business, taking into consideration the related tips regarding its selection....

Rational Probabilistic Deciders—Part I: Individual Behavior

Directory of Open Access Journals (Sweden)

S. M. Meerkov

2007-04-01

Full Text Available This paper is intended to model a decision maker as a rational probabilistic decider (RPD and to investigate its behavior in stationary and symmetric Markov switch environments. RPDs take their decisions based on penalty functions defined by the environment. The quality of decision making depends on a parameter referred to as level of rationality. The dynamic behavior of RPDs is described by an ergodic Markov chain. Two classes of RPDs are considered—local and global. The former take their decisions based on the penalty in the current state while the latter consider all states. It is shown that asymptotically (in time and in the level of rationality both classes behave quite similarly. However, the second largest eigenvalue of Markov transition matrices for global RPDs is smaller than that for local ones, indicating faster convergence to the optimal state. As an illustration, the behavior of a chief executive officer, modeled as a global RPD, is considered, and it is shown that the company performance may or may not be optimized—depending on the pay structure employed. While the current paper investigates individual RPDs, a companion paper will address collective behavior.

Efficient Communication Protocols for Deciding Edit Distance

DEFF Research Database (Denmark)

Jowhari, Hossein

2012-01-01

In this paper we present two communication protocols on computing edit distance. In our first result, we give a one-way protocol for the following Document Exchange problem. Namely given x ∈ Σn to Alice and y ∈ Σn to Bob and integer k to both, Alice sends a message to Bob so that he learns x...... or truthfully reports that the edit distance between x and y is greater than k. For this problem, we give a randomized protocol in which Alice transmits at most O ˜ (klog 2 n) bits and each party’s time complexity is O ˜ (nlogn+k 2 log 2 n) . Our second result is a simultaneous protocol for edit distance over...... permutations. Here Alice and Bob both send a message to a third party (the referee) who does not have access to the input strings. Given the messages, the referee decides if the edit distance between x and y is at most k or not. For this problem we give a protocol in which Alice and Bob run a O...

Split views among parents regarding children's right to decide about participation in research: a questionnaire survey.

Science.gov (United States)

Swartling, U; Helgesson, G; Hansson, M G; Ludvigsson, J

2009-07-01

Based on extensive questionnaire data, this paper focuses on parents' views about children's right to decide about participation in research. The data originates from 4000 families participating in a longitudinal prospective screening as 1997. Although current regulations and recommendations underline that children should have influence over their participation, many parents in this study disagree. Most (66%) were positive providing information to the child about relevant aspects of the study. However, responding parents were split about whether or not children should at some point be allowed decisional authority when participating in research: 41.6% of the parents reported being against or unsure. Those who responded positively believed that children should be allowed to decide about blood-sampling procedures (70%), but to a less extent about participation (48.5%), analyses of samples (19.7%) and biological bank storage (15.4%). That as many as possible should remain in the study, and that children do not have the competence to understand the consequences for research was strongly stressed by respondents who do not think children should have a right to decide. When asked what interests they consider most important in paediatric research, child autonomy and decision-making was ranked lowest. We discuss the implications of these findings.

Quasi-Decidability of a Fragment of the First-Order Theory of Real Numbers

Czech Academy of Sciences Publication Activity Database

Franek, Peter; Ratschan, Stefan; Zgliczynski, P.

2016-01-01

Roč. 57, č. 2 (2016), s. 157-185 ISSN 0168-7433 R&D Projects: GA ČR GCP202/12/J060; GA MŠk OC10048; GA ČR GA15-14484S Institutional support: RVO:67985807 Keywords : decidability * decision procedure * real numbers Subject RIV: IN - Informatics, Computer Science Impact factor: 1.636, year: 2016

41 CFR 302-12.109 - What must we consider in deciding whether to use the fixed-fee or cost-reimbursable contracting...

Science.gov (United States)

2010-07-01

... deciding whether to use the fixed-fee or cost-reimbursable contracting method? 302-12.109 Section 302-12... Services Company § 302-12.109 What must we consider in deciding whether to use the fixed-fee or cost...-fee or cost-reimbursable contracting method: (a) Risk of alternative methods. Under a fixed fee...

Momentum conservation decides Heisenberg's interpretation of the uncertainty formulas

International Nuclear Information System (INIS)

Angelidis, T.D.

1977-01-01

In the light of Heisenberg's interpretation of the uncertainty formulas, the conditions necessary for the derivation of the quantitative statement or law of momentum conservation are considered. The result of such considerations is a contradiction between the formalism of quantum physics and the asserted consequences of Heisenberg's interpretation. This contradiction decides against Heisenberg's interpretation of the uncertainty formulas on upholding that the formalism of quantum physics is both consistent and complete, at least insofar as the statement of momentum conservation can be proved within this formalism. A few comments are also included on Bohr's complementarity interpretation of the formalism of quantum physics. A suggestion, based on a statistical mode of empirical testing of the uncertainty formulas, does not give rise to any such contradiction

INTEGRATING ICT IN ENGLISH LANGUAGE TEACHING AND LEARNING IN INDONESIA

Directory of Open Access Journals (Sweden)

Tuti Hidayati

2016-11-01

Full Text Available Indonesian ELT is complex for numerous reasons, and the level of students‟ outcome has been regarded unsatisfactory by a number of researchers and academics. This paper considers ICT as one of possible alternatives to deal with the complexity of Indonesian ELT and to improve its outcomes. It widely explores ICT integration in English LTL, especially on how ICT has been used in this field. It further investigates the benefits and challenges of integrating ICT in LTL. The paper argues that the integration of ICT is promising for changing and improving the effectiveness of the current Indonesian ELT condition when it is carried out in line with the effective LTL principles. The integration of ICT will enable teachers to vary teaching and learning activities, to gradually change the teaching style to be more student-centred, to train students to have more active role in learning, and to access a huge range of authentic learning materials. The paper also acknowledges the contraints that will emerge in an effort of integrating ICT in Indonesian English LTL. Hence, some recommedations for action are proposed at the end.

Paternal age at birth is associated with offspring leukocyte telomere length in the nurses' health study.

Science.gov (United States)

Prescott, J; Du, M; Wong, J Y Y; Han, J; De Vivo, I

2012-12-01

Is the association between paternal age at birth and offspring leukocyte telomere length (LTL) an artifact of early life socioeconomic status (SES)? Indicators of early life SES did not alter the relationship between paternal age at birth and offspring LTL among a population of white female nurses. Telomere length is considered a highly heritable trait. Recent studies report a positive correlation between paternal age at birth and offspring LTL. Maternal age at birth has also been positively associated with offspring LTL, but may stem from the strong correlation with paternal age at birth. The Nurses' Health Study (NHS) is an ongoing prospective cohort study of 121 700 female registered nurses who were enrolled in 1976. Great effort goes into maintaining a high degree of follow-up among our cohort participants (>95% of potential person-years). In 1989-1990, a subset of 32 826 women provided blood samples from which we selected participants for several nested case-control studies of telomere length and incident chronic disease. We used existing LTL data on a total of 4250 disease-free women who also reported maternal and paternal age at birth for this study. Nested case-control studies of stroke, myocardial infarction, cancers of the breast, endometrium, skin, pancreas and colon, as well as colon adenoma, were conducted within the blood sub-cohort. Each study used the following study design: for each case of a disease diagnosed after blood collection, a risk-set sampling scheme was used to select from one to three controls from the remaining participants in the blood sub-cohort who were free of that disease when the case was diagnosed. Controls were matched to cases by age at blood collection (± 1 year), date of blood collection (± 3 months), menopausal status, recent postmenopausal hormone use at blood collection (within 3 months, except for the myocardial infarction case-control study), as well as other factors carefully chosen for each individual study. The

How do local governments decide on public policy in fiscal federalism?

DEFF Research Database (Denmark)

Köthenbürger, Marko

2011-01-01

Previous literature widely assumes that taxes are optimized in local public finance while expenditures adjust residually. This paper endogenizes the choice of the optimization variable. In particular, it analyzes how federal policy toward local governments influences the way local governments...... decide on public policy. Unlike the usual presumption, the paper shows that local governments may choose to optimize over expenditures. The result holds when federal policy subsidizes local taxation. The results offer a new perspective of the efficiency implications of federal policy toward local...

How Do Local Governments Decide on Public Policy in Fiscal Federalism?

DEFF Research Database (Denmark)

Köthenbürger, Marko

2008-01-01

Previous literature widely assumes that taxes are optimized in local public finance while expenditures adjust residually. This paper endogenizes the choice of the optimization variable. In particular, it analyzes how federal policy toward local governments influences the way local governments...... decide on public policy. Unlike the presumption, the paper shows that local governments may choose to optimize over expenditures. The result most notably prevails when federal policy subsidizes local fiscal effort. The results offer a new perspective of the efficiency implications of federal policy...

Usefulness of 67Ga scintigraphy in deciding surgical indication in secondary hyperparathyroidism

International Nuclear Information System (INIS)

Otsuka, Nobuaki; Mimura, Hiroaki; Sone, Teruki; Tamada, Tsutomu; Yanagimoto, Shinichi; Tomomitsu, Tatsushi; Fukunaga, Masao; Katagiri, Makoto

1999-01-01

In order to evaluate the usefulness in deciding surgical indication in secondary hyperparathyroidism (SHP), 67 Ga scintigraphy was performed in 37 patients of SHP before parathyroidectomy (PTx). The radionuclide accumulation in skull and submandible was classified into 4 patterns (skull-submandibular pattern, skull pattern, submandibular pattern and normal pattern). Serum alkaline phosphatase levels were significantly elevated in patients of skull-submandibular pattern (13 cases) compared with skull pattern (6 cases), submandibular pattern (6 cases) and normal pattern (12 cases). Serum intact parathyroid hormone levels were significantly elevated in patients of skull-submandibular and skull patterns compared with normal pattern. No significant difference was observed among the weight of resected parathyroid glands. In 4 of 6 patients of normal pattern on 67 Ga scintigram, bone scintigraphy showed a characteristic pattern of SHP including an increased accumulation in the skull and submandible. Bone mineral density (BMD) in the distal radius was increased within six to twelve months after PTx in 10 of 11 patients of skull-submandibular pattern on 67 Ga scintigram, whereas only one patient showed an increase in BMD in 9 patients of normal pattern. In summary, it was concluded that 67 Ga scintigraphy could provide a useful information in deciding the indication for PTx in secondary hyperparathyroidism. (author)

Right to decide and self-determination in the Catalan case. Analysis and reflection according to the Spanish Constitutional Law

OpenAIRE

Gina Marietta OLCESE SCHENONE

2015-01-01

The paper analyzes the issue of the right to decide and self-determination in the current case of Catalonia from a legal point of view and within the Spanish constitutional framework. In particular, this analysis explores three aspects: a) The right to self-determination, general aspects and the Spanish Constitution; b) The right to decide as a regional consultation or referendum under Spanish law; c) Initiative of constitutional reform as a possible way to deal with the separatist aspiration...

Intrinsic ligament and triangular fibrocartilage complex tears of the wrist: comparison of MDCT arthrography, conventional 3-T MRI, and MR arthrography

Energy Technology Data Exchange (ETDEWEB)

Lee, Ryan K.L.; Ng, Alex W.H.; Tong, Cina S.L.; Griffith, James F. [The Chinese University of Hong Kong, Department of Imaging and Interventional Radiology, Prince Of Wales Hospital, Shatin (China); Tse, W.L.; Wong, C.; Ho, P.C. [The Chinese University of Hong Kong, Department of Imaging and Interventional Radiology, Prince Of Wales Hospital, Shatin (China); The Chinese University of Hong Kong, Department of Orthopedics, Prince Of Wales Hospital, Shatin (China)

2013-09-15

This study compares the diagnostic performance of multidetector CT arthrography (CTA), conventional 3-T MR and MR arthrography (MRA) in detecting intrinsic ligament and triangular fibrocartilage complex (TFCC) tears of the wrist. Ten cadaveric wrists of five male subjects with an average age 49.6 years (range 26-59 years) were evaluated using CTA, conventional 3-T MR and MRA. We assessed the presence of scapholunate ligament (SLL), lunotriquetral ligament (LTL), and TFCC tears using a combination of conventional arthrography and arthroscopy as a gold standard. All images were evaluated in consensus by two musculoskeletal radiologists with sensitivity, specificity, and accuracy being calculated. Sensitivities/specificity/accuracy of CTA, conventional MRI, and MRA were 100 %/100 %/100 %, 66 %/86 %/80 %, 100 %/86 %/90 % for the detection of SLL tear, 100 %/80 %/90 %, 60 %/80 %/70 %, 100 %/80 %/90 % for the detection of LTL tear, and 100 %/100 %/100 %, 100 %/86 %/90 %, 100 %/100 %/100 % for the detection of TFCC tear. Overall CTA had the highest sensitivity, specificity, and accuracy among the three investigations while MRA performed better than conventional MR. CTA also had the highest sensitivity, specificity, and accuracy for identifying which component of the SLL and LTL was torn. Membranous tears of both SLL and LTL were better visualized than dorsal or volar tears on all three imaging modalities. Both CT and MR arthrography have a very high degree of accuracy for diagnosing tears of the SLL, LTL, and TFCC with both being more accurate than conventional MR imaging. (orig.)

Using 3-color chromosome painting to decide between chromosome aberration models

International Nuclear Information System (INIS)

Lucas, J.N.; Sachs, R.K.

1993-01-01

Ionizing radiation produces chromosome aberrations when DNA double strand breaks (DSB) interact pairwise. For more than 30 years there have been two main, competing theories of such binary DSB interactions. The classical theory asserts that an unrepaired DSB makes two ends which separate, with each end subsequently able to join any similar (non-telomeric) end. The exchange theory asserts that the two DSB ends remain associated until repair or a reciprocal chromosome exchange involving a second DSB occurs. The authors conducted an experiment to test these models, using 3-color chromosome painting. After in vitro irradiation of resting human lymphocytes, they observed cells with three-color triplets at first metaphase: three derivative chromosomes having permuted colors, as if three broken chromosomes had played musical chairs. On the exchange model in its standard form such 3-color triplets cannot occur. On the classical model the expected frequency can be calculated. They report data and computer calculations which exclude the exchange model and favor the classical model

14 CFR 11.87 - Are there circumstances in which FAA may decide not to publish a summary of my petition for...

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Are there circumstances in which FAA may decide not to publish a summary of my petition for exemption? 11.87 Section 11.87 Aeronautics and Space... in which FAA may decide not to publish a summary of my petition for exemption? The FAA may not...

Right to decide and self-determination in the Catalan case. Analysis and reflection according to the Spanish Constitutional Law

Directory of Open Access Journals (Sweden)

Gina Marietta OLCESE SCHENONE

2015-07-01

Full Text Available The paper analyzes the issue of the right to decide and self-determination in the current case of Catalonia from a legal point of view and within the Spanish constitutional framework. In particular, this analysis explores three aspects: a The right to self-determination, general aspects and the Spanish Constitution; b The right to decide as a regional consultation or referendum under Spanish law; c Initiative of constitutional reform as a possible way to deal with the separatist aspirations of Catalonia. 

5 CFR 890.1069 - Information the debarring official must consider in deciding a provider's contest of proposed...

Science.gov (United States)

2010-01-01

... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL... deciding a provider's contest of proposed penalties and assessments. (a) Documentary material and written...

Efficient Parallel Statistical Model Checking of Biochemical Networks

Directory of Open Access Journals (Sweden)

Paolo Ballarini

2009-12-01

Full Text Available We consider the problem of verifying stochastic models of biochemical networks against behavioral properties expressed in temporal logic terms. Exact probabilistic verification approaches such as, for example, CSL/PCTL model checking, are undermined by a huge computational demand which rule them out for most real case studies. Less demanding approaches, such as statistical model checking, estimate the likelihood that a property is satisfied by sampling executions out of the stochastic model. We propose a methodology for efficiently estimating the likelihood that a LTL property P holds of a stochastic model of a biochemical network. As with other statistical verification techniques, the methodology we propose uses a stochastic simulation algorithm for generating execution samples, however there are three key aspects that improve the efficiency: first, the sample generation is driven by on-the-fly verification of P which results in optimal overall simulation time. Second, the confidence interval estimation for the probability of P to hold is based on an efficient variant of the Wilson method which ensures a faster convergence. Third, the whole methodology is designed according to a parallel fashion and a prototype software tool has been implemented that performs the sampling/verification process in parallel over an HPC architecture.

Socioeconomic Status, Financial Strain, and Leukocyte Telomere Length in a Sample of African American Midlife Men.

Science.gov (United States)

Schrock, Joshua M; Adler, Nancy E; Epel, Elissa S; Nuru-Jeter, Amani M; Lin, Jue; Blackburn, Elizabeth H; Taylor, Robert Joseph; Chae, David H

2017-06-20

African American men in the USA experience poorer aging-related health outcomes compared to their White counterparts, partially due to socioeconomic disparities along racial lines. Greater exposure to socioeconomic strains among African American men may adversely impact health and aging at the cellular level, as indexed by shorter leukocyte telomere length (LTL). This study examined associations between socioeconomic factors and LTL among African American men in midlife, a life course stage when heterogeneity in both health and socioeconomic status are particularly pronounced. Using multinomial logistic regression, we examined associations between multiple measures of SES and tertiles of LTL in a sample of 92 African American men between 30 to 50 years of age. Reports of greater financial strain were associated with higher odds of short versus medium LTL (odds ratio (OR)=2.21, p = 0.03). Higher income was associated with lower odds of short versus medium telomeres (OR=0.97, p = 0.04). Exploratory analyses revealed a significant interaction between educational attainment and employment status (χ 2  = 4.07, p = 0.04), with greater education associated with lower odds of short versus long telomeres only among those not employed (OR=0.10, p = 0.040). Cellular aging associated with multiple dimensions of socioeconomic adversity may contribute to poor aging-related health outcomes among African American men. Subjective appraisal of financial difficulty may impact LTL independently of objective dimensions of SES. Self-appraised success in fulfilling traditionally masculine gender roles, including being an economic provider, may be a particularly salient aspect of identity for African American men and have implications for cellular aging in this population.

The functional polymorphism rs73598374:G>A (p.Asp8Asn) of the ADA gene is associated with telomerase activity and leukocyte telomere length.

Science.gov (United States)

Concetti, Fabio; Carpi, Francesco M; Nabissi, Massimo; Picciolini, Matteo; Santoni, Giorgio; Napolioni, Valerio

2015-02-01

Recent evidence demonstrated a relevant role of adenosine deaminase (ADA) in replicative senescence of T cells through its capacity to modulate telomerase activity (TA). Herein, we tested the impact of the functional polymorphism ADA rs73598374:G>A (c.22G>A, p.Asp8Asn) on telomere biology, by measuring TA and leukocyte telomere length (LTL) in healthy subjects selected according to rs73598374 genotype. rs73598374-A carriers showed lower TA (P=0.019) and shorter LTL (P=0.003), respectively, compared to G/G carriers. rs73598374-A carriers showed a stronger cross-sectional age reduction of LTL (r=-0.314, P=0.005) compared to G/G carriers (r=-0.243, P=0.022). The reduced ADA activity associated to rs73598374-A variant predisposes those carriers to display higher levels of adenosine compared to G/G carriers. Consequently, it may lead to an accelerated process of replicative senescence, causing a stronger reduction of TA and in turn shorter LTL. In conclusion, the crucial role played by replicative senescence of the immune system in several human diseases and in the aging process underscores the relevance of the present findings and also spurs interest into the possible involvement of rs73598374 in shaping the susceptibility to several age-related diseases.

Who should decide how much and what information is important in person-centred health care?

DEFF Research Database (Denmark)

Kaltoft, Mette Kjer; Nielsen, Jesper Bo; Salkeld, Glenn

2015-01-01

implicitly segues into the patient having made a 'good decision'. In person-centred health care, whether, in what form, and with what weight, 'information' is included as a criterion of decision quality is a matter for the person involved, to decide in the light of their own values, preferences, and time...

What makes men and women with musculoskeletal complaints decide they are too sick to work?

NARCIS (Netherlands)

Hooftman, W.E.; Westerman, M.J.; Beek, A.J. van der; Bongers, P.M.; Mechelen, W. van

2008-01-01

Objective: The objective of this study was to determine what makes men and women with musculoskeletal complaints decide to call in sick for work. Methods: Qualitative, face-to-face interviews were used with employees (16 men and 14 women) who had called in sick due to a musculoskeletal complaint and

Trends in Energy. 'The consumer decides'; Trends in Energy. 'De consument bepaalt'

Energy Technology Data Exchange (ETDEWEB)

Brzezowsky-Ruys, Y.; Van der Zalm, M.; Van Zutphen, M. [eds.

2012-03-15

A report is given of the Capgemini organised congress 'Trends in Energy 2011' which has the Dutch subtitle 'De consument bepaalt' (The consumer decides'. The focus of the articles, interviews, debates and presentations is on the role of the consumer in the supply of and demand for energy. Parts of the report are in Dutch and English [Dutch] Dit rapport bestaat uit een verslag van het congres 'Trends in Energy 2011. De consument bepaalt' en een aantal artikelen met achtergrondinformatie over onder meer de rol van de consument in vraag en aanbod van energie.

Sterol 27-Hydroxylase Polymorphism Significantly Associates With Shorter Telomere, Higher Cardiovascular and Type-2 Diabetes Risk in Obese Subjects

Directory of Open Access Journals (Sweden)

Sofia Pavanello

2018-06-01

Full Text Available Background/objectivesThe pathologic relationship linking obesity and lipid dismetabolism with earlier onset of aging-related disorders, including cardiovascular disease (CVD and type-2 diabetes (T2D, is not fully elucidate. Chronic inflammatory state, in obese individuals, may accelerate cellular aging. However, leukocyte telomere length (LTL, the cellular biological aging indicator, is elusively linked with obesity. Recent studies indicate that sterol 27-hydroxylase (CYP27A1 is an emerging antiatherogenic enzyme, that, by converting extrahepatic cholesterol to 27-hydroxycholesterol, facilitates cholesterol removal via high-density lipoprotein-cholesterol (HDL-C. We tested the hypothesis that obese subjects who carry at least three copies of CYP27A1 low-hydroxylation (LH activity genome-wide-validated alleles (rs4674345A, rs1554622A, and rs4674338G present premature aging, as reflected in shorter LTL and higher levels of CVD/T2D risk factors, including reduced HDL-C.Subjects/methodsObese subjects from SPHERE project {n = 1,457; overweight [body mass index (BMI 25–30 kg/m2] 65.8% and severe-obese (BMI > 30 kg/m2 34.2%} were characterized for the presence from 0 to 6 LH-CYP27A1 allele copy number. Univariate and multivariable sex–age–smoking-adjusted linear-regression models were performed to compare CVD/T2D risk factors and biological aging (LTL in relation to the combined BMI-LH groups: overweight-LH: 0–2, overweight-LH: 3–6, severe-obese-LH: 0–2, and severe-obese-LH: 3–6.ResultsHigher LTL attrition was found in severe-obese than overweight individuals (p < 0.001. Multivariable model reveals that among severe-obese patients those with LH: 3–6 present higher LTL attrition than LH: 0–2 (p < 0.05. Univariate and multivariable models remarkably show that insulin resistance is higher both in overweight-LH: 3–6 vs overweight-LH: 0–2 (p < 0.001 and in severe-obese-LH: 3–6 vs severe-obese-LH: 0–2 (p�

Efficient Synthesis of Network Updates

Science.gov (United States)

2015-06-17

mal Languages ]: Mathematical Logic—Temporal logic; C.2.3 [Computer-communication Networks]: Network Operations— Network Management Keywords synthesis...problem, and prove this algorithm to be correct (§4). • We present an incremental LTL model checker for loop-free models (§5). • We describe an OCaml ...canned” properties, we use a specification language that is expressive enough to encode these properties and others, as well as conjunctions

On Verification of PLC-Programs Written in the LD-Language

Directory of Open Access Journals (Sweden)

E. V. Kuzmin

2012-01-01

Full Text Available We discuss some questions connected with the construction of a technology of analysing correctness of Programmable Logic Controller programs. We consider an example of modeling and automated verification of PLC-programs written in the Ladder Diagram language (including timed function blocks of the IEC 61131-3 standard. We use the Cadence SMV for symbolic model checking. Program properties are written in the linear-time temporal logic LTL.

Offspring's Leukocyte Telomere Length, Paternal Age, and Telomere Elongation in Sperm

DEFF Research Database (Denmark)

Kimura, Masayuki; Cherkas, Lynn F; Kato, Bernet S

2008-01-01

), the NHLBI Family Heart Study (NHLBI-Heart), the Longitudinal Study of Aging Danish Twins (Danish Twins), and the UK Adult Twin Registry (UK Twins). Using Southern blots, Q-FISH, and flow-FISH, we also measured telomere parameters in sperm from 46 young (50 years) donors. Paternal age...... had an independent effect, expressed by a longer LTL in males of the Framingham Offspring and Danish Twins, males and females of the NHLBI-Heart, and females of UK Twins. For every additional year of paternal age, LTL in offspring increased at a magnitude ranging from half to more than twice......Leukocyte telomere length (LTL) is a complex genetic trait. It shortens with age and is associated with a host of aging-related disorders. Recent studies have observed that offspring of older fathers have longer LTLs. We explored the relation between paternal age and offspring's LTLs in 4 different...

Towards the Formal Verification of a Distributed Real-Time Automotive System

Science.gov (United States)

Endres, Erik; Mueller, Christian; Shadrin, Andrey; Tverdyshev, Sergey

2010-01-01

We present the status of a project which aims at building, formally and pervasively verifying a distributed automotive system. The target system is a gate-level model which consists of several interconnected electronic control units with independent clocks. This model is verified against the specification as seen by a system programmer. The automotive system is implemented on several FPGA boards. The pervasive verification is carried out using combination of interactive theorem proving (Isabelle/HOL) and model checking (LTL).

Effects of prior exposure on music liking and recognition in patients with temporal lobe lesions.

Science.gov (United States)

Samson, Séverine; Peretz, Isabelle

2005-12-01

Prior exposure to music typically increases liking. This manifestation of implicit memory can be dissociated from explicit memory recognition. To examine the contribution of the medial temporal lobe to musical preference and recognition, we tested patients with either left (LTL) or right (RTL) temporal lobe lesions as well as normal control (NC) participants using the procedure of Peretz et al. The results in the affect task showed that NC and LTL participants preferred the studied over nonstudied melodies, thereby demonstrating an implicit exposure effect on liking judgments, whereas RTL patients failed to exhibit this effect. Explicit recognition was impaired in both LTL and RTL patients as compared to NC participants. On the basis of these findings, we suggest that RTL structures play a critical role in the formation of melody representations that support both priming and memory recognition, whereas LTL structures are more involved in the explicit retrieval of melodies. Furthermore, we were able to test an amnesic patient (PC) with bilateral lesions of the temporal lobe. In this case, the exposure effect on liking was also absent. However, repeated exposure to melodies was found to enhance both liking and recognition judgments. This remarkable sparing of memory observed through melody repetition suggests that extensive exposure may assist both implicit and explicit memory in the presence of global amnesia.

Telomeric repeat-containing RNA (TERRA) related to polycystic ovary syndrome (PCOS).

Science.gov (United States)

Wang, Caiqin; Shen, Fengxian; Zhu, Yuning; Fang, Yuying; Lu, Shiming

2017-04-01

Telomeric repeat-containing RNA (TERRA) participates in the regulation of telomere length, and leucocyte telomere length (LTL) plays an important role in the pathophysiology of polycystic ovary syndrome (PCOS), but little is known about the role of TERRA in PCOS. To evaluate the role of TERRA and peripheral blood LTL in PCOS. Forty women with PCOS and 35 healthy women without PCOS were recruited. A prospective case-control study was performed. RNA fluorescence in situ hybridization (FISH) was used to detect TERRA expression in peripheral blood leucocyte. Quantitative PCR was used to measure TERRA expression and the mean LTL in the PCOS and control groups. We analysed the association between related clinical parameters and the age-adjusted ratio of the telomere repeat length (T/S ratio) or TERRA. Telomeric repeat-containing RNA was expressed in human peripheral blood leucocytes, and the signal was abolished after culture with RNase A. The age-adjusted LTLs were significantly longer in the PCOS group than in the control group (P PCOS group than in the control group (P PCOS group (r = 0·532, P = 0·002; r = -0·477, P = 0·017). We found TERRA expression in human peripheral blood leucocytes, and LTLs were positively associated with PCOS. TERRA and testosterone play an important role in the LTL regulation in PCOS. © 2016 John Wiley & Sons Ltd.

Are women deciding against home births in low and middle income countries?

Science.gov (United States)

Amoako Johnson, Fiifi; Padmadas, Sabu S; Matthews, Zoë

2013-01-01

Although there is evidence to tracking progress towards facility births within the UN Millennium Development Goals framework, we do not know whether women are deciding against home birth over their reproductive lives. Using Demographic and Health Surveys (DHS) data from 44 countries, this study aims to investigate the patterns and shifts in childbirth locations and to determine whether these shifts are in favour of home or health settings. The analyses considered 108,777 women who had at least two births in the five years preceding the most recent DHS over the period 2000-2010. The vast majority of women opted for the same place of childbirth for their successive births. However, about 14% did switch their place and not all these decisions favoured health facility over home setting. In 24 of the 44 countries analysed, a higher proportion of women switched from a health facility to home. Multilevel regression analyses show significantly higher odds of switching from home to a facility for high parity women, those with frequent antenatal visits and more wealth. However, in countries with high infant mortality rates, low parity women had an increased probability of switching from home to a health facility. There is clear evidence that women do change their childbirth locations over successive births in low and middle income countries. After two decades of efforts to improve maternal health, it might be expected that a higher proportion of women will be deciding against home births in favour of facility births. The results from this analysis show that is not the case.

Are women deciding against home births in low and middle income countries?

Directory of Open Access Journals (Sweden)

Fiifi Amoako Johnson

Full Text Available Although there is evidence to tracking progress towards facility births within the UN Millennium Development Goals framework, we do not know whether women are deciding against home birth over their reproductive lives. Using Demographic and Health Surveys (DHS data from 44 countries, this study aims to investigate the patterns and shifts in childbirth locations and to determine whether these shifts are in favour of home or health settings.The analyses considered 108,777 women who had at least two births in the five years preceding the most recent DHS over the period 2000-2010. The vast majority of women opted for the same place of childbirth for their successive births. However, about 14% did switch their place and not all these decisions favoured health facility over home setting. In 24 of the 44 countries analysed, a higher proportion of women switched from a health facility to home. Multilevel regression analyses show significantly higher odds of switching from home to a facility for high parity women, those with frequent antenatal visits and more wealth. However, in countries with high infant mortality rates, low parity women had an increased probability of switching from home to a health facility.There is clear evidence that women do change their childbirth locations over successive births in low and middle income countries. After two decades of efforts to improve maternal health, it might be expected that a higher proportion of women will be deciding against home births in favour of facility births. The results from this analysis show that is not the case.

Developing and Evaluating Communication Strategies to Support Informed Decisions and Practice Based on Evidence (DECIDE): protocol and preliminary results.

Science.gov (United States)

Treweek, Shaun; Oxman, Andrew D; Alderson, Philip; Bossuyt, Patrick M; Brandt, Linn; Brożek, Jan; Davoli, Marina; Flottorp, Signe; Harbour, Robin; Hill, Suzanne; Liberati, Alessandro; Liira, Helena; Schünemann, Holger J; Rosenbaum, Sarah; Thornton, Judith; Vandvik, Per Olav; Alonso-Coello, Pablo

2013-01-09

Healthcare decision makers face challenges when using guidelines, including understanding the quality of the evidence or the values and preferences upon which recommendations are made, which are often not clear. GRADE is a systematic approach towards assessing the quality of evidence and the strength of recommendations in healthcare. GRADE also gives advice on how to go from evidence to decisions. It has been developed to address the weaknesses of other grading systems and is now widely used internationally. The Developing and Evaluating Communication Strategies to Support Informed Decisions and Practice Based on Evidence (DECIDE) consortium (http://www.decide-collaboration.eu/), which includes members of the GRADE Working Group and other partners, will explore methods to ensure effective communication of evidence-based recommendations targeted at key stakeholders: healthcare professionals, policymakers, and managers, as well as patients and the general public. Surveys and interviews with guideline producers and other stakeholders will explore how presentation of the evidence could be improved to better meet their information needs. We will collect further stakeholder input from advisory groups, via consultations and user testing; this will be done across a wide range of healthcare systems in Europe, North America, and other countries. Targeted communication strategies will be developed, evaluated in randomized trials, refined, and assessed during the development of real guidelines. Results of the DECIDE project will improve the communication of evidence-based healthcare recommendations. Building on the work of the GRADE Working Group, DECIDE will develop and evaluate methods that address communication needs of guideline users. The project will produce strategies for communicating recommendations that have been rigorously evaluated in diverse settings, and it will support the transfer of research into practice in healthcare systems globally.

College or Training Programs: How to Decide. PACER Center ACTion Information Sheets. PHP-c115

Science.gov (United States)

PACER Center, 2006

2006-01-01

A high school diploma opens the door to many exciting new options. These might include a first full-time job, or part-time or full-time attendance at a technical school, community college, or university. Students might want to obtain a certificate, an associate degree, or a diploma. With so many choices, it can be a challenge to decide which path…

Why do some entrepreneurs decide to give up? Exploring the causes through cognitive maps

OpenAIRE

Khelil, N.; Hammer, M.H.M.

2013-01-01

Despite the contributions of previous studies, no satisfying answer has been provided to explain why some entrepreneurs decided to exit from entrepreneurship. This question will remain extremely complex and difficult to answer if researchers continue to study this phenomenon using uni-dimensional and/or binary approach. The aim of this paper is to contribute to a better understanding the complexity of entrepreneurial exit by proposing an integrative and typological framework. This study seeks...

Association of Leukocyte Telomere Length with Fatigue in Nondisabled Older Adults

DEFF Research Database (Denmark)

Bendix, Laila; Thinggaard, Mikael; Kimura, Masayuki

2014-01-01

Introduction. Fatigue is often present in older adults with no identified underlying cause. The accruing burden of oxidative stress and inflammation might be underlying factors of fatigue. We therefore hypothesized that leukocyte telomere length (LTL) is relatively short in older adults who...... experience fatigue. Materials and Methods. We assessed 439 older nondisabled Danish twins. LTL was measured using Southern blots of terminal restriction fragments. Fatigue was measured by the Mob-T Scale based on questions on whether the respondents felt fatigued after performing six mobility items. Results...

Automatic Generation of Minimal Cut Sets

Directory of Open Access Journals (Sweden)

Sentot Kromodimoeljo

2015-06-01

Full Text Available A cut set is a collection of component failure modes that could lead to a system failure. Cut Set Analysis (CSA is applied to critical systems to identify and rank system vulnerabilities at design time. Model checking tools have been used to automate the generation of minimal cut sets but are generally based on checking reachability of system failure states. This paper describes a new approach to CSA using a Linear Temporal Logic (LTL model checker called BT Analyser that supports the generation of multiple counterexamples. The approach enables a broader class of system failures to be analysed, by generalising from failure state formulae to failure behaviours expressed in LTL. The traditional approach to CSA using model checking requires the model or system failure to be modified, usually by hand, to eliminate already-discovered cut sets, and the model checker to be rerun, at each step. By contrast, the new approach works incrementally and fully automatically, thereby removing the tedious and error-prone manual process and resulting in significantly reduced computation time. This in turn enables larger models to be checked. Two different strategies for using BT Analyser for CSA are presented. There is generally no single best strategy for model checking: their relative efficiency depends on the model and property being analysed. Comparative results are given for the A320 hydraulics case study in the Behavior Tree modelling language.

Influences of chlorine content on emission of HCl and organic compounds in waste incineration using fluidized beds.

Science.gov (United States)

Wey, M Y; Liu, K Y; Yu, W J; Lin, C L; Chang, F Y

2008-01-01

HCl and some organic compounds are the precursors of polychlorinated dibenzo-p-dioxins and furans (PCDD/Fs) in municipal solid waste incinerators. In this work, a lab-scale fluidized bed incinerator is adopted to study the relationship between the organic and the inorganic chlorine contents of artificial wastes and the emissions of HCl and organic compounds. The lower threshold limit (LTL) of chlorine content below which HCl and organic compounds are not generated is studied. Experimental results showed that organic chlorides had a greater potential to release chlorine than inorganic chlorides. The generation of organic pollutants fell, but the emissions of HCl increased with the temperature. The concentrations of chlorophenols (CPs)/chlorobenzenes (CBs) increased with chlorine contents. No LTL existed for HCl regardless of whether CaO was added. The LTL for CPs was between 0.1 and 0.3wt% of inorganic chloride, but there was none for organic sources. For CBs, the LTL was between 0.5 and 1.0wt% for inorganics at 700 and 800 degrees C, but 0.1-0.3 wt% at 700 degrees C and 0.3-0.5 wt% at 800 degrees C for organics. The production of PAHs and benzene, toluene, ethylbenzene and xylene (BTEX) was related to the surplus hydrogen ions that were not reacted with the chlorine. Adding CaO inhibited the production of HCl, CBs and CPs, but did not seriously affect PAHs and BTEX.

Robin Hood vs. King John Redistribution: How Do Local Judges Decide Cases In Brazil?

OpenAIRE

Ribeiro, Ivan Cesar

2007-01-01

This article discusses two opposed hypotheses to predict the behavior of judges when they have to decide a claim between parties with asymmetrical eco- nomic and political power. The .rst, which has broad acceptance among policy makers in Brazil, is the jurisdictional uncertainty hypothesis (Arida et al, 2005) that suggests that Brazilian judges tend to favor the weak party in the claim as a form of social justice and redistribution of income in favor of the poor. Glaeser et al (2003) stated ...

Involving Communities in Deciding What Benefits They Receive in Multinational Research.

Science.gov (United States)

Wendler, David; Shah, Seema

2015-10-01

There is wide agreement that communities in lower-income countries should benefit when they participate in multinational research. Debate now focuses on how and to what extent these communities should benefit. This debate has identified compelling reasons to reject the claim that whatever benefits a community agrees to accept are necessarily fair. Yet, those who conduct clinical research may conclude from this rejection that there is no reason to involve communities in the process of deciding how they benefit. Against this possibility, the present manuscript argues that involving host communities in this process helps to promote four important goals: (1) protecting host communities, (2) respecting host communities, (3) promoting transparency, and (4) enhancing social value. Published by Oxford University Press on behalf of the Journal of Medicine and Philosophy, Inc. 2015.

Research on Investment Estimation when Deciding to Start a new Business.

Directory of Open Access Journals (Sweden)

Guga, L.

2014-06-01

Full Text Available An entrepreneur has to follow several steps when deciding to start a new business. Starting a business involves planning, making key financial decisions, completing a series of legal activities, hiring reliable employees and after all of this the success of the new firm is determined by a few steps, which every manager must take into account. One of these steps is adopting a company name, the calling card of the business, taking into consideration the related tips regarding its selection. Entrepreneur must estimate the initial investment and the necessary financial resources. When talking about a company its mission must be clear and easy to understand. Thus, the description of the main activity and the general environment must be present in the business plan as well.

Stakeholder engagement for comparative effectiveness research in cancer care: experience of the DEcIDE Cancer Consortium.

Science.gov (United States)

Greenberg, Caprice C; Wind, Jennifer K; Chang, George J; Chen, Ronald C; Schrag, Deborah

2013-03-01

Stakeholder input is a critical component of comparative effectiveness research. To ensure that the research activities of the Developing Evidence to Inform Decisions about Effectiveness (DEcIDE) Network, supported by the Agency for Healthcare Research and Quality, translate into the greatest impact for everyday practice and policy-making in cancer, we were tasked with soliciting stakeholder input regarding priority areas in cancer-related comparative effectiveness research for the DEcIDE Cancer Consortium. Given the increasing emphasis on stakeholder engagement in research, many investigators are facing a similar task, yet there is limited literature to guide such efforts, particularly in cancer care. To help fill this gap, we present our approach to operationalizing stakeholder engagement and discuss it in the context of other recent developments in the area. We describe challenges encountered in convening stakeholders from multiple vantage points to prioritize topics and strategies used to mitigate these barriers. We offer several recommendations regarding how to best solicit stakeholder input to inform comparative effectiveness research in cancer care. These recommendations can inform other initiatives currently facing the challenges of engaging stakeholders in priority setting for cancer.

Association between leukocyte telomere length and bone mineral density in women 25-93 years of age

DEFF Research Database (Denmark)

Nielsen, Barbara Rubek; Linneberg, Allan; Bendix, Laila

2015-01-01

whether there is an association of LTL with BMD and to determine whether this possible association is independent of age. The BMDs of the lumbar spine (LS), femoral neck (FN) and total hip (TH) were evaluated in 460 women using DXA. LTL was analyzed using quantitative polymerase chain reaction. The women...... and 95% confidence interval (CI): -0.003 (-0.005; -0.002)); and between BMI adjusted age and logarithmic transformed BMD. Estimates and 95% CI were as follows: LS: -0.13 (-0.26; -0.01); right TH: -0.44 (-0.53; -0.34); left TH: -0.38 (-0.48; -0.28); right FN: -0.57 (-0.67; -0.46) and left FN: -0.51 (-0.......62; -0.40). There were no statistically significant associations between BMD and LTL (both logarithmically transformed) with or without age adjustments. The age-adjusted estimates and CI were as follows: LS: -0.10 (-0.71; 0.52); right TH: -0.13 (-0.66; 0.41); left TH: -0.13 (-0.67; 0.42); right FN: -0...

Low vitamin D levels predict clinical features of schizophrenia.

Science.gov (United States)

Cieslak, Kristina; Feingold, Jordyn; Antonius, Daniel; Walsh-Messinger, Julie; Dracxler, Roberta; Rosedale, Mary; Aujero, Nicole; Keefe, David; Goetz, Deborah; Goetz, Raymond; Malaspina, Dolores

2014-11-01

Vitamin D plays crucial roles in neuroprotection and neurodevelopment, and low levels are commonly associated with schizophrenia. We considered if the association was spurious or causal by examining the association of Vitamin D with Leukocyte Telomere Length (LTL), a marker of cellular aging. Vitamin D levels in 22 well-characterized schizophrenia cases were examined with respect to symptoms, cognition, and functioning. LTL was assessed using quantitative polymerase chain reaction (qPCR). The results showed that 91% (20) had deficient or insufficient Vitamin D levels, which were associated with excitement and grandiosity, social anhedonia, and poverty of speech. Sex-specific analyses showed strong associations of hypovitamintosis D to negative symptoms and decreased premorbid adjustment in males, and to lesser hallucinations and emotional withdrawal, but increased anti-social aggression in females. In females LTL was furthermore associated with Vitamin D levels. This study demonstrates a relationship of low vitamin D levels with increased cellular aging in females. It is also the first study to demonstrate potential sex-specific profiles among schizophrenia cases with hypovitaminosis. Copyright © 2014 Elsevier B.V. All rights reserved.

How many invariant polynomials are needed to decide local unitary equivalence of qubit states?

International Nuclear Information System (INIS)

Maciążek, Tomasz; Oszmaniec, Michał; Sawicki, Adam

2013-01-01

Given L-qubit states with the fixed spectra of reduced one-qubit density matrices, we find a formula for the minimal number of invariant polynomials needed for solving local unitary (LU) equivalence problem, that is, problem of deciding if two states can be connected by local unitary operations. Interestingly, this number is not the same for every collection of the spectra. Some spectra require less polynomials to solve LU equivalence problem than others. The result is obtained using geometric methods, i.e., by calculating the dimensions of reduced spaces, stemming from the symplectic reduction procedure

20 CFR 416.1866 - Deciding whether you are a child: Are you the head of a household?

Science.gov (United States)

2010-04-01

... the head of a household. (b) If you share decision-making equally. If you live with one or more people and everyone has an equal voice in the decision-making (for example, a group of students who share off... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Deciding whether you are a child: Are you the...

Relationship Between Preseason Training Load and In-Season Availability in Elite Australian Football Players.

Science.gov (United States)

Murray, Nick B; Gabbett, Tim J; Townshend, Andrew D

2017-07-01

To investigate the relationship between the proportion of preseason training sessions completed and load and injury during the ensuing Australian Football League season. Single-cohort, observational study. Forty-six elite male Australian football players from 1 club participated. Players were divided into 3 equal groups based on the amount of preseason training completed (high [HTL], >85% sessions completed; medium [MTL], 50-85% sessions completed; and low [LTL], technology was used to record training and game loads, with all injuries recorded and classified by club medical staff. Differences between groups were analyzed using a 2-way (group × training/competition phase) repeated-measures ANOVA, along with magnitude-based inferences. Injury incidence was expressed as injuries per 1000 h. The HTL and MTL groups completed a greater proportion of in-season training sessions (81.1% and 74.2%) and matches (76.7% and 76.1%) than the LTL (56.9% and 52.7%) group. Total distance and player load were significantly greater during the first half of the in-season period for the HTL (P = .03, ES = 0.88) and MTL (P = .02, ES = 0.93) groups than the LTL group. The relative risk of injury for the LTL group (26.8/1000 h) was 1.9 times greater than that for the HTL group (14.2/1000 h) (χ 2 = 3.48, df = 2, P = .17). Completing a greater proportion of preseason training resulted in higher training loads and greater participation in training and competition during the competitive phase of the season.

A facile strategy to design zeolite L crystals with tunable morphology and surface architecture.

Science.gov (United States)

Lupulescu, Alexandra I; Kumar, Manjesh; Rimer, Jeffrey D

2013-05-01

Tailoring the anisotropic growth rates of materials to achieve desired structural outcomes is a pervasive challenge in synthetic crystallization. Here we discuss a method to selectively control the growth of zeolite crystals, which are used extensively in a wide range of industrial applications. This facile method cooperatively tunes crystal properties, such as morphology and surface architecture, through the use of inexpensive, commercially available chemicals with specificity for binding to crystallographic surfaces and mediating anisotropic growth. We examined over 30 molecules as potential zeolite growth modifiers (ZGMs) of zeolite L (LTL type) crystallization. ZGM efficacy was quantified through a combination of macroscopic (bulk) and microscopic (surface) investigations that identified modifiers capable of dramatically altering the cylindrical morphology of LTL crystals. We demonstrate an ability to tailor properties critical to zeolite performance, such as external porous surface area, crystal shape, and pore length, which can enhance sorbate accessibility to LTL pores, tune the supramolecular organization of guest-host composites, and minimize the diffusion path length, respectively. We report that a synergistic combination of ZGMs and the judicious adjustment of synthesis parameters produce LTL crystals with unique surface features, and a range of length-to-diameter aspect ratios spanning 3 orders of magnitude. A systematic examination of different ZGM structures and molecular compositions (i.e., hydrophobicity and binding moieties) reveal interesting physicochemical properties governing their efficacy and specificity. Results of this study suggest this versatile strategy may prove applicable for a host of framework types to produce unrivaled materials that have eluded more conventional techniques.

45 CFR 1351.18 - What criteria has HHS established for deciding which Runaway and Homeless Youth Program grant...

Science.gov (United States)

2010-10-01

... which Runaway and Homeless Youth Program grant applications to fund? 1351.18 Section 1351.18 Public... SERVICES BUREAU RUNAWAY AND HOMELESS YOUTH PROGRAM Runaway and Homeless Youth Program Grant § 1351.18 What criteria has HHS established for deciding which Runaway and Homeless Youth Program grant applications to...

Seaweed Polysaccharides (Laminarin and Fucoidan) as Functional Ingredients in Pork Meat: An Evaluation of Anti-Oxidative Potential, Thermal Stability and Bioaccessibility

Science.gov (United States)

Moroney, Natasha C.; O’Grady, Michael N.; Lordan, Sinéad; Stanton, Catherine; Kerry, Joseph P.

2015-01-01

The anti-oxidative potential of laminarin (L), fucoidan (F) and an L/F seaweed extract was measured using the DPPH free radical scavenging assay, in 25% pork (longissimus thoracis et lumborum (LTL)) homogenates (TBARS) (3 and 6 mg/mL) and in horse heart oxymyoglobin (OxyMb) (0.1 and 1 mg/mL). The DPPH activity of fresh and cooked minced LTL containing L (100 mg/g; L100), F100 and L/F100,300, and bioaccessibility post in vitro digestion (L/F300), was assessed. Theoretical cellular uptake of antioxidant compounds was measured in a transwell Caco-2 cell model. Laminarin displayed no activity and fucoidan reduced lipid oxidation but catalysed OxyMb oxidation. Fucoidan activity was lowered by cooking while the L/F extract displayed moderate thermal stability. A decrease in DPPH antioxidant activity of 44.15% and 36.63%, after 4 and 20 h respectively, indicated theoretical uptake of L/F antioxidant compounds. Results highlight the potential use of seaweed extracts as functional ingredients in pork. PMID:25903283

Seaweed Polysaccharides (Laminarin and Fucoidan as Functional Ingredients in Pork Meat: An Evaluation of Anti-Oxidative Potential, Thermal Stability and Bioaccessibility

Directory of Open Access Journals (Sweden)

Natasha C. Moroney

2015-04-01

Full Text Available The anti-oxidative potential of laminarin (L, fucoidan (F and an L/F seaweed extract was measured using the DPPH free radical scavenging assay, in 25% pork (longissimus thoracis et lumborum (LTL homogenates (TBARS (3 and 6 mg/mL and in horse heart oxymyoglobin (OxyMb (0.1 and 1 mg/mL. The DPPH activity of fresh and cooked minced LTL containing L (100 mg/g; L100, F100 and L/F100,300, and bioaccessibility post in vitro digestion (L/F300, was assessed. Theoretical cellular uptake of antioxidant compounds was measured in a transwell Caco-2 cell model. Laminarin displayed no activity and fucoidan reduced lipid oxidation but catalysed OxyMb oxidation. Fucoidan activity was lowered by cooking while the L/F extract displayed moderate thermal stability. A decrease in DPPH antioxidant activity of 44.15% and 36.63%, after 4 and 20 h respectively, indicated theoretical uptake of L/F antioxidant compounds. Results highlight the potential use of seaweed extracts as functional ingredients in pork.

Deciding to work during the Ebola outbreak: The voices and experiences of nurses and midwives in Liberia

Directory of Open Access Journals (Sweden)

Erhuvwukorotu S. Kollie

Full Text Available In this study we explored the experiences of nurses and midwives, including the process involved in deciding whether or not to render care to patients during the Ebola outbreak in Liberia, West Africa. Data were collected from 30 registered nurses and registered midwives through face-to-face, semi-structured, tape-recorded interviews. We combined both Corbin and Strauss (2015 and Charmaz (2014 grounded theory methods of data collection and analysis. The result is a description of the experiences and a conceptual model that describes the social process involved in the work decisions made by the study participants. The core category identified in the data is “living in fear and terror.” The work decisions of nurses and midwives were primarily influenced by family responsibilities and demands. The findings of this study could be applied to education, research, and working policies when planning for future disease outbreaks in Liberia and other regions in the world. Keywords: Grounded theory, Health care, Work environment, Midwifery, Nursing

How to decide on the scope, priorities and coordination of information society policy? Analytical framework and three case studies

NARCIS (Netherlands)

Poel, M.; Kool, L.; Giessen, A. van der

2010-01-01

Purpose: ICT is everywhere, but information society policy cannot address all the sectors and policy issues in which ICT plays a role. This paper's aim is to develop an analytical framework to assist policy makers in deciding on the priorities and coordination of information society policy.

¿Un fin o un medio?: Contexto en el que se decide la reproducción An end or means?: context where reproduction is decided

Directory of Open Access Journals (Sweden)

Diva Estela Jaramillo

2005-11-01

Full Text Available Estudio cualitativo que explora el proceso de toma de decisiones en la reproducción. Describe el contexto para dicha decisión. Se entrevistan 17 hombres y 23 mujeres, entre 20 y 35 años, de diferentes estratos sociales, procedencias y niveles educativos, con relación de pareja mayor a un año. Metodológicamente se apoya en la teoría fundada y el interaccionismo simbólico. Los hallazgos muestran diferentes significados de reproducirse y de interpretar las normas de género, los cuales guían las decisiones sobre la descendencia. Cuando las parejas entienden la reproducción como un fin, deciden prepararse y planear el número y el momento de realizarla. Son decisiones dialogadas y concertadas a la luz de sus planes de vida. Cuando entienden reproducirse como un medio para lograr fines individuales, como son, desde lo masculino obtener placer sexual o cuidados, y desde lo femenino, encontrar estabilidad afectiva, emocional y económica para tener unas determinadas condiciones de vida, las decisiones son individuales no negociadas. No se preparan, e interpretan rígidamente las normas de género, lo cual conduce a relaciones de inequidad. La reproducción no es motivo de preocupación y en consecuencia, los hijos aparecen inesperadamente, lo que se convierte en motivo permanente de conflicto entre la pareja.Qualitative study which explores the decision-making process in reproduction. This article describes the context to decide reproduction. Seventeen (17 men and 23 women, between 20 and 35 years old from different social strata and educational levels, with over one year of couple relationship were interviewed. This study is methodologically based on the funded theory and symbolic interactionism. The findings show different meanings of reproduction and interpretation of the principles of gender which guide the decisions regarding offspring. When a couple understands reproduction as an end, they decide to prepare themselves and to plan the

Testing Parametric versus Semiparametric Modelling in Generalized Linear Models

NARCIS (Netherlands)

Härdle, W.K.; Mammen, E.; Müller, M.D.

1996-01-01

We consider a generalized partially linear model E(Y|X,T) = G{X'b + m(T)} where G is a known function, b is an unknown parameter vector, and m is an unknown function.The paper introduces a test statistic which allows to decide between a parametric and a semiparametric model: (i) m is linear, i.e.

Prospective Coronary Heart Disease Screening in Asymptomatic Hodgkin Lymphoma Patients Using Coronary Computed Tomography Angiography: Results and Risk Factor Analysis

Energy Technology Data Exchange (ETDEWEB)

Girinsky, Theodore, E-mail: girinsky.theodore@orange.fr [Department of Radiation Oncology, Institut Gustave Roussy, Villejuif (France); M’Kacher, Radhia [Laboratory of Radiobiology and Oncology, Institut de Radiobiologie Cellulaire et Moleculaire/Direction des Sciences Vivantes/Commissariat Energie Atomique, Fontenay aux Roses (France); Lessard, Nathalie [Department of Radiation Oncology, Institut Gustave Roussy, Villejuif (France); Koscielny, Serge [Biostatistics and Epidemiology Unit, Institut Gustave Roussy, Villejuif (France); Elfassy, Eric; Raoux, François [Department of Radiology, Marie Lannelongue, Chatenay-Malabry (France); Carde, Patrice [Department of Hematology, Institut Gustave Roussy, Villejuif (France); Santos, Marcos Dos [Department of Radiation Oncology, Institut Gustave Roussy, Villejuif (France); Margainaud, Jean-Pierre [Department of Head and Neck Surgery, Institut Gustave Roussy, Villejuif (France); Sabatier, Laure [Laboratory of Radiobiology and Oncology, Institut de Radiobiologie Cellulaire et Moleculaire/Direction des Sciences Vivantes/Commissariat Energie Atomique, Fontenay aux Roses (France); Ghalibafian, Mithra [Department of Radiation Oncology, Institut Gustave Roussy, Villejuif (France); Paul, Jean-François [Department of Radiology, Marie Lannelongue, Chatenay-Malabry (France)

2014-05-01

Purpose: To prospectively investigate the coronary artery status using coronary CT angiography (CCTA) in patients with Hodgkin lymphoma treated with combined modalities and mediastinal irradiation. Methods and Materials: All consecutive asymptomatic patients with Hodgkin lymphoma entered the study during follow-up, from August 2007 to May 2012. Coronary CT angiography was performed, and risk factors were recorded along with leukocyte telomere length (LTL) measurements. Results: One hundred seventy-nine patients entered the 5-year study. The median follow-up was 11.6 years (range, 2.1-40.2 years), and the median interval between treatment and the CCTA was 9.5 years (range, 0.5-40 years). Coronary artery abnormalities were demonstrated in 46 patients (26%). Coronary CT angiography abnormalities were detected in nearly 15% of the patients within the first 5 years after treatment. A significant increase (34%) occurred 10 years after treatment (P=.05). Stenoses were mostly nonostial. Severe stenoses were observed in 12 (6.7%) of the patients, entailing surgery with either angioplasty with stent placement or bypass grafting in 10 of them (5.5%). A multivariate analysis demonstrated that age at treatment, hypertension, and hypercholesterolemia, as well as radiation dose to the coronary artery origins, were prognostic factors. In the group of patients with LTL measurements, hypertension and LTL were the only independent risk factors. Conclusions: The findings suggest that CCTA can identify asymptomatic individuals at risk of acute coronary artery disease who might require either preventive or curative measures. Conventional risk factors and the radiation dose to coronary artery origins were independent prognostic factors. The prognostic value of LTL needs further investigation.

Wrist Traction During MR Arthrography Improves Detection of Triangular Fibrocartilage Complex and Intrinsic Ligament Tears and Visibility of Articular Cartilage.

Science.gov (United States)

Lee, Ryan K L; Griffith, James F; Ng, Alex W H; Nung, Ryan C H; Yeung, David K W

2016-01-01

The purpose of this study was to assess the effects of traction during MR arthrography of the wrist on joint space widening, cartilage visibility, and detection of tears of the triangular fibrocartilage complex (TFCC) and intrinsic ligaments. A prospective study included 40 wrists in 39 patients (25 men, 14 women; mean age, 35 years). MR arthrography was performed with a 3-T MRI system with and without axial traction. Two radiologists independently measured wrist and carpal joint space widths and semiquantitatively graded articular cartilage visibility. Using conventional arthrography as the reference standard and working in consensus, they assessed for the presence of tears of the TFCC, lunotriquetral ligament (LTL), and scapholunate ligament (SLL). Visibility of a tear before traction was compared with visibility after traction. With traction, all joint spaces in the wrist and carpus were significantly widened (change, 0.15-1.01 mm; all p < 0.006). Subjective cartilage visibility of all joint spaces improved after traction (all p ≤ 0.048) except for that of the radioscaphoid space, which was well visualized even before traction. Conventional arthrography depicted 24 TFCC tears, seven LTL tears, and three SLL tears. The accuracy of tear detection improved after traction for the TFCC (98% after traction vs 83% before traction), the LTL (100% vs 88%), and the SLL (100% vs 95%). Tear visibility improved after traction for 54% of TFCC tears, 71% of LTL tears, and 66% of SLL tears. Wrist MR arthrography with axial traction significantly improved the visibility of articular cartilage and the detection and visibility of tears of the TFCC and intrinsic ligaments. The results favor more widespread use of traction during MR arthrography of the wrist.

Consideration on risk of drinking water. How was the regulation value in water decided?

International Nuclear Information System (INIS)

Murakami Michio

2011-01-01

This is an explanatory lecture record of the title subject, motivated by detection of radioactivity in tap water of Tokyo (I-131, 30 Bq/kg) in March 2011. The author explains the process of the detection in comparison with radioactivity in the vegetables and Fukushima spinach, and refers with temporary regulation values (March to April) of Cs-134, 137, U and Pu/transuranium elements as well as I-131 in drinking water and other foods. Also commented is that even water with satisfactorily less than the standard value cannot be said to be absolutely safe. Japan generally decides the standard value based on World Health Organization (WHO) guideline which assumes no threshold for radiation carcinogenesis. Relationship between low dose exposure in Hiroshima and carcinogenesis is obscure, of which situation is also similar in Chinese Guangdon where natural dose is always higher than other areas of the world. The regulation values above are derived from the index values decided by Nuclear Safety Committee of Japan (NSCJ) and Codex committee founded by FAO and WHO, and used at emergency, not at ordinary. Then explained are concept for calculation of regulation values, actual calculating equations of the value for water according to WHO, Codex and NSCJ, and of index values of I-131 and Cs by NSCJ. Exposure dose by I-131 in water and food in Tokyo is actually estimated in this paper to consider its risk (carcinogenic, 0.3/100 thousands people/year) by comparison with other matters like arsenic exposure (1.3) and traffic accident (deaths, 4.5). Lastly, the author warns with Sedgwick's words that Standards are devices to keep the lazy mind from thinking. (T.T.)

Cerebral microdialysis and PtiO2 to decide unilateral decompressive craniectomy after brain gunshot

Directory of Open Access Journals (Sweden)

Boret Henry

2012-01-01

Full Text Available Decompressive craniectomy (DC following brain injury can induce complications (hemorrhage, infection, and hygroma. It is then considered as a last-tier therapy, and can be deleteriously delayed. Focal neuromonitoring (microdialysis and PtiO2 can help clinicians to decide bedside to perform DC in case of intracranial pressure (ICP around 20 to 25 mmHg despite maximal medical treatment. This was the case of a hunter, brain injured by gunshot. DC was performed at day 6, because of unstable ICP, ischemic trend of PtiO2, and decreased cerebral glucose but normal lactate/pyruvate ratio. His evolution was good despite left hemiplegia due to initial injury.

Consent and assessment of capacity to decide or refuse treatment.

Science.gov (United States)

Simpson, Owena

Consent protects the right of patients to decide what happens to them. Before any medical intervention, adults must give valid consent, which must be voluntary, informed and given free of undue influence. When consent is being obtained, patients must be informed about the intervention, why it is being done and its risks; information they are given must be recorded. Every effort should be made to explain the issues in terms that the patient can understand and by providing support and aids to communicate. Consent can be expressed, where patients say they consent or put it in writing, or implied, where a healthcare professional infers from their behaviour that they consent. While different types of consent are valid, some are evidence of stronger proof in court that valid consent has been given. Competent adults have the right to refuse treatment, regardless of the reasons they give for refusal and even if the refusal will result in death; clinicians must respect their decision. In some circumstances-such as when an unconscious person is admitted as an emergency-healthcare professionals can make decisions on behalf of patients, and must do so in patients' best interests.

Internal audit assurance or consulting services rendered on governance: How does one decide?

Directory of Open Access Journals (Sweden)

Naomi Wilkinson

2015-04-01

Full Text Available The concept of organisational governance maturity and what exactly this entails is still perceived as somewhat of a mystery to most and, as a result, internal auditing find themselves in a dilemma when deciding which services to deliver in this regard. The objective of this article was to develop an organisational governance maturity framework that could be used as a measurement tool to assist internal auditing in this dilemma. A preliminary organisational governance maturity framework was developed based on the most relevant literature. A case study was conducted to obtain feedback on the preliminary framework from key stakeholders in the organisation. The results indicated that the framework significantly contributed to the determining and continuous monitoring of governance maturity; both for management and internal auditing.

Multi-Core Emptiness Checking of Timed Büchi Automata using Inclusion Abstraction

DEFF Research Database (Denmark)

Laarman, Alfons; Olesen, Mads Chr.; Dalsgaard, Andreas

2013-01-01

This paper contributes to the multi-core model checking of timed automata (TA) with respect to liveness properties, by investigating checking of TA Büchi emptiness under the very coarse inclusion abstraction or zone subsumption, an open problem in this field. We show that in general Büchi emptiness...... parallel LTL model checking algorithm for timed automata. The algorithms are implemented in LTSmin, and experimental evaluations show the effectiveness and scalability of both contributions: subsumption halves the number of states in the real-world FDDI case study, and the multi-core algorithm yields...

42 CFR 59.7 - What criteria will the Department of Health and Human Services use to decide which family...

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false What criteria will the Department of Health and Human Services use to decide which family planning services projects to fund and in what amount? 59.7... FOR FAMILY PLANNING SERVICES Project Grants for Family Planning Services § 59.7 What criteria will the...

a metabolic wastage model for the rate-yield trade off

Indian Academy of Sciences (India)

A METABOLIC WASTAGE MODEL FOR THE RATE-YIELD TRADE OFF. There is a growth limiting step in which an intermediate metabolite (m) has to hit a target molecule (t). ... D= rate of diffusing out. S= the rate of formation of the metabolite. The equilibrium loss decides the yield. The no. of activated targets decide the rate ...

Inflammatory Long Pentraxin 3 is Associated with Leukocyte Telomere Length in Night-Shift Workers.

Science.gov (United States)

Pavanello, Sofia; Stendardo, Mariarita; Mastrangelo, Giuseppe; Bonci, Melissa; Bottazzi, Barbara; Campisi, Manuela; Nardini, Marco; Leone, Roberto; Mantovani, Alberto; Boschetto, Piera

2017-01-01

Aging is an emerging worldwide threat to public health, even in the workplace, as it links with risk of illness and death. Bewildered inflammatory responses and stressful conditions associate with age-related disorders. Additionally, circadian rhythm disruption, a critical health issue in night-shift workers, correlates with premature aging. We investigated the hypothesis of a link between altered inflammatory response, detected by plasmatic long pentraxin 3 (PTX3), and biological aging, measured by leukocyte telomere length (LTL), attrition, and possibly induced by night-shift work. Within the framework of a cross-sectional study, such possible relationships were appraised by simultaneous equation model (SEM) technique among day and night-shift hospital workers. PTX3 levels, modulated by several aging conditions [i.e., body mass index (BMI) (beta = -0.22; p  = 0.022), C-reactive protein (CRP) (beta = -0.07; p  = 0.000), and cardiovascular diseases with hypertension included (CVD) (beta = -0.12; p  = 0.000)], positively associate with LTL (coefficient = 0.15; p  = 0.033). LTL, in turn is reduced by CVD (beta = -0.15; p  = 0.000), binge drinking (beta = -0.10; p  = 0.004), and CRP (beta = -0.05; p  = 0.026). On the other hand, night-shift work, found to be remarkably free from aging risk factors [i.e., age (beta = -0.13; p  = 0.017), BMI (beta = -0.17; p  = 0.030), CVD (beta = -0.14; p  = 0.000), and binge drinking (beta = -0.13; p  = 0.000)], does associate almost significantly with reversed PTX3 (coefficient = -0.09; p  = 0.089) and even with CRP (beta = 0.17; p  = 0.000). In conclusion, the SEM analysis indicates that PTX3 is positively linked to LTL. The finding suggests a possible new role of this long pentraxin that, by orchestrating an efficient governance of inflammatory processes, may protect telomere from attrition, ensuring therefore the genetic

Using Probabilistic Models to Appraise and Decide on Sovereign Disaster Risk Financing and Insurance

OpenAIRE

Ley-Borrás, Roberto; Fox, Benjamin D.

2015-01-01

This paper presents an overview of the structure of probabilistic catastrophe risk models, discusses their importance for appraising sovereign disaster risk financing and insurance instruments and strategy, and puts forward a model and a process for improving decision making on the linked disaster risk management strategy and sovereign disaster risk financing and insurance strategy. The pa...

Comparison of conventional MRI and MR arthrography in the evaluation of wrist ligament tears: A preliminary experience

Science.gov (United States)

Pahwa, Shivani; Srivastava, Deep N; Sharma, Raju; Gamanagatti, Shivanand; Kotwal, Prakash P; Sharma, Vijay

2014-01-01

Aims: To compare conventional magnetic resonance imaging (MRI) and direct magnetic resonance (MR) arthrography in the evaluation of triangular fibrocartilage complex (TFCC) and intrinsic wrist ligament tears. Materials and Methods: T1-weighted, fat suppressed (FS) proton density plus T2-weighted (FS PD/T2), 3D multiple-echo data image combination (MEDIC) sequences and direct MR arthrography were performed in 53 patients with wrist pain. Images were evaluated for the presence and location of TFCC, scapholunate ligament (SLL) and lunatotriquetral ligament (LTL) tears, and imaging findings were compared with operative findings in 16 patients who underwent arthroscopy or open surgery (gold standard). Results: Sixteen patients underwent arthroscopy/open surgery: 12 TFCC tears were detected arthroscopically out of which 9 were detected on FS PD/T2 sequence, 10 on MEDIC sequence, and all 12 were detected on MR arthrography. The sensitivities of FS PD/T2, MEDIC sequences, and MR arthrography in the detection of TFCC tears were 75%, 83.3%, and 100%, respectively. Out of the eight arthroscopically confirmed SLL tears, three tears were detected on FS PD/T2 sequence, five on MEDIC sequence, and all eight were visualized on MR arthrography. The sensitivities of FS PD/T2, MEDIC sequences, and MR arthrography in detecting SLL tears were 37.5%, 62.5%, and 100%, respectively. One arthroscopically confirmed LTL tear was diagnosed on FS PD/T2 sequence, three on MEDIC sequence, and all five arthroscopically confirmed LTL tears were detected with MR arthrography. The sensitivities of PD, MEDIC sequences, and MR arthrography in detecting LTL tears were 20%, 40%, and 100%, respectively. Conclusions: MR arthrography is the most sensitive and specific imaging modality for the evaluation of wrist ligament tears. PMID:25114389

Comparison of conventional MRI and MR arthrography in the evaluation of wrist ligament tears: A preliminary experience

Directory of Open Access Journals (Sweden)

Shivani Pahwa

2014-01-01

Full Text Available Aims: To compare conventional magnetic resonance imaging (MRI and direct magnetic resonance (MR arthrography in the evaluation of triangular fibrocartilage complex (TFCC and intrinsic wrist ligament tears. Materials and Methods: T1-weighted, fat suppressed (FS proton density plus T2-weighted (FS PD/T2, 3D multiple-echo data image combination (MEDIC sequences and direct MR arthrography were performed in 53 patients with wrist pain. Images were evaluated for the presence and location of TFCC, scapholunate ligament (SLL and lunatotriquetral ligament (LTL tears, and imaging findings were compared with operative findings in 16 patients who underwent arthroscopy or open surgery (gold standard. Results: Sixteen patients underwent arthroscopy/open surgery: 12 TFCC tears were detected arthroscopically out of which 9 were detected on FS PD/T2 sequence, 10 on MEDIC sequence, and all 12 were detected on MR arthrography. The sensitivities of FS PD/T2, MEDIC sequences, and MR arthrography in the detection of TFCC tears were 75%, 83.3%, and 100%, respectively. Out of the eight arthroscopically confirmed SLL tears, three tears were detected on FS PD/T2 sequence, five on MEDIC sequence, and all eight were visualized on MR arthrography. The sensitivities of FS PD/T2, MEDIC sequences, and MR arthrography in detecting SLL tears were 37.5%, 62.5%, and 100%, respectively. One arthroscopically confirmed LTL tear was diagnosed on FS PD/T2 sequence, three on MEDIC sequence, and all five arthroscopically confirmed LTL tears were detected with MR arthrography. The sensitivities of PD, MEDIC sequences, and MR arthrography in detecting LTL tears were 20%, 40%, and 100%, respectively. Conclusions: MR arthrography is the most sensitive and specific imaging modality for the evaluation of wrist ligament tears.

Association Between Leukocyte Telomere Length and the Risk of Incident Atrial Fibrillation

DEFF Research Database (Denmark)

Staerk, Laila; Wang, Biqi; Lunetta, Kathryn L

2017-01-01

BACKGROUND: Advancing age is a prominent risk factor for atrial fibrillation (AF). Shorter telomere length is a biomarker of biological aging, but the link between shorter telomere length and increased risk of AF remains unclear. We examined the association between shorter leukocyte telomere length...... at baseline was 6.95±0.57 kb. During 15.1±4.2 years mean follow-up, 184 participants (64 women) developed AF. Chronological age was associated with increased risk of AF (hazard ratio per 10-year increase, 2.16; 95% confidence interval, 1.71-2.72). There was no significant association between LTL and incident...... evidence for a significant association between LTL and risk of incident AF....

Was R (Miller v Secretary of State for Exiting the European Union correctly decided?

Directory of Open Access Journals (Sweden)

Jacob M. Nolan

2017-09-01

Full Text Available Jacob M. Nolan gives a timely examination of the case of R (on the application of Miller and Dos Santos v Secretary of State for Exiting the European Union – arguably amongst the most important cases on constitutional law decided by the UK Supreme Court. In this landmark case the Supreme Court was required to rule on whether the UK Government (the executive could trigger Article 50 of the Treaty on European Union without the authorisation of an Act of Parliament, through the use of the Crown’s prerogative. On an 8 – 3 majority, with Lords Reed, Carnwath, and Hughes dissenting, the Supreme Court upheld the previous High Court ruling that an Act of Parliament was first required.

How the Recession Affects the Expectations of Potential Acquirers of Real Estate Right in Deciding to Purchase Property?

OpenAIRE

Grum, Bojan; Grum, Darja Kobal

2012-01-01

The objective was to identify factors which are critical to potential acquirers of real estate right in deciding to purchase property. We analysed whether the recession is negatively associated with these expectations. The results of 1306 participant show that people generally expressed higher expectations in year 2009 than then in year 2011, as specially reflected by younger participants. Further analyses of the impact of statistically significant differences of potential acquirers of real e...

Wall Shear Stress Estimation of Thoracic Aortic Aneurysm Using Computational Fluid Dynamics

Directory of Open Access Journals (Sweden)

J. Febina

2018-01-01

Full Text Available An attempt has been made to evaluate the effects of wall shear stress (WSS on thoracic aortic aneurysm (TAA using Computational Fluid Dynamics (CFD. Aneurysm is an excessive localized swelling of the arterial wall due to many physiological factors and it may rupture causing shock or sudden death. The existing imaging modalities such as MRI and CT assist in the visualization of anomalies in internal organs. However, the expected dynamic behaviour of arterial bulge under stressed condition can only be effectively evaluated through mathematical modelling. In this work, a 3D aneurysm model is reconstructed from the CT scan slices and eventually the model is imported to Star CCM+ (Siemens, USA for intensive CFD analysis. The domain is discretized using polyhedral mesh with prism layers to capture the weakening boundary more accurately. When there is flow reversal in TAA as seen in the velocity vector plot, there is a chance of cell damage causing clots. This is because of the shear created in the system due to the flow pattern. It is observed from the proposed mathematical modelling that the deteriorating WSS is an indicator for possible rupture and its value oscillates over a cardiac cycle as well as over different stress conditions. In this model, the vortex formation pattern and flow reversals are also captured. The non-Newtonian model, including a pulsatile flow instead of a steady average flow, does not overpredict the WSS (15.29 Pa compared to 16 Pa for the Newtonian model. Although in a cycle the flow behaviour is laminar-turbulent-laminar (LTL, utilizing the non-Newtonian model along with LTL model also overpredicted the WSS with a value of 20.1 Pa. The numerical study presented here provides good insight of TAA using a systematic approach to numerical modelling and analysis.

Characteristics of the large corporation-based, bureaucratic model among oecd countries - an foi model analysis

Directory of Open Access Journals (Sweden)

Bartha Zoltán

2014-03-01

Full Text Available Deciding on the development path of the economy has been a delicate question in economic policy, not least because of the trade-off effects which immediately worsen certain economic indicators as steps are taken to improve others. The aim of the paper is to present a framework that helps decide on such policy dilemmas. This framework is based on an analysis conducted among OECD countries with the FOI model (focusing on future, outside and inside potentials. Several development models can be deduced by this method, out of which only the large corporation-based, bureaucratic model is discussed in detail. The large corporation-based, bureaucratic model implies a development strategy focused on the creation of domestic safe havens. Based on country studies, it is concluded that well-performing safe havens require the active participation of the state. We find that, in countries adhering to this model, business competitiveness is sustained through intensive public support, and an active role taken by the government in education, research and development, in detecting and exploiting special market niches, and in encouraging sectorial cooperation.

Trends in Energy. 'The consumer decides'; Trends in Energy. 'De consument bepaalt'

Energy Technology Data Exchange (ETDEWEB)

Brzezowsky-Ruys, Y.; Van der Zalm, M.; Van Zutphen, M. (eds.)

2012-03-15

A report is given of the Capgemini organised congress 'Trends in Energy 2011' which has the Dutch subtitle 'De consument bepaalt' (The consumer decides'. The focus of the articles, interviews, debates and presentations is on the role of the consumer in the supply of and demand for energy. Parts of the report are in Dutch and English [Dutch] Dit rapport bestaat uit een verslag van het congres 'Trends in Energy 2011. De consument bepaalt' en een aantal artikelen met achtergrondinformatie over onder meer de rol van de consument in vraag en aanbod van energie.

25 CFR 12.62 - Who decides what uniform an Indian country law enforcement officer can wear and who pays for it?

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Who decides what uniform an Indian country law... what uniform an Indian country law enforcement officer can wear and who pays for it? Each local law... provide uniforms and related equipment to officers in lieu of this payment. All law enforcement officers...

Characterizing economic trends by Bayesian stochastic model specification search

DEFF Research Database (Denmark)

Grassi, Stefano; Proietti, Tommaso

We extend a recently proposed Bayesian model selection technique, known as stochastic model specification search, for characterising the nature of the trend in macroeconomic time series. In particular, we focus on autoregressive models with possibly time-varying intercept and slope and decide on ...

Why (and how) they decide to leave: A grounded theory analysis of STEM attrition at a large public research university

Science.gov (United States)

Minutello, Michael F.

A grounded theory investigation of STEM attrition was conducted that describes and explains why undergraduates at a large Mid-Atlantic research university decided to leave their initial STEM majors to pursue non-STEM courses of study. Participants ultimately decided to leave their initial STEM majors because they were able to locate preferable non-STEM courses of study that did not present the same kinds of obstacles they had encountered in their original STEM majors. Grounded theory data analysis revealed participants initially enrolled in STEM majors with tenuous motivation that did not withstand the various obstacles that were present in introductory STEM coursework. Obstacles that acted as demotivating influences and prompted participants to locate alternative academic pathways include the following: (1.) disengaging curricula; (2.) competitive culture; (3.) disappointing grades; (4.) demanding time commitments; and (5.) unappealing career options. Once discouraged from continuing along their initial STEM pathways, participants then employed various strategies to discover suitable non-STEM majors that would allow them to realize their intrinsic interests and extrinsic goals. Participants were largely satisfied with their decisions to leave STEM and have achieved measures of personal satisfaction and professional success.

Verifying Embedded Systems using Component-based Runtime Observers

DEFF Research Database (Denmark)

Guan, Wei; Marian, Nicolae; Angelov, Christo K.

against formally specified properties. This paper presents a component-based design method for runtime observers, which are configured from instances of prefabricated reusable components---Predicate Evaluator (PE) and Temporal Evaluator (TE). The PE computes atomic propositions for the TE; the latter...... is a reconfigurable component processing a data structure, representing the state transition diagram of a non-deterministic state machine, i.e. a Buchi automaton derived from a system property specified in Linear Temporal Logic (LTL). Observer components have been implemented using design models and design patterns...

Sense, decide, act, communicate (SDAC): next generation of smart sensor systems

Science.gov (United States)

Berry, Nina; Davis, Jesse; Ko, Teresa H.; Kyker, Ron; Pate, Ron; Stark, Doug; Stinnett, Regan; Baker, James; Cushner, Adam; Van Dyke, Colin; Kyckelhahn, Brian

2004-09-01

The recent war on terrorism and increased urban warfare has been a major catalysis for increased interest in the development of disposable unattended wireless ground sensors. While the application of these sensors to hostile domains has been generally governed by specific tasks, this research explores a unique paradigm capitalizing on the fundamental functionality related to sensor systems. This functionality includes a sensors ability to Sense - multi-modal sensing of environmental events, Decide - smart analysis of sensor data, Act - response to environmental events, and Communication - internal to system and external to humans (SDAC). The main concept behind SDAC sensor systems is to integrate the hardware, software, and networking to generate 'knowledge and not just data'. This research explores the usage of wireless SDAC units to collectively make up a sensor system capable of persistent, adaptive, and autonomous behavior. These systems are base on the evaluation of scenarios and existing systems covering various domains. This paper presents a promising view of sensor network characteristics, which will eventually yield smart (intelligent collectives) network arrays of SDAC sensing units generally applicable to multiple related domains. This paper will also discuss and evaluate the demonstration system developed to test the concepts related to SDAC systems.

PSI decides to write off most of its $2.7B Marble Hill investment

International Nuclear Information System (INIS)

Anon.

1986-01-01

After the Indiana Supreme Court ruled last November that the utility may not recover its investment from the cancelled plant, Public Service Indiana (PSI) decided to write off a substantial portion of the $2.7 million already invested in the cancelled Marble Hill nuclear plant. The board will omit common stock dividends for three years and the preferred stock dividend for the first quarter. It will also accept a negotiated rate settlement of 8.2% increase. A 5% emergency surcharge will become permanent. The settlement calls for the utility to restrict capital expenditures over the next three years to the $285.1 million already budgeted for construction. Opposition from a consumers group argues that ratepayers should not be the risk bearers for PSI, but the utility argues that its long-term financial health depends on attracting and keeping investors

Leukocyte Telomere Length and Cognitive Function in Older Adults

Directory of Open Access Journals (Sweden)

Emily Frith

2018-04-01

Full Text Available We evaluated the specific association between leukocyte telomere length and cognitive function among a national sample of the broader U.S. older adult population. Data from the 1999-2002 National Health and Nutrition Examination Survey (NHANES were used to identify 1,722 adults, between 60-85 years, with complete data on selected study variables. DNA was extracted from whole blood via the LTL assay, which is administered using quantitative polymerase chain reaction to measure telomere length relative to standard reference DNA (T/S ratio. Average telomere length was recorded, with two to three assays performed to control for individual variability. The DSST (Digit Symbol Substitution Test was used to assess participant executive cognitive functioning tasks of pairing and free recall. Individuals were excluded if they had been diagnosed with coronary artery disease, congestive heart failure, heart attack or stroke at the baseline assessment. Leukocyte telomere length was associated with higher cognitive performance, independent of gender, race-ethnicity, physical activity status, body mass index and other covariates. In this sample, there was a strong association between LTL and cognition; for every 1 T/S ratio increase in LTL, there was a corresponding 9.9 unit increase in the DSST (β = 9.9; 95% CI: 5.6-14.2; P [JCBPR 2018; 7(1.000: 14-18

Mathematical Modeling in the Undergraduate Curriculum

Science.gov (United States)

Toews, Carl

2012-01-01

Mathematical modeling occupies an unusual space in the undergraduate mathematics curriculum: typically an "advanced" course, it nonetheless has little to do with formal proof, the usual hallmark of advanced mathematics. Mathematics departments are thus forced to decide what role they want the modeling course to play, both as a component of the…

Surface-based geometric modelling using teaching trees for advanced robots

International Nuclear Information System (INIS)

Nakamura, Akira; Ogasawara, Tsukasa; Tsukune, Hideo; Oshima, Masaki

2000-01-01

Geometric modelling of the environment is important in robot motion planning. Generally, shapes can be stored in a data base, so the elements that need to be decided are positions and orientations. In this paper, surface-based geometric modelling using a teaching tree is proposed. In this modelling, combinations of surfaces are considered in order to decide positions and orientations of objects. The combinations are represented by a depth-first tree, which makes it easy for the operator to select one combination out of several. This method is effective not only in the case when perfect data can be obtained, but also when conditions for measurement of three-dimensional data are unfavorable, which often occur in the environment of a working robot. (author)

Parents' accounts : factors considered when deciding how far to involve their son/daughter with learning disabilities in choice-making

OpenAIRE

Mitchell, Wendy Ann

2012-01-01

There is limited literature on the processes of choice-making in families of young people with learning disabilities. This paper examines the factors considered by parents of young people with learning disabilities when deciding their own and their child's role in a range of significant choices (health, social care and education) about their child's life. The paper reports data collected from a sub-sample of 14 parents recruited from 11 families participating in a longitudinal (2007-2010) qua...

Use of Erythropoietin-Stimulating Agents (ESA) in Patients With End-Stage Renal Failure Decided to Forego Dialysis: Palliative Perspective.

Science.gov (United States)

Cheng, Hon Wai Benjamin; Chan, Kwok Ying; Lau, Hoi To; Man, Ching Wah; Cheng, Suk Ching; Lam, Carman

2017-05-01

Normochromic normocytic anemia is a common complication in chronic kidney disease (CKD) and is associated with many adverse clinical consequences. Erythropoiesis-stimulating agents (ESAs) act to replace endogenous erythropoietin for patients with end-stage renal disease having anemia. Today, ESAs remain the main tool for treating anemia associated with CKD. In current practice, the use of ESA is not limited to the patients on renal replacement therapy but has extended to nondialysis patients under palliative care (PC). Current evidence on ESA usage in patients with CKD decided to forego dialysis often have to take reference from studies conducted in other groups of patients with CKD, including pre-dialysis patients and those on renal replacement therapy. There is paucity of studies targeting use of ESAs in renal PC patients. Small-scale retrospective study in renal PC patients had suggested clinical advantage of ESAs in terms of hemoglobin improvement, reduction in fatigue, and hospitalization rate. With the expected growth in elderly patients with CKD decided to forego dialysis and manage conservatively, there remains an urgent need to call for large-scale prospective trial in exploring efficacy of ESAs in this population, targeting on quality of life and symptoms improvement outcome. This article also reviews the mechanism of action, pharmacology, adverse effects, and clinical trial evidence for ESA in patients with CKD under renal PC.

How adolescents decide on bariatric surgery: an interpretative phenomenological analysis.

Science.gov (United States)

Doyle, J; Colville, S; Brown, P; Christie, D

2018-04-01

The National Institute of Clinical Excellence states that bariatric surgery may be considered for adolescents with severe obesity in 'exceptional circumstances'. However, it is not clear what is deemed to be exceptional, and there is a lack of long-term outcomes data or research, which would inform patient selection. This is an in-depth qualitative study involving five adolescents who had previously undergone bariatric surgery (between 1 and 3 years postoperatively) and four who were being assessed for the treatment. All patients were from one tertiary NHS weight management service offering bariatric surgery to adolescents. Participants were interviewed to explore how young people decide whether bariatric surgery is an appropriate intervention for them. Of the nine adolescents recruited, four were male and five female, aged between 17 and 20 years at the time of interview. Participants who had already undergone surgery did so between the ages of 16 and 18. The data were analysed using interpretative phenomenological analysis, and key themes were identified, such as (i) wanting a different future, (ii) experiences of uncertainty, (iii) managing the dilemmas and (iv) surgery as the last resort. The findings suggest that young people are prepared to accept a surgical solution for obesity despite numerous dilemmas. Young people choose this intervention as a way of 'normalizing' when they perceive there is nothing better available. It is argued that these findings may have implications for the counselling of young people living with overweight and obesity and for government policy. © 2018 World Obesity Federation.

Deciding on gender in children with intersex conditions: considerations and controversies.

Science.gov (United States)

Thyen, Ute; Richter-Appelt, Hertha; Wiesemann, Claudia; Holterhus, Paul-Martin; Hiort, Olaf

2005-01-01

Biologic factors such as genetic and hormonal influences contribute to gender identity, gender role behavior, and sexual orientation in humans, but this relationship is considerably modified by psychologic, social, and cultural factors. The recognition of biologically determined conditions leading to incongruity of genetically determined sex, somatic phenotype, and gender identity has led to growing interest in gender role development and gender identity in individuals with intersex conditions. Sex assignment of children with ambiguous genitalia remains a difficult decision for the families involved and subject to controversial discussion among professionals and self-help groups. Although systematic empirical data on outcomes of functioning and health-related quality of life are sparse, anecdotal evidence from case series and individual patients about their experiences in healthcare suggests traumatic experiences in some. This article reviews the earlier 'optimal gender policy' as well as the more recent 'full consent policy' and reviews published data on both surgical and psychosocial outcomes. The professional debate on deciding on sex assignment in children with intersex conditions is embedded in a much wider public discourse on gender as a social construction. Given that the empirical basis of our knowledge of the causes, treatment options, long-term outcomes, and patient preferences is insufficient, we suggest preliminary recommendations based on clinical experience, study of the literature, and interviews with affected individuals.

No Bridge Too High: Infants Decide Whether to Cross Based on the Probability of Falling not the Severity of the Potential Fall

Science.gov (United States)

Kretch, Kari S.; Adolph, Karen E.

2013-01-01

Do infants, like adults, consider both the probability of falling and the severity of a potential fall when deciding whether to cross a bridge? Crawling and walking infants were encouraged to cross bridges varying in width over a small drop-off, a large drop-off, or no drop-off. Bridge width affects the probability of falling, whereas drop-off…

ORIGINAL ARTICLE ORI ORI Radioiodine therapy in skeletal ...

African Journals Online (AJOL)

and analyse the effect of variables that influence the prognosis of this .... lobectomy; LTL = left total thyroidectomy; RST = right subtotal thyroidectomy; Dissec = dissec- ... that gender was not indicative of survival.9-12 Those patients who died.

Research design models: a new category

International Nuclear Information System (INIS)

Burgeson, D.A.

1983-01-01

This paper discusses the concept of a research design model and how it differs from an engineering design model. Essentially, the research design model draws on the methods, materials and processes of engineering design models but more emphasis is placed on conceptualization in 3-D. Typically, equipment and processes in research are unique. Often, there are competing concepts from which to decide. The approach which is evolving at Sandia National Laboratories mixes preliminary, engineering and research design on the same model

Model Checking the Logic of Allen's Relations Meets and Started-by is P^NP-Complete

Directory of Open Access Journals (Sweden)

Laura Bozzelli

2016-09-01

Full Text Available In the plethora of fragments of Halpern and Shoham's modal logic of time intervals (HS, the logic AB of Allen's relations Meets and Started-by is at a central position. Statements that may be true at certain intervals, but at no sub-interval of them, such as accomplishments, as well as metric constraints about the length of intervals, that force, for instance, an interval to be at least (resp., at most, exactly k points long, can be expressed in AB. Moreover, over the linear order of the natural numbers N, it subsumes the (point-based logic LTL, as it can easily encode the next and until modalities. Finally, it is expressive enough to capture the ω-regular languages, that is, for each ω-regular expression R there exists an AB formula Φ such that the language defined by R coincides with the set of models of Φ over N. It has been shown that the satisfiability problem for AB over N is EXPSPACE-complete. Here we prove that, under the homogeneity assumption, its model checking problem is Δ^p_2 = P^NP-complete (for the sake of comparison, the model checking problem for full HS is EXPSPACE-hard, and the only known decision procedure is nonelementary. Moreover, we show that the modality for the Allen relation Met-by can be added to AB at no extra cost (AA'B is P^NP-complete as well.

Physical activity and telomere length in U.S. men and women: An NHANES investigation.

Science.gov (United States)

Tucker, Larry A

2017-07-01

The principal objective was to determine the extent to which physical activity (PA) accounts for differences in leukocyte telomere length (LTL) in a large random sample of U.S. adults. Another purpose was to assess the extent to which multiple demographic and lifestyle covariates affect the relationship between PA and LTL. A total of 5823 adults from the National Health and Nutrition Examination Survey (NHANES 1999-2002) were studied cross-sectionally. Employing the quantitative polymerase chain reaction method, LTL was compared to standard reference DNA. PA was indexed using MET-minutes using self-reported frequency, intensity, and duration of participation in 62 physical activities. Covariates were controlled statistically. Telomeres were 15.6 base pairs shorter for each year of chronological age (F=723.2, Pactivity and those in the Sedentary, Low, and Moderate groups were 140, 137, and 111, respectively. Adults with High activity were estimated to have a biologic aging advantage of 9years (140 base pairs÷15.6) over Sedentary adults. The difference in cell aging between those with High and Low activity was also significant, 8.8years, as was the difference between those with High and Moderate PA (7.1years). Overall, PA was significantly and meaningfully associated with telomere length in U.S. men and women. Evidently, adults who participate in high levels of PA tend to have longer telomeres, accounting for years of reduced cellular aging compared to their more sedentary counterparts. Copyright © 2017 Elsevier Inc. All rights reserved.

Modelling Preference Heterogeneity for Theatre Tickets

DEFF Research Database (Denmark)

Baldin, Andrea; Bille, Trine

This paper analyzes the behavioural choice for theatre tickets using a rich dataset for 2010-2013 from the sale system of the Royal Danish National Theatre. A consumer who decides to attend a theater production faces multiple sources of price variation that depends on: socio-economic characterist......This paper analyzes the behavioural choice for theatre tickets using a rich dataset for 2010-2013 from the sale system of the Royal Danish National Theatre. A consumer who decides to attend a theater production faces multiple sources of price variation that depends on: socio......-economic characteristics, quality of the seat, day of the performance and timing of purchase. Except for the first case, factors of price differentiation involves a choice by the consumer among different ticket alternatives. Two modelling approaches, namely multinomial logit (with socio-demographic characteristics......) and latent class are proposed in order to model ticket purchase behaviour. These models allow us explicitly to take into account consumers' preference heterogeneity with respect to the attributes associated to each ticket alternative In addition, the distribution of the willingness-to-pay (WTP) of choice...

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

Characterising the loading direction sensitivity of 3D woven composites: Effect of z-binder architecture

KAUST Repository

Saleh, Mohamed Nasr; Yudhanto, Arief; Potluri, Prasad; Lubineau, Gilles; Soutis, Constantinos

2016-01-01

Three different architectures of 3D carbon fibre woven composites (orthogonal, ORT; layer-to-layer, LTL; angle interlock, AI) were tested in quasi-static uniaxial tension. Mechanical tests (tensile in on-axis of warp and weft directions as well

Modeling Human Information Acquisition Strategies

NARCIS (Netherlands)

Heuvelink, Annerieke; Klein, Michel C. A.; van Lambalgen, Rianne; Taatgen, Niels A.; Rijn, Hedderik van

2009-01-01

The focus of this paper is the development of a computational model for intelligent agents that decides on whether to acquire required information by retrieving it from memory or by interacting with the world. First, we present a task for which such decisions have to be made. Next, we discuss an

When we decided to create the Revista Scientific

Directory of Open Access Journals (Sweden)

Oscar Antonio Martínez Molina

2017-08-01

Full Text Available When we proposed to create the Revista Scientific, we had many doubts about what would be the treatment to be followed for the development of it? On the one hand, we needed to create a common basis for their more ethical and moral aspects so that the authors always applied the same criteria. This is not only to achieve an editorial unit, but to establish guidelines to follow throughout the publication, so as to facilitate the reading and understanding of the contents from the respect to the information, to the sources, but on all to the readers. The rules created are, therefore, the guidelines to be followed by the authors that appear in our publication, which must take into account these basic rules. Another point to be addressed was the selection of a disciplinary and multidisciplinary team at the international level that is in charge of the valuation of scientific productions, high invoice equipment of different Universities and Organizations recognized worldwide. On the basis of the above considerations, the question arises of deciding, what can or should be, and what can not or should not be counted, but rather how to explain and explain information in the most ethically correct way from the deontological perspective of the writer. It should be noted that Scientific tries to serve as a complement and informative tool for both teachers and the general public. We aim to disseminate scientific and technological knowledge, through the original results, the product of scientific research, which represent a contribution to the development of science and technology. It includes works, products of scientific research and theoretical reflections that, due to their relevance, merit publication, and in this way contribute to the visibility of intellectual production in the areas of education and social sciences. Scientific Magazine is aimed at the academic audience in its different levels (Initial, Basic, University as well as the scientific community

Bisimulation for Single-Agent Plausibility Models

DEFF Research Database (Denmark)

Andersen, Mikkel Birkegaard; Bolander, Thomas; van Ditmarsch, H.

2013-01-01

define a proper notion of bisimulation, and prove that bisimulation corresponds to logical equivalence on image-finite models. We relate our results to other epistemic notions, such as safe belief and degrees of belief. Our results imply that there are only finitely many non-bisimilar single......-agent epistemic plausibility models on a finite set of propositions. This gives decidability for single-agent epistemic plausibility planning....

Temporal Aggregation in First Order Cointegrated Vector Autoregressive models

DEFF Research Database (Denmark)

Milhøj, Anders; la Cour, Lisbeth Funding

2011-01-01

with the frequency of the data. We also introduce a graphical representation that will prove useful as an additional informational tool for deciding the appropriate cointegration rank of a model. In two examples based on models of time series of different grades of gasoline, we demonstrate the usefulness of our...

Leukocyte telomere length and personality : Associations with the big five and type d personality traits

NARCIS (Netherlands)

Schoormans, D.; Verhoeven, J.E.; Denollet, J.; van de Poll-Franse, L.V.; Penninx, B.W.J.H.

2018-01-01

Accelerated cellular ageing, which can be examined by telomere length (TL), may be an overarching mechanism underlying the association between personality and adverse health outcomes. This 6-year longitudinal study examined the relation between personality and leukocyte telomere length (LTL) across

Paving the road from transport models to “new mobilities” models

DEFF Research Database (Denmark)

Wind, Simon; Jensen, Ole B.; Kaplan, Sigal

2012-01-01

For half a century, tremendous efforts have been invested in developing transport models as a decision aid for policy makers in designing effective policy interventions and deciding among costly public projects for the benefit of the population. Transport and activity-based models are often...... criticized for neglecting the “new mobilities” turn (Urry 2007, Cresswell 2006), namely multiple mobility aspects and rationales, including social, cultural, material, aesthetic and affective, in analyzing travel behavior. This paper aims at taking a tentative first step in bridging the gap between...

A Finite Model Property for Intersection Types

Directory of Open Access Journals (Sweden)

Rick Statman

2015-03-01

Full Text Available We show that the relational theory of intersection types known as BCD has the finite model property; that is, BCD is complete for its finite models. Our proof uses rewriting techniques which have as an immediate by-product the polynomial time decidability of the preorder <= (although this also follows from the so called beta soundness of BCD.

Ranked retrieval of Computational Biology models.

Science.gov (United States)

Henkel, Ron; Endler, Lukas; Peters, Andre; Le Novère, Nicolas; Waltemath, Dagmar

2010-08-11

The study of biological systems demands computational support. If targeting a biological problem, the reuse of existing computational models can save time and effort. Deciding for potentially suitable models, however, becomes more challenging with the increasing number of computational models available, and even more when considering the models' growing complexity. Firstly, among a set of potential model candidates it is difficult to decide for the model that best suits ones needs. Secondly, it is hard to grasp the nature of an unknown model listed in a search result set, and to judge how well it fits for the particular problem one has in mind. Here we present an improved search approach for computational models of biological processes. It is based on existing retrieval and ranking methods from Information Retrieval. The approach incorporates annotations suggested by MIRIAM, and additional meta-information. It is now part of the search engine of BioModels Database, a standard repository for computational models. The introduced concept and implementation are, to our knowledge, the first application of Information Retrieval techniques on model search in Computational Systems Biology. Using the example of BioModels Database, it was shown that the approach is feasible and extends the current possibilities to search for relevant models. The advantages of our system over existing solutions are that we incorporate a rich set of meta-information, and that we provide the user with a relevance ranking of the models found for a query. Better search capabilities in model databases are expected to have a positive effect on the reuse of existing models.

On a Stochastic Model in Insurance

Indian Academy of Sciences (India)

Insurance mathematics today is considered a part of applied probability theory. Main objectives are modelling of claims that arrive in an insurance business, and decide how premiums are to be charged to avoid ruin of the insurance company. GENERAL I ARTICLE various results and the heuristics can be appreciated.

Domain-Specific Modelling Languages in Bigraphs

DEFF Research Database (Denmark)

Perrone, Gian David

" of models, in order to improve the utility of the models we build, and to ease the process of model construction by moving the languages we use to express such models closer to their respective domains. This thesis is concerned with the study of bigraphical reactive systems as a host for domain...... for deciding reaction rule causation. Finally, we provide a mechanism for the modular construction of domain-specic modelling languages as bigraphical reactive systems, exploring the relationship between vertical renement and language specialisation in this setting. The thesis is composed of several...

A Model of Feeding Readiness for Preterm Infants

OpenAIRE

Pickler, Rita H.

2004-01-01

This paper presents a theoretical model of bottle feeding readiness in preterm infants, which hypothesizes relationships between bottle feeding readiness, experience, and outcomes. The synactive theory of development provided the conceptual foundation for the model. The model, which is currently being tested, is designed to establish bottle feeding readiness criteria that will help nurses decide when to offer a bottle to a preterm infant The model may also provide a useful framework for deter...

A Model of Student Workload

Science.gov (United States)

Bowyer, Kyle

2012-01-01

Student workload is a contributing factor to students deciding to withdraw from their study before completion of the course, at significant cost to students, institutions and society. The aim of this paper is to create a basic workload model for a group of undergraduate students studying business law units at Curtin University in Western…

Using the supply-chain operations reference model (SCOR) to model the production of nautical charts by the SA navy hydrographic office

CSIR Research Space (South Africa)

Schmitz, Peter MU

2011-07-01

Full Text Available as the Centre of Hydrographic Excellence in Africa by the International Hydrographic Community through its proven professional conduct, products, innovation and supreme service. Since chart production can be seen as a supply chain, it was decided to model...

ORF Alignment: NC_003233 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

ORF Alignment: NC_003238 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

ORF Alignment: NC_003229 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

The influence of metal-support interactions on the whiteline intensity

NARCIS (Netherlands)

Vaarkamp, M.; Miller, J.T.; Modica, F.S.; Koningsberger, D.C.; Kuroda, H.; Ohta, T.

1993-01-01

The whiteline intensity of Pt/K-LTL catalysts reduced at 300, 450, and 600 Deg decreases with increasing redn. temp. This change in whiteline intensity was ascribed to the removal of hydrogen from the metal-support interface by redn. at higher temp.

Tutorial on Modeling VAT Rules Using OWL-DL

DEFF Research Database (Denmark)

Nielsen, Morten Ib; Simonsen, Jakob Grue; Larsen, Ken Friis

. In an ERP setting such a model could reduce the Total Cost of Ownership (TCO) and increase the quality of the system. We have selected OWL-DL because we believe that description logic is suited for modeling VAT rules due to the decidability of important inference problems that are key to the way we plan...... to use the model and because OWL-DL is relatively intuitive to use....

Deciding to Come Out to Parents: Toward a Model of Sexual Orientation Disclosure Decisions.

Science.gov (United States)

Grafsky, Erika L

2017-08-16

The purpose of this study was to conduct research to understand nonheterosexual youths' decision to disclose their sexual orientation information to their parents. The sample for this study includes 22 youth between the ages of 14 and 21. Constructivist grounded theory guided the qualitative methodology and data analysis. The findings from this study posit an emerging model of sexual orientation disclosure decisions comprised of four interrelated factors that influence the decision to disclose or not disclose, as well as a description of the mechanism through which disclosure either does or does not occur. Clinical implications and recommendations for further research are provided. © 2017 Family Process Institute.

Is Post-Traumatic Stress Disorder Associated with Premature Senescence? A Review of the Literature

Science.gov (United States)

Lohr, James B.; Palmer, Barton W.; Eidt, Carolyn A.; Aailaboyina, Smitha; Mausbach, Brent T.; Wolkowitz, Owen M.; Thorp, Steven R.; Jeste, Dilip V.

2015-01-01

Post-Traumatic Stress Disorder (PTSD) has major public health significance. Evidence that PTSD may be associated with premature senescence (early or accelerated aging) would have major implications for quality of life and healthcare policy. We conducted a comprehensive review of published empirical studies relevant to early aging in PTSD. Our search included the PubMed, PsycINFO and PILOTS databases for empirical reports published since the year 2000 relevant to early senescence and PTSD, including: (1) biomarkers of senescence (leukocyte telomere length (LTL) and pro-inflammatory markers), (2) prevalence of senescence-associated medical conditions, and (3) mortality rates. All six studies examining LTL indicated reduced LTL in PTSD (pooled Cohen’s d = 0.76). We also found consistent evidence of increased pro-inflammatory markers in PTSD (mean Cohen’s ds), including C-reactive protein = 0.18, Interleukin-1 beta = 0.44, Interleukin-6 = 0.78, and tumor necrosis factor alpha = 0.81. The majority of reviewed studies also indicated increased medical comorbidity among several targeted conditions known to be associated with normal aging, including cardiovascular disease, type 2 diabetes mellitus, gastrointestinal ulcer disease, and dementia. We also found seven of 10 studies indicated PTSD to be associated with earlier mortality (average HR = 1.29). In short, evidence from multiple lines of investigation suggests that PTSD may be associated with a phenotype of accelerated senescence. Further research is critical to understand the nature of this association. There may be a need to re-conceptualize PTSD beyond the boundaries of mental illness, and instead as a full systemic disorder. PMID:25959921

Variants in TERT influencing telomere length are associated with paranoid schizophrenia risk.

Science.gov (United States)

Rao, Shuquan; Ye, Ning; Hu, Huiling; Shen, Yan; Xu, Qi

2016-04-01

Schizophrenia is one of the most severe psychiatric disorders, with a high heritability of up to 80%. Several studies have reported telomere dysfunction in schizophrenia, and common variants in the telomerase reverse transcriptase (TERT) gene. TERT is a key component of the telomerase complex that maintains telomere length by addition of telomere repeats to telomere ends, and has repeatedly shown association with mean lymphocyte telomere length (LTL). Thus, we hypothesized that TERT may be a novel susceptibility gene for schizophrenia. Using a Taqman protocol, we genotyped eight tag SNPs from the TERT locus in 1,072 patients with paranoid schizophrenia and 1,284 control subjects from a Chinese Han population. We also measured mean LTL in 98 cases and 109 controls using a quantitative PCR-based technique. Chi-square tests showed that two SNPs, rs2075786 (P = 0.0009, OR = 0.76, 95%CI = 0.65-0.90) and rs4975605 (P = 0.0026, OR = 0.73, 95%CI = 0.60-0.90), were associated with a protective effect, while rs10069690 was associated with risk of paranoid schizophrenia (P = 0.0044, OR = 1.23, 95%CI = 1.07-1.42). Additionally, the rs2736118-rs2075786 haplotype showed significant association with paranoid schizophrenia (P = 0.0013). Moreover, mean LTL correlated with rs2075786 genotypes was significantly shorter in the patient group than the control group. The present results suggest that the TERT gene may be a novel candidate involved in the development of paranoid schizophrenia. © 2016 Wiley Periodicals, Inc.

An Approximate Dynamic Programming Approach to Urban Freight Distribution with Batch Arrivals

NARCIS (Netherlands)

van Heeswijk, W.J.A.; Mes, Martijn R.K.; Schutten, Johannes M.J.; Corman, Francesco; Voβ, Stefan; Negenborn, Rudy R.

2015-01-01

We study an extension of the delivery dispatching problem (DDP) with time windows, applied on LTL orders arriving at an urban consolidation center. Order properties (e.g., destination, size, dispatch window) may be highly varying, and directly distributing an incoming order batch may yield high

Identification of seven loci affecting mean telomere length and their association with disease

NARCIS (Netherlands)

Codd, V.; Nelson, C.P.; Albrecht, E.; Mangino, M.; Deelen, J.; Buxton, J.L.; Hottenga, J.J.; Fischer, K.; Esko, T.; Surakka, I.; Broer, L.; Nyholt, DR; Mateo Leach, I.; Salo, P.; Hägg, S.; Matthews, M.K.; Palmen, J.; Norata, G.D.; O'Reilly, P.F.; Saleheen, D.; Amin, N.; Balmforth, A.J.; Beekman, M.; de Boer, R.A.; Böhringer, S.; Braund, P.S.; Burton, P.R.; de Craen, A.J.; Denniff, M.; Dong, Y.; Douroudis, K.; Dubinina, E.; Eriksson, J.G.; Garlaschelli, K.; Guo, D.; Hartikainen, A.L.; Henders, A.K.; Houwing-Duistermaat, J.J.; Kananen, L.; Karssen, L.C.; Kettunen, J.; Klopp, N.; Lagou, V.; van Leeuwen, E.; Madden, P.A.; Mägi, R.; Magnusson, P.K.E.; Männistö, S.; McCarthy, M.I.; Medland, S.E.; Mihailov, E.; Montgomery, G.W.; Oostra, B.A.; Palotie, A.; Peters, A.; Pollard, H.; Pouta, A.; Prokopenko, I.; Ripatti, S.; Salomaa, V.; Suchiman, H.E.D.; Valdes, A.M.; Verweij, N.; Viñuela, A.; Wang, X.; Wichmann, H. E.; Widen, E.; Willemsen, G.; Wright, M.J.; Xia, K.; Xiao, X.; van Veldhuisen, D.J.; Catapano, A.L.; Tobin, M.D.; Hall, A.S.; Blakemore, A.I.F.; van Gilst, W.H.; Zhu, H.; Erdmann, J.; Reilly, M.P.; Kathiresan, S.; Schunkert, H.; Talmud, P.J.; Pedersen, N.L.; Perola, M.; Ouwehand, W.; Kaprio, J.; Martin, N.G.; van Duijn, C.M.; Hovatta, I.; Gieger, C.; Metspalu, A.; Boomsma, D.I.; Järvelin, M.R.; Slagboom, P.E.; Thompson, J.R.; Spector, T.D.; van der Harst, P.; Samani, N.J.

2013-01-01

Interindividual variation in mean leukocyte telomere length (LTL) is associated with cancer and several age-associated diseases. We report here a genome-wide meta-analysis of 37,684 individuals with replication of selected variants in an additional 10,739 individuals. We identified seven loci,

Identification of seven loci affecting mean telomere length and their association with disease

NARCIS (Netherlands)

Codd, Veryan; Nelson, Christopher P.; Albrecht, Eva; Mangino, Massimo; Deelen, Joris; Buxton, Jessica L.; Hottenga, Jouke Jan; Fischer, Krista; Esko, Tonu; Surakka, Ida; Broer, Linda; Nyholt, Dale R.; Mateo Leach, Irene; Salo, Perttu; Hagg, Sara; Matthews, Mary K.; Palmen, Jutta; Norata, Giuseppe D.; O'Reilly, Paul F.; Saleheen, Danish; Amin, Najaf; Balmforth, Anthony J.; Beekman, Marian; de Boer, Rudolf A.; Bohringer, Stefan; Braund, Peter S.; Burton, Paul R.; de Craen, Anton J. M.; Denniff, Matthew; Dong, Yanbin; Douroudis, Konstantinos; Dubinina, Elena; Eriksson, Johan G.; Garlaschelli, Katia; Guo, Dehuang; Hartikainen, Anna-Liisa; Henders, Anjali K.; Houwing-Duistermaat, Jeanine J.; Kananen, Laura; Karssen, Lennart C.; Kettunen, Johannes; Klopp, Norman; Lagou, Vasiliki; van Leeuwen, Elisabeth M.; Madden, Pamela A.; Maegi, Reedik; Verweij, Niek; van Veldhuisen, Dirk J.; van Gilst, Wiek H.; van der Harst, Pim

Interindividual variation in mean leukocyte telomere length (LTL) is associated with cancer and several age-associated diseases. We report here a genome-wide meta-analysis of 37,684 individuals with replication of selected variants in an additional 10,739 individuals. We identified seven loci,

An evolutionary behavioral model for decision making

OpenAIRE

Romero Lopez, Dr Oscar Javier

2011-01-01

For autonomous agents the problem of deciding what to do next becomes increasingly complex when acting in unpredictable and dynamic environments pursuing multiple and possibly conflicting goals. One of the most relevant behavior-based model that tries to deal with this problem is the one proposed by Maes, the Bbehavior Network model. This model proposes a set of behaviors as purposive perception-action units which are linked in a nonhierarchical network, and whose behavior selection process i...

An expert system for dispersion model interpretation

International Nuclear Information System (INIS)

Skyllingstad, E.D.; Ramsdell, J.V.

1988-10-01

A prototype expert system designed to diagnose dispersion model uncertainty is described in this paper with application to a puff transport model. The system obtains qualitative information from the model user and through an expert-derived knowledge base, performs a rating of the current simulation. These results can then be used in combination with dispersion model output for deciding appropriate evacuation measures. Ultimately, the goal of this work is to develop an expert system that may be operated accurately by an individual uneducated in meteorology or dispersion modeling. 5 refs., 3 figs

How US institutional review boards decide when researchers need to translate studies.

Science.gov (United States)

Klitzman, Robert

2014-03-01

Informed consent is crucial in research, but potential participants may not all speak the same language, posing questions that have not been examined concerning decisions by institutional review boards (IRBs) and research ethics committees' (RECs) about the need for researchers to translate consent forms and other study materials. Sixty US IRBs (every fourth one in the list of the top 240 institutions by The National Institutes of Health funding) were contacted, and leaders (eg, chairs) from 34 (response rate=57%) and an additional 12 members and administrators were interviewed. IRBs face a range of problems about translation of informed consent documents, questionnaires and manuals-what, when and how to translate (eg, for how many or what proportion of potential subjects), why to do so and how to decide. Difficulties can arise about translation of specific words and of broader cultural concepts regarding processes of informed consent and research, especially in the developing world. In these decisions, IRBs weigh the need for autonomy (through informed consent) and justice (to ensure fair distribution of benefits and burdens of research) against practical concerns about costs to researchers. At times IRBs may have to compromise between these competing goals. These data, the first to examine when and how IRBs/RECs require researchers to translate materials, thus highlight a range of problems with which these committees struggle, suggesting a need for further normative and empirical investigation of these domains, and consideration of guidelines to help IRBs deal with these tensions.

[Prevention of drink driving at academic festivals: «Tú decides» project].

Science.gov (United States)

Malveiro, Jorge; de Jesus, Saul Neves; Viseo, Joao; Pechorro, Pedro; Pacheco, Eusébio; Lima-Rodríguez, Joaquín Salvador; Lima-Serrano, Marta

2015-01-01

Alcohol consumption among university students has reached worrying levels, its effects on driving being highly dangerous. This aspect emphasizes the need to develop prevention programs, intended to raise subjects' awareness about the effects of alcohol on driving. The aim of the present research is to evaluate the effectiveness of the intervention program «Tú decides», implemented at the Algarve University during several students festivals, between 2010-2014. Quasi-experimental study, pre-post test without control group. A total of 5,079 participants were inquired. They were asked, at two different moments, before and after the measurement of the blood alcohol level and giving an information session with technical recommendations to prevent driving under alcohol effects. One factor ANOVA test used, in order to perform a mean comparison, as well as the Chi-square statistics, to perform a proportion comparison (p<.05). It was found that the intention to drive was lower at the second moment (42.1%) (χ(2)=2078.71; p=.000). This intention was influenced by blood alcohol level different levels (χ(2)=338.252; p=.000), gender (χ(2)=35.718; p=.000), age (χ(2)=62.805; p=.000) and professional situation of the participants (χ(2)=27.397; p=.001). We can affirm that the main objective of this intervention was achieved, since the participants followed the technical recommendations based on the blood alcohol level results. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.

Optimization model of energy mix taking into account the environmental impact

International Nuclear Information System (INIS)

Gruenwald, O.; Oprea, D.

2012-01-01

At present, the energy system in the Czech Republic needs to decide some important issues regarding limited fossil resources, greater efficiency in producing of electrical energy and reducing emission levels of pollutants. These problems can be decided only by formulating and implementing an energy mix that will meet these conditions: rational, reliable, sustainable and competitive. The aim of this article is to find a new way of determining an optimal mix for the energy system in the Czech Republic. To achieve the aim, the linear optimization model comprising several economics, environmental and technical aspects will be applied. (Authors)

Evaluation of the autoregression time-series model for analysis of a noisy signal

International Nuclear Information System (INIS)

Allen, J.W.

1977-01-01

The autoregression (AR) time-series model of a continuous noisy signal was statistically evaluated to determine quantitatively the uncertainties of the model order, the model parameters, and the model's power spectral density (PSD). The result of such a statistical evaluation enables an experimenter to decide whether an AR model can adequately represent a continuous noisy signal and be consistent with the signal's frequency spectrum, and whether it can be used for on-line monitoring. Although evaluations of other types of signals have been reported in the literature, no direct reference has been found to AR model's uncertainties for continuous noisy signals; yet the evaluation is necessary to decide the usefulness of AR models of typical reactor signals (e.g., neutron detector output or thermocouple output) and the potential of AR models for on-line monitoring applications. AR and other time-series models for noisy data representation are being investigated by others since such models require fewer parameters than the traditional PSD model. For this study, the AR model was selected for its simplicity and conduciveness to uncertainty analysis, and controlled laboratory bench signals were used for continuous noisy data. (author)

Slime moulds use heuristics based on within-patch experience to decide when to leave.

Science.gov (United States)

Latty, Tanya; Beekman, Madeleine

2015-04-15

Animals foraging in patchy, non-renewing or slowly renewing environments must make decisions about how long to remain within a patch. Organisms can use heuristics ('rules of thumb') based on available information to decide when to leave the patch. Here, we investigated proximate patch-departure heuristics in two species of giant, brainless amoeba: the slime moulds Didymium bahiense and Physarum polycephalum. We explicitly tested the importance of information obtained through experience by eliminating chemosensory cues of patch quality. In P. polycephalum, patch departure was influenced by the consumption of high, and to a much lesser extent low, quality food items such that engulfing a food item increased patch-residency time. Physarum polycephalum also tended to forage for longer in darkened, 'safe' patches. In D. bahiense, engulfment of any food item increased patch residency irrespective of that food item's quality. Exposure to light had no effect on the patch-residency time of D. bahiense. Given that these organisms lack a brain, our results illustrate how the use of simple heuristics can give the impression that individuals make sophisticated foraging decisions. © 2015. Published by The Company of Biologists Ltd.

Assessing Mental Models of Emergencies Through Two Knowledge Elicitation Tasks.

Science.gov (United States)

Whitmer, Daphne E; Sims, Valerie K; Torres, Michael E

2017-05-01

The goals of this study were to assess the risk identification aspect of mental models using standard elicitation methods and how university campus alerts were related to these mental models. People fail to follow protective action recommendations in emergency warnings. Past research has yet to examine cognitive processes that influence emergency decision-making. Study 1 examined 2 years of emergency alerts distributed by a large southeastern university. In Study 2, participants listed emergencies in a thought-listing task. Study 3 measured participants' time to decide if a situation was an emergency. The university distributed the most alerts about an armed person, theft, and fire. In Study 2, participants most frequently listed fire, car accident, heart attack, and theft. In Study 3, participants quickly decided a bomb, murder, fire, tornado, and rape were emergencies. They most slowly decided that a suspicious package and identify theft were emergencies. Recent interaction with warnings was only somewhat related to participants' mental models of emergencies. Risk identification precedes decision-making and applying protective actions. Examining these characteristics of people's mental representations of emergencies is fundamental to further understand why some emergency warnings go ignored. Someone must believe a situation is serious to categorize it as an emergency before taking the protective action recommendations in an emergency warning. Present-day research must continue to examine the problem of people ignoring warning communication, as there are important cognitive factors that have not yet been explored until the present research.

The Business Emergency Operations Center (BEOC) - A Model for Inter-Agency and Inter-Sector Communication and Collaboration

Science.gov (United States)

2011-06-01

of Observe, Orient, Decide, Act (OODA) and Sense, Interpret, Decide, Act ( SIDA ) loops is important to understand and research as part of this...C2 process loops, OODA, developed by John Boyd, (Coram 2002, Lind 1985) and/or SIDA , (Haeckel 2001) are functioning at multiple levels and the...model of C2 is grounded in OODA and SIDA loops addressed earlier in this paper. During exercises, the salient activity of moving through the process

Factors associated with utilization of long-acting and permanent contraceptive methods among women who have decided not to have more children in Gondar city.

Science.gov (United States)

Zenebe, Chernet Baye; Adefris, Mulat; Yenit, Melaku Kindie; Gelaw, Yalemzewod Assefa

2017-09-06

Despite the fact that long acting family planning methods reduce population growth and improve maternal health, their utilization remains poor. Therefore, this study assessed the prevalence of long acting and permanent family planning method utilization and associated factors among women in reproductive age groups who have decided not to have more children in Gondar city, northwest Ethiopia. An institution based cross-sectional study was conducted from August to October, 2015. Three hundred seventeen women who have decided not to have more children were selected consecutively into the study. A structured and pretested questionnaire was used to collect data. Both bivariate and multi-variable logistic regressions analyses were used to identify factors associated with utilization of long acting and permanent family planning methods. The multi-variable logistic regression analysis was used to investigate factors associated with the utilization of long acting and permanent family planning methods. The Adjusted Odds Ratio (AOR) with the corresponding 95% Confidence Interval (CI) was used to show the strength of associations, and variables with a P-value of <0.05 were considered statistically significant. In this study, the overall prevalence of long acting and permanent contraceptive (LAPCM) method utilization was 34.7% (95% CI: 29.5-39.9). According to the multi-variable logistic regression analysis, utilization of long acting and permanent contraceptive methods was significantly associated with women who had secondary school, (AOR: 2279, 95% CI: 1.17, 4.44), college, and above education (AOR: 2.91, 95% CI: 1.36, 6.24), history of previous utilization (AOR: 3.02, 95% CI: 1.69, 5.38), and information about LAPCM (AOR: 8.85, 95% CI: 2.04, 38.41). In this study the prevalence of long acting and permanent family planning method utilization among women who have decided not to have more children was high compared with previous studies conducted elsewhere. Advanced educational

Evaluating the systematic implementation of the 'Let Me Decide' advance care planning programme in long term care through focus groups: staff perspectives.

LENUS (Irish Health Repository)

Cornally, Nicola

2015-11-01

The \\'Let Me Decide\\' Advance Care Planning (LMD-ACP) programme offers a structured approach to End-of-Life (EoL) care planning in long-term care for residents with and without capacity to complete an advance care directive\\/plan. The programme was implemented in three homes in the South of Ireland, with a view to improving quality of care at end of life. This paper will present an evaluation of the systematic implementation of the LMD-ACP programme in the homes.

Assessment of the meat quality of lamb M. longissimus thoracis et lumborum and M. triceps brachii following three different Halal slaughter procedures.

Science.gov (United States)

Danso, A S; Richardson, R I; Khalid, R

2017-05-01

A total of fifteen male and fifteen female lambs were allocated to three groups of ten animals and subjected to: traditional Halal slaughter without stunning (TNS); slaughter following electric head-only stunning (EHOS) or; post-cut electric head-only stun (PCEHOS) and their meat quality was determined. Instrumental and sensory analyses were carried out on two muscles; M. longissimus thoracis et lumborum (LTL) and M. triceps brachii (TB). Additionally, the effects of sex and muscle type were also assessed. No differences were found among slaughter methods for pH, drip loss and shear force. TB had a higher pHu and was more tender than LTL. Muscles from EHOS and PCEHOS lambs discoloured more quickly than TNS muscles. There were no differences in the measured sensory attributes, with the exception of EHOS meat being tougher than PCEHOS and TNS meat. This study showed that the three slaughter methods had no substantial effect on lamb meat quality. Copyright © 2017 Elsevier Ltd. All rights reserved.

Proceedings of 1991-workshops of the working group on 'Development and application of facilities for low temperature irradiation as well as controlled irradiation'

International Nuclear Information System (INIS)

Kuramoto, Eiichi; Okada, Moritami

1992-09-01

This is the proceedings of 1991-workshops of the working group on 'Development and Application of Facilities for Low Temperature Irradiation as well as Controlled Irradiation' held at the Research Reactor Institute of Kyoto University on July 25, 1991 and on February 28, 1992. In the present proceedings, it is emphasized that the study of radiation damages in various materials must be performed under carefully controlled irradiation conditions (irradiation temperature, neutron spectrum and so forth) during reactor irradiations. Especially, it is pointed out that a middle scale reactor such as KUR is suitable for the precise control of neutron spectra. Several remarkable results, which are made through experiments using the Low Temperature Irradiation Facility in KUR (KUR-LTL), are reported. Also, possible advanced research programs are discussed including the worldwide topics on the radiation damages in metals, semi-conductors and also insulators. Further, the present status of KUR-LTL is reported and the advanced plan of the facility is proposed. (author)

Reduced telomere length is not associated with early signs of vascular aging in young men born after intrauterine growth restriction: a paradox?

DEFF Research Database (Denmark)

Laganovic, M.; Bendix, L.; Rubelj, I.

2014-01-01

Objective: The mechanisms that increase cardiovascular risk in individuals born small for gestational age (SGA) are not well understood. Telomere shortening has been suggested to be a predictor of disease onset. Our aim was to determine whether impaired intrauterine growth is associated with earl...... of cardiovascular risk in SGA participants. Follow-up of this cohort will clarify hypothesis and validate telomere dynamics as indicators of future health risks.......Objective: The mechanisms that increase cardiovascular risk in individuals born small for gestational age (SGA) are not well understood. Telomere shortening has been suggested to be a predictor of disease onset. Our aim was to determine whether impaired intrauterine growth is associated with early......IMT, and a trend to increased SBP and heart rate in comparison to the AGA group. Interestingly, SGA men exhibited a 42% longer LTL than the AGA group. LTL was inversely associated with age, BMI, BP and birth parameters. In multiple regression analysis, BMI was the key determinant of SBP and cIMT. Conclusion: Young...

On quantum models of the human mind.

Science.gov (United States)

Wang, Hongbin; Sun, Yanlong

2014-01-01

Recent years have witnessed rapidly increasing interests in developing quantum theoretical models of human cognition. Quantum mechanisms have been taken seriously to describe how the mind reasons and decides. Papers in this special issue report the newest results in the field. Here we discuss why the two levels of commitment, treating the human brain as a quantum computer and merely adopting abstract quantum probability principles to model human cognition, should be integrated. We speculate that quantum cognition models gain greater modeling power due to a richer representation scheme. Copyright © 2013 Cognitive Science Society, Inc.

A Behavioral Decision Making Modeling Approach Towards Hedging Services

NARCIS (Netherlands)

Pennings, J.M.E.; Candel, M.J.J.M.; Egelkraut, T.M.

2003-01-01

This paper takes a behavioral approach toward the market for hedging services. A behavioral decision-making model is developed that provides insight into how and why owner-managers decide the way they do regarding hedging services. Insight into those choice processes reveals information needed by

Samba for solar modules. Brazil decides reimbursement strategy and starts pilot projects; Samba fuer Solarmodule. Brasilien macht den Weg fuer die Einspeisung von Solarstrom frei und startet Pilotprojekte

Energy Technology Data Exchange (ETDEWEB)

Rosell, Alejandro Diego

2012-06-15

Better late than never: After long years of discussion, Brazil recently decided on a reimbursement strategy. Further, pilot projects with a total of 24 MW are in te planning stage. While some expect a major invitation for tender, local experts warn of rough times ahead.

The RERS 2017 Challenge and Workshop

NARCIS (Netherlands)

Jasper, Marc; Fecke, Maximilian; Steffen, Bernhard; Schordan, Markus; Meijer, Jeroen; Pol, Jaco van de; Howar, Falk; Siegel, Stephen F.

RERS is an annual verification challenge that focuses on LTL and reachability properties of reactive systems. In 2017, RERS was extended to a one day workshop that in addition to the original challenge program also featured an invited talk about possible future developments. As a satellite of ISSTA

Higher circulating levels of IGF-1 are associated with longer leukocyte telomere length in healthy subjects

DEFF Research Database (Denmark)

Barbieri, Michelangela; Paolisso, Giuseppe; Kimura, Masayuki

2009-01-01

Mutations that inhibit the insulin-like growth factor-1 (IGF-1) extend the lifespan of worms, flies and mice. However, it appears that relatively low circulating levels of IGF-1 in humans are associated with aging-related diseases and diminished longevity. As leukocyte telomere length (LTL) is os...

MTL-Model Checking of One-Clock Parametric Timed Automata is Undecidable

Directory of Open Access Journals (Sweden)

Karin Quaas

2014-03-01

Full Text Available Parametric timed automata extend timed automata (Alur and Dill, 1991 in that they allow the specification of parametric bounds on the clock values. Since their introduction in 1993 by Alur, Henzinger, and Vardi, it is known that the emptiness problem for parametric timed automata with one clock is decidable, whereas it is undecidable if the automaton uses three or more parametric clocks. The problem is open for parametric timed automata with two parametric clocks. Metric temporal logic, MTL for short, is a widely used specification language for real-time systems. MTL-model checking of timed automata is decidable, no matter how many clocks are used in the timed automaton. In this paper, we prove that MTL-model checking for parametric timed automata is undecidable, even if the automaton uses only one clock and one parameter and is deterministic.

Robust Satisficing Decision Making for Unmanned Aerial Vehicle Complex Missions under Severe Uncertainty.

Directory of Open Access Journals (Sweden)

Xiaoting Ji

Full Text Available This paper presents a robust satisficing decision-making method for Unmanned Aerial Vehicles (UAVs executing complex missions in an uncertain environment. Motivated by the info-gap decision theory, we formulate this problem as a novel robust satisficing optimization problem, of which the objective is to maximize the robustness while satisfying some desired mission requirements. Specifically, a new info-gap based Markov Decision Process (IMDP is constructed to abstract the uncertain UAV system and specify the complex mission requirements with the Linear Temporal Logic (LTL. A robust satisficing policy is obtained to maximize the robustness to the uncertain IMDP while ensuring a desired probability of satisfying the LTL specifications. To this end, we propose a two-stage robust satisficing solution strategy which consists of the construction of a product IMDP and the generation of a robust satisficing policy. In the first stage, a product IMDP is constructed by combining the IMDP with an automaton representing the LTL specifications. In the second, an algorithm based on robust dynamic programming is proposed to generate a robust satisficing policy, while an associated robustness evaluation algorithm is presented to evaluate the robustness. Finally, through Monte Carlo simulation, the effectiveness of our algorithms is demonstrated on an UAV search mission under severe uncertainty so that the resulting policy can maximize the robustness while reaching the desired performance level. Furthermore, by comparing the proposed method with other robust decision-making methods, it can be concluded that our policy can tolerate higher uncertainty so that the desired performance level can be guaranteed, which indicates that the proposed method is much more effective in real applications.

Student understanding of control of variables: Deciding whether or not a variable influences the behavior of a system

Science.gov (United States)

Boudreaux, Andrew; Shaffer, Peter S.; Heron, Paula R. L.; McDermott, Lillian C.

2008-02-01

The ability of adult students to reason on the basis of the control of variables was the subject of an extended investigation. This paper describes the part of the study that focused on the reasoning required to decide whether or not a given variable influences the behavior of a system. The participants were undergraduates taking introductory Physics and K-8 teachers studying physics and physical science in inservice institutes and workshops. Although most of the students recognized the need to control variables, many had significant difficulty with the underlying reasoning. The results indicate serious shortcomings in the preparation of future scientists and in the education of a scientifically literate citizenry. There are also strong implications for the professional development of teachers, many of whom are expected to teach control of variables to young students.

Automata-Based CSL Model Checking

DEFF Research Database (Denmark)

Zhang, Lijun; Jansen, David N.; Nielson, Flemming

2011-01-01

For continuous-time Markov chains, the model-checking problem with respect to continuous-time stochastic logic (CSL) has been introduced and shown to be decidable by Aziz, Sanwal, Singhal and Brayton in 1996. The presented decision procedure, however, has exponential complexity. In this paper, we...... probability can then be approximated in polynomial time (using uniformization). This makes the present work the centerpiece of a broadly applicable full CSL model checker. Recently, the decision algorithm by Aziz et al. was shown to be incorrect in general. In fact, it works only for stratified CTMCs...

Exploring Yellowstone National Park with Mathematical Modeling

Science.gov (United States)

Wickstrom, Megan H.; Carr, Ruth; Lackey, Dacia

2017-01-01

Mathematical modeling, a practice standard in the Common Core State Standards for Mathematics (CCSSM) (CCSSI 2010), is a process by which students develop and use mathematics as a tool to make sense of the world around them. Students investigate a real-world situation by asking mathematical questions; along the way, they need to decide how to use…

Characterizing economic trends by Bayesian stochastic model specifi cation search

OpenAIRE

Grassi, Stefano; Proietti, Tommaso

2010-01-01

We apply a recently proposed Bayesian model selection technique, known as stochastic model specification search, for characterising the nature of the trend in macroeconomic time series. We illustrate that the methodology can be quite successfully applied to discriminate between stochastic and deterministic trends. In particular, we formulate autoregressive models with stochastic trends components and decide on whether a specific feature of the series, i.e. the underlying level and/or the rate...

Citizen Views on Punishment: the Difference between Talking and Deciding

Directory of Open Access Journals (Sweden)

Maria Ines Bergoglio

2016-06-01

Full Text Available In 2004, the Province of Córdoba, Argentina implemented lay participation in criminal decisions by means of Law 9182. The law was passed within a context of national debate concerning efficient measures to fight against insecurity and crime. These debates were brought about by a social movement led by Juan Carlos Blumberg, which demanded harsher penalties and judicial reform as means to improve urban safety.Data obtained in two public opinions studies, conducted in 1993 and 2011, are used to analyze trends in attitudes towards criminal punishment, including issues such as the image of criminals or opinions on capital punishment. The revision also includes the influence of the fear of crime on attitudes towards punishment.The analysis of citizen views on punishment extends beyond public opinion data to the judicial field, reviewing how these views are expressed during jury service. Using a set of 213 sentences decided between 2005 and 2012, juror and judge decisions on the same cases are compared. En 2004, la provincia de Córdoba, Argentina, estableció la participación ciudadana en las decisiones penales por medio de la ley 9182. La ley fue aprobada en el contexto de un debate nacional sobre las medidas más eficientes para luchar contra la inseguridad y el delito, impulsados por un movimiento social liderado por Juan Carlos Blumberg. Las demandas de este movimiento incluían endurecimiento penal y reforma judicial, entendidos como medios para mejorar la seguridad.Empleando datos de encuesta de población general recogidos en 1993 y 2011, el artículo analiza las tendencias en actitudes hacia el castigo penal, incluyendo temas como la imagen de los delincuentes y las opiniones sobre la pena de muerte. Se revisa especialmente la influencia de la sensación de inseguridad sobre las actitudes respecto del castigo.El análisis de las actitudes ciudadanas ante el castigo se extiende hacia el terreno judicial, revisando la dureza de las decisiones

A model of the precaution adoption process: evidence from home radon testing

International Nuclear Information System (INIS)

Weinstein, N.D.; Sandman, P.M.

1992-01-01

The authors present the precaution adoption process model--a stage theory consisting of seven distinct states between ignorance and completed preventive action. The stages are 'unaware of the issue,' 'aware of the issue but not personally engaged,' 'engaged and deciding what to do,' 'planning to act but not yet having acted,' 'having decided not to act,' 'acting,' and 'maintenance.' The theory asserts that these stages represent qualitatively different patterns of behavior, beliefs, and experience and that the factors that produce transitions between stages vary depending on the specific transition being considered. Data from seven studies of home radon testing are examined to test some of the claims made by this model. Stage theories of protective behavior are contrasted with theories that see precaution adoption in terms of movement along a single continuum of action likelihood.32 references

Model visionary

Energy Technology Data Exchange (ETDEWEB)

Chandler, Graham

2011-03-15

Ken Dedeluk is the president and CEO of Computer Modeling Group (CMG). Dedeluk started his career with Gulf Oil in 1972, worked in computer assisted design; then joined Imperial Esso and Shell, where he became international operations' VP; and finally joined CMG in 1998. CMG made a decision that turned out to be the company's turning point: they decided to provide intensive support and service to their customer to better use their technology. Thanks to this service, their customers' satisfaction grew as well as their revenues.

Application towards the Concept of Rechtsvinding and Rechtsschepping by the Judges in Deciding a Case

Directory of Open Access Journals (Sweden)

Harifin A. Tumpa

2015-08-01

Full Text Available The judge may not refuse to examine and to decide a case which has been submitted to the court despite having unclear or non-existent legal pretext. The judge are expected to be able to explore values and sense of justice that grows and embodies the community as the living law. The concept of justice here is not the outcome by the human intellectualism, but rather from his/her own spirit. A justice could not exist or be born from a mere theory, because justice is naturally born from the deepest conscience of a judge who is also a human being. A person’s conscience can not come in sudden, but was born through the process, practice or habit. Either legal finding (Rechtsvinding or the creation of law (rechtsschepping should be used in providing justice for litigants as follows: First, in absence of the relevant rules within the existing legislation. Second, regulated by the law but insufficiently clear and contain multi-interpretations. Third, regulated by the law but no longer meet the public sense of justice (out of date. Fourth, based on a jurisprudence or an expert opinion.

Modelling Preference Heterogeneity for Theatre Tickets

DEFF Research Database (Denmark)

Baldin, Andrea; Bille, Trine

2018-01-01

This article analyses the behavioural choice for theatre tickets using a rich data set for 2010–2013 from the sale system of the Royal Danish National Theatre. A consumer who decides to attend a theatre production faces multiple sources of price variation that involves a choice by the consumer...... among different ticket alternatives. Three modelling approaches are proposed in order to model ticket purchases: conditional logit with socio-demographic characteristics, nested logit and latent class. These models allow us explicitly to take into account consumers’ preference heterogeneity with respect...... of behaviour in the choice of theatre ticket....

A Problem-Solving Model for Literacy Coaching Practice

Science.gov (United States)

Toll, Cathy A.

2017-01-01

Literacy coaches are more effective when they have a clear plan for their collaborations with teachers. This article provides details of such a plan, which involves identifying a problem, understanding the problem, deciding what to do differently, and trying something different. For each phase of the problem-solving model, there are key tasks for…

Hydrogen Temperature-Programmed Desorption (H2 TPD) of Supported Platinum Catalysts.

NARCIS (Netherlands)

Koningsberger, D.C.; Miller, J.T.; Meyers, B.L.; Modica, F.S.; Lane, G.S.; Vaarkamp, M.

1993-01-01

Hydrogen temperature-programmed desorption (TPD) of supported platinum catalysts, Pt/KLTL, Pt/H-LTL, Pt/K-MAZ, Pt/H-MAZ, Pt/-Al2O3, and Pt/SiO2, was performed after hydrogen reduction at 300, 450, or 650°C. For all catalysts, reversible desorption of chemisorbed hydrogen occurred at approximately

Implicit and Explicit Memory for Affective Passages in Temporal Lobectomy Patients

Science.gov (United States)

Burton, Leslie A.; Rabin, Laura; Vardy, Susan Bernstein; Frohlich, Jonathan; Porter, Gwinne Wyatt; Dimitri, Diana; Cofer, Lucas; Labar, Douglas

2008-01-01

Eighteen temporal lobectomy patients (9 left, LTL; 9 right, RTL) were administered four verbal tasks, an Affective Implicit Task, a Neutral Implicit Task, an Affective Explicit Task, and a Neutral Explicit Task. For the Affective and Neutral Implicit Tasks, participants were timed while reading aloud passages with affective or neutral content,…

COMPARING OF DEPOSIT MODEL AND LIFE INSURANCE MODEL IN MACEDONIA

Directory of Open Access Journals (Sweden)

TATJANA ATANASOVA-PACHEMSKA

2016-02-01

Full Text Available In conditions of the continuous decline of the interest rates for bank deposits, and at a time when uncertainty about the future is increasing, physical and legal persons have doubts how to secure their future or how and where to invest their funds and thus to “fertilize” and increase their savings. Individuals usually choose to put their savings in the bank for a certain period, and for that period to receive certain interest, or decide to invest their savings in different types of life insurance and thus to "take care" of their life, their future and the future of their families. In mathematics are developed many models that relate to the compounding and the insurance. This paper is a comparison of the deposit model and the model of life insurance

Automated Formal Verification for PLC Control Systems

CERN Multimedia

Fernández Adiego, Borja

2014-01-01

Programmable Logic Controllers (PLCs) are widely used devices used in industrial control systems. Ensuring that the PLC software is compliant with its specification is a challenging task. Formal verification has become a recommended practice to ensure the correctness of the safety-critical software. However, these techniques are still not widely applied in industry due to the complexity of building formal models, which represent the system and the formalization of requirement specifications. We propose a general methodology to perform automated model checking of complex properties expressed in temporal logics (e.g. CTL, LTL) on PLC programs. This methodology is based on an Intermediate Model (IM), meant to transform PLC programs written in any of the languages described in the IEC 61131-3 standard (ST, IL, etc.) to different modeling languages of verification tools. This approach has been applied to CERN PLC programs validating the methodology.

Adapting the SCOR model to suit the military: A South African example

CSIR Research Space (South Africa)

Bean, WL

2009-09-01

Full Text Available of military supply chains, therefore it was decided that supply chain management in conjunction with the SCOR model should be used during a logistics and supply chain improvement project for the South African National Defence Force (SANDF). Three case studies...

Perinatal postmortems: what is important to parents and how do they decide?

Science.gov (United States)

Breeze, Andrew C G; Statham, Helen; Hackett, Gerald A; Jessop, Flora A; Lees, Christoph C

2012-03-01

Falling consent rates for postmortems, regardless of age of death, have been widely reported in recent years. The aim of this study was to explore parental attitudes to, and decision-making about, a perinatal postmortem after termination for fetal abnormality, late miscarriage, or stillbirth. A prospective self-completion questionnaire was given to 35 women and their partners. The participants had experienced second or third trimester pregnancy loss in a single fetal medicine and delivery unit in the United Kingdom and were making decisions about having a postmortem. They were asked to complete a questionnaire about their attitudes to, and expectations of, a perinatal postmortem. Thirty-one questionnaires were received from parents of 17 babies (49% of those asked; 16 from mothers, 15 from fathers). Parents of nine babies (53%) said they would agree to a full postmortem, of three babies to a limited postmortem, and of four babies to an external examination only; one couple were undecided. The most important issues for the parents in this study that related to their decisions about a postmortem centered on the need for information, both for future planning and about what had happened. Moderately important issues related to altruism, which is, improving medical knowledge and helping other parents experiencing similar bereavement. Among the lowest scoring issues were potential barriers, such as concerns about cultural or religious acceptability of a postmortem, funeral delays, and what would happen to the baby's body. Bereaved parents who participated in this study, where postmortem consent rates were relatively high, thought that their need for knowledge eclipsed assumed barriers when deciding whether or not to have a postmortem for their baby. © 2012, Copyright the Authors. Journal compilation © 2012, Wiley Periodicals, Inc.

Computer-Aided Detection of Rapid, Overt, Airborne, Reconnaissance Data with the Capability of Removing Oceanic Noises

Science.gov (United States)

2013-12-01

dl--NA’u•-.llw l"\\l;t.l"t, "’’"~r~ll•t• ·•~r•d "’lcottt~ry oaf"!’@ 11\\•ol\\dorwu"’ Mtb! .ctv• titA Mourtd 1Nl..en.ce l’llntell•eR ~ltl4.nftUt!rlc

A large-scale multi-species spatial depletion model for overwintering waterfowl

NARCIS (Netherlands)

Baveco, J.M.; Kuipers, H.; Nolet, B.A.

2011-01-01

In this paper, we develop a model to evaluate the capacity of accommodation areas for overwintering waterfowl, at a large spatial scale. Each day geese are distributed over roosting sites. Based on the energy minimization principle, the birds daily decide which surrounding fields to exploit within

Efficient model checking for duration calculus based on branching-time approximations

DEFF Research Database (Denmark)

Fränzle, Martin; Hansen, Michael Reichhardt

2008-01-01

Duration Calculus (abbreviated to DC) is an interval-based, metric-time temporal logic designed for reasoning about embedded real-time systems at a high level of abstraction. But the complexity of model checking any decidable fragment featuring both negation and chop, DC's only modality, is non...

A Model Based Control methodology combining Blade Pitch and Adaptive Trailing Edge Flaps in a common framework

DEFF Research Database (Denmark)

Henriksen, Lars Christian; Bergami, Leonardo; Andersen, Peter Bjørn

2013-01-01

This work investigates how adaptive trailing edge flaps and classical blade pitch can work in concert using a model-based state space control formulation. The trade-off between load reduction and actuator activity is decided by setting different weights in the objective function used by the model...

A Model Based Control methodology combining Blade Pitch and Adaptive Trailing Edge Flaps in a common framework

DEFF Research Database (Denmark)

This work investigates how adaptive trailing edge flaps and classical blade pitch can work in concert using a model-based state space control formulation. The trade-off between load reduction and actuator activity is decided by setting different weights in the objective function used by the model...

The LifeCycle model

DEFF Research Database (Denmark)

Krink, Thiemo; Løvbjerg, Morten

2002-01-01

genetic algorithms (GAs), particle swarm optimisation (PSOs), and stochastic hill climbing to create a generally well-performing search heuristics. In the LifeCycle model, we consider candidate solutions and their fitness as individuals, which, based on their recent search progress, can decide to become...... either a GA individual, a particle of a PSO, or a single stochastic hill climber. First results from a comparison of our new approach with the single search algorithms indicate a generally good performance in numerical optimization....

Formal verification of complex properties on PLC programs

CERN Document Server

Darvas, D; Voros, A; Bartha, T; Blanco Vinuela, E; Gonzalez Suarez, V M

2014-01-01

Formal verification has become a recommended practice in the safety-critical application areas. However, due to the complexity of practical control and safety systems, the state space explosion often prevents the use of formal analysis. In this paper we extend our former verification methodology with effective property preserving reduction techniques. For this purpose we developed general rule-based reductions and a customized version of the Cone of Influence (COI) reduction. Using these methods, the verification of complex requirements formalised with temporal logics (e.g. CTL, LTL) can be orders of magnitude faster. We use the NuSMV model checker on a real-life PLC program from CERN to demonstrate the performance of our reduction techniques.

A two-factor, stochastic programming model of Danish mortgage-backed securities

DEFF Research Database (Denmark)

Nielsen, Søren S.; Poulsen, Rolf

2004-01-01

-trivial, both in terms of deciding on an initial mortgage, and in terms of managing (rebalancing) it optimally.We propose a two-factor, arbitrage-free interest-rate model, calibrated to observable security prices, and implement on top of it a multi-stage, stochastic optimization program with the purpose...

Adolescents with a diagnosis of anorexia nervosa: parents' experience of recognition and deciding to seek help.

Science.gov (United States)

Thomson, Samuel; Marriott, Michael; Telford, Katherine; Law, Hou; McLaughlin, Jo; Sayal, Kapil

2014-01-01

Adolescents with anorexia nervosa rarely present themselves as having a problem and are usually reliant on parents to recognise the problem and facilitate help-seeking. This study aimed to investigate parents' experiences of recognising that their child had an eating problem and deciding to seek help. A qualitative study with interpretative phenomenological analysis applied to semi-structured interviews with eight parents of adolescents with a diagnosis of anorexia nervosa. Parents commonly attributed early signs of anorexia nervosa to normal adolescent development and they expected weight loss to be short-lived. As parents' suspicions grew, close monitoring exposing their child's secretive attempts to lose weight and the use of internet searches aided parental recognition of the problem. They avoided using the term anorexia as it made the problem seem 'real'. Following serial unsuccessful attempts to effect change, parental fear for their child's life triggered a desire for professional help. Parents require early advice and support to confirm their suspicions that their child might have anorexia nervosa. Since parents commonly approach the internet for guidance, improving awareness of useful and accurate websites could reduce delays in help-seeking.

Function of One Regular Separable Relation Set Decided for the Minimal Covering in Multiple Valued Logic

Directory of Open Access Journals (Sweden)

Liu Yu Zhen

2016-01-01

Full Text Available Multiple-valued logic is an important branch of the computer science and technology. Multiple-valued logic studies the theory, multiple-valued circuit & multiple-valued system, and the applications of multiple-valued logic included.In the theory of multiple-valued logic, one primary and important problem is the completeness of function sets, which can be solved depending on the decision for all the precomplete sets(also called maximal closed sets of K-valued function sets noted by PK*, and another is the decision for Sheffer function, which can be totally solved by picking out all of the minimal covering of the precomplete sets. In the function structure theory of multi-logic, decision on Sheffer function is an important role. It contains structure and decision of full multi-logic and partial multi-logic. Its decision is closely related to decision of completeness of function which can be done by deciding the minimal covering of full multi-logic and partial-logic. By theory of completeness of partial multi-logic, we prove that function of one regular separable relation is not minimal covering of PK* under the condition of m = 2, σ = e.

Licensing method for new nuclear power plant: A study on decision making modeling

Energy Technology Data Exchange (ETDEWEB)

Ramli, N; Ohaga, E. O.; Jung, J. C. [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

2012-10-15

This work provides a study on decision making modeling for a licensing method of a new nuclear power plant. SWOT analysis provides the licensing alternatives attributes, then the expectation from either COL or two step licensing method is decided by inputting the output from the Hurwitz mathematical model. From the analysis, COL shows the best candidate for both optimistic and pessimistic conditions.

Licensing method for new nuclear power plant: A study on decision making modeling

International Nuclear Information System (INIS)

Ramli, N; Ohaga, E. O.; Jung, J. C.

2012-01-01

This work provides a study on decision making modeling for a licensing method of a new nuclear power plant. SWOT analysis provides the licensing alternatives attributes, then the expectation from either COL or two step licensing method is decided by inputting the output from the Hurwitz mathematical model. From the analysis, COL shows the best candidate for both optimistic and pessimistic conditions

Accurate lithography simulation model based on convolutional neural networks

Science.gov (United States)

Watanabe, Yuki; Kimura, Taiki; Matsunawa, Tetsuaki; Nojima, Shigeki

2017-07-01

Lithography simulation is an essential technique for today's semiconductor manufacturing process. In order to calculate an entire chip in realistic time, compact resist model is commonly used. The model is established for faster calculation. To have accurate compact resist model, it is necessary to fix a complicated non-linear model function. However, it is difficult to decide an appropriate function manually because there are many options. This paper proposes a new compact resist model using CNN (Convolutional Neural Networks) which is one of deep learning techniques. CNN model makes it possible to determine an appropriate model function and achieve accurate simulation. Experimental results show CNN model can reduce CD prediction errors by 70% compared with the conventional model.

Model for Refurbishment of Heritage Buildings

DEFF Research Database (Denmark)

Rasmussen, Torben Valdbjørn

2014-01-01

the Heritage Agency, the Danish Working Environment Authority and the owner as a team cooperated in identifying feasible refurbishments. In this case, the focus centered on restoring and identifying potential energy savings and deciding on energy upgrading measures for the listed complex. The refurbished...... with the requirements for the use of the building. The model focuses on the cooperation and dialogue between authorities and owners, who refurbish heritage buildings. The developed model was used for the refurbishment of the listed complex, Fæstningens Materialgård. Fæstningens Materialgård is a case study where...

On competition in a Stackelberg location-design model with deterministic supplier choice

NARCIS (Netherlands)

Hendrix, E.M.T.

2016-01-01

We study a market situation where two firms maximize market capture by deciding on the location in the plane and investing in a competing quality against investment cost. Clients choose one of the suppliers; i.e. deterministic supplier choice. To study this situation, a game theoretic model is

Model evaluation methodology applicable to environmental assessment models

International Nuclear Information System (INIS)

Shaeffer, D.L.

1979-08-01

A model evaluation methodology is presented to provide a systematic framework within which the adequacy of environmental assessment models might be examined. The necessity for such a tool is motivated by the widespread use of models for predicting the environmental consequences of various human activities and by the reliance on these model predictions for deciding whether a particular activity requires the deployment of costly control measures. Consequently, the uncertainty associated with prediction must be established for the use of such models. The methodology presented here consists of six major tasks: model examination, algorithm examination, data evaluation, sensitivity analyses, validation studies, and code comparison. This methodology is presented in the form of a flowchart to show the logical interrelatedness of the various tasks. Emphasis has been placed on identifying those parameters which are most important in determining the predictive outputs of a model. Importance has been attached to the process of collecting quality data. A method has been developed for analyzing multiplicative chain models when the input parameters are statistically independent and lognormally distributed. Latin hypercube sampling has been offered as a promising candidate for doing sensitivity analyses. Several different ways of viewing the validity of a model have been presented. Criteria are presented for selecting models for environmental assessment purposes

p-values for model evaluation

International Nuclear Information System (INIS)

Beaujean, F.; Caldwell, A.; Kollar, D.; Kroeninger, K.

2011-01-01

Deciding whether a model provides a good description of data is often based on a goodness-of-fit criterion summarized by a p-value. Although there is considerable confusion concerning the meaning of p-values, leading to their misuse, they are nevertheless of practical importance in common data analysis tasks. We motivate their application using a Bayesian argumentation. We then describe commonly and less commonly known discrepancy variables and how they are used to define p-values. The distribution of these are then extracted for examples modeled on typical data analysis tasks, and comments on their usefulness for determining goodness-of-fit are given.

MODELS CONCERNING PREVENTIVE VERIFICATION OF TECHNICAL EQUIPMENT

Directory of Open Access Journals (Sweden)

CÂRLAN M.

2016-12-01

Full Text Available The paper presents three operative models whose purpose is to improve the practice of preventive maintenance to a wide range of technical installations. Although the calculation criteria are different, the goal is the same: to determine the optimum time between two consecutive preventive interventions. The optimum criteria of these models are: - the maximum share of technical entity operating probabilities, in the case of the Ackoff - Sasieni [1] method; -the optimum time interval for preventive verification depending on the preventive-corrective maintenance costs imposed by the deciding factor, for the AsturioBaldin [2] model; - the minimum number of renewals – preventive and/or corrective maintenance operations [3

On Deciding How to Decide: To Centralize or Decentralize.

Science.gov (United States)

Chaffee, Ellen Earle

Issues concerning whether to centralize or decentralize decision-making are addressed, with applications for colleges. Centralization/decentralization (C/D) must be analyzed with reference to a particular decision. Three components of C/D are locus of authority, breadth of participation, and relative contribution by the decision-maker's staff. C/D…

Trade and Variety in a Model of Endogenous Product Differentiation

OpenAIRE

Oliver Lorz; Matthias Wrede

2009-01-01

This paper sets up a model of endogenous product differentiation to analyze the variety effects of international trade. In our model multi-product firms decide not only about the number of varieties they supply but also about the degree of horizontal differentiation between these varieties. Firms can raise the degree of differentiation by investing variety-specific fixed costs. In this setting, we analyze how trade integration, i.e. an increase in market size, influences the number of firms i...

Kalman-filter model for determining block and trickle SNM losses

International Nuclear Information System (INIS)

Barlow, R.E.; Durst, M.J.; Smiriga, N.G.

1982-07-01

This paper describes an integrated decision procedure for deciding whether a diversion of SNM has occurred. Two possible types of diversion are considered: a block loss during a single time period and a cumulative trickle loss over several time periods. The methodology used is based on a compound Kalman filter model. Numerical examples illustrate our approach

MOTORCYCLE CRASH PREDICTION MODEL FOR NON-SIGNALIZED INTERSECTIONS

Directory of Open Access Journals (Sweden)

S. HARNEN

2003-01-01

Full Text Available This paper attempts to develop a prediction model for motorcycle crashes at non-signalized intersections on urban roads in Malaysia. The Generalized Linear Modeling approach was used to develop the model. The final model revealed that an increase in motorcycle and non-motorcycle flows entering an intersection is associated with an increase in motorcycle crashes. Non-motorcycle flow on major road had the greatest effect on the probability of motorcycle crashes. Approach speed, lane width, number of lanes, shoulder width and land use were also found to be significant in explaining motorcycle crashes. The model should assist traffic engineers to decide the need for appropriate intersection treatment that specifically designed for non-exclusive motorcycle lane facilities.

Genome-wide meta-analysis points to CTC1 and ZNF676 as genes regulating telomere homeostasis in humans

DEFF Research Database (Denmark)

Mangino, Massimo; Hwang, Shih-Jen; Spector, Timothy D

2012-01-01

(-8)). We also identified two novel genomic regions associated with LTL variation that map near a conserved telomere maintenance complex component 1 (CTC1; rs3027234, P = 3.6 × 10(-8)) on chromosome17p13.1 and zinc finger protein 676 (ZNF676; rs412658, P = 3.3 × 10(-8)) on 19p12. The minor allele of rs...

Modeling irradiation embrittlement in reactor pressure vessel steels

International Nuclear Information System (INIS)

Odette, G.R.

1998-01-01

As a result of the popularity of the Agencies report 'Neutron Irradiation Embrittlement of Reactor Pressure Vessel Steels' of 1975, it was decided that another report on this broad subject would be of use. In this report, background and contemporary views on specially identified areas of the subject are considered as self-contained chapters, written by experts. In chapter 10, numerical modeling of irradiation embrittlement in reactor vessel steels are introduced. Physically-based models are developed and their role in advancing the state-of-the-art of predicting irradiation embrittlement of RPV steels is stressed

Deciding on Science: An Analysis of Higher Education Science Student Major Choice Criteria

Science.gov (United States)

White, Stephen Wilson

The number of college students choosing to major in science, technology, engineering, and math (STEM) in the United States affects the size and quality of the American workforce (Winters, 2009). The number of graduates in these academic fields has been on the decline in the United States since the 1960s, which, according to Lips and McNeil (2009), has resulted in a diminished ability of the United States to compete in science and engineering on the world stage. The purpose of this research was to learn why students chose a STEM major and determine what decision criteria influenced this decision. According to Ajzen's (1991) theory of planned behavior (TPB), the key components of decision-making can be quantified and used as predictors of behavior. In this study the STEM majors' decision criteria were compared between different institution types (two-year, public four-year, and private four-year), and between demographic groups (age and sex). Career, grade, intrinsic, self-efficacy, and self-determination were reported as motivational factors by a majority of science majors participating in this study. Few students reported being influenced by friends and family when deciding to major in science. Science students overwhelmingly attributed the desire to solve meaningful problems as central to their decision to major in science. A majority of students surveyed credited a teacher for influencing their desire to pursue science as a college major. This new information about the motivational construct of the studied group of science majors can be applied to the previously stated problem of not enough STEM majors in the American higher education system to provide workers required to fill the demand of a globally STEM-competitive United States (National Academy of Sciences, National Academy of Engineering, & Institute of Medicine, 2010).

Como o povo decide seu voto? Um estudo de caso do comportamento do eleitor [doi: 10.5329/RECADM.2013011

Directory of Open Access Journals (Sweden)

Marcos Ferreira Santos

2013-09-01

Full Text Available Esse estudo tem por objetivo investigar o comportamento do eleitor na escolha do candidato e do partido. A revisão bibliográfica trata das abordagens sobre a formação do comportamento político e opções dos eleitores, segundo fatores econômicos, sociológicos e psicológicos, a partir dos quais se desenvolveu dois modelos conceituais para analise dos pesos dos fatores na escolha do eleitor pelo candidato e partido. Foi realizada uma pesquisa survey na Região Metropolitana de Belo Horizonte em 2010, com 310 eleitores, logo após a eleição de Governador do Estado de Minas Gerais. Os modelos apresentaram pesos significativos na escolha do candidato, nos fatores: a opinião dos amigos/colegas, da família, os eventos correntes e a avaliação do corrente do governo em exercício. A pesquisa contribui para a compreensão dos fatores influentes na decisão pelo voto do eleitor e indica pontos de atenção para a sociedade, pesquisadores, políticos e estabelecimento de estratégicas eleitorais. Sugere-se a replicação dos modelos e métricas adotados em outros pleitos.   Palavras-chave: Comportamento do Eleitor. Voto democrático. Política. Marketing Politico. HOW THE PEOPLE DECIDE THEIR VOTE? A CASE STUDY OF THE VOTER BEHAVIOR Abstract This study has the objective of investigate the vote behavior when choosing candidate and party. The review of the bibliography discusses the approaches to the formation of political behavior and choices of voters, according to economic, sociological and psychological factors, from which it developed two conceptual models to analyze the weights of the factors in the choice of the voter by the candidate and party.  A survey research was conducted in the metropolitan region of Belo Horizonte in 2010, with 310 voters, after the election of the Governor of the State of Minas Gerais. The models showed significant weights related to the selection of the candidate in the following factors: the opinion of friends

A dynamic marketing model with best reply and inertia

International Nuclear Information System (INIS)

Bischi, Gian Italo; Cerboni Baiardi, Lorenzo

2015-01-01

In this paper we consider a nonlinear discrete-time dynamic model proposed by Farris et al. (2005) as a market share attraction model with two firms that decide marketing efforts over time according to best reply strategies with naïve expectations. The model also considers an adaptive adjustment toward best reply, a form of inertia or anchoring attitude, and we investigate the effects of heterogeneities among firms. A rich scenario of local and global bifurcations is obtained even with just two competing firms, and a comparison is proposed with apparently similar duopoly models based on repeated best reply dynamics with naïve expectations and adaptive adjustment.

Enterprise Networks for Competences Exchange: A Simulation Model

Science.gov (United States)

Remondino, Marco; Pironti, Marco; Pisano, Paola

A business process is a set of logically related tasks performed to achieve a defined business and related to improving organizational processes. Process innovation can happen at various levels: incrementally, redesign of existing processes, new processes. The knowledge behind process innovation can be shared, acquired, changed and increased by the enterprises inside a network. An enterprise can decide to exploit innovative processes it owns, thus potentially gaining competitive advantage, but risking, in turn, that other players could reach the same technological levels. Or it could decide to share it, in exchange for other competencies or money. These activities could be the basis for a network formation and/or impact the topology of an existing network. In this work an agent based model is introduced (E3), aiming to explore how a process innovation can facilitate network formation, affect its topology, induce new players to enter the market and spread onto the network by being shared or developed by new players.

Required experimental accuracy to select between supersymmetrical models

Science.gov (United States)

Grellscheid, David

2004-03-01

We will present a method to decide a priori whether various supersymmetrical scenarios can be distinguished based on sparticle mass data alone. For each model, a scan over all free SUSY breaking parameters reveals the extent of that model's physically allowed region of sparticle-mass-space. Based on the geometrical configuration of these regions in mass-space, it is possible to obtain an estimate of the required accuracy of future sparticle mass measurements to distinguish between the models. We will illustrate this algorithm with an example. This talk is based on work done in collaboration with B C Allanach (LAPTH, Annecy) and F Quevedo (DAMTP, Cambridge).

Tinjauan terhadap Model Bisnis Penyelenggaraan Penyiaran Tv Digital

Directory of Open Access Journals (Sweden)

Daniel P. Hutabarat

2014-06-01

Full Text Available TV broadcast systems are migrating from analogue to digital broadcasting system. Some countries in the world have completed this migration since a few years ago. America decided to stop broadcasting analog television in 2009. In Asia, Singapore launched this technology in 2004 and Malaysia implemented in 2006 (Depkominfo, 2009. With so many countries are migrating to digital broadcasting system, there are many business models that can be referred for organizing digital television broadcasts. In this writing, several business models that are used in the world will be reviewed and analyzed and the results can be a reference to determine the appropriate business model according to the organizers.

Electrical measurement of radiation effect in SiC

Energy Technology Data Exchange (ETDEWEB)

Kanazawa, Satoshi; Kamiya, Koji; Kanno, Ikuo [Kyoto Univ. (Japan). Faculty of Engineering] [and others

1996-04-01

For aiming to limited resources and environmental conservations on the Earth, development of controlling element workable under high temperature environment was investigated so as to establish a high grade and optimum controlling system. In order to observe changes of electrical properties before and after irradiation and after annealing, and to investigate changes of carrier concentration and movability after irradiating neutron from reactor and accelerator for the SiC single crystal wafer, elucidation on neutron irradiation effect of SiC as well as finding an optimum method on nuclear conversion injection were investigated. For this reason, SiC surface was purified by its etching and was treated thermally at 1000degC for about 30 min. under argon gas atmosphere after vacuum depositing nickel on it. And then, it was irradiated neutron using Kyoto University reactor (LTL), Linac and University of Tokyo reactor (YAYOI) to measure changes of resistivity using van der Pauw. As a result, it was found that LTL irradiation data was under investigation of measuring method, that in Linac no meaning change was observed because of low irradiation, and that only YAYOI data showed increase of resistivity. (G.K.)

Wrist ligament injuries: value of post-arthrography computed tomography

Energy Technology Data Exchange (ETDEWEB)

Theumann, N.; Schnyder, P.; Meuli, R. [Dept. of Diagnostic and Interventional Radiology, University Hospital, CHUV, Lausanne (Switzerland); Favarger, N. [Clinique Longeraie, Lausanne (Switzerland)

2001-02-01

Objective: To evaluate the use of post-arthrography high-resolution computed tomography in wrist ligament injuries.Design and patients: Thirty-six consecutive patients who had a history and clinical findings suggestive of ligamentous injuries of the wrist were prospectively studied. The findings of three-compartment arthrography and post-arthrography computed tomography (arthro-CT) were compared with those of arthroscopy. The evaluation concentrates on the detection and precise localization of ligament lesions in the triangular fibrocartilage (TFC), the scapholunate ligament (SLL) and the lunotriquetral ligament (LTL).Results: For TFC, SLL and LTL lesions, standard arthrography responded with a sensitivity and specificity of 85% and 100%, 85% and 100%, 80% and 100% respectively, while arthro-CT showed a sensitivity and specificity of 85% and 100%, 100% and 100%, 80% and 100% respectively. The precise localization of the lesions was possible only with arthro-CT.Conclusion: The sensitivity and specificity of standard arthrography and arthro-CT are similar, although the latter shows the site of tears or perforation with greater precision, while conventional arthrography demonstrates them indirectly. This precision is essential and may have clinical implications for the success of treatment procedures. (orig.)

Component Composition Using Feature Models

DEFF Research Database (Denmark)

Eichberg, Michael; Klose, Karl; Mitschke, Ralf

2010-01-01

interface description languages. If this variability is relevant when selecting a matching component then human interaction is required to decide which components can be bound. We propose to use feature models for making this variability explicit and (re-)enabling automatic component binding. In our...... approach, feature models are one part of service specifications. This enables to declaratively specify which service variant is provided by a component. By referring to a service's variation points, a component that requires a specific service can list the requirements on the desired variant. Using...... these specifications, a component environment can then determine if a binding of the components exists that satisfies all requirements. The prototypical environment Columbus demonstrates the feasibility of the approach....

Nutrition pathways in consequence modeling

International Nuclear Information System (INIS)

Tveten, U.

1982-01-01

During 1979-1980 calculations of risk from waste transportation by truck (fire following collision) and fire in temporary storage for waste were performed. A modified version of the consequence model of WASH-1400 (CRAC) was used. Two exposure pathways dominated the results: external exposure from material on the ground and exposure via nutrition. Many of the parameters entering into the nutrition calculations will depend upon local conditions, like soil composition, crop yield, etc. It was decided to collect detailed comments upon the CRAC nutritions model and parameter values from radioecologists in the four Nordic countries. Four alternate sets of parameter values were derived from these comments, and new risk calculations were performed

Research on JD e-commerce's delivery model

Science.gov (United States)

Fan, Zhiguo; Ma, Mengkun; Feng, Chaoying

2017-03-01

E-commerce enterprises represented by JD have made a great contribution to the economic growth and economic development of our country. Delivery, as an important part of logistics, has self-evident importance. By establishing efficient and perfect self-built logistics systems and building good cooperation models with third-party logistics enterprises, e-commerce enterprises have created their own logistics advantages. Characterized by multi-batch and small-batch, e-commerce is much more complicated than traditional transaction. It's not easy to decide which delivery model e-commerce enterprises should adopt. Having e-commerce's logistics delivery as the main research object, this essay aims to find a more suitable logistics delivery model for JD's development.

The Karlsruhe Atmospheric Mesoscale Model KAMM; Das Karlsruher Atmosphaerische Mesoskalige Modell KAMM

Energy Technology Data Exchange (ETDEWEB)

Adrian, G. [Forschungszentrum Karlsruhe GmbH Umwelt und Technik (Germany). Inst. fuer Meteorologie und Klimaforschung]|[Karlsruhe Univ. (T.H.). (Germany). Inst. fuer Meteorologie und Klimaforschung

1998-01-01

The applications of the KAMM model range from real-time simulations over the analysis of mesoscale phenomena and the development of parametrizations to describing climatology. In the course of time, wishes emerged to change essential parts of the original model concept, calling for substantial reprogramming; so it was decided to entirely redraft the dynamic core of KAMM and to program it from the beginning including the parallelization of the code. The paper describes the basics of the new model core. (orig./KW) [Deutsch] Der Anwendungsbereich des KAMM-Modells erstreckt sich von Echtzeitsimulationen, ueber Analyse mesoskaliger Phaenomene, Entwicklung von Parametrisierungen bis hin zur beschreibenden Klimatologie. Weil im Laufe der Entstehungszeit wesentliche Aenderungswuensche des urspruenglichen Konzeptes entstanden sind, die eine Neuprogrammierung in wesentlichen Teilen erforderlich erscheinen lassen, wurde entschieden, den dynamischen Kern von KAMM voellig neu zu gestalten und bei der Programmierung eine Parallelisierung des Codes von Anfang an mit einzubeziehen. Die Grundlagen dieses neuen Modellkernes werden vorgestellt. (orig./KW)

Prioritizing treatment outcomes: How people with acne vulgaris decide if their treatment is working.

Science.gov (United States)

Layton, Alison M; Whitehouse, Heather; Eady, E Anne; Cowdell, Fiona; Warburton, Katharine L; Fenton, Mark

2017-08-01

To collect information about how people with acne make day-to-day decisions concerning the effectiveness of their treatment. Between May and August 2013, an optional question was embedded in the James Lind Alliance Acne Priority Setting Partnership's online survey to collect treatment uncertainties. The question asked people with acne to "Tell us in your own words how you decide if your treatment has been effective." A total of 742 respondents specified at least one outcome or means of assessing change (outcome measure). Fewer spots were the most commonly cited outcome, identified by 272 respondents (36.7%). Other frequently mentioned outcomes were in descending order: less redness (19.4%), reduction in spot size (12.1%), and less pain/discomfort (11.4%). Signs were much more commonly used than symptoms and surrogate outcomes such as changes in aspects of life quality were infrequently mentioned. Visual inspection of the skin was the most widely adopted outcome measure (16.3%). Although the most frequently used methods map well onto the outcome measures adopted in the majority of acne trials, namely physician-assessed changes in lesion counts and global acne severity, people with acne often take into account several factors that cannot be assessed by a third party at a single point in time. The minimal use of changes in psychosocial wellbeing and mood may reflect that these are regarded as secondary consequences of improvements in appearance. The robustness of these findings now requires independent evaluation. If confirmed, they could form the basis of a new patient-reported outcome measure. © 2017 Chinese Cochrane Center, West China Hospital of Sichuan University and John Wiley & Sons Australia, Ltd.

[Reasons for deciding to die in hospital or at home. The vision of professionals].

Science.gov (United States)

Lima-Rodríguez, Joaquín Salvador; Asensio-Pérez, Mª de Los Reyes; Palomo-Lara, Juan Carlos; Ramírez-López, Encarnación Bella; Lima-Serrano, Marta

2018-05-21

To discover the reasons for deciding to die in hospital or at home, from the perspective of professionals involved. Qualitative phenomenological study. Intentional sample. Four multidisciplinary focus groups were held, two in hospitals and two in primary care centres in Seville (Spain). Twenty-nine professionals with at least two years experience in the care of people with a terminal disease participated, following the theoretical saturation of information criterion. Responses from the first script were gathered in three core categories: patient and the family, professionals and care process. Patients are generally not asked about their preferences as to where they wish to die, and if their family is not aware of their preference, it is not possible to carry out advanced planning of care. Families tend to choose the hospital because of the possibility of monitoring and resources in primary care. Professionals are trained in how to approach death, but they do not feel sufficiently prepared and focus on the clinical and administrative issues. The care process favours oncology patients because it is easier to identify their illness as terminal. Resources are not equal and interlevel communication needs to be improved. The family's involvement in the process is not facilitated, which impedes their decision-making. Advance care planning and use of the advance directive should be promoted, as well as, interlevel communication and coordination, supply resources, especially in primary care, and professionals should receive training on how to approach death.. The patient's family should be involved in the care process and provided the necessary support. Copyright © 2018 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.

Household Labour Supply in Britain and Denmark: Some Interpretations Using a Model of Pareto Optimal Behaviour

DEFF Research Database (Denmark)

Barmby, Tim; Smith, Nina

1996-01-01

This paper analyses the labour supply behaviour of households in Denmark and Britain. It employs models in which the preferences of individuals within the household are explicitly represented. The households are then assumed to decide on their labour supply in a Pareto-Optimal fashion. Describing...

The Case for Using the Spherical Model to Calculate the Interpolated Points in the Connectivity Software Deployment Module

National Research Council Canada - National Science Library

Still, G. W; Nealon, James F

2008-01-01

.... The developers must decide which model of the earth to use as the basis of the calculations. Thus, a comparison was made between the National Geodetic Survey-provided computer programs Forward an Inverse based on the WGS84 Oblate Spheroid (OS...

Modeling of Construction Cost of Villas in Oman

Directory of Open Access Journals (Sweden)

MA Al-Mohsin

2014-06-01

Full Text Available In this research, a model for estimating construction cost of villas is presented. The model takes into account four major factors affecting villa's cost, namely: built up area, number of toilets, number of bedrooms and the number of stories. A field survey was conducted to collect information required for such model using data collection form designed by the researchers. Information about 150 villas was collected from six well experienced consultants in the field of villa design and supervision in Oman. Collected data was analyzed to develop suggested model which consists of two main levels of estimate. The first level is at the conceptual design stage where the client presents his/her need of space and basic information about the available plot for construction. The second level of cost estimation is carried out after the preliminary design stage where the client has to decide on the finishes and type of structure. At the second level of estimation, the client should be able to decide whether to precede for construction or not, according to his/her budget. The model is general and can be used anywhere and was validated for accepted degree of confidence using the actual cost of the 112 executed villa projects in Oman. The villas included in this study were owned by clients from both high and low income brackets and had different types of finishing material. The developed equations showed good correlation between the selected variables and the actual cost with R2  = 0.79 in the case of conceptual estimate and R2  = 0.601 for preliminary estimate.

A quick and easy test for deciding entanglement status of an N-qubit pure quantum state

International Nuclear Information System (INIS)

Mehendale, D.P.; Joag, P.S.

2018-01-01

We develop a simple criterion in terms of a necessary-sufficient condition (NS condition) for deciding separability of an arbitrary n-qubit pure quantum state. This NS condition provides a quick and easy test procedure to determine the entanglement status of a pure quantum state. We normalize the given quantum state and using this normalized state we can easily build a simplest system of equations containing trigonometric functions by making use of the well known Bloch Sphere representation for single qubit states and check whether or not this system of equations is consistent. According to proposed NS condition the given pure quantum state is separable (entangled) if and only if the above mentioned system of equations is consistent (inconsistent). We build this system of equations by equating the coefficients of computational basis states in the superposition representing the given pure quantum state with certain products of trigonometric functions obtained using standard Bloch Sphere representation for single qubit states. To establish separability of given state one requires to find a valid solution of the above mentioned system of equations but entanglement on the other hand follows when any two equations in this system of equations are mutually inconsistent. Thus, entanglement of the state can follow easily if one succeeds in finding any two mutually inconsistent equations in the above mentioned system of equations.

Effect of a dietary supplementation with linseed oil and selenium to growing rabbits on their productive performances, carcass traits and fresh and cooked meat quality.

Science.gov (United States)

Matics, Zs; Cullere, M; Szín, M; Gerencsér, Zs; Szabó, A; Fébel, H; Odermatt, M; Radnai, I; Dalle Zotte, A; Szendrő, Zs

2017-08-01

The present experiment tested a dietary supplementation with linseed oil and selenium to growing rabbits. The basal diet (B) contained 3% sunflower oil, while it was substituted with 3% linseed oil in the experimental feed (S). The selenium (Se) content of the two diets was 0.10 vs. 0.46 mg/kg. Rabbits were fed with B diet from the age of 18 days. One group was fed with the B diet until 11 weeks of age (group B), whereas the experimental groups were fed with S diet for 1, 2, 3 or 4 weeks (groups S1, S2, S3 and S4, respectively), before slaughtering (11 weeks of age). Live performance and carcass traits of rabbits, fatty acid (FA) profile and selenium content of their hind leg (HL) and Longissimus thoracis et lumborum (LTL) meat were considered in this study. In addition, the effect of two different cooking methods on the nutritional value of the enriched HL meat was also assessed. The tested dietary supplementation only minimally affected the live performance and carcass traits of rabbits. The S supplementation significantly reduced the Σ n-6 FA and increased the Σ n-3 FA of the HL meat and LTL meat, compared to the B diet (p meat and LTL meat of S fed rabbits were significantly enriched in Se reaching a twofold increase in both meat cuts (p meat. The heat treatment affected cooking loss, Se and vitamin E contents as well as the oxidative status of the HL meat (p < 0.001), with the different cooking methods providing different results. In addition, even if the beneficial C20:5 n-3 and C22:6 n-3 decreased with cooking, the n-6/n-3 ratio remained unaffected. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

CMS announces new payment model

Directory of Open Access Journals (Sweden)

Robbins RA

2018-01-01

Full Text Available No abstract available. Article truncated after 150 words. On Tuesday, 1/9/18, the Centers for Medicare and Medicaid (CMS announced a new voluntary bundled-payment model that will be considered an advanced alternative payment model under Medicare Access and CHIP Reauthorization Act of 2015 (MACRA (1. The new model is the first advanced Alternative Payment Model (APM to be introduced by the Trump administration. The Trump administration has been a vocal advocate of reducing administrative burden for clinicians and has touted voluntary models as a solution (2. The new, voluntary model comes less than two months after the CMS officially decided to eliminate two mandatory bundled-payment models created during the Obama administration. Under the model, clinician payment will be based on quality measures during a 90-day episode of care. Participants must select at least one of the 32 clinical episodes to apply to the model. The inpatient clinical episodes are listed in Table 1 (3. Table 1. Clinical inpatient episodes under …

MODELS OF PROJECT REVERSE ENGINEERING

Directory of Open Access Journals (Sweden)

Віктор Володимирович ІВАНОВ

2017-03-01

Full Text Available Reverse engineering decided important scientific and technical problems of increasing the cost of the existing technical product by transforming it into a product with other features or design. Search ideas of the new application of existing products on the base of heuristic analysis were created. The concept of reverse engineering and its division into three types: conceptual, aggregate and complete was expanded. The use of heuristic methods for reverse engineering concept was showed. The modification model of Reverse engineering based on the model of РМВОК was developed. Our model includes two new phases: identification and transformation. At the identification phase, technical control is made. At the transformation phase, search heuristic idea of the new applied existing technical product was made. The model of execution phase that included heuristic methods, metrological equipment, and CAD/CAM/CAE program complex was created. The model that connected economic indicators of reverse engineering project was developed.

Who decides what, when, how?; Qui decide quoi, quand, comment?

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

The law from December 30, 1991, precisely defines 3 axes of researches for the management of high level and long-lived radioactive wastes: separation/transmutation, surface storage and underground disposal. A global evaluation report about these researches is to be supplied in 2006 by the French government to the Parliament. A first synthesis of the knowledge gained after 14 years of research has led the national commission of the public debate (CNDP) to organize a national debate about the general options of management of high-level and long-lived radioactive wastes before the 2006 date line. The debate comprises 4 public hearings (September 2005: Bar-le-Duc, Saint-Dizier, Pont-du-Gard, Cherbourg), 12 round-tables (October and November 2005: Paris, Joinville, Caen, Nancy, Marseille), a synthesis meeting (December 2005, Dunkerque) and a closing meeting (January 2006, Lyon). This document is the synthesis of the round table debates which took place at Marseille. The main discussions of this session concerns the decision making in nuclear wastes management and the use of public funds for the management of radioactive wastes today and tomorrow. (J.S.)

A Model of Boundedly Rational Consumer Choice

OpenAIRE

Thomas Riechmann

2000-01-01

The paper presents an extended version of the standard textbook problem of consumer choice. As usual, agents have to decide about their desired quatities of various consumption goods, at the same time taking into account their limited budget. Prices for the goods are not fixed but arise from a Walrasian interaction of total demand and a stilized supply function for each of the goods. After showing that this type of model cannot be solved analytically, three different types of evolutionary alg...

Deciding Where to Burn: Stakeholder Priorities for Prescribed Burning of a Fire-Dependent Ecosystem

Directory of Open Access Journals (Sweden)

Jennifer K. Costanza

2011-03-01

Full Text Available Multiagency partnerships increasingly work cooperatively to plan and implement fire management. The stakeholders that comprise such partnerships differ in their perceptions of the benefits and risks of fire use or nonuse. These differences inform how different stakeholders prioritize sites for burning, constrain prescribed burning, and how they rationalize these priorities and constraints. Using a survey of individuals involved in the planning and implementation of prescribed fire in the Onslow Bight region of North Carolina, we examined how the constraints and priorities for burning in the longleaf pine (Pinus palustris ecosystem differed among three stakeholder groups: prescribed burn practitioners from agencies, practitioners from private companies, and nonpractitioners. Stakeholder groups did not differ in their perceptions of constraints to burning, and development near potentially burned sites was the most important constraint identified. The top criteria used by stakeholders to decide where to burn were the time since a site was last burned, and a site's ecosystem health, with preference given to recently burned sites in good health. Differences among stakeholder groups almost always pertained to perceptions of the nonecological impacts of burning. Prescribed burning priorities of the two groups of practitioners, and particularly practitioners from private companies, tended to be most influenced by nonecological impacts, especially through deprioritization of sites that have not been burned recently or are in the wildland-urban interface (WUI. Our results highlight the difficulty of burning these sites, despite widespread laws in the southeast U.S. that limit liability of prescribed burn practitioners. To avoid ecosystem degradation on sites that are challenging to burn, particularly those in the WUI, conservation partnerships can facilitate demonstration projects involving public and private burn practitioners on those sites. In summary

How orthodox protestant parents decide on the vaccination of their children: a qualitative study

Directory of Open Access Journals (Sweden)

Ruijs Wilhelmina L M

2012-06-01

Full Text Available Abstract Background Despite high vaccination coverage, there have recently been epidemics of vaccine preventable diseases in the Netherlands, largely confined to an orthodox protestant minority with religious objections to vaccination. The orthodox protestant minority consists of various denominations with either low, intermediate or high vaccination coverage. All orthodox protestant denominations leave the final decision to vaccinate or not up to their individual members. Methods To gain insight into how orthodox protestant parents decide on vaccination, what arguments they use, and the consequences of their decisions, we conducted an in-depth interview study of both vaccinating and non-vaccinating orthodox protestant parents selected via purposeful sampling. The interviews were thematically coded by two analysts using the software program Atlas.ti. The initial coding results were reviewed, discussed, and refined by the analysts until consensus was reached. Emerging concepts were assessed for consistency using the constant comparative method from grounded theory. Results After 27 interviews, data saturation was reached. Based on characteristics of the decision-making process (tradition vs. deliberation and outcome (vaccinate or not, 4 subgroups of parents could be distinguished: traditionally non-vaccinating parents, deliberately non-vaccinating parents, deliberately vaccinating parents, and traditionally vaccinating parents. Except for the traditionally vaccinating parents, all used predominantly religious arguments to justify their vaccination decisions. Also with the exception of the traditionally vaccinating parents, all reported facing fears that they had made the wrong decision. This fear was most tangible among the deliberately vaccinating parents who thought they might be punished immediately by God for vaccinating their children and interpreted any side effects as a sign to stop vaccinating. Conclusions Policy makers and health care

How orthodox protestant parents decide on the vaccination of their children: a qualitative study.

Science.gov (United States)

Ruijs, Wilhelmina L M; Hautvast, Jeannine L A; van Ijzendoorn, Giovanna; van Ansem, Wilke J C; van der Velden, Koos; Hulscher, Marlies E J L

2012-06-06

Despite high vaccination coverage, there have recently been epidemics of vaccine preventable diseases in the Netherlands, largely confined to an orthodox protestant minority with religious objections to vaccination. The orthodox protestant minority consists of various denominations with either low, intermediate or high vaccination coverage. All orthodox protestant denominations leave the final decision to vaccinate or not up to their individual members. To gain insight into how orthodox protestant parents decide on vaccination, what arguments they use, and the consequences of their decisions, we conducted an in-depth interview study of both vaccinating and non-vaccinating orthodox protestant parents selected via purposeful sampling. The interviews were thematically coded by two analysts using the software program Atlas.ti. The initial coding results were reviewed, discussed, and refined by the analysts until consensus was reached. Emerging concepts were assessed for consistency using the constant comparative method from grounded theory. After 27 interviews, data saturation was reached. Based on characteristics of the decision-making process (tradition vs. deliberation) and outcome (vaccinate or not), 4 subgroups of parents could be distinguished: traditionally non-vaccinating parents, deliberately non-vaccinating parents, deliberately vaccinating parents, and traditionally vaccinating parents. Except for the traditionally vaccinating parents, all used predominantly religious arguments to justify their vaccination decisions. Also with the exception of the traditionally vaccinating parents, all reported facing fears that they had made the wrong decision. This fear was most tangible among the deliberately vaccinating parents who thought they might be punished immediately by God for vaccinating their children and interpreted any side effects as a sign to stop vaccinating. Policy makers and health care professionals should stimulate orthodox protestant parents to make a

Adoption of open source software in business models: a Red Hat and IBM case study

CSIR Research Space (South Africa)

Munga, N

2009-10-01

Full Text Available and its position in the market identified [15]. Various types of business models are discussed in the literature. Rappa [16], using the customer relationship as the primary dimension, defines the brokerage model, information intermediary model... is growing at twice the rate of the platform business [29]. The Market After years of trying to sell to the individual consumer market, Red Hat decided to follow the money and focus its efforts on the enterprise market. The enterprise business customers...

A Numerical Procedure for Model Identifiability Analysis Applied to Enzyme Kinetics

DEFF Research Database (Denmark)

Daele, Timothy, Van; Van Hoey, Stijn; Gernaey, Krist

2015-01-01

The proper calibration of models describing enzyme kinetics can be quite challenging. In the literature, different procedures are available to calibrate these enzymatic models in an efficient way. However, in most cases the model structure is already decided on prior to the actual calibration...... and Pronzato (1997) and which can be easily set up for any type of model. In this paper the proposed approach is applied to the forward reaction rate of the enzyme kinetics proposed by Shin and Kim(1998). Structural identifiability analysis showed that no local structural model problems were occurring......) identifiability problems. By using the presented approach it is possible to detect potential identifiability problems and avoid pointless calibration (and experimental!) effort....

The Evolution of the Navy Supply Corps and Its Role in Future Operations

Science.gov (United States)

2013-04-25

AI:IJX~ \\ ’..-, .:no~ -..)(.11. A."ll> l OTill Ot’tlCt. fll>’ M ~ .. \\ftlJ.t&\\ I n tu toon. 1’<\\,PU.,.,Y)Q. XEIJl" Cll ().’\\ "’()Jfr’T{O"\\’’r4..I’ltl Wr...to this inventory loss. Majority of the time it stems from miscommunication along the chain of end user, inventory control points, commercial

Theoretical and Experimental Investigation of Opinion Dynamics in Small Social Networks

Science.gov (United States)

2016-07-01

iti ve P3 : M an ip ul at io ns in te nd ed t o he ig ht en th e sa lie nc e of c ul tu ra l f au ltl in es w ith in a te rr or is t gr ou...OCA DEPARTMENT OF DEFENSE CONTRACTORS QUANTERION SOLUTIONS, INC. 1680 TEXAS STREET, SE KIRTLAND AFB, NM 87117-5669 ATTN: DTRIAC

MOSFET Loss Evaluation for a Low-Power Stand-Alone Photovoltaic-LED System

DEFF Research Database (Denmark)

Mira Albert, Maria del Carmen; Knott, Arnold; Andersen, Michael A. E.

2015-01-01

This paper presents a performance evaluation and comparison of state-of-the-art low voltage Si MOSFETs for a stand-alone photovoltaic-LED Light to Light (LtL) system. The complete system is formed by two cascaded converters that will be optimized for a determined solar irradiation and LED...... illumination profiles. The comparison is performed based on dynamic characterization and evaluation of the devices energy loss at different current levels....

A Data-Driven Air Transportation Delay Propagation Model Using Epidemic Process Models

Directory of Open Access Journals (Sweden)

B. Baspinar

2016-01-01

Full Text Available In air transport network management, in addition to defining the performance behavior of the system’s components, identification of their interaction dynamics is a delicate issue in both strategic and tactical decision-making process so as to decide which elements of the system are “controlled” and how. This paper introduces a novel delay propagation model utilizing epidemic spreading process, which enables the definition of novel performance indicators and interaction rates of the elements of the air transportation network. In order to understand the behavior of the delay propagation over the network at different levels, we have constructed two different data-driven epidemic models approximating the dynamics of the system: (a flight-based epidemic model and (b airport-based epidemic model. The flight-based epidemic model utilizing SIS epidemic model focuses on the individual flights where each flight can be in susceptible or infected states. The airport-centric epidemic model, in addition to the flight-to-flight interactions, allows us to define the collective behavior of the airports, which are modeled as metapopulations. In network model construction, we have utilized historical flight-track data of Europe and performed analysis for certain days involving certain disturbances. Through this effort, we have validated the proposed delay propagation models under disruptive events.

Power supply-demand balance in a Smart Grid : An information sharing model for a market mechanism

NARCIS (Netherlands)

Larsen, Gunn K. H.; van Foreest, Nicky D.; Scherpen, Jacquelien M. A.

2014-01-01

In the future, global energy balance of a Smart Grid system can be achieved by its agents deciding on their own power demand and production (locally) and the exchange of these decisions. In this paper, we develop a network model that describes how the information of power imbalance of individual

A Heat Transfer Model for a Stratified Corium-Metal Pool in the Lower Plenum of a Nuclear Reactor

International Nuclear Information System (INIS)

Sohal, M.S.; Siefken, L.J.

1999-01-01

This preliminary design report describes a model for heat transfer in a corium-metal stratified pool. It was decided to make use of the existing COUPLE model. Currently available correlations for natural convection heat transfer in a pool with and without internal heat generation were obtained. The appropriate correlations will be incorporated in the existing COUPLE model. Heat conduction and solidification modeling will be done with existing algorithms in the COUPLE. Assessment of the new model will be done by simple energy conservation problems

Mesh refinement for uncertainty quantification through model reduction

International Nuclear Information System (INIS)

Li, Jing; Stinis, Panos

2015-01-01

We present a novel way of deciding when and where to refine a mesh in probability space in order to facilitate uncertainty quantification in the presence of discontinuities in random space. A discontinuity in random space makes the application of generalized polynomial chaos expansion techniques prohibitively expensive. The reason is that for discontinuous problems, the expansion converges very slowly. An alternative to using higher terms in the expansion is to divide the random space in smaller elements where a lower degree polynomial is adequate to describe the randomness. In general, the partition of the random space is a dynamic process since some areas of the random space, particularly around the discontinuity, need more refinement than others as time evolves. In the current work we propose a way to decide when and where to refine the random space mesh based on the use of a reduced model. The idea is that a good reduced model can monitor accurately, within a random space element, the cascade of activity to higher degree terms in the chaos expansion. In turn, this facilitates the efficient allocation of computational sources to the areas of random space where they are more needed. For the Kraichnan–Orszag system, the prototypical system to study discontinuities in random space, we present theoretical results which show why the proposed method is sound and numerical results which corroborate the theory

Developing Formal Correctness Properties from Natural Language Requirements

Science.gov (United States)

Nikora, Allen P.

2006-01-01

This viewgraph presentation reviews the rationale of the program to transform natural language specifications into formal notation.Specifically, automate generation of Linear Temporal Logic (LTL)correctness properties from natural language temporal specifications. There are several reasons for this approach (1) Model-based techniques becoming more widely accepted, (2) Analytical verification techniques (e.g., model checking, theorem proving) significantly more effective at detecting types of specification design errors (e.g., race conditions, deadlock) than manual inspection, (3) Many requirements still written in natural language, which results in a high learning curve for specification languages, associated tools and increased schedule and budget pressure on projects reduce training opportunities for engineers, and (4) Formulation of correctness properties for system models can be a difficult problem. This has relevance to NASA in that it would simplify development of formal correctness properties, lead to more widespread use of model-based specification, design techniques, assist in earlier identification of defects and reduce residual defect content for space mission software systems. The presentation also discusses: potential applications, accomplishments and/or technological transfer potential and the next steps.

Deciding about fast and slow decisions.

Science.gov (United States)

Croskerry, Pat; Petrie, David A; Reilly, James B; Tait, Gordon

2014-02-01

Two reports in this issue address the important topic of clinical decision making. Dual process theory has emerged as the dominant model for understanding the complex processes that underlie human decision making. This theory distinguishes between the reflexive, autonomous processes that characterize intuitive decision making and the deliberate reasoning of an analytical approach. In this commentary, the authors address the polarization of viewpoints that has developed around the relative merits of the two systems. Although intuitive processes are typically fast and analytical processes slow, speed alone does not distinguish them. In any event, the majority of decisions in clinical medicine are not dependent on very short response times. What does appear relevant to diagnostic ease and accuracy is the degree to which the symptoms of the disease being diagnosed are characteristic ones. There are also concerns around some methodological issues related to research design in this area of enquiry. Reductionist approaches that attempt to isolate dependent variables may create such artificial experimental conditions that both external and ecological validity are sacrificed. Clinical decision making is a complex process with many independent (and interdependent) variables that need to be separated out in a discrete fashion and then reflected on in real time to preserve the fidelity of clinical practice. With these caveats in mind, the authors believe that research in this area should promote a better understanding of clinical practice and teaching by focusing less on the deficiencies of intuitive and analytical systems and more on their adaptive strengths.

Selection of the ''best'' model for converting beta backscatter count readings into thickness measurements

International Nuclear Information System (INIS)

Smiriga, N.G.

1976-01-01

This report compares two models for converting beta backscatter count readings into thickness measurements. The necessary formulas to be used in an unweighted and weighted regression analysis are listed. The question of whether one should perform a regression analysis using the five available standard thicknesses or whether one should, in addition to these standard thicknesses, use zero as a standard thickness is decided. A weighted regression analysis is compared with an unweighted one for each model. The ''best'' model is selected, and the conclusions of the analysis are presented

Circulating Prostate-Specific Antigen and Telomere Length in a Nationally Representative Sample of Men Without History of Prostate Cancer.

Science.gov (United States)

Wulaningsih, Wahyu; Astuti, Yuliana; Matsuguchi, Tetsuya; Anggrandariyanny, Putri; Watkins, Johnathan

2017-01-01

We investigated the association of prostate-specific antigen (PSA) with leukocyte telomere length, which may be altered in preclinical prostate malignancies. This study was based on the 2001-2002 U.S. National Health and Nutrition Examination Survey (NHANES). A subsample of 1,127 men aged 40-85 years without prior history of prostate cancer who provided informed consent and blood samples were selected. Leukocyte telomere length (LTL) relative to standard DNA reference (T/S ratio) was quantified by polymerase chain reaction (PCR). Survey-weighted multivariable linear regression was performed to examine T/S ratio across quintiles of total and free PSA and free-to-total PSA ratio (%fPSA). A sensitivity analysis was performed by excluding men dying from prostate cancer during follow-up through to December 31, 2006. Stratification analyses were carried out to assess any effect modification by age group, race, body mass index (BMI), and levels of C-reactive protein (CRP), a marker of inflammation. Higher total PSA levels were associated to longer LTL, with approximately 8% increase in log-transformed T/S ratio (95% confidence interval [CI]: 2-13%) among men in the highest quintile of total PSA compared to the lowest in the fully adjusted model (P trend  = 0.01). No significant association was found for free PSA or %fPSA, although nonlinearity between all PSA measures and T/S ratio was indicated. Similar results were found after excluding men who died from prostate cancer during follow-up. We also found the associations between total PSA and T/S ratio to be strongest among non-Hispanic blacks, non-obese men (BMI specific mechanisms contributing to prostate cancer development. Prostate 77:22-32, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

A Knowledge base representing Porter's Five Forces Model

OpenAIRE

Swaan Arons, H.; Waalewijn, Ph.

1999-01-01

textabstractStrategic Analysis and Planning is a field in which expertise and experience are key factors. In order to decide on strategic matters such as the competitive position of a company experts heavily lean on their ability to reason with uncertain or incomplete knowledge, or in other words on their experience and expertise. An important aspect is to assess a company's profit potential in the industry for which Porter's Competitive Forces Model is by far the most widely used framework. ...

How Do Patients and Parents Decide for Orthodontic Treatment-Effects of Malocclusion, Personal Expectations, Education and Media.

Science.gov (United States)

Tuncer, C; Canigur Bavbek, N; Balos Tuncer, B; Ayhan Bani, A; Çelik, B

2015-01-01

To examine patients' and parents' perceptions and expectations from orthodontic treatment. 491 patients (274 female, 217 male) aged 14-22 years, and 399 parents (245 female, 154 male) completed a questionnaire about preferences, needs and expectations about orthodontic treatment, and scored the present problem. Continuous variables were compared by Mann-Whitney U and Kruskal-Wallis tests, whereas Chi-square test was used for categorical variables. Patients'(77.1%) and parents'(84.6%), decision about orthodontic treatments were influenced by suggestion of dentists. Patients who decided to attend to clinic by themselves were higher than parents (p=0.006). Dental aesthetics was the determinant factor for treatment demand for patients(61.0%) and parents(57.3%). Improvement in oral functions was more important for Class III patients than Class I patients (p=0.040). Adult patients/parents with higher education gave more importance to oral functions as well as dental aesthetics (p=0.031). There was no difference among Angle classifications regarding orthodontic problem scores. Parents found media sources valuable (p=0.018) but majority expected dentists for information about orthodontic treatments. Education degree of adult patients/parents effected this decision(p=0.002). Desire to have better dental aesthetics was the primary motivating factor for all participants. Clinicians should consider concerns of Class III patients about oral functions during treatment planning.

Internal cycling, not external loading, decides the nutrient limitation in eutrophic lake: A dynamic model with temporal Bayesian hierarchical inference.

Science.gov (United States)

Wu, Zhen; Liu, Yong; Liang, Zhongyao; Wu, Sifeng; Guo, Huaicheng

2017-06-01

Lake eutrophication is associated with excessive anthropogenic nutrients (mainly nitrogen (N) and phosphorus (P)) and unobserved internal nutrient cycling. Despite the advances in understanding the role of external loadings, the contribution of internal nutrient cycling is still an open question. A dynamic mass-balance model was developed to simulate and measure the contributions of internal cycling and external loading. It was based on the temporal Bayesian Hierarchical Framework (BHM), where we explored the seasonal patterns in the dynamics of nutrient cycling processes and the limitation of N and P on phytoplankton growth in hyper-eutrophic Lake Dianchi, China. The dynamic patterns of the five state variables (Chla, TP, ammonia, nitrate and organic N) were simulated based on the model. Five parameters (algae growth rate, sediment exchange rate of N and P, nitrification rate and denitrification rate) were estimated based on BHM. The model provided a good fit to observations. Our model results highlighted the role of internal cycling of N and P in Lake Dianchi. The internal cycling processes contributed more than external loading to the N and P changes in the water column. Further insights into the nutrient limitation analysis indicated that the sediment exchange of P determined the P limitation. Allowing for the contribution of denitrification to N removal, N was the more limiting nutrient in most of the time, however, P was the more important nutrient for eutrophication management. For Lake Dianchi, it would not be possible to recover solely by reducing the external watershed nutrient load; the mechanisms of internal cycling should also be considered as an approach to inhibit the release of sediments and to enhance denitrification. Copyright © 2017 Elsevier Ltd. All rights reserved.

A Model for the Growth of Network Service Providers

Science.gov (United States)

2011-12-01

Service Provider O-D Origin-Destination POP Point of Presence UCG Unilateral Connection Game xiv THIS PAGE INTENTIONALLY LEFT BLANK xv EXECUTIVE...xvi We make use of the Abilene dataset as input to the network provisioning model and assume that the NSP is new to the market and is building an...has to decide on the connections to build and the markets to serve in order to maximize its profits. The NSP makes these decisions based on the market

Degummed crude canola oil, sire breed and gender effects on intramuscular long-chain omega-3 fatty acid properties of raw and cooked lamb meat.

Science.gov (United States)

Flakemore, Aaron Ross; Malau-Aduli, Bunmi Sherifat; Nichols, Peter David; Malau-Aduli, Aduli Enoch Othniel

2017-01-01

Omega-3 long-chain (≥C 20 ) polyunsaturated fatty acids (ω3 LC-PUFA) confer important attributes to health-conscious meat consumers due to the significant role they play in brain development, prevention of coronary heart disease, obesity and hypertension. In this study, the ω3 LC-PUFA content of raw and cooked Longissimus thoracis et lumborum (LTL) muscle from genetically divergent Australian prime lambs supplemented with dietary degummed crude canola oil (DCCO) was evaluated. Samples of LTL muscle were sourced from 24 first cross ewe and wether lambs sired by Dorset, White Suffolk and Merino rams joined to Merino dams that were assigned to supplemental regimes of degummed crude canola oil (DCCO): a control diet at 0 mL/kg DM of DCCO (DCCOC); 25 mL/kg DM of DCCO (DCCOM) and 50 mL/kg DCCO (DCCOH). Lambs were individually housed and offered 1 kg/day/head for 42 days before being slaughtered. Samples for cooked analysis were prepared to a core temperature of 70 °C using conductive dry-heat. Within raw meats: DCCOH supplemented lambs had significantly ( P  culinary preparation method can be used as effective management tools to deliver nutritionally improved ω3 LC-PUFA lamb to meat consumers.

Environmental optimal control strategies based on plant canopy photosynthesis responses and greenhouse climate model

Science.gov (United States)

Deng, Lujuan; Xie, Songhe; Cui, Jiantao; Liu, Tao

2006-11-01

It is the essential goal of intelligent greenhouse environment optimal control to enhance income of cropper and energy save. There were some characteristics such as uncertainty, imprecision, nonlinear, strong coupling, bigger inertia and different time scale in greenhouse environment control system. So greenhouse environment optimal control was not easy and especially model-based optimal control method was more difficult. So the optimal control problem of plant environment in intelligent greenhouse was researched. Hierarchical greenhouse environment control system was constructed. In the first level data measuring was carried out and executive machine was controlled. Optimal setting points of climate controlled variable in greenhouse was calculated and chosen in the second level. Market analysis and planning were completed in third level. The problem of the optimal setting point was discussed in this paper. Firstly the model of plant canopy photosynthesis responses and the model of greenhouse climate model were constructed. Afterwards according to experience of the planting expert, in daytime the optimal goals were decided according to the most maximal photosynthesis rate principle. In nighttime on plant better growth conditions the optimal goals were decided by energy saving principle. Whereafter environment optimal control setting points were computed by GA. Compared the optimal result and recording data in real system, the method is reasonable and can achieve energy saving and the maximal photosynthesis rate in intelligent greenhouse

Which model of capitalism best delivers both wealth and equality?

OpenAIRE

William Q Judge; Stav Fainshmidt; J Lee Brown III

2014-01-01

Capitalism is the dominant economic system adopted throughout the global economy, but there are many different models of capitalism practiced depending on what the society decides “economic effectiveness” is. In this study, we assert that an effective economy simultaneously achieves two seemingly divergent outcomes: it (1) creates economic wealth efficiently, and (2) shares that wealth equitably. Employing insights from Whitley’s national business systems framework and fuzzy set analysis, we ...

How we decide

CERN Document Server

Lehrer, Jonah

2009-01-01

Since Plato, philosophers have described the decision-making process as either rational or emotional: we carefully deliberate, or we “blink” and go with our gut. But as scientists break open the mind’s black box with the latest tools of neuroscience, they’re discovering that this is not how the mind works. Our best decisions are a finely tuned blend of both feeling and reason—and the precise mix depends on the situation. When buying a house, for example, it’s best to let our unconscious mull over the many variables. But when we’re picking a stock, intuition often leads us astray. The trick is to determine when to use the different parts of the brain, and to do this, we need to think harder (and smarter) about how we think. Jonah Lehrer arms us with the tools we need, drawing on cutting-edge research as well as the real-world experiences of a wide range of “deciders”—from airplane pilots and hedge fund investors to serial killers and poker players. Lehrer shows how people are taking advan...

Deciding on PSS: A Framework for PSS Strategies

DEFF Research Database (Denmark)

Neugebauer, Line Maria; Mougaard, Krestine; Andersen, Jakob Axel Bejbro

2013-01-01

Product/Service-Systems (PSS) are a strategic approach wherein the value proposition covers the performance of a system throughout the whole life cycle. Many industrial companies are challenged on many levels in the transition process towards a PSS oriented approach. Much of the literature has...... until now focused on PSS from a design object perspective, and less focus has been on how the business model of the company must be designed simultaneously with the offering, covering topics as organisational restructuring, value chain collaboration plus a change management focus. This paper presents...

Parametric, nonparametric and parametric modelling of a chaotic circuit time series

Science.gov (United States)

Timmer, J.; Rust, H.; Horbelt, W.; Voss, H. U.

2000-09-01

The determination of a differential equation underlying a measured time series is a frequently arising task in nonlinear time series analysis. In the validation of a proposed model one often faces the dilemma that it is hard to decide whether possible discrepancies between the time series and model output are caused by an inappropriate model or by bad estimates of parameters in a correct type of model, or both. We propose a combination of parametric modelling based on Bock's multiple shooting algorithm and nonparametric modelling based on optimal transformations as a strategy to test proposed models and if rejected suggest and test new ones. We exemplify this strategy on an experimental time series from a chaotic circuit where we obtain an extremely accurate reconstruction of the observed attractor.

Encouraging workplace innovation using 'World Cafe' model.

Science.gov (United States)

Burke, Cathy; Sheldon, Keeley

2010-11-01

To ensure that community health services are as good as they can be, professional leaders in Bassetlaw, Nottinghamshire, decided to engage staff using a method attributed to the World Café movement. The adopted model gives staff an opportunity to influence the development of services, and focuses on six areas: end of life care; health and wellbeing and reducing inequalities; children, young people and families; rehabilitation; acute care closer to home; and long-term conditions. Staff have appreciated being involved and there is now an action plan for each service area to continue its improvement.

Advanced oxidation processes: overall models

Energy Technology Data Exchange (ETDEWEB)

Rodriguez, M. [Univ. de los Andes, Escuela Basica de Ingenieria, La Hechicera, Merida (Venezuela); Curco, D.; Addardak, A.; Gimenez, J.; Esplugas, S. [Dept. de Ingenieria Quimica. Univ. de Barcelona, Barcelona (Spain)

2003-07-01

Modelling AOPs implies to consider all the steps included in the process, that means, mass transfer, kinetic (reaction) and luminic steps. In this way, recent works develop models which relate the global reaction rate to catalyst concentration and radiation absorption. However, the application of such models requires to know what is the controlling step for the overall process. In this paper, a simple method is explained which allows to determine the controlling step. Thus, it is assumed that reactor is divided in two hypothetical zones (dark and illuminated), and according to the experimental results, obtained by varying only the reaction volume, it can be decided if reaction occurs only in the illuminated zone or in the all reactor, including dark zone. The photocatalytic degradation of phenol, by using titania degussa P-25 as catalyst, is studied as reaction model. The preliminary results obtained are presented here, showing that it seems that, in this case, reaction only occurs in the illuminated zone of photoreactor. A model is developed to explain this behaviour. (orig.)

Coordinating Robot Teams for Disaster Relief

Science.gov (United States)

2015-05-01

eventually guide vehicles in cooperation with its Operator(s), but in this paper we assume static mission goals, a fixed number of vehicles, and a...is tedious and error prone. Kress-Gazit et al. (2009) instead synthesize an FSA from an LTL specification using a game theory approach (Bloem et al...helping an Operator coordinate a team of vehicles in Disaster Relief. Acknowledgements Thanks to OSD ASD (R&E) for sponsoring this research. The

We Decide, They Decide For Us: Popular Participation as an Issue ...

African Journals Online (AJOL)

, the success of the non-governmental organization far outweighed the government-sponsored one because of its basic belief in popular participation. BLP was more likely to encourage bureaucratic and individual politically motivated ...

We Decide, They Decide For Us: Popular Participation as an Issue ...

African Journals Online (AJOL)

Participation at all levels of organizing, programme development, and implementation is critical if development programmes are to meet a minimum level of success. An examination of the organizational decision-making structure of two Nigerian women's development organizations, Better Life for Rural Women (BLP), ...

Agent-Based Models in Social Physics

Science.gov (United States)

Quang, Le Anh; Jung, Nam; Cho, Eun Sung; Choi, Jae Han; Lee, Jae Woo

2018-06-01

We review the agent-based models (ABM) on social physics including econophysics. The ABM consists of agent, system space, and external environment. The agent is autonomous and decides his/her behavior by interacting with the neighbors or the external environment with the rules of behavior. Agents are irrational because they have only limited information when they make decisions. They adapt using learning from past memories. Agents have various attributes and are heterogeneous. ABM is a non-equilibrium complex system that exhibits various emergence phenomena. The social complexity ABM describes human behavioral characteristics. In ABMs of econophysics, we introduce the Sugarscape model and the artificial market models. We review minority games and majority games in ABMs of game theory. Social flow ABM introduces crowding, evacuation, traffic congestion, and pedestrian dynamics. We also review ABM for opinion dynamics and voter model. We discuss features and advantages and disadvantages of Netlogo, Repast, Swarm, and Mason, which are representative platforms for implementing ABM.

A Cultural Diffusion Model for the Rise and Fall of Programming Languages.

Science.gov (United States)

Valverde, Sergi; Solé, Ricard V

2015-07-01

Our interaction with complex computing machines is mediated by programming languages (PLs), which constitute one of the major innovations in the evolution of technology. PLs allow flexible, scalable, and fast use of hardware and are largely responsible for shaping the history of information technology since the rise of computers in the 1950s. The rapid growth and impact of computers were followed closely by the development of PLs. As occurs with natural, human languages, PLs have emerged and gone extinct. There has been always a diversity of coexisting PLs that compete somewhat while occupying special niches. Here we show that the statistical patterns of language adoption, rise, and fall can be accounted for by a simple model in which a set of programmers can use several PLs, decide to use existing PLs used by other programmers, or decide not to use them. Our results highlight the influence of strong communities of practice in the diffusion of PL innovations.

Model Predictive Control of Wind Turbines

DEFF Research Database (Denmark)

Henriksen, Lars Christian

Wind turbines play a major role in the transformation from a fossil fuel based energy production to a more sustainable production of energy. Total-cost-of-ownership is an important parameter when investors decide in which energy technology they should place their capital. Modern wind turbines...... the need for maintenance of the wind turbine. Either way, better total-cost-of-ownership for wind turbine operators can be achieved by improved control of the wind turbines. Wind turbine control can be improved in two ways, by improving the model on which the controller bases its design or by improving...

Beyond price: individuals' accounts of deciding to pay for private healthcare treatment in the UK.

Science.gov (United States)

Exley, Catherine; Rousseau, Nikki; Donaldson, Cam; Steele, Jimmy G

2012-03-07

Delivering appropriate and affordable healthcare is a concern across the globe. As countries grapple with the issue of delivering healthcare with finite resources and populations continue to age, more health-related care services or treatments may become an optional 'extra' to be purchased privately. It is timely to consider how, and to what extent, the individual can act as both a 'patient' and a 'consumer'. In the UK the majority of healthcare treatments are free at the point of delivery. However, increasingly some healthcare treatments are being made available via the private healthcare market. Drawing from insights from healthcare policy and social sciences, this paper uses the exemplar of private dental implant treatment provision in the UK to examine what factors people considered when deciding whether or not to pay for a costly healthcare treatment for a non-fatal condition. Qualitative interviews with people (n = 27) who considered paying for dental implants treatments in the UK. Data collection and analysis processes followed the principles of the constant comparative methods, and thematic analysis was facilitated through the use of NVivo qualitative data software. Decisions to pay for private healthcare treatments are not simply determined by price. Decisions are mediated by: the perceived 'status' of the healthcare treatment as either functional or aesthetic; how the individual determines and values their 'need' for the treatment; and, the impact the expenditure may have on themselves and others. Choosing a private healthcare provider is sometimes determined simply by personal rapport or extant clinical relationship, or based on the recommendation of others. As private healthcare markets expand to provide more 'non-essential' services, patients need to develop new skills and to be supported in their new role as consumers.

The Nordic Maintenance Care Program - Time intervals between treatments of patients with low back pain: how close and who decides?

Directory of Open Access Journals (Sweden)

Leboeuf-Yde Charlotte

2010-03-01

Full Text Available Abstract Background The management of chiropractic patients with acute and chronic/persistent conditions probably differs. However, little is known on this subject. There is, for example, a dearth of information on maintenance care (MC. Thus it is not known if patients on MC are coerced to partake in a program of frequent treatments over a long period of time, or if they are actively involved in designing their own individualized treatment program. Objectives It was the purpose of this study to investigate how chiropractic patients with low back pain were scheduled for treatment, with special emphasis on MC. The specific research questions were: 1. How many patients are on maintenance care? 2 Are there specific patterns of intervals between treatments for patients and, if so, do they differ between MC patients and non-MC patients? 3. Who decides on the next treatment, the patient, the chiropractor or both, and are there any differences between MC patients and non-MC patients? Methods Chiropractic students, who during their summer holidays were observers in chiropractic clinics in Norway and Denmark, recorded whether patients were classified by the treating chiropractor as a MC-patient or not, dates for last and subsequent visits, and made a judgement on whether the patient or the chiropractor decided on the next appointment. Results Observers in the study were 16 out of 30 available students. They collected data on 868 patients from 15 Danish and 13 Norwegian chiropractors. Twenty-two percent and 26%, respectively, were classified as MC patients. Non-MC patients were most frequently seen within 1 week. For MC patients, the previous visit was most often 2-4 weeks prior to the actual visit, and the next appointment between 1 and 3 months. This indicates a gradual increase in intervals. The decision of the next visit was mainly made by the chiropractor, also for MC patients. However, the study samples of chiropractors appear not to be

Architecting the cloud design decisions for cloud computing service models (SaaS, PaaS, and IaaS)

CERN Document Server

Kavis, Michael J

2014-01-01

An expert guide to selecting the right cloud service model for your business Cloud computing is all the rage, allowing for the delivery of computing and storage capacity to a diverse community of end-recipients. However, before you can decide on a cloud model, you need to determine what the ideal cloud service model is for your business. Helping you cut through all the haze, Architecting the Cloud is vendor neutral and guides you in making one of the most critical technology decisions that you will face: selecting the right cloud service model(s) based on a combination of both business and tec

Lifetime-Aware Cloud Data Centers: Models and Performance Evaluation

Directory of Open Access Journals (Sweden)

Luca Chiaraviglio

2016-06-01

Full Text Available We present a model to evaluate the server lifetime in cloud data centers (DCs. In particular, when the server power level is decreased, the failure rate tends to be reduced as a consequence of the limited number of components powered on. However, the variation between the different power states triggers a failure rate increase. We therefore consider these two effects in a server lifetime model, subject to an energy-aware management policy. We then evaluate our model in a realistic case study. Our results show that the impact on the server lifetime is far from negligible. As a consequence, we argue that a lifetime-aware approach should be pursued to decide how and when to apply a power state change to a server.

Chaotic Lagrangian models for turbulent relative dispersion.

Science.gov (United States)

Lacorata, Guglielmo; Vulpiani, Angelo

2017-04-01

A deterministic multiscale dynamical system is introduced and discussed as a prototype model for relative dispersion in stationary, homogeneous, and isotropic turbulence. Unlike stochastic diffusion models, here trajectory transport and mixing properties are entirely controlled by Lagrangian chaos. The anomalous "sweeping effect," a known drawback common to kinematic simulations, is removed through the use of quasi-Lagrangian coordinates. Lagrangian dispersion statistics of the model are accurately analyzed by computing the finite-scale Lyapunov exponent (FSLE), which is the optimal measure of the scaling properties of dispersion. FSLE scaling exponents provide a severe test to decide whether model simulations are in agreement with theoretical expectations and/or observation. The results of our numerical experiments cover a wide range of "Reynolds numbers" and show that chaotic deterministic flows can be very efficient, and numerically low-cost, models of turbulent trajectories in stationary, homogeneous, and isotropic conditions. The mathematics of the model is relatively simple, and, in a geophysical context, potential applications may regard small-scale parametrization issues in general circulation models, mixed layer, and/or boundary layer turbulence models as well as Lagrangian predictability studies.

Synthesis of Numerical Methods for Modeling Wave Energy Converter-Point Absorbers: Preprint

Energy Technology Data Exchange (ETDEWEB)

Li, Y.; Yu, Y. H.

2012-05-01

During the past few decades, wave energy has received significant attention among all ocean energy formats. Industry has proposed hundreds of prototypes such as an oscillating water column, a point absorber, an overtopping system, and a bottom-hinged system. In particular, many researchers have focused on modeling the floating-point absorber as the technology to extract wave energy. Several modeling methods have been used such as the analytical method, the boundary-integral equation method, the Navier-Stokes equations method, and the empirical method. However, no standardized method has been decided. To assist the development of wave energy conversion technologies, this report reviews the methods for modeling the floating-point absorber.

Model Penentuan Nilai Target Functional Requirement Berbasis Utilitas

Directory of Open Access Journals (Sweden)

Cucuk Nur Rosyidi

2012-01-01

Full Text Available In a product design and development process, a designer faces a problem to decide functional requirement (FR target values. That decision is made under a risk since it is conducted in the early design phase using incomplete information. Utility function can be used to reflect the decision maker attitude towards the risk in making such decision. In this research, we develop a utility-based model to determine FR target values using quadratic utility function and information from Quality Function Deployment (QFD. A pencil design is used as a numerical example using quadratic utility function for each FR. The model can be applied for balancing customer and designer interest in determining FR target values.

A Simulation Platform To Model, Optimize And Design Wind Turbines. The Matlab/Simulink Toolbox

Directory of Open Access Journals (Sweden)

Anca Daniela HANSEN

2002-12-01

Full Text Available In the last years Matlab / Simulink® has become the most used software for modeling and simulation of dynamic systems. Wind energy conversion systems are for example such systems, containing subsystems with different ranges of the time constants: wind, turbine, generator, power electronics, transformer and grid. The electrical generator and the power converter need the smallest simulation step and therefore, these blocks decide the simulation speed. This paper presents a new and integrated simulation platform for modeling, optimizing and designing wind turbines. The platform contains different simulation tools: Matlab / Simulink - used as basic modeling tool, HAWC, DIgSilent and Saber.

Neuro-fuzzy system modeling based on automatic fuzzy clustering

Institute of Scientific and Technical Information of China (English)

Yuangang TANG; Fuchun SUN; Zengqi SUN

2005-01-01

A neuro-fuzzy system model based on automatic fuzzy clustering is proposed.A hybrid model identification algorithm is also developed to decide the model structure and model parameters.The algorithm mainly includes three parts:1) Automatic fuzzy C-means (AFCM),which is applied to generate fuzzy rules automatically,and then fix on the size of the neuro-fuzzy network,by which the complexity of system design is reducesd greatly at the price of the fitting capability;2) Recursive least square estimation (RLSE).It is used to update the parameters of Takagi-Sugeno model,which is employed to describe the behavior of the system;3) Gradient descent algorithm is also proposed for the fuzzy values according to the back propagation algorithm of neural network.Finally,modeling the dynamical equation of the two-link manipulator with the proposed approach is illustrated to validate the feasibility of the method.

Electricity Price Forecast Using Combined Models with Adaptive Weights Selected and Errors Calibrated by Hidden Markov Model

Directory of Open Access Journals (Sweden)

Da Liu

2013-01-01

Full Text Available A combined forecast with weights adaptively selected and errors calibrated by Hidden Markov model (HMM is proposed to model the day-ahead electricity price. Firstly several single models were built to forecast the electricity price separately. Then the validation errors from every individual model were transformed into two discrete sequences: an emission sequence and a state sequence to build the HMM, obtaining a transmission matrix and an emission matrix, representing the forecasting ability state of the individual models. The combining weights of the individual models were decided by the state transmission matrixes in HMM and the best predict sample ratio of each individual among all the models in the validation set. The individual forecasts were averaged to get the combining forecast with the weights obtained above. The residuals of combining forecast were calibrated by the possible error calculated by the emission matrix of HMM. A case study of day-ahead electricity market of Pennsylvania-New Jersey-Maryland (PJM, USA, suggests that the proposed method outperforms individual techniques of price forecasting, such as support vector machine (SVM, generalized regression neural networks (GRNN, day-ahead modeling, and self-organized map (SOM similar days modeling.

Laser shaft alignment measurement model

Science.gov (United States)

Mo, Chang-tao; Chen, Changzheng; Hou, Xiang-lin; Zhang, Guoyu

2007-12-01

Laser beam's track which is on photosensitive surface of the a receiver will be closed curve, when driving shaft and the driven shaft rotate with same angular velocity and rotation direction. The coordinate of arbitrary point which is on the curve is decided by the relative position of two shafts. Basing on the viewpoint, a mathematic model of laser alignment is set up. By using a data acquisition system and a data processing model of laser alignment meter with single laser beam and a detector, and basing on the installation parameter of computer, the state parameter between two shafts can be obtained by more complicated calculation and correction. The correcting data of the four under chassis of the adjusted apparatus moving on the level and the vertical plane can be calculated. This will instruct us to move the apparatus to align the shafts.

On Transaction-Cost Models in Continuous-Time Markets

Directory of Open Access Journals (Sweden)

Thomas Poufinas

2015-04-01

Full Text Available Transaction-cost models in continuous-time markets are considered. Given that investors decide to buy or sell at certain time instants, we study the existence of trading strategies that reach a certain final wealth level in continuous-time markets, under the assumption that transaction costs, built in certain recommended ways, have to be paid. Markets prove to behave in manners that resemble those of complete ones for a wide variety of transaction-cost types. The results are important, but not exclusively, for the pricing of options with transaction costs.

Modelling of multi-block data

DEFF Research Database (Denmark)

Høskuldsson, Agnar; Svinning, K.

2006-01-01

Here is presented a unified approach to modelling multi-block regression data. The starting point is a partition of the data X into L data blocks, X = (X-1, X-2,...X-L), and the data Y into M data-blocks, Y = (Y-1, Y-2,...,Y-M). The methods of linear regression, X -> Y, are extended to the case...... of a linear relationship between each X-i and Y-j. X-i -> Y-j. A modelling strategy is used to decide if the residual X-i should take part in the modelling of one or more Y(j)s. At each step the procedure of finding score vectors is based on well-defined optimisation procedures. The principle of optimisation...... is based on that the score vectors should give the sizes of the resulting Y(j)s loading vectors as large as possible. The partition of X and Y are independent of each other. The choice of Y-j can be X-j, Y-i = X-i, thus including the possibility of modelling X -> X-i,i=1,...,L. It is shown how...

Automatic Generation of 3D Building Models with Multiple Roofs

Institute of Scientific and Technical Information of China (English)

Kenichi Sugihara; Yoshitugu Hayashi

2008-01-01

Based on building footprints (building polygons) on digital maps, we are proposing the GIS and CG integrated system that automatically generates 3D building models with multiple roofs. Most building polygons' edges meet at right angles (orthogonal polygon). The integrated system partitions orthogonal building polygons into a set of rectangles and places rectangular roofs and box-shaped building bodies on these rectangles. In order to partition an orthogonal polygon, we proposed a useful polygon expression in deciding from which vertex a dividing line is drawn. In this paper, we propose a new scheme for partitioning building polygons and show the process of creating 3D roof models.

Business models in commercial media markets: Bargaining, advertising, and mixing

OpenAIRE

Thöne, Miriam; Rasch, Alexander; Wenzel, Tobias

2016-01-01

We consider a product and a media market and show how a change in the business model employed by the media platforms affects consumers, producers (or advertisers), and price negotiations for advertisements. On both markets, two firms differentiated á la Hotelling compete for consumers. On the media market, consumers can mix between the two outlets whereas on the product market, consumers have to decide for one supplier. With pay-tv, as opposed to free-to-air, mixing by consumers disappears, p...

Deciding Full Branching Time Logic by Program Transformation

Science.gov (United States)

Pettorossi, Alberto; Proietti, Maurizio; Senni, Valerio

We present a method based on logic program transformation, for verifying Computation Tree Logic (CTL*) properties of finite state reactive systems. The finite state systems and the CTL* properties we want to verify, are encoded as logic programs on infinite lists. Our verification method consists of two steps. In the first step we transform the logic program that encodes the given system and the given property, into a monadic ω -program, that is, a stratified program defining nullary or unary predicates on infinite lists. This transformation is performed by applying unfold/fold rules that preserve the perfect model of the initial program. In the second step we verify the property of interest by using a proof method for monadic ω-programs.

Comparison of elastic-viscous-plastic and viscous-plastic dynamics models using a high resolution Arctic sea ice model

Energy Technology Data Exchange (ETDEWEB)

Hunke, E.C. [Los Alamos National Lab., NM (United States); Zhang, Y. [Naval Postgraduate School, Monterey, CA (United States)

1997-12-31

A nonlinear viscous-plastic (VP) rheology proposed by Hibler (1979) has been demonstrated to be the most suitable of the rheologies commonly used for modeling sea ice dynamics. However, the presence of a huge range of effective viscosities hinders numerical implementations of this model, particularly on high resolution grids or when the ice model is coupled to an ocean or atmosphere model. Hunke and Dukowicz (1997) have modified the VP model by including elastic waves as a numerical regularization in the case of zero strain rate. This modification (EVP) allows an efficient, fully explicit discretization that adapts well to parallel architectures. The authors present a comparison of EVP and VP dynamics model results from two 5-year simulations of Arctic sea ice, obtained with a high resolution sea ice model. The purpose of the comparison is to determine how differently the two dynamics models behave, and to decide whether the elastic-viscous-plastic model is preferable for high resolution climate simulations, considering its high efficiency in parallel computation. Results from the first year of this experiment (1990) are discussed in detail in Hunke and Zhang (1997).

Linear Parametric Model Checking of Timed Automata

DEFF Research Database (Denmark)

Hune, Tohmas Seidelin; Romijn, Judi; Stoelinga, Mariëlle

2001-01-01

We present an extension of the model checker Uppaal capable of synthesize linear parameter constraints for the correctness of parametric timed automata. The symbolic representation of the (parametric) state-space is shown to be correct. A second contribution of this paper is the identication...... of a subclass of parametric timed automata (L/U automata), for which the emptiness problem is decidable, contrary to the full class where it is know to be undecidable. Also we present a number of lemmas enabling the verication eort to be reduced for L/U automata in some cases. We illustrate our approach...

The value of models in informing resource allocation in colorectal cancer screening – 1 the case of the Netherlands

Science.gov (United States)

van Hees, Frank; Zauber, Ann G.; van Veldhuizen, Harriët; Heijnen, Marie-Louise A.; Penning, Corine; de Koning, Harry J.; van Ballegooijen, Marjolein; Lansdorp-Vogelaar, Iris

2015-01-01

In May 2011, the Dutch government decided to implement a national programme for colorectal cancer (CRC) screening using biennial faecal immunochemical test (FIT) screening between ages 55 and 75.[1] Decision modelling played an important role in informing this decision, as well as in the planning and implementation of the programme afterwards. In this overview, we illustrate the value of models in informing resource allocation in CRC screening, using the role that decision modelling has played in the Dutch CRC screening programme as an example. PMID:26063755

Investigating the Potential of Using Off-Axis 3D Woven Composites in Composite Joints’ Applications

KAUST Repository

Saleh, Mohamed Nasr; Wang, Ying; Yudhanto, Arief; Joesbury, Adam; Potluri, Prasad; Lubineau, Gilles; Soutis, Constantinos

2016-01-01

The effect of circular notch has been evaluated for three different architectures of three-dimensional (3D) carbon fibre woven composites (orthogonal, ORT; layer-to-layer, LTL; angle interlock, AI) through open-hole quasi-static tension and double-lap bearing strength tests in the off-axis (45°) direction. Damage characterisation is monitored using Digital Image correlation (DIC) for open-hole testing and X-ray Computed Tomography (CT) for double-lap bearing strength test. The off-axis notched 3D woven composites exhibits minor reduction (less than 10 %) of the notched strength compared to the un-notched strength. DIC strain contour clearly show stress/strain localisation regions around the hole periphery and stress/strain redistribution away from the whole due to the z-binder existence, especially for ORT architecture. Up to 50 % bearing strain, no significant difference in the bearing stress/bearing strain response is observed. However when ORT architecture was loaded up to failure, it demonstrates higher strain to failure (~140 %) followed by AI (~105 %) and lastly LTL (~85 %). X-ray CT scans reveal the effect of the z-binder architecture on damage evolution and delamination resistance. The study suggests that off-axis loaded 3D woven composites, especially ORT architecture, has a great potential of overcoming the current challenges facing composite laminates when used in composite joints’ applications. © 2016 The Author(s)

Investigating the Potential of Using Off-Axis 3D Woven Composites in Composite Joints’ Applications

KAUST Repository

Saleh, Mohamed Nasr

2016-09-26

The effect of circular notch has been evaluated for three different architectures of three-dimensional (3D) carbon fibre woven composites (orthogonal, ORT; layer-to-layer, LTL; angle interlock, AI) through open-hole quasi-static tension and double-lap bearing strength tests in the off-axis (45°) direction. Damage characterisation is monitored using Digital Image correlation (DIC) for open-hole testing and X-ray Computed Tomography (CT) for double-lap bearing strength test. The off-axis notched 3D woven composites exhibits minor reduction (less than 10 %) of the notched strength compared to the un-notched strength. DIC strain contour clearly show stress/strain localisation regions around the hole periphery and stress/strain redistribution away from the whole due to the z-binder existence, especially for ORT architecture. Up to 50 % bearing strain, no significant difference in the bearing stress/bearing strain response is observed. However when ORT architecture was loaded up to failure, it demonstrates higher strain to failure (~140 %) followed by AI (~105 %) and lastly LTL (~85 %). X-ray CT scans reveal the effect of the z-binder architecture on damage evolution and delamination resistance. The study suggests that off-axis loaded 3D woven composites, especially ORT architecture, has a great potential of overcoming the current challenges facing composite laminates when used in composite joints’ applications. © 2016 The Author(s)

GENERAL REQUIREMENTS FOR SIMULATION MODELS IN WASTE MANAGEMENT

International Nuclear Information System (INIS)

Miller, Ian; Kossik, Rick; Voss, Charlie

2003-01-01

Most waste management activities are decided upon and carried out in a public or semi-public arena, typically involving the waste management organization, one or more regulators, and often other stakeholders and members of the public. In these environments, simulation modeling can be a powerful tool in reaching a consensus on the best path forward, but only if the models that are developed are understood and accepted by all of the parties involved. These requirements for understanding and acceptance of the models constrain the appropriate software and model development procedures that are employed. This paper discusses requirements for both simulation software and for the models that are developed using the software. Requirements for the software include transparency, accessibility, flexibility, extensibility, quality assurance, ability to do discrete and/or continuous simulation, and efficiency. Requirements for the models that are developed include traceability, transparency, credibility/validity, and quality control. The paper discusses these requirements with specific reference to the requirements for performance assessment models that are used for predicting the long-term safety of waste disposal facilities, such as the proposed Yucca Mountain repository

System modelling and energy management for grid connected PV systems associated with storage

OpenAIRE

Riffonneau , Yann; DELAILLE , Arnaud; Barruel , Franck; Bacha , Seddik

2008-01-01

International audience; This paper presents the modelling and energy management of a grid connected PV system associatedwith storage. Within the economic, energetic and environmental context, objective of the system is to ensure loadssupply at the least cost by optimising the use of solar power. Therefore, due to the complicated operating patterns, anenergy management system which decides on energy flow for any moment is necessary. First, we present the systemstudied. Based on an AC bus typol...

Analytic uncertainty and sensitivity analysis of models with input correlations

Science.gov (United States)

Zhu, Yueying; Wang, Qiuping A.; Li, Wei; Cai, Xu

2018-03-01

Probabilistic uncertainty analysis is a common means of evaluating mathematical models. In mathematical modeling, the uncertainty in input variables is specified through distribution laws. Its contribution to the uncertainty in model response is usually analyzed by assuming that input variables are independent of each other. However, correlated parameters are often happened in practical applications. In the present paper, an analytic method is built for the uncertainty and sensitivity analysis of models in the presence of input correlations. With the method, it is straightforward to identify the importance of the independence and correlations of input variables in determining the model response. This allows one to decide whether or not the input correlations should be considered in practice. Numerical examples suggest the effectiveness and validation of our analytic method in the analysis of general models. A practical application of the method is also proposed to the uncertainty and sensitivity analysis of a deterministic HIV model.

Fault Tolerant Control Using Gaussian Processes and Model Predictive Control

Directory of Open Access Journals (Sweden)

Yang Xiaoke

2015-03-01

Full Text Available Essential ingredients for fault-tolerant control are the ability to represent system behaviour following the occurrence of a fault, and the ability to exploit this representation for deciding control actions. Gaussian processes seem to be very promising candidates for the first of these, and model predictive control has a proven capability for the second. We therefore propose to use the two together to obtain fault-tolerant control functionality. Our proposal is illustrated by several reasonably realistic examples drawn from flight control.

Mathematical modeling of a thermovoltaic cell

Science.gov (United States)

White, Ralph E.; Kawanami, Makoto

1992-01-01

A new type of battery named 'Vaporvolt' cell is in the early stage of its development. A mathematical model of a CuO/Cu 'Vaporvolt' cell is presented that can be used to predict the potential and the transport behavior of the cell during discharge. A sensitivity analysis of the various transport and electrokinetic parameters indicates which parameters have the most influence on the predicted energy and power density of the 'Vaporvolt' cell. This information can be used to decide which parameters should be optimized or determined more accurately through further modeling or experimental studies. The optimal thicknesses of electrodes and separator, the concentration of the electrolyte, and the current density are determined by maximizing the power density. These parameter sensitivities and optimal design parameter values will help in the development of a better CuO/Cu 'Vaporvolt' cell.

Model of Advertising Communication in Sport

Directory of Open Access Journals (Sweden)

Stevo Popović

2016-02-01

Full Text Available The objective of this study represent the advertising communication, while the main goal will be directional to creating of advertising model with specific retrospection in sport. The main tasks of this study are, the first conducting a situational analysis, then setting objectives for advertising, deciding on the budget funds, choosing the target market, creation of the advertising messages, selection of appropriate media, as well as evaluating effectiveness of advertising. During the making of this study, the author used descriptive method with consulting of competent literature. The previous author’ experience in this field was also so useful. Moreover, the author used the analytic method and parallel method that is the most productive if you make some inferences about some appearance. Consequently, the main outcome of this study was creation of conceptual model of advertising communication with special application in sport industry.

Approaches in Modeling the Impact of Air Pollution-Induced Material Degradation

OpenAIRE

Boden, H.

1989-01-01

Damage to materials from air pollution is considered to be an important economic factor in society. For this reason, it was decided as part of the 1988 Young Scientists Summer Program at IIASA to explore the possibility of including a submodel for materials damage in IIASA's Regional Acidification INformation and Simulation (RAINS) model. This Working Paper is the result of this investigation. Although the conclusion of the author is that it is at the present time premature to include materia...

A Model of Bus Bunching under Reliability-based Passenger Arrival Patterns

OpenAIRE

Fonzone, Achille; Schmöcker, Jan-Dirk; Liu, Ronghui

2015-01-01

If bus service departure times are not completely unknown to the passengers, non-uniform passenger arrival patterns can be expected. We propose that passengers decide their arrival time at stops based on a continuous logit model that considers the risk of missing services. Expected passenger waiting times are derived in a bus system that allows also for overtaking between bus services. We then propose an algorithm to derive the dwell time of subsequent buses serving a stop in order to illustr...

Assessing The Performance of Hydrological Models

Science.gov (United States)

van der Knijff, Johan

The performance of hydrological models is often characterized using the coefficient of efficiency, E. The sensitivity of E to extreme streamflow values, and the difficulty of deciding what value of E should be used as a threshold to identify 'good' models or model parameterizations, have proven to be serious shortcomings of this index. This paper reviews some alternative performance indices that have appeared in the litera- ture. Legates and McCabe (1999) suggested a more generalized form of E, E'(j,B). Here, j is a parameter that controls how much emphasis is put on extreme streamflow values, and B defines a benchmark or 'null hypothesis' against which the results of the model are tested. E'(j,B) was used to evaluate a large number of parameterizations of a conceptual rainfall-runoff model, using 6 different combinations of j and B. First, the effect of j and B is explained. Second, it is demonstrated how the index can be used to explicitly test hypotheses about the model and the data. This approach appears to be particularly attractive if the index is used as a likelihood measure within a GLUE-type analysis.

Modeling the influence of polls on elections: a population dynamics approach

Energy Technology Data Exchange (ETDEWEB)

Hyman, James M [Los Alamos National Laboratory; Restrepo, Juan M [UNIV OF ARIZONA; Rael, Rosalyn C [UNIV OF ARIZONA

2009-01-01

We propose a population dynamics model for quantifying the effects of polling data on the outcome of multi-party elections decided by a majority-rule voting process. We divide the population into two groups: committed voters impervious to polling data, and susceptible voters whose decision to vote is influenced by data, depending on its reliability. This population-based approach to modeling the process sidesteps the problem of upscaling models based upon the choices made by individuals. We find releasing poll data is not advantageous to leading candidates, but it can be exploited by those closely trailing. The analysis identifies the particular type of voting impetus at play in different stages of an election and could help strategists optimize their influence on susceptible voters.

A precise electromagnetic field model useful for development of microwave imaging systems

DEFF Research Database (Denmark)

Chaber, Bartosz; Mohr, Johan Jacob

2016-01-01

was created in an iterative fashion in order to determine how much details are needed to make it reliable, while keeping it efficient.Findings - The authors found that the commercial software seems like a viable platform for developing electromagnetic solvers. The resulting computer model is easy to prepare......Purpose - The paper describes a fast forward electromagnetic model built with help of commercial software. The purpose of this paper is to create an efficient and robust electromagnetic field model that could be easily plugged into a working microwave imaging system. The secondary purpose...... is to evaluate advantages and disadvantages of such a commercial packages for creating such a model.Design/methodology/approach - In this paper the authors decided to build the model using COMSOL Multiphysics software suite, ultimately comparing its result to measurements of a real device. The numerical model...

The role of models in managing the uncertainty of software-intensive systems

International Nuclear Information System (INIS)

Littlewood, Bev; Neil, Martin; Ostrolenk, Gary

1995-01-01

It is increasingly argued that uncertainty is an inescapable feature of the design and operational behaviour of software-intensive systems. This paper elaborates the role of models in managing such uncertainty, in relation to evidence and claims for dependability. Personal and group models are considered with regard to abstraction, consensus and corroboration. The paper focuses on the predictive property of models, arguing for the need for empirical validation of their trustworthiness through experimentation and observation. The impact on trustworthiness of human fallibility, formality of expression and expressiveness is discussed. The paper identifies two criteria for deciding the degree of trust to be placed in a model, and hence also for choosing between models, namely accuracy and informativeness. Finally, analogy and reuse are proposed as the only means by which empirical evidence can be established for models in software engineering

A decision support model for identification and prioritization of key performance indicators in the logistics industry

OpenAIRE

Kucukaltan, Berk; Irani, Zahir; Aktas, Emel

2016-01-01

Performance measurement of logistics companies is based upon various performance indicators. Yet, in the logistics industry, there are several vaguenesses, such as deciding on key indicators and determining interrelationships between performance indicators. In order to resolve these vaguenesses, this paper first presents the stakeholder-informed Balanced Scorecard (BSC) model, by incorporating financial (e.g. cost) and non-financial (e.g. social media) performance indicators, with a comprehen...

Mars Propellant Liquefaction Modeling in Thermal Desktop

Science.gov (United States)

Desai, Pooja; Hauser, Dan; Sutherlin, Steven

2017-01-01

NASAs current Mars architectures are assuming the production and storage of 23 tons of liquid oxygen on the surface of Mars over a duration of 500+ days. In order to do this in a mass efficient manner, an energy efficient refrigeration system will be required. Based on previous analysis NASA has decided to do all liquefaction in the propulsion vehicle storage tanks. In order to allow for transient Martian environmental effects, a propellant liquefaction and storage system for a Mars Ascent Vehicle (MAV) was modeled using Thermal Desktop. The model consisted of a propellant tank containing a broad area cooling loop heat exchanger integrated with a reverse turbo Brayton cryocooler. Cryocooler sizing and performance modeling was conducted using MAV diurnal heat loads and radiator rejection temperatures predicted from a previous thermal model of the MAV. A system was also sized and modeled using an alternative heat rejection system that relies on a forced convection heat exchanger. Cryocooler mass, input power, and heat rejection for both systems were estimated and compared against sizing based on non-transient sizing estimates.

Boswellia Da/zielii Hutch

African Journals Online (AJOL)

BSN

The dishes were then dipped in each of the various extracts and placed on labded pans accord1ngl~ using u forceps. I he 1n11l>rn1atcd pl,1tc. containing the e\\tracts ''~h 1nu1batcd for 2-1 hours. I hL·rcalkr. otisen"ltl\\lll .:um prising thL· dialllL'tcr nr disk and zone or inhibition were liell.'.r1111ned .is dcsrnbed b~ l3ansu I.'/ ui.

JPRS Report, Science & Technology, USSR: Life Sciences.

Science.gov (United States)

1988-02-12

the [Leu]enkephalin pentapeptide Tyr-Gly-Gly-Phe-Leu (i)and its [D-Ala2]analog Tyr-D-Ala-Gly-Phe-Leu ( la ), which is more resistant to proteinases, by...Biology and Genetics, Ukrainian SSR Academy of Sciences, Kiev] ltl!tra°+V ^° la ^ion ^dies were conducted for mini forms of the M13 bacteri- ophage...of fodder substrates (hay, soya millet,,oats, wheat, barley, bean, etc.) Various degrees of growth were obtained on the various fodder products

A Layered Decision Model for Cost-Effective System Security

Energy Technology Data Exchange (ETDEWEB)

Wei, Huaqiang; Alves-Foss, James; Soule, Terry; Pforsich, Hugh; Zhang, Du; Frincke, Deborah A.

2008-10-01

System security involves decisions in at least three areas: identification of well-defined security policies, selection of cost-effective defence strategies, and implementation of real-time defence tactics. Although choices made in each of these areas affect the others, existing decision models typically handle these three decision areas in isolation. There is no comprehensive tool that can integrate them to provide a single efficient model for safeguarding a network. In addition, there is no clear way to determine which particular combinations of defence decisions result in cost-effective solutions. To address these problems, this paper introduces a Layered Decision Model (LDM) for use in deciding how to address defence decisions based on their cost-effectiveness. To validate the LDM and illustrate how it is used, we used simulation to test model rationality and applied the LDM to the design of system security for an e-commercial business case.

Qualitative analysis of how patients decide that they want risk-reducing mastectomy, and the implications for surgeons in responding to emotionally-motivated patient requests.

Science.gov (United States)

Brown, Stephen L; Whiting, Demian; Fielden, Hannah G; Saini, Pooja; Beesley, Helen; Holcombe, Christopher; Holcombe, Susan; Greenhalgh, Lyn; Fairburn, Louise; Salmon, Peter

2017-01-01

Contemporary approaches to medical decision-making advise that clinicians should respect patients' decisions. However, patients' decisions are often shaped by heuristics, such as being guided by emotion, rather than by objective risk and benefit. Risk-reducing mastectomy (RRM) decisions focus this dilemma sharply. RRM reduces breast cancer (BC) risk, but is invasive and can have iatrogenic consequences. Previous evidence suggests that emotion guides patients' decision-making about RRM. We interviewed patients to better understand how they made decisions about RRM, using findings to consider how clinicians could ethically respond to their decisions. Qualitative face-to-face interviews with 34 patients listed for RRM surgery and two who had decided against RRM. Patients generally did not use objective risk estimates or, indeed, consider risks and benefits of RRM. Instead emotions guided their decisions: they chose RRM because they feared BC and wanted to do 'all they could' to prevent it. Most therefore perceived RRM to be the 'obvious' option and made the decision easily. However, many recounted extensive post-decisional deliberation, generally directed towards justifying the original decision. A few patients deliberated before the decision because fears of surgery counterbalanced those of BC. Patients seeking RRM were motivated by fear of BC, and the need to avoid potential regret for not doing all they could to prevent it. We suggest that choices such as that for RRM, which are made emotionally, can be respected as autonomous decisions, provided patients have considered risks and benefits. Drawing on psychological theory about how people do make decisions, as well as normative views of how they should, we propose that practitioners can guide consideration of risks and benefits even, where necessary, after patients have opted for surgery. This model of practice could be extended to other medical decisions that are influenced by patients' emotions.

Qualitative analysis of how patients decide that they want risk-reducing mastectomy, and the implications for surgeons in responding to emotionally-motivated patient requests.

Directory of Open Access Journals (Sweden)

Stephen L Brown

Full Text Available Contemporary approaches to medical decision-making advise that clinicians should respect patients' decisions. However, patients' decisions are often shaped by heuristics, such as being guided by emotion, rather than by objective risk and benefit. Risk-reducing mastectomy (RRM decisions focus this dilemma sharply. RRM reduces breast cancer (BC risk, but is invasive and can have iatrogenic consequences. Previous evidence suggests that emotion guides patients' decision-making about RRM. We interviewed patients to better understand how they made decisions about RRM, using findings to consider how clinicians could ethically respond to their decisions.Qualitative face-to-face interviews with 34 patients listed for RRM surgery and two who had decided against RRM.Patients generally did not use objective risk estimates or, indeed, consider risks and benefits of RRM. Instead emotions guided their decisions: they chose RRM because they feared BC and wanted to do 'all they could' to prevent it. Most therefore perceived RRM to be the 'obvious' option and made the decision easily. However, many recounted extensive post-decisional deliberation, generally directed towards justifying the original decision. A few patients deliberated before the decision because fears of surgery counterbalanced those of BC.Patients seeking RRM were motivated by fear of BC, and the need to avoid potential regret for not doing all they could to prevent it. We suggest that choices such as that for RRM, which are made emotionally, can be respected as autonomous decisions, provided patients have considered risks and benefits. Drawing on psychological theory about how people do make decisions, as well as normative views of how they should, we propose that practitioners can guide consideration of risks and benefits even, where necessary, after patients have opted for surgery. This model of practice could be extended to other medical decisions that are influenced by patients' emotions.

Perspective in site-suitability modelling

International Nuclear Information System (INIS)

Chartier, M.

1989-01-01

The Steering Committee for Nuclear Energy of the OECD-Nuclear Energy Agency decided in April 1981 to set up a Co-ordinated Research and Environmental Surveillance Programme relevant to sea disposal of radioactive waste (CRESP) with the objective of reinforcing the scientific basis of future assessments of the continued suitability of the North-East Atlantic site to be made under the NEA Multilateral Consultation and Surveillance Mechanism. A major component of the initial CRESP plan was the development of a site-specific model to predict radionuclide transfer rates and patterns in the marine environment. A new general approach to the design of such a site-specific model is discussed.Although this approach originates partly from methodologies presented in GESAMP partly from an approach put forward within the NEA Seabed Working Group/Geochemical and Physical Oceanography Task Group and partly from methods previously agreed by the CRESP Modelling Task Group, the modelling philosophy developed in the text expressed the personal viewpoint of the author. This text aims to state the present methods of modelling the marine transfer of radionuclides and to anticipate modelling strategies which may be adopted in the future (in France for example), but it does not necessarily meet present NEA viewpoints and the philosophy of other CRESP participating countries

Significance tests to determine the direction of effects in linear regression models.

Science.gov (United States)

Wiedermann, Wolfgang; Hagmann, Michael; von Eye, Alexander

2015-02-01

Previous studies have discussed asymmetric interpretations of the Pearson correlation coefficient and have shown that higher moments can be used to decide on the direction of dependence in the bivariate linear regression setting. The current study extends this approach by illustrating that the third moment of regression residuals may also be used to derive conclusions concerning the direction of effects. Assuming non-normally distributed variables, it is shown that the distribution of residuals of the correctly specified regression model (e.g., Y is regressed on X) is more symmetric than the distribution of residuals of the competing model (i.e., X is regressed on Y). Based on this result, 4 one-sample tests are discussed which can be used to decide which variable is more likely to be the response and which one is more likely to be the explanatory variable. A fifth significance test is proposed based on the differences of skewness estimates, which leads to a more direct test of a hypothesis that is compatible with direction of dependence. A Monte Carlo simulation study was performed to examine the behaviour of the procedures under various degrees of associations, sample sizes, and distributional properties of the underlying population. An empirical example is given which illustrates the application of the tests in practice. © 2014 The British Psychological Society.

Desenredando las identidades soberanistas vasca y catalana: un Análisis de Redes Sociales de las etiquetas de Twitter #BasquesDecide y #Up4Freedom

Directory of Open Access Journals (Sweden)

Jordi Morales i Gras

2015-09-01

Full Text Available La intención de este artículo es identificar y comparar mediante técnicas de Análisis de Redes Sociales algunos de los agentes que contribuyen de manera relevante al proceso de configuración de identidades políticas soberanistas en el País Vasco y en Cataluña, así como atender a las relaciones establecidas entre los participantes de los debates bajo las etiquetas #BasquesDecide y #Up4Freedom. El artículo muestra que existen diferencias sustanciales entre las comunicaciones establecidas en Twitter bajo ambas etiquetas tanto por lo que respecta a la participación de sus usuarios como por el tipo de usuarios que gozan de mayor influencia o poder en las redes y las dinámicas que configuran sus comunidades.

A Test of the Integrity of the Components of Baddeley's Model of Working Memory in Attention-Deficit/Hyperactivity Disorder (ADHD)

Science.gov (United States)

Karatekin, Canan

2004-01-01

Background: The integrity of working memory in attention-deficit/hyperactivity disorder (ADHD) was tested within the framework of Baddeley's model. Methods-1: Buffers and rehearsal mechanisms were assessed by presenting children with or without ADHD (ages 8 to 15) with 1-7 target letters and a probe after 2-10 s. They decided if the probe was the…

Integer Optimization Model for a Logistic System based on Location-Routing Considering Distance and Chosen Route

Science.gov (United States)

Mulyasari, Joni; Mawengkang, Herman; Efendi, Syahril

2018-02-01

In a distribution network it is important to decide the locations of facilities that impacts not only the profitability of an organization but the ability to serve customers.Generally the location-routing problem is to minimize the overall cost by simultaneously selecting a subset of candidate facilities and constructing a set of delivery routes that satisfy some restrictions. In this paper we impose restriction on the route that should be passed for delivery. We use integer programming model to describe the problem. A feasible neighbourhood search is proposed to solve the result model.

Canonical vs. micro-canonical sampling methods in a 2D Ising model

International Nuclear Information System (INIS)

Kepner, J.

1990-12-01

Canonical and micro-canonical Monte Carlo algorithms were implemented on a 2D Ising model. Expressions for the internal energy, U, inverse temperature, Z, and specific heat, C, are given. These quantities were calculated over a range of temperature, lattice sizes, and time steps. Both algorithms accurately simulate the Ising model. To obtain greater than three decimal accuracy from the micro-canonical method requires that the more complicated expression for Z be used. The overall difference between the algorithms is small. The physics of the problem under study should be the deciding factor in determining which algorithm to use. 13 refs., 6 figs., 2 tabs

The Logistic Maturity Model: Application to a Fashion Company

Directory of Open Access Journals (Sweden)

Claudia Battista

2013-08-01

Full Text Available This paper describes the structure of the logistic maturity model (LMM in detail and shows the possible improvements that can be achieved by using this model in terms of the identification of the most appropriate actions to be taken in order to increase the performance of the logistics processes in industrial companies. The paper also gives an example of the LMM’s application to a famous Italian female fashion firm, which decided to use the model as a guideline for the optimization of its supply chain. Relying on a 5-level maturity staircase, specific achievement indicators as well as key performance indicators and best practices are defined and related to each logistics area/process/sub-process, allowing any user to easily and rapidly understand the more critical logistical issues in terms of process immaturity.

The Dominance of the Agency Model on Financing Decisions

Directory of Open Access Journals (Sweden)

Bramantyo Djohanputro

2015-08-01

Full Text Available There are some issues about how companies consider their financing. These issues are related to the amount, source, type, and the structure of such financing. So far, there is no uniform model that is able to explain how companies deal with these issues. There are three competing, dominant theories of financing decision making, i.e. the Pecking Order Theory, the Static Trade-off Theory, and the Agency Model Theory. This study attempts to explore which theory explains the best way for companies in the consumer industry to decide their financing method. There are five hypotheses to be tested in this study. Using data from public listed companies on the Indonesian Stock Exchange from 2008 to 2011, it seems that the Agency Model Theory is more dominant than the other two theories in explaining the way companies fulfill their financing needs.

Dynamics of synthetic drugs transmission model with psychological addicts and general incidence rate

Science.gov (United States)

Ma, Mingju; Liu, Sanyang; Xiang, Hong; Li, Jun

2018-02-01

Synthetic drugs are replacing traditional ones and becoming the main popular ones gradually, which have given rise to serious social issues in recent years. In this paper, a synthetic drugs transmission model with psychological addicts and general contact rate is proposed. The local and global stabilities are decided by the basic reproduction number R0. By analyzing the sensitivity of parameters, we obtain that controlling psychological addiction is better than drugs treatment. These results are verified by numerical simulations.

The Fermilab central computing facility architectural model

International Nuclear Information System (INIS)

Nicholls, J.

1989-01-01

The goal of the current Central Computing Upgrade at Fermilab is to create a computing environment that maximizes total productivity, particularly for high energy physics analysis. The Computing Department and the Next Computer Acquisition Committee decided upon a model which includes five components: an interactive front-end, a Large-Scale Scientific Computer (LSSC, a mainframe computing engine), a microprocessor farm system, a file server, and workstations. With the exception of the file server, all segments of this model are currently in production: a VAX/VMS cluster interactive front-end, an Amdahl VM Computing engine, ACP farms, and (primarily) VMS workstations. This paper will discuss the implementation of the Fermilab Central Computing Facility Architectural Model. Implications for Code Management in such a heterogeneous environment, including issues such as modularity and centrality, will be considered. Special emphasis will be placed on connectivity and communications between the front-end, LSSC, and workstations, as practiced at Fermilab. (orig.)

Context Sensitive Modeling of Cancer Drug Sensitivity.

Directory of Open Access Journals (Sweden)

Bo-Juen Chen

Full Text Available Recent screening of drug sensitivity in large panels of cancer cell lines provides a valuable resource towards developing algorithms that predict drug response. Since more samples provide increased statistical power, most approaches to prediction of drug sensitivity pool multiple cancer types together without distinction. However, pan-cancer results can be misleading due to the confounding effects of tissues or cancer subtypes. On the other hand, independent analysis for each cancer-type is hampered by small sample size. To balance this trade-off, we present CHER (Contextual Heterogeneity Enabled Regression, an algorithm that builds predictive models for drug sensitivity by selecting predictive genomic features and deciding which ones should-and should not-be shared across different cancers, tissues and drugs. CHER provides significantly more accurate models of drug sensitivity than comparable elastic-net-based models. Moreover, CHER provides better insight into the underlying biological processes by finding a sparse set of shared and type-specific genomic features.

The Fermilab Central Computing Facility architectural model

International Nuclear Information System (INIS)

Nicholls, J.

1989-05-01

The goal of the current Central Computing Upgrade at Fermilab is to create a computing environment that maximizes total productivity, particularly for high energy physics analysis. The Computing Department and the Next Computer Acquisition Committee decided upon a model which includes five components: an interactive front end, a Large-Scale Scientific Computer (LSSC, a mainframe computing engine), a microprocessor farm system, a file server, and workstations. With the exception of the file server, all segments of this model are currently in production: a VAX/VMS Cluster interactive front end, an Amdahl VM computing engine, ACP farms, and (primarily) VMS workstations. This presentation will discuss the implementation of the Fermilab Central Computing Facility Architectural Model. Implications for Code Management in such a heterogeneous environment, including issues such as modularity and centrality, will be considered. Special emphasis will be placed on connectivity and communications between the front-end, LSSC, and workstations, as practiced at Fermilab. 2 figs

Formal Specification and Verification of Real-Time Multi-Agent Systems using Timed-Arc Petri Nets

Directory of Open Access Journals (Sweden)

QASIM, A.

2015-08-01

Full Text Available In this study we have formally specified and verified the actions of communicating real-time software agents (RTAgents. Software agents are expected to work autonomously and deal with unfamiliar situations astutely. Achieving cent percent test cases coverage for these agents has always been a problem due to limited resources. Also a high degree of dependability and predictability is expected from real-time software agents. In this research we have used Timed-Arc Petri Net's for formal specification and verification. Formal specification of e-agents has been done in the past using Linear Temporal Logic (LTL but we believe that Timed-Arc Petri Net's being more visually expressive provides a richer framework for such formalism. A case study of Stock Market System (SMS based on Real Time Multi Agent System framework (RTMAS using Timed-Arc Petri Net's is taken to illustrate the proposed modeling approach. The model was verified used AF, AG, EG, and EF fragments of Timed Computational Tree Logic (TCTL via translations to timed automata.

İlişkide Karar Verme Ölçeğinin Türk Kültürüne Uyarlanması / The Turkish Adaptation of Relationship Deciding Scale

Directory of Open Access Journals (Sweden)

Cansu Tosun

2017-06-01

Full Text Available Abstract The purpose of this study was to assess the validity and reliability of Relationship Deciding Scale (Vennum & Fincham, 2011 for Turkish culture. The sample of the study consisted of 880 students (EFA=439, CFA=441 studying at Karadeniz Technical University. Criterion-related validity, exploratory and confirmatory factor analyses were conducted for the validity of RDS while internal consistency, split half and test-retest techniques were performed to examine the reliability of RDS. Exploratory factor analysis (EFA revealed that the scale had two-factor structures. However, two items were removed from the scale because they didn't have appropriate factor loadings. The scale consisting of 10 items explained 58.97% of the total variance. The results of confirmatory factor analysis (CFA indicated that the model was compatible with the data. In the reliability analysis for EFA and CFA samples, Cronbach alpha coefficients were found as .87 and .86 respectively. Internal consistency coefficients of subscales were found as .83 and .80 for “Relationship Confidence”, .82 and .84 for “Directing Relationship”. According to test-retest reliability analysis results, the whole scale’s coefficient was r= .67. In addition, as a result of criterion validity analysis, correlations (r= .33 between Self-Control Scale (Duyan, Gülden & Gelbal, 2012 and Relationship Deciding Scale (RDS were found to be statistically significant. In conclusion, these findings suggest that RDS, which has two-factor structures with 10 items, can be suggested as a valid and reliable instrument in Turkish culture. Öz Bu araştırmanın amacı, Vennum ve Fincham (2011 tarafından geliştirilen İlişkide Karar Verme Ölçeği’nin (Relationship Deciding Scale Türk kültürüne uyarlanması ile ilgili geçerlik ve güvenirlik işlemlerini yapmaktır. Araştırma grubu Karadeniz Teknik Üniversitesi’nde öğrenim gören 880 öğrenciden (AFA=439, DFA=441 olu

Some hybrid models applicable to dose-response relationships

International Nuclear Information System (INIS)

Kumazawa, Shigeru

1992-01-01

A new type of models of dose-response relationships has been studied as an initial stage to explore a reliable extrapolation of the relationships decided by high dose data to the range of low dose covered by radiation protection. The approach is to use a 'hybrid scale' of linear and logarithmic scales; the first model is that the normalized surviving fraction (ρ S > 0) in a hybrid scale decreases linearly with dose in a linear scale, and the second is that the induction in a log scale increases linearly with the normalized dose (τ D > 0) in a hybrid scale. The hybrid scale may reflect an overall effectiveness of a complex system against adverse events caused by various agents. Some data of leukemia in the atomic bomb survivors and of rodent experiments were used to show the applicability of hybrid scale models. The results proved that proposed models fit these data not less than the popular linear-quadratic models, providing the possible interpretation of shapes of dose-response curves, e.g. shouldered survival curves varied by recovery time. (author)

When fast logic meets slow belief: Evidence for a parallel-processing model of belief bias

OpenAIRE

Trippas, Dries; Thompson, Valerie A.; Handley, Simon J.

2016-01-01

Two experiments pitted the default-interventionist account of belief bias against a parallel-processing model. According to the former, belief bias occurs because a fast, belief-based evaluation of the conclusion pre-empts a working-memory demanding logical analysis. In contrast, according to the latter both belief-based and logic-based responding occur in parallel. Participants were given deductive reasoning problems of variable complexity and instructed to decide whether the conclusion was ...

Thermoluminescence of Simulated Interstellar Matter after Gamma-ray Irradiation

OpenAIRE

Koike, K.; Nakagawa, M.; Koike, C.; Okada, M.; Chihara, H.

2002-01-01

Interstellar matter is known to be strongly irradiated by radiation and several types of cosmic ray particles. Simulated interstellar matter, such as forsterite $\\rm Mg_{2}SiO_{4}$, enstatite $\\rm MgSiO_{3}$ and magnesite $\\rm MgCO_{3}$ has been irradiated with the $\\rm ^{60}Co$ gamma-rays in liquid nitrogen, and also irradiated with fast neutrons at 10 K and 70 K by making use of the low-temperature irradiation facility of Kyoto University Reactor (KUR-LTL. Maximum fast neutron dose is $10^{...

Telomere length is associated with ACE I/D polymorphism in hypertensive patients with left ventricular hypertrophy

DEFF Research Database (Denmark)

Fyhrquist, Frej; Eriksson, Anders; Saijonmaa, Outi

2013-01-01

INTRODUCTION: Short telomeres are often associated with cardiovascular risk factors and age-related diseases, while the angiotensin converting enzyme (ACE) gene insertion/deletion polymorphism (DD, ID, II) has shown such associations less consistently. We hypothesized that telomere length...... and association of telomere length with cardiovascular risk is affected by ACE (I/D) genotype. METHODS: We measured leucocyte telomere length (LTL) by Southern blot and analysed ACE I/D genotypes in 1249 subjects with hypertension and left ventricular hypertrophy (LVH). We examined interactions of ACE I...

A Determination of Eligibility to the National Register of Historic Places for Select Historic Properties Along the Souris River in North Dakota

Science.gov (United States)

1989-08-01

Company Historic District," 1985. "Historic Resources of Hardin, Montana," :984. "Silver Bow Brewery Malt House," 1982. "Silver Bow County Poor Farm...34i QQL-- Q ..i FEATURE TYPE CULTURAL MATERIAL ’iii Site Type -0,- Cm Scatter , , Bone 0 Chimney %.Z Ceramics tA Context .Q, Depression 1 Charcoal i...Sec , QQQ i, QQ . Q, ,LTL, L- Twp R ,.. , Sec ,., QQO 1- QQ’ L- Q’ ’ FEATURE TYPE CULTURAL MATERIAL &. Site Type m, Cm Scatter ,.Z, Bone Chimney

MODELLING AND ANALYSIS OF TOWER INTERVENTION EQUIPMENT OF OIL & GAS WELLS

Directory of Open Access Journals (Sweden)

César A. Chagoyén-Méndez

2015-04-01

Full Text Available In this paper, the modeling and analysis of one tower Workover Rig belonging to a maintenance facility for oil and gas wells is presented. When performing the maintenance of this tower, it is detected that one of the elements of the structure has some deformation. It was decided not to put it into operation and submit it to research. The modeling of invariants as well as ways of modeling soil structure interaction is discussed. It was necessary to determine the material properties with the performing of test of some samples taken on two components of the tower. The structural behavior of the tower to operating loads are then studied, proving that the effect of the deformed element in the structure is not significant for the stresses to which are subject.

The Aalborg Model and management by objectives and resources

DEFF Research Database (Denmark)

Qvist, Palle; Spliid, Claus Monrad

2010-01-01

Model is successful has never been subject to a scientific study. An educational program in an HEI (Higher Education Institution) can be seen and understood as a system managed by objectives (MBO)5 within a given resource frame and based on an “agreement” between the student and the study board....... The student must achieve the objectives decided by the study board and that achievement is then documented with an exam. The study board supports the student with resources which helps them to fulfill the objectives. When the resources are divided into human, material and methodological resources...

Everyday ethical problems in dementia care: a teleological model.

Science.gov (United States)

Bolmsjö, Ingrid Agren; Edberg, Anna-Karin; Sandman, Lars

2006-07-01

In this article, a teleological model for analysis of everyday ethical situations in dementia care is used to analyse and clarify perennial ethical problems in nursing home care for persons with dementia. This is done with the aim of describing how such a model could be useful in a concrete care context. The model was developed by Sandman and is based on four aspects: the goal; ethical side-constraints to what can be done to realize such a goal; structural constraints; and nurses' ethical competency. The model contains the following main steps: identifying and describing the normative situation; identifying and describing the different possible alternatives; assessing and evaluating the different alternatives; and deciding on, implementing and evaluating the chosen alternative. Three ethically difficult situations from dementia care were used for the application of the model. The model proved useful for the analysis of nurses' everyday ethical dilemmas and will be further explored to evaluate how well it can serve as a tool to identify and handle problems that arise in nursing care.

A Representation for Gaining Insight into Clinical Decision Models

Science.gov (United States)

Jimison, Holly B.

1988-01-01

For many medical domains uncertainty and patient preferences are important components of decision making. Decision theory is useful as a representation for such medical models in computer decision aids, but the methodology has typically had poor performance in the areas of explanation and user interface. The additional representation of probabilities and utilities as random variables serves to provide a framework for graphical and text insight into complicated decision models. The approach allows for efficient customization of a generic model that describes the general patient population of interest to a patient- specific model. Monte Carlo simulation is used to calculate the expected value of information and sensitivity for each model variable, thus providing a metric for deciding what to emphasize in the graphics and text summary. The computer-generated explanation includes variables that are sensitive with respect to the decision or that deviate significantly from what is typically observed. These techniques serve to keep the assessment and explanation of the patient's decision model concise, allowing the user to focus on the most important aspects for that patient.

Dialysis: Deciding to Stop

Science.gov (United States)

... Names, addresses and telephone numbers of your attorney, accountant, family members and other loved ones, friends and ... Wise Giving Alliance Charity Seal provides the giving public with an easily recognizable symbol which certifies that ...

Deciding treatment for miscarriage

DEFF Research Database (Denmark)

Olesen, Mette Linnet; Graungaard, Anette H; Husted, Gitte R

2015-01-01

understanding of the women's reactions. In relation to theory about informed consent, our findings suggest that women need more understanding of the treatments before making a decision. This study is limited due to a small sample size, but it generates important findings that need to be examined in a larger...... to gain insight into this process and the circumstances that may affect it. METHOD: A qualitative study using a grounded theory approach. Data were obtained through semi-structured interviews with six women who had chosen and completed either surgical, medical or expectant treatment for miscarriage...... sample. CONCLUSION: Frequently, women did not use information provided about treatment pros and cons in their decision-making process. Because of unspoken thoughts, and women's needs being unexplored by healthcare professionals, information did not target women's needs and their reasoning remained...

Let the Experts Decide?

DEFF Research Database (Denmark)

Morton, Rebecca; Tyran, Jean-Robert

in information quality is large, we find that voting groups largely coordinate on the SVC equilibrium which is also Pareto Optimal. However, we find that when the asymmetry in information quality is not large and the Pareto Optimal equilibrium is for all to participate, significant numbers of voters with low...

Deciding about an IUD

Science.gov (United States)

... RD, eds. Conn's Current Therapy 2017 . Philadelphia, PA: Elsevier; 2016:chap 17. Copper T IUD. Association of ... Endocrinology: Adult and Pediatric . 7th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 134. Hormonal IUD. Association of ...

Deciding Between Conflicting Influences

DEFF Research Database (Denmark)

Jensen, Andreas Schmidt

2013-01-01

This paper investigates an approach of decision making internally in an agent in which a decision is based on both preference and expectation. The approach uses a logic for qualitative decision theory proposed by Boutilier in order to express such notions. To make readily use of this we describe ...

Applying transport-distance specific SOC distribution to calibrate soil erosion model WaTEM

Science.gov (United States)

Hu, Yaxian; Heckrath, Goswin J.; Kuhn, Nikolaus J.

2016-04-01

Slope-scale soil erosion, transport and deposition fundamentally decide the spatial redistribution of eroded sediments in terrestrial and aquatic systems, which further affect the burial and decomposition of eroded SOC. However, comparisons of SOC contents between upper eroding slope and lower depositional site cannot fully reflect the movement of eroded SOC in-transit along hillslopes. The actual transport distance of eroded SOC is decided by its settling velocity. So far, the settling velocity distribution of eroded SOC is mostly calculated from mineral particle specific SOC distribution. Yet, soil is mostly eroded in form of aggregates, and the movement of aggregates differs significantly from individual mineral particles. This urges a SOC erodibility parameter based on actual transport distance distribution of eroded fractions to better calibrate soil erosion models. Previous field investigation on a freshly seeded cropland in Denmark has shown immediate deposition of fast settling soil fractions and the associated SOC at footslopes, followed by a fining trend at the slope tail. To further quantify the long-term effects of topography on erosional redistribution of eroded SOC, the actual transport-distance specific SOC distribution observed on the field was applied to a soil erosion model WaTEM (based on USLE). After integrating with local DEM, our calibrated model succeeded in locating the hotspots of enrichment/depletion of eroded SOC on different topographic positions, much better corresponding to the real-world field observation. By extrapolating into repeated erosion events, our projected results on the spatial distribution of eroded SOC are also adequately consistent with the SOC properties in the consecutive sample profiles along the slope.

Assessment of anti-arrhythmic activity of antipsychotic drugs in an animal model

DEFF Research Database (Denmark)

Mow, Tomas; Frederiksen, Kristen; Thomsen, Morten B.

2015-01-01

limited experimental information exists about the effects of α1-adrenergic receptor activity of antipsychotic drugs in pro-arrhythmic models, we have decided to investigate this. In this study we show that four antipsychotic drugs all have high affinity for α1-adrenergic receptor (sertindole>risperidone>haloperidol......>olanzapine) and all block IKr (sertindole>haloperidol>risperidone>olanzapine). In canine Purkinje fibres, α1-adrenergic stimulation prolonged action potential duration; however, the stimulation does not cause afterdepolarizations, even in the presence of dofetilide-induced delayed repolarization. We showed...

Protocol for the Delirium and Cognitive Impact in Dementia (DECIDE) study: A nested prospective longitudinal cohort study.

Science.gov (United States)

Richardson, Sarah J; Davis, Daniel H J; Stephan, Blossom; Robinson, Louise; Brayne, Carol; Barnes, Linda; Parker, Stuart; Allan, Louise M

2017-04-28

Delirium is common, affecting at least 20% of older hospital inpatients. It is widely accepted that delirium is associated with dementia but the degree of causation within this relationship is unclear. Previous studies have been limited by incomplete ascertainment of baseline cognition or a lack of prospective delirium assessments. There is an urgent need for an improved understanding of the relationship between delirium and dementia given that delirium prevention may plausibly impact upon dementia prevention. A well-designed, observational study could also answer fundamental questions of major importance to patients and their families regarding outcomes after delirium. The Delirium and Cognitive Impact in Dementia (DECIDE) study aims to explore the association between delirium and cognitive function over time in older participants. In an existing population based cohort aged 65 years and older, the effect on cognition of an episode of delirium will be measured, independent of baseline cognition and illness severity. The predictive value of clinical parameters including delirium severity, baseline cognition and delirium subtype on cognitive outcomes following an episode of delirium will also be explored. Over a 12 month period, surviving participants from the Cognitive Function and Ageing Study II-Newcastle will be screened for delirium on admission to hospital. At the point of presentation, baseline characteristics along with a number of disease relevant clinical parameters will be recorded. The progression/resolution of delirium will be monitored. In those with and without delirium, cognitive decline and dementia will be assessed at one year follow-up. We will evaluate the effect of delirium on cognitive function over time along with the predictive value of clinical parameters. This study will be the first to prospectively elucidate the size of the effect of delirium upon cognitive decline and incident dementia. The results will be used to inform future

An economic model of friendship and enmity for measuring social balance in networks

Science.gov (United States)

Lee, Kyu-Min; Shin, Euncheol; You, Seungil

2017-12-01

We propose a dynamic economic model of networks where agents can be friends or enemies with one another. This is a decentralized relationship model in that agents decide whether to change their relationships so as to minimize their imbalanced triads. In this model, there is a single parameter, which we call social temperature, that captures the degree to which agents care about social balance in their relationships. We show that the global structure of relationship configuration converges to a unique stationary distribution. Using this stationary distribution, we characterize the maximum likelihood estimator of the social temperature parameter. Since the estimator is computationally challenging to calculate from real social network datasets, we provide a simple simulation algorithm and verify its performance with real social network datasets.

The reliability of pre-travel history to decide on appropriate counseling and vaccinations: a prospective study.

Science.gov (United States)

Rossi, Isabelle A; Genton, Blaise

2012-01-01

Although medical and travel plans gathered from pre-travel interviews are used to decide the provision of specific pre-travel health advice and vaccinations, there has been no evaluation of the relevance of this strategy. In a prospective study, we assessed the agreement between pre-travel plans and post-travel history and the effect on advice regarding the administration of vaccines and recommendations for malaria prevention. We included prospectively all consenting adults who had not planned an organized tour. Pre- and post-travel information included questions on destination, itineraries, departure and return dates, access to bottled water, plan of bicycle ride, stays in a rural zone, and close contact with animals. The outcomes measured included: agreement between pre- and post-travel itineraries and activities; and the effect of these differences on pre-travel health recommendations, had the traveler gone to the actual versus intended destinations for actual versus intended duration and activities. Three hundred and sixty-five travelers were included in the survey, where 188 (52%) were males (median age 38 years). In 81(23%) travelers, there was no difference between pre- and post-travel history. Disagreement between pre- and post-travel history were the highest for stays in rural zones or with local people (66% of travelers), close contact with animals (33%), and bicycle riding (21%). According to post-travel history, 125 (35%) travelers would have needed rabies vaccine and 9 (3%) typhoid fever vaccine. Potential overprovision of vaccine was found in travelers. A change in the malaria prescription would have been recommended in 18 (5%) travelers. Pre-travel history does not adequately reflect what travelers do. However, difference between recommendations for the actual versus intended travel plans was only clinically significant for the need for rabies vaccine. Particular attention during pre-travel health counseling should focus on the risk of rabies, the

Development of a career coaching model for medical students.

Science.gov (United States)

Hur, Yera

2016-03-01

Deciding on a future career path or choosing a career specialty is an important academic decision for medical students. The purpose of this study is to develop a career coaching model for medical students. This research was carried out in three steps. The first step was systematic review of previous studies. The second step was a need assessment of medical students. The third step was a career coaching model using the results acquired from the researched literature and the survey. The career coaching stages were defined as three big phases: The career coaching stages were defined as the "crystallization" period (Pre-medical year 1 and 2), "specification" period (medical year 1 and 2), and "implementation" period (medical year 3 and 4). The career coaching model for medical students can be used in programming career coaching contents and also in identifying the outcomes of career coaching programs at an institutional level.

System dynamics model of Suzhou water resources carrying capacity and its application

Directory of Open Access Journals (Sweden)

Li Cheng

2010-06-01

Full Text Available A model of Suzhou water resources carrying capacity (WRCC was set up using the method of system dynamics (SD. In the model, three different water resources utilization programs were adopted: (1 continuity of existing water utilization, (2 water conservation/saving, and (3 water exploitation. The dynamic variation of the Suzhou WRCC was simulated with the supply-decided principle for the time period of 2001 to 2030, and the results were characterized based on socio-economic factors. The corresponding Suzhou WRCC values for several target years were calculated by the model. Based on these results, proper ways to improve the Suzhou WRCC are proposed. The model also produced an optimized plan, which can provide a scientific basis for the sustainable utilization of Suzhou water resources and for the coordinated development of the society, economy, and water resources.

Cyto-Sim: a formal language model and stochastic simulator of membrane-enclosed biochemical processes.

Science.gov (United States)

Sedwards, Sean; Mazza, Tommaso

2007-10-15

Compartments and membranes are the basis of cell topology and more than 30% of the human genome codes for membrane proteins. While it is possible to represent compartments and membrane proteins in a nominal way with many mathematical formalisms used in systems biology, few, if any, explicitly model the topology of the membranes themselves. Discrete stochastic simulation potentially offers the most accurate representation of cell dynamics. Since the details of every molecular interaction in a pathway are often not known, the relationship between chemical species in not necessarily best described at the lowest level, i.e. by mass action. Simulation is a form of computer-aided analysis, relying on human interpretation to derive meaning. To improve efficiency and gain meaning in an automatic way, it is necessary to have a formalism based on a model which has decidable properties. We present Cyto-Sim, a stochastic simulator of membrane-enclosed hierarchies of biochemical processes, where the membranes comprise an inner, outer and integral layer. The underlying model is based on formal language theory and has been shown to have decidable properties (Cavaliere and Sedwards, 2006), allowing formal analysis in addition to simulation. The simulator provides variable levels of abstraction via arbitrary chemical kinetics which link to ordinary differential equations. In addition to its compact native syntax, Cyto-Sim currently supports models described as Petri nets, can import all versions of SBML and can export SBML and MATLAB m-files. Cyto-Sim is available free, either as an applet or a stand-alone Java program via the web page (http://www.cosbi.eu/Rpty_Soft_CytoSim.php). Other versions can be made available upon request.

Relationships between road safety, safety measures and external factors : a scan of the literature in view of model development and topics for further research.

NARCIS (Netherlands)

Churchill, T. & Norden, Y. van

2010-01-01

The purpose of this literature scan is to examine where literature on the effect of external factors and road safety measures on road safety exists and where it is lacking. This scan will help us to decide which factors to include in a comprehensive road safety model as SWOV is working on, and at

How Nurses Decide to Ambulate Hospitalized Older Adults: Development of a Conceptual Model

Science.gov (United States)

Doherty-King, Barbara; Bowers, Barbara

2011-01-01

Adults over the age of 65 years account for 60% of all hospital admissions and experience consequential negative outcomes directly related to hospitalization. Negative outcomes include falls, delirium, loss in ability to perform basic activities of daily living, and new walking dependence. New walking dependence, defined as the loss in ability to…

An optimization model for carbon capture & storage/utilization vs. carbon trading: A case study of fossil-fired power plants in Turkey.

Science.gov (United States)

Ağralı, Semra; Üçtuğ, Fehmi Görkem; Türkmen, Burçin Atılgan

2018-06-01

We consider fossil-fired power plants that operate in an environment where a cap and trade system is in operation. These plants need to choose between carbon capture and storage (CCS), carbon capture and utilization (CCU), or carbon trading in order to obey emissions limits enforced by the government. We develop a mixed-integer programming model that decides on the capacities of carbon capture units, if it is optimal to install them, the transportation network that needs to be built for transporting the carbon captured, and the locations of storage sites, if they are decided to be built. Main restrictions on the system are the minimum and maximum capacities of the different parts of the pipeline network, the amount of carbon that can be sold to companies for utilization, and the capacities on the storage sites. Under these restrictions, the model aims to minimize the net present value of the sum of the costs associated with installation and operation of the carbon capture unit and the transportation of carbon, the storage cost in case of CCS, the cost (or revenue) that results from the emissions trading system, and finally the negative revenue of selling the carbon to other entities for utilization. We implement the model on General Algebraic Modeling System (GAMS) by using data associated with two coal-fired power plants located in different regions of Turkey. We choose enhanced oil recovery (EOR) as the process in which carbon would be utilized. The results show that CCU is preferable to CCS as long as there is sufficient demand in the EOR market. The distance between the location of emission and location of utilization/storage, and the capacity limits on the pipes are an important factor in deciding between carbon capture and carbon trading. At carbon prices over $15/ton, carbon capture becomes preferable to carbon trading. These results show that as far as Turkey is concerned, CCU should be prioritized as a means of reducing nation-wide carbon emissions in an

Ideal Experimental Rat Models for Liver Diseases.

Science.gov (United States)

Lee, Sang Woo; Kim, Sung Hoon; Min, Seon Ok; Kim, Kyung Sik

2011-05-01

There are many limitations for conducting liver disease research in human beings due to the high cost and potential ethical issues. For this reason, conducting a study that is difficult to perform in humans using appropriate animal models, can be beneficial in ascertaining the pathological physiology, and in developing new treatment modalities. However, it is difficult to determine the appropriate animal model which is suitable for research purposes, since every patient has different and diverse clinical symptoms, adverse reactions, and complications due to the pathological physiology. Also, it is not easy to reproduce identically various clinical situations in animal models. Recently, the Guide for the Care and Use of Laboratory Animals has tightened up the regulations, and therefore it is advisable to select the appropriate animals and decide upon the appropriate quantities through scientific and systemic considerations before conducting animal testing. Therefore, in this review article the authors examined various white rat animal testing models and determined the appropriate usable rat model, and the pros and cons of its application in liver disease research. The authors believe that this review will be beneficial in selecting proper laboratory animals for research purposes.

Review of Dynamic Modeling and Simulation of Large Scale Belt Conveyor System

Science.gov (United States)

He, Qing; Li, Hong

Belt conveyor is one of the most important devices to transport bulk-solid material for long distance. Dynamic analysis is the key to decide whether the design is rational in technique, safe and reliable in running, feasible in economy. It is very important to study dynamic properties, improve efficiency and productivity, guarantee conveyor safe, reliable and stable running. The dynamic researches and applications of large scale belt conveyor are discussed. The main research topics, the state-of-the-art of dynamic researches on belt conveyor are analyzed. The main future works focus on dynamic analysis, modeling and simulation of main components and whole system, nonlinear modeling, simulation and vibration analysis of large scale conveyor system.

Big Data and Consumer Participation in Privacy Contracts: Deciding who Decides on Privacy

Directory of Open Access Journals (Sweden)

Michiel Rhoen

2015-02-01

Full Text Available Big data puts data protection to the test. Consumers granting permission to process their personal data are increasingly opening up their personal lives, thanks to the “datafication” of everyday life, indefinite data retention and the increasing sophistication of algorithms for analysis.The privacy implications of big data call for serious consideration of consumers’ opportunities to participate in decision-making processes about their contracts. If these opportunities are insufficient, the resulting rules may represent special interests rather than consumers’ needs. This may undermine the legitimacy of big data applications.This article argues that providing sufficient consumer participation in privacy matters requires choosing the best available decision making mechanism. Is a consumer to negotiate his own privacy terms in the market, will lawmakers step in on his behalf, or is he to seek protection through courts? Furthermore is this a matter of national law or European law? These choices will affect the opportunities for achieving different policy goals associated with the possible benefits of the “big data revolution”.

Calibration of environmental radionuclide transfer models using a Bayesian approach with Markov chain Monte Carlo simulations and model comparisons - Calibration of radionuclides transfer models in the environment using a Bayesian approach with Markov chain Monte Carlo simulation and comparison of models

Energy Technology Data Exchange (ETDEWEB)

Nicoulaud-Gouin, V.; Giacalone, M.; Gonze, M.A. [Institut de Radioprotection et de Surete Nucleaire-PRP-ENV/SERIS/LM2E (France); Martin-Garin, A.; Garcia-Sanchez, L. [IRSN-PRP-ENV/SERIS/L2BT (France)

2014-07-01

Calibration of transfer models according to observation data is a challenge, especially if parameters uncertainty is required, and if competing models should be decided between them. Generally two main calibration methods are used: The frequentist approach in which the unknown parameter of interest is supposed fixed and its estimation is based on the data only. In this category, least squared method has many restrictions in nonlinear models and competing models need to be nested in order to be compared. The bayesian inference in which the unknown parameter of interest is supposed random and its estimation is based on the data and on prior information. Compared to frequentist method, it provides probability density functions and therefore pointwise estimation with credible intervals. However, in practical cases, Bayesian inference is a complex problem of numerical integration, which explains its low use in operational modeling including radioecology. This study aims to illustrate the interest and feasibility of Bayesian approach in radioecology particularly in the case of ordinary differential equations with non-constant coefficients models, which cover most radiological risk assessment models, notably those implemented in the Symbiose platform (Gonze et al, 2010). Markov Chain Monte Carlo (MCMC) method (Metropolis et al., 1953) was used because the posterior expectations are intractable integrals. The invariant distribution of the parameters was performed by the metropolis-Hasting algorithm (Hastings, 1970). GNU-MCSim software (Bois and Maszle, 2011) a bayesian hierarchical framework, was used to deal with nonlinear differential models. Two case studies including this type of model were investigated: An Equilibrium Kinetic sorption model (EK) (e.g. van Genuchten et al, 1974), with experimental data concerning {sup 137}Cs and {sup 85}Sr sorption and desorption in different soils studied in stirred flow-through reactors. This model, generalizing the K{sub d} approach

Developing R&D portfolio business validity simulation model and system.

Science.gov (United States)

Yeo, Hyun Jin; Im, Kwang Hyuk

2015-01-01

The R&D has been recognized as critical method to take competitiveness by not only companies but also nations with its value creation such as patent value and new product. Therefore, R&D has been a decision maker's burden in that it is hard to decide how much money to invest, how long time one should spend, and what technology to develop which means it accompanies resources such as budget, time, and manpower. Although there are diverse researches about R&D evaluation, business factors are not concerned enough because almost all previous studies are technology oriented evaluation with one R&D technology based. In that, we early proposed R&D business aspect evaluation model which consists of nine business model components. In this research, we develop a simulation model and system evaluating a company or industry's R&D portfolio with business model point of view and clarify default and control parameters to facilitate evaluator's business validity work in each evaluation module by integrate to one screen.

Innovative research of AD HOC network mobility model

Science.gov (United States)

Chen, Xin

2017-08-01

It is difficult for researchers of AD HOC network to conduct actual deployment during experimental stage as the network topology is changeable and location of nodes is unfixed. Thus simulation still remains the main research method of the network. Mobility model is an important component of AD HOC network simulation. It is used to describe the movement pattern of nodes in AD HOC network (including location and velocity, etc.) and decides the movement trail of nodes, playing as the abstraction of the movement modes of nodes. Therefore, mobility model which simulates node movement is an important foundation for simulation research. In AD HOC network research, mobility model shall reflect the movement law of nodes as truly as possible. In this paper, node generally refers to the wireless equipment people carry. The main research contents include how nodes avoid obstacles during movement process and the impacts of obstacles on the mutual relation among nodes, based on which a Node Self Avoiding Obstacle, i.e. NASO model is established in AD HOC network.

Supply chain modeling of forest fuel

Energy Technology Data Exchange (ETDEWEB)

Gunnarsson, Helene; Lundgren, Jan T.; Roennqvist, Mikael

2001-04-01

We study the problem of deciding when and where forest residues are to be converted into forest fuel, and how the residues are to be transported and stored in order to satisfy demand at heating plants. Decisions also include whether or not additional harvest areas and saw-mills are to be contracted. In addition, we consider the flow of products from saw-mills and import harbors, and address the question about which terminals to use. The planning horizon is one year and monthly time periods are considered. The supply chain problem is formulated as a large mixed integer linear programming model. In order to obtain solutions within reasonable time we have developed a heuristic solution approach. Computational results from a large Swedish supplying entrepreneur are reported.

Supply chain modeling of forest fuel

International Nuclear Information System (INIS)

Gunnarsson, Helene; Lundgren, Jan T.; Roennqvist, Mikael

2001-04-01

We study the problem of deciding when and where forest residues are to be converted into forest fuel, and how the residues are to be transported and stored in order to satisfy demand at heating plants. Decisions also include whether or not additional harvest areas and saw-mills are to be contracted. In addition, we consider the flow of products from saw-mills and import harbors, and address the question about which terminals to use. The planning horizon is one year and monthly time periods are considered. The supply chain problem is formulated as a large mixed integer linear programming model. In order to obtain solutions within reasonable time we have developed a heuristic solution approach. Computational results from a large Swedish supplying entrepreneur are reported

Comparative Model Tests of SDP and CFA Pile Groups in Non-Cohesive Soil

Science.gov (United States)

Krasiński, Adam; Kusio, Tomasz

2015-02-01

The research topic relates to the subject of deep foundations supported on continuous flight auger (CFA) piles and screw displacement piles (SDP). The authors have decided to conduct model tests of foundations supported on the group of piles mentioned above and also the tests of the same piles working as a single. The tests are ongoing in Geotechnical Laboratory of Gdaňsk University of Technology. The description of test procedure, interpretation and analysis of the preliminary testing series results are presented in the paper.

Can a model of study activity increase didactic dialogue and students' understanding of learning in IPE?

DEFF Research Database (Denmark)

Hansen, Bodil Winther; Hatt, Camusa

at Metropolitan University College. Since 2013 all UCS have worked with a nationally decided study activity model. The model outlines four different types of learning activities. Students are introduced to courses via the model to heighten their understanding of course design and the expectations...... combining quantitative surveys, interviews, observation and focus groups. Comparisonldiscussion: The presentation will discuss the ambition to optimize dialogue about learning between lecturers and students by using a model of study activity. Results related to the value and potential of the model as seen...... by both lecturers and students will be presented. Findings/results/outcomes/effects: Students point out that the model can be a useful tool to gain an overview of learning activities and the amount of time they are expected to spend in courses. When lecturers introduce courses via the model it deepens...

Summary of ARI Research on Remotely Monitored Sensors

Science.gov (United States)

1980-07-01

I NAVY PFRSONNEL R AND 0 CENTER/ I US ARMY AVN ENbINEERING FLIGHT ACTIVIIY ATTN8 SAVTE- TD SoFc OF NAVAL RESEARCH PERSONNEL AND TRAINING RESEARCH...LABS ATTN: LTL- TD -S I USA MORILITY EWUIPMENT R AND 0 COMO ATTNS ODMUE-TO I NIGHT VISION LAH ATTN: UHSEL-NV-SUU I USA TRAINING BUAHD I USA HUMAN...I PURDUE UNIV DLPT OF PSYCMOLOGICAL SCIE.NCES 1 05A MOHILITY EWI,1PMENT w AND 0 LUMMANL) ATTNt URDME-1rG IHQ . USA MDW ATTN; ANPE-vE It D A US ARMY

Dicty_cDB: Contig-U01890-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available mfvplswfyglmn*skeis ltl*fsfknlqlkigknvilkvyslllsiidhymkklnhi*kvii*i*iiillksnifnn fffyfptkkkkkkkqkkkkn Translated...tum chromosome 30. 114 5e-25 AM494967_147( AM494967 |pid:none) Leishmania braziliensis chromoso... 112...a infantum chromosome 27. 79 5e-13 AM494964_217( AM494964 |pid:none) Leishmania braziliensi...2 ( CO474648 ) GQ0045.B3_N06 GQ004: Non-lignified secondary xyle... 62 6e-06 2 ( CO166798 ) FLD1_64_C09.g1_A029 Root flooded...nghamella elegans pBluescript (... 30 0.043 3 ( BC134880 ) Danio rerio apoptosis antagonizing trans

Three-Dimensional Computer-Assisted Two-Layer Elastic Models of the Face.

Science.gov (United States)

Ueda, Koichi; Shigemura, Yuka; Otsuki, Yuki; Fuse, Asuka; Mitsuno, Daisuke

2017-11-01

To make three-dimensional computer-assisted elastic models for the face, we decided on five requirements: (1) an elastic texture like skin and subcutaneous tissue; (2) the ability to take pen marking for incisions; (3) the ability to be cut with a surgical knife; (4) the ability to keep stitches in place for a long time; and (5) a layered structure. After testing many elastic solvents, we have made realistic three-dimensional computer-assisted two-layer elastic models of the face and cleft lip from the computed tomographic and magnetic resonance imaging stereolithographic data. The surface layer is made of polyurethane and the inner layer is silicone. Using this elastic model, we taught residents and young doctors how to make several typical local flaps and to perform cheiloplasty. They could experience realistic simulated surgery and understand three-dimensional movement of the flaps.

A Software Tool for Legal Drafting

Directory of Open Access Journals (Sweden)

Daniel Gorín

2011-09-01

Full Text Available Although many attempts at automated aids for legal drafting have been made, they were based on the construction of a new tool, completely from scratch. This is at least curious, considering that a strong parallelism can be established between a normative document and a software specification: both describe what an entity should or should not do, can or cannot do. In this article we compare normative documents and software specifications to find out their similarities and differences. The comparison shows that there are distinctive particularities, but they are restricted to a very specific subclass of normative propositions. The rest, we postulate, can be dealt with software tools. For such an enterprise the FormaLex tool set was devised: an LTL-based language and companion tools that utilize model checking to find out normative incoherences in regulations, contracts and other legal documents. A feature-rich case study is analyzed with the presented tools.

Intergovernmental Grants: A Formal Model of Interrelated National and Subnational Political Decisions

OpenAIRE

Craig Volden

2007-01-01

Intergovernmental grants are based on the interrelated choices of: (i) the national government deciding whether to offer the grant; (ii) the national government determining grant conditions; (iii) the subnational government deciding whether to accept the grant; and (iv) the subnational government determining policy, including spending levels, upon grant receipt. Empirically and theoretically, scholars often study these decisions separately, leading to an incomplete understanding of grant-rela...

The models of internal dose calculation in ICRP

International Nuclear Information System (INIS)

Nakano, Takashi

1995-01-01

There are a lot discussions about internal dose calculation in ICRP. Many efforts are devoted to improvement in models and parameters. In this report, we discuss what kind of models and parameters are used in ICRP. Models are divided into two parts, the dosimetric model and biokinetic model. The former is a mathematical phantom model, and it is mainly developed in ORNL. The results are used in many researchers. The latter is a compartment model and it has a difficulty to decide the parameter values. They are not easy to estimate because of their age dependency. ICRP officially sets values at ages of 3 month, 1 year, 5 year, 10 year, 15 year and adult, and recommends to get values among ages by linear age interpolate. But it is very difficult to solve the basic equation with these values, so we calculate by use of computers. However, it has complex shame and needs long CPU time. We should make approximated equations. The parameter values include much uncertainty because of less experimental data, especially for a child. And these models and parameter values are for Caucasian. We should inquire whether they could correctly describe other than Caucasian. The body size affects the values of calculated SAF, and the differences of metabolism change the biokinetic pattern. (author)

CT arthrography of the wrist using a novel, mobile, dedicated extremity cone-beam CT (CBCT)

Energy Technology Data Exchange (ETDEWEB)

Koskinen, Seppo K. [Helsinki University Central Hospital, Department of Radiology, HUS Helsinki Medical Imaging Center, Helsinki (Finland); Helsinki University Hospital, Toeoeloe Trauma Center, Department of Radiology, HUS Helsinki Medical Imaging Center, Helsinki (Finland); Haapamaeki, Ville V.; Kortesniemi, Mika [Helsinki University Central Hospital, Department of Radiology, HUS Helsinki Medical Imaging Center, Helsinki (Finland); Salo, Jari [Helsinki University Central Hospital, Department of Orthopedic and Trauma Surgery, Helsinki (Finland); Kuopio University Hospital, UEF, Department of Orthopedics, Traumatology and Hand Surgery, Kuopio (Finland); Lindfors, Nina C. [Helsinki University Central Hospital, Department of Orthopedic and Hand Surgery, Helsinki (Finland); Seppaelae, Lauri [Planmed Oy, Helsinki (Finland); Mattila, Kimmo T. [Turku University Central Hospital, Department of Diagnostic Radiology, Turku (Finland)

2013-05-15

To evaluate the feasibility and intra- and interobserver agreement of CBCT arthrography of wrist ligaments, triangular fibrocartilaginous complex (TFCC), and to assess the sensitivity (SE), specificity (SP), accuracy (ACC), and positive and negative predictive value (PPV, NPV) of CBCT arthrography in the diagnosis of scapholunate (SLL) and lunotriquetral (LTL) ligament tears, TFCC, and cartilage abnormalities of the scaphoid and lunate with their corresponding radial surfaces (scaphoid and lunate fossa) using a novel, mobile, dedicated extremity CBCT scanner. Fifty-two consecutively enrolled subjects (26 M, 26 F, mean age 38 years, range 18-66 years) with suspected wrist ligament tears underwent CBCT-arthrography before normally scheduled MR arthrography.An extremity CBCT was used for imaging with isotropic voxel size of 0.4 x 0.4 x 0.4 mm{sup 3}. Subsequent routine 1.5 T MRI was performed using a dedicated wrist coil.Two observers reviewed the anonymized CBCT images twice for contrast enhancement (CE) and technical details (TD), for tears of the SLL, LTL, and TFCC. Also, cartilage abnormalities of the scaphoid and lunate with their corresponding radial surfaces (scaphoid and lunate fossa) were evaluated. Inter- and intraobserver agreement was determined using weighted kappa statistics. Since no surgery was performed, MRI served as a reference standard, and SE and SP, ACC, PPV, and NPV were calculated. Intra- and interobserver kappa values for both readers (reader 1/reader 2; first reading/second reading) with 95 % confidence limits were: CE 0.54 (0.08-1.00)/ 0.75 (0.46-1.00); 0.73 (0.29-1.00)/ 0.45 (0.07-0.83), TD 0.53 (0.30-0.88)/ 0.86 (0.60-1.00); 0.56 (0.22-0.91)/ 0.67 (0.37-0.98), SLL 0.59 (0.25-0.93)/ 0.66 (0.42-0.91); 0.31 (0.06-0.56)/ 0.49 (0.26-0.73), LTL 0.83 (0.66-1.00)/ 0.68 (0.46-0.91); 0.90 (0.79-1.00)/ 0.48 (0.22-0.74); TFCC (0.72-1.00)/ (0.79-1.00); 0.65 (0.43-0.87)/ 0.59 (0.35-0.83), radius (scaphoid fossa) 0.45 (0.12-0.77)/ 0.64 (0.31-0.96); 0

Planning model of purchasing logistics in outsourcing

Directory of Open Access Journals (Sweden)

Igor JAKOMIN

2014-03-01

Full Text Available It is often the case that when preparing their offers, potential outsourcers of logistic activities do not thoroughly research all the activities that have an influence on the process of logistics. Consequently, they prepare relatively expensive offers (that can later lead to greater unexpected costs which, in many cases, business partners decide against and persist with their own existing methods of doing business. The original contribution to science in this article is a model that will aid better understanding of dealing with problems and will, in practice, serve as a tool for the successful execution of business offers by outsourcers. Following research we have discovered, and are able to confirm, that despite the high start-up costs of the outsourcing, in the long term the company can reduce logistic costs. The model presented serves as an in-depth analysis of the company which enables the definition of favourable and optimal offers for outsourcing. The model shown helps to minimise the influence of mistrust and emphasises the importance of reducing the logistic costs with outsourcing.

Development of a career coaching model for medical students

Directory of Open Access Journals (Sweden)

Yera Hur

2016-03-01

Full Text Available Purpose: Deciding on a future career path or choosing a career specialty is an important academic decision for medical students. The purpose of this study is to develop a career coaching model for medical students. Methods: This research was carried out in three steps. The first step was systematic review of previous studies. The second step was a need assessment of medical students. The third step was a career coaching model using the results acquired from the researched literature and the survey. Results: The career coaching stages were defined as three big phases: The career coaching stages were defined as the “crystallization” period (Pre-medical year 1 and 2, “specification” period (medical year 1 and 2, and “implementation” period (medical year 3 and 4. Conclusion: The career coaching model for medical students can be used in programming career coaching contents and also in identifying the outcomes of career coaching programs at an institutional level.

A model, describing the influence of water management alternatives on dike stability

Directory of Open Access Journals (Sweden)

J. W. M. Lambert

2015-11-01

Full Text Available The awareness is rising that economic effects of Land Subsidence are high. Nevertheless, quantifying these economic losses is difficult and, as far as known, not yet done in a sophisticated way. Also, to be able to decide about future strategies, for example to avoid or decrease subsidence, it is necessary to know the financial consequences of measures and possible solutions. As a first step to quantify these economic effects, a MODFLOW-SCR (coupled MODFLOW-Settlements model is coupled with the model DAM. Based on the local stratigraphy, the shape and composition of the existing dike or levee, the level of the surface water and the surface level, macro-stability of the dike is calculated and – if the dike does not meet the required stability – adaptions are proposed. The model enables to separate effects that are caused by sea-level rise and the effects of subsidence. Coupling the DAM model with an economic model to calculate costs of these adaptions is under construction.

Experimental Fracture Model versus Osteotomy Model in Metacarpal Bone Plate Fixation

Directory of Open Access Journals (Sweden)

S. Ochman

2011-01-01

Full Text Available Introduction. Osteotomy or fracture models can be used to evaluate mechanical properties of fixation techniques of the hand skeleton in vitro. Although many studies make use of osteotomy models, fracture models simulate the clinical situation more realistically. This study investigates monocortical and bicortical plate fixation on metacarpal bones considering both aforementioned models to decide which method is best suited to test fixation techniques. Methods. Porcine metacarpal bones (=40 were randomized into 4 groups. In groups I and II bones were fractured with a modified 3-point bending test. The intact bones represented a further control group to which the other groups after fixation were compared. In groups III and IV a standard osteotomy was carried out. Bones were fixated with plates monocortically (group I, III and bicortically (group II, IV and tested for failure. Results. Bones fractured at a mean maximum load of 482.8 N ± 104.8 N with a relative standard deviation (RSD of 21.7%, mean stiffness was 122.3 ± 35 N/mm. In the fracture model, there was a significant difference (=0.01 for maximum load of monocortically and bicortically fixed bones in contrast to the osteotomy model (=0.9. Discussion. In the fracture model, because one can use the same bone for both measurements in the intact state and the bone-plate construct states, the impact of inter-individual differences is reduced. In contrast to the osteotomy model there are differences between monocortical and bicortical fixations in the fracture model. Thus simulation of the in vivo situation is better and seems to be suitable for the evaluation of mechanical properties of fixation techniques on metacarpals.

Model Checking Temporal Logic Formulas Using Sticker Automata

Science.gov (United States)

Feng, Changwei; Wu, Huanmei

2017-01-01

As an important complex problem, the temporal logic model checking problem is still far from being fully resolved under the circumstance of DNA computing, especially Computation Tree Logic (CTL), Interval Temporal Logic (ITL), and Projection Temporal Logic (PTL), because there is still a lack of approaches for DNA model checking. To address this challenge, a model checking method is proposed for checking the basic formulas in the above three temporal logic types with DNA molecules. First, one-type single-stranded DNA molecules are employed to encode the Finite State Automaton (FSA) model of the given basic formula so that a sticker automaton is obtained. On the other hand, other single-stranded DNA molecules are employed to encode the given system model so that the input strings of the sticker automaton are obtained. Next, a series of biochemical reactions are conducted between the above two types of single-stranded DNA molecules. It can then be decided whether the system satisfies the formula or not. As a result, we have developed a DNA-based approach for checking all the basic formulas of CTL, ITL, and PTL. The simulated results demonstrate the effectiveness of the new method. PMID:29119114

The Effect of Entrepreneurship Education on Entrepreneurial Intention of University Students By Adopting Linan Model

Directory of Open Access Journals (Sweden)

Yud Buana

2017-05-01

Full Text Available The success of entrepreneurship education programs remains unanswered if it is associated with some students who have decided to launch and pursue a business venture. It is important to know the intentions of a nascent entrepreneur to start up the business ventures persistently if experts and policy makers’ attentions are drawn on how to arouse interest in starting a business. Quantitative approached was used in this research to examine the influence of entrepreneurship education, social norms and self-efficacy on intentions to pursue business ventures by adopting Linan model of intention-behavior. The model was addressed to the students who participated in entrepreneurship education program during the mid of study in Bina Nusantara University. Last, the result is in line with Linan model.

Modelling contractor’s bidding decision

Directory of Open Access Journals (Sweden)

Biruk Sławomir

2017-03-01

Full Text Available The authors aim to provide a set of tools to facilitate the main stages of the competitive bidding process for construction contractors. These involve 1 deciding whether to bid, 2 calculating the total price, and 3 breaking down the total price into the items of the bill of quantities or the schedule of payments to optimise contractor cash flows. To define factors that affect the decision to bid, the authors rely upon literature on the subject and put forward that multi-criteria methods are applied to calculate a single measure of contract attractiveness (utility value. An attractive contract implies that the contractor is likely to offer a lower price to increase chances of winning the competition. The total bid price is thus to be interpolated between the lowest acceptable and the highest justifiable price based on the contract attractiveness. With the total bid price established, the next step is to split it between the items of the schedule of payments. A linear programming model is proposed for this purpose. The application of the models is illustrated with a numerical example.

Constrained optimization via simulation models for new product innovation

Science.gov (United States)

Pujowidianto, Nugroho A.

2017-11-01

We consider the problem of constrained optimization where the decision makers aim to optimize the primary performance measure while constraining the secondary performance measures. This paper provides a brief overview of stochastically constrained optimization via discrete event simulation. Most review papers tend to be methodology-based. This review attempts to be problem-based as decision makers may have already decided on the problem formulation. We consider constrained optimization models as there are usually constraints on secondary performance measures as trade-off in new product development. It starts by laying out different possible methods and the reasons using constrained optimization via simulation models. It is then followed by the review of different simulation optimization approach to address constrained optimization depending on the number of decision variables, the type of constraints, and the risk preferences of the decision makers in handling uncertainties.

Comparative Model Tests of SDP and CFA Pile Groups in Non-Cohesive Soil

Directory of Open Access Journals (Sweden)

Krasiński Adam

2015-02-01

Full Text Available The research topic relates to the subject of deep foundations supported on continuous flight auger (CFA piles and screw displacement piles (SDP. The authors have decided to conduct model tests of foundations supported on the group of piles mentioned above and also the tests of the same piles working as a single. The tests are ongoing in Geotechnical Laboratory of Gdaňsk University of Technology. The description of test procedure, interpretation and analysis of the preliminary testing series results are presented in the paper.

Defining epidemics in computer simulation models: How do definitions influence conclusions?

Directory of Open Access Journals (Sweden)

Carolyn Orbann

2017-06-01

Full Text Available Computer models have proven to be useful tools in studying epidemic disease in human populations. Such models are being used by a broader base of researchers, and it has become more important to ensure that descriptions of model construction and data analyses are clear and communicate important features of model structure. Papers describing computer models of infectious disease often lack a clear description of how the data are aggregated and whether or not non-epidemic runs are excluded from analyses. Given that there is no concrete quantitative definition of what constitutes an epidemic within the public health literature, each modeler must decide on a strategy for identifying epidemics during simulation runs. Here, an SEIR model was used to test the effects of how varying the cutoff for considering a run an epidemic changes potential interpretations of simulation outcomes. Varying the cutoff from 0% to 15% of the model population ever infected with the illness generated significant differences in numbers of dead and timing variables. These results are important for those who use models to form public health policy, in which questions of timing or implementation of interventions might be answered using findings from computer simulation models.

A Study On Traditional And Evolutionary Software Development Models

Directory of Open Access Journals (Sweden)

Kamran Rasheed

2017-07-01

Full Text Available Today Computing technologies are becoming the pioneers of the organizations and helpful in individual functionality i.e. added to computing device we need to add softwares. Set of instruction or computer program is known as software. The development of software is done through some traditional or some new or evolutionary models. Software development is becoming a key and a successful business nowadays. Without software all hardware is useless. Some collective steps that are performed in the development of these are known as Software development life cycle SDLC. There are some adaptive and predictive models for developing software. Predictive mean already known like WATERFALL Spiral Prototype and V-shaped models while Adaptive model include agile Scrum. All methodologies of both adaptive and predictive have their own procedure and steps. Predictive are Static and Adaptive are dynamic mean change cannot be made to the predictive while adaptive have the capability of changing. The purpose of this study is to get familiar with all these and discuss their uses and steps of development. This discussion will be helpful in deciding which model they should use in which circumstance and what are the development step including in each model.

How do clinicians practise the principles of beneficence when deciding to allow or deny family presence during resuscitation?

Science.gov (United States)

Giles, Tracey; de Lacey, Sheryl; Muir-Cochrane, Eimear

2018-03-01

To examine how clinicians practise the principles of beneficence when deciding to allow or deny family presence during resuscitation. Family presence during resuscitation has important benefits for family and is supported by professional bodies and the public. Yet, many clinicians restrict family access to patients during resuscitation, and rationales for decision-making are unclear. Secondary analysis of an existing qualitative data set using deductive category application of content analysis. We analysed 20 interview transcripts from 15 registered nurses, two doctors and three paramedics who had experienced family presence during resuscitation in an Australian hospital. The transcripts were analysed for incidents of beneficent decision-making when allowing or denying family presence during resuscitation. Decision-making around family presence during resuscitation occurred in time poor environments and in the absence of local institutional guidelines. Clinicians appeared to be motivated by doing "what's best" for patients and families when allowing or denying family presence during resuscitation. However, their individual interpretations of "what's best" was subjective and did not always coincide with family preferences or with current evidence that promotes family presence during resuscitation as beneficial. The decision to allow or deny family presence during resuscitation is complex, and often impacted by personal preferences and beliefs, setting norms and tensions between clinicians and consumers. As a result, many families are missing the chance to be with their loved ones at the end of life. The introduction of institutional guidelines and policies would help to establish what safe and effective practice consists of, reduce value-laden decision-making and guide beneficent decision-making. These findings highlight current deficits in decision-making around FPDR and could prompt the introduction of clinical guidelines and policies and in turn promote the

Initial computer modeling of WIPP [Waste Isolation Pilot Plant] underground ventilation system, September 1985--March 1986

International Nuclear Information System (INIS)

Sethi, S.

1986-11-01

Provision of a good ventilation system has been and continues to be a major priority here of those responsible for its design, management, and operation. As an ongoing effort in this direction, development of computer simulated models for the system was initiated in September, 1985. It was decided to utilize Dravo's 'MINEVENT' computer program for this purpose. Accordingly, initial computer models of the mine's ventilation system have been developed for various modes of operation. Specifically, they include: Simulation of the current ventilation system, and Simulation of the designed ventilation system for modes: mine construction mode/shift, waste storage mode/shift, and air reversal mode. 5 figs

Proposal of a theoretical model for the practical nurse

Directory of Open Access Journals (Sweden)

Dolores Abril Sabater

2010-01-01

Full Text Available AIM: To determine which model of nursing is proposed by care professionals and the reason for their choice. METHOD: cross-sectional, descriptive study design. The main variable: Nursing Models and Theories. As secondary variables were collected: age, gender, years of work experience, nursing model of basic training, and course/s related. We used a self-elaborated, anonymous questionnaire, passed between April - May, 2006. Not random sample.RESULTS: 546 nurses were invited, answered 205. 38 % response rate. Virginia Henderson was the more selected model (33%, however, 42% left the question blank, 12% indicated that they wanted to work under the guidance of a model. They selected a specifically model: Knowledge of the model to their training, standardization in other centers, the characteristics of the model itself and identification with its philosophy. They are not decided by a model by ignorance, lack of time and usefulness. CONCLUSIONS: The model chosen mostly for their daily work was Virginia Henderson model, so that knowledge of a model is the main reason for their election. Professionals who choose not to use the model in their practice realize offers and calling for resources, besides to explain the lack of knowledge on this topic. To advance the nursing profession is necessary that nurse is thought over widely on the abstract concepts of the theory in our context.

Cognitive models and computer aids for nuclear plant control room operators

International Nuclear Information System (INIS)

Sheridan, T.B.

1982-01-01

This paper reviews what is usually meant by a cognitive model of a control room operator in a nuclear power plant. It emphasizes the idea of internal (that is, mental) representation of external events and the use of such representation for the cognitive steps of attending, recognizing or learning, assessing and deciding. As computers play an increasingly important role in nuclear power plants, especially as cognitive aids to human supervisors of highly automated control systems, it is important that the software and computer interface characteristics be compatible with the operator's internal model. Specific examples discussed in this paper are in the monitoring and prediction of the plant state and in the detection and diagnosis of failures. Current trends in SPDS (safety parameter display system) and failure detection/location systems will be discussed in this regard

Quality control of Photosystem II: reversible and irreversible protein aggregation decides the fate of Photosystem II under excessive illumination

Directory of Open Access Journals (Sweden)

Yasusi eYamamoto

2013-10-01

Full Text Available In response to excessive light, the thylakoid membranes of higher plant chloroplasts show dynamic changes including the degradation and reassembly of proteins, a change in the distribution of proteins, and large-scale structural changes such as unstacking of the grana. Here, we examined the aggregation of light-harvesting chlorophyll-protein complexes and Photosystem II core subunits of spinach thylakoid membranes under light stress with 77K chlorophyll fluorescence; aggregation of these proteins was found to proceed with increasing light intensity. Measurement of changes in the fluidity of thylakoid membranes with fluorescence polarization of diphenylhexatriene showed that membrane fluidity increased at a light intensity of 500–1,000 µmol photons m-2 s-1, and decreased at very high light intensity (1,500 µmol photons m-2 s-1. The aggregation of light-harvesting complexes at moderately high light intensity is known to be reversible, while that of Photosystem II core subunits at extremely high light intensity is irreversible. It is likely that the reversibility of protein aggregation is closely related to membrane fluidity: increases in fluidity should stimulate reversible protein aggregation, whereas irreversible protein aggregation might decrease membrane fluidity. When spinach leaves were pre-illuminated with moderately high light intensity, the qE component of non-photochemical quenching and the optimum quantum yield of Photosystem II increased, indicating that Photosystem II/ light-harvesting complexes rearranged in the thylakoid membranes to optimize Photosystem II activity. Transmission electron microscopy revealed that the thylakoids underwent partial unstacking under these light stress conditions. Thus, protein aggregation is involved in thylakoid dynamics and regulates photochemical reactions, thereby deciding the fate of Photosystem II.

Modeling the Virtual Machine Launching Overhead under Fermicloud

Energy Technology Data Exchange (ETDEWEB)

Garzoglio, Gabriele [Fermilab; Wu, Hao [Fermilab; Ren, Shangping [IIT, Chicago; Timm, Steven [Fermilab; Bernabeu, Gerard [Fermilab; Noh, Seo-Young [KISTI, Daejeon

2014-11-12

FermiCloud is a private cloud developed by the Fermi National Accelerator Laboratory for scientific workflows. The Cloud Bursting module of the FermiCloud enables the FermiCloud, when more computational resources are needed, to automatically launch virtual machines to available resources such as public clouds. One of the main challenges in developing the cloud bursting module is to decide when and where to launch a VM so that all resources are most effectively and efficiently utilized and the system performance is optimized. However, based on FermiCloud’s system operational data, the VM launching overhead is not a constant. It varies with physical resource (CPU, memory, I/O device) utilization at the time when a VM is launched. Hence, to make judicious decisions as to when and where a VM should be launched, a VM launch overhead reference model is needed. The paper is to develop a VM launch overhead reference model based on operational data we have obtained on FermiCloud and uses the reference model to guide the cloud bursting process.

A CFD model for particle dispersion in turbulent boundary layer flows

International Nuclear Information System (INIS)

Dehbi, A.

2008-01-01

In Lagrangian particle dispersion modeling, the assumption that turbulence is isotropic everywhere yields erroneous predictions of particle deposition rates on walls, even in simple geometries. In this investigation, the stochastic particle tracking model in Fluent 6.2 is modified to include a better treatment of particle-turbulence interactions close to walls where anisotropic effects are significant. The fluid rms velocities in the boundary layer are computed using fits of DNS data obtained in channel flow. The new model is tested against correlations for particle removal rates in turbulent pipe flow and 90 o bends. Comparison with experimental data is much better than with the default model. The model is also assessed against data of particle removal in the human mouth-throat geometry where the flow is decidedly three-dimensional. Here, the agreement with the data is reasonable, especially in view of the fact that the DNS fits used are those of channel flows, for lack of better alternatives. The CFD Best Practice Guidelines are followed to a large extent, in particular by using multiple grid resolutions and at least second order discretization schemes

Development of a model for the primary system CAREM reactor's stationary thermohydraulic calculation

International Nuclear Information System (INIS)

Gaspar, C.; Abbate, P.

1990-01-01

The ESCAREM program oriented to CAREM reactors' stationary thermohydraulic calculation is presented. As CAREM gives variations in relation to models for BWR (Boiling Water Reactors)/PWR (Pressurized Water Reactors) reactors, it was decided to develop a suitable model which allows to calculate: a) if the Steam Generator design is adequate to transfer the power required; b) the circulation flow that occurs in the Primary System; c) the temperature at the entrance (cool branch) and d) the contribution of each component to the pressure drop in the circulation connection. Results were verified against manual calculations and alternative numerical models. An experimental validation at the Thermohydraulic Essays Laboratory is suggested. A parametric analysis series is presented on CAREM 25 reactor, demonstrating operating conditions, at different power levels, as well as the influence of different design aspects. (Author) [es

Specific acoustic models for spontaneous and dictated style in indonesian speech recognition

Science.gov (United States)

Vista, C. B.; Satriawan, C. H.; Lestari, D. P.; Widyantoro, D. H.

2018-03-01

The performance of an automatic speech recognition system is affected by differences in speech style between the data the model is originally trained upon and incoming speech to be recognized. In this paper, the usage of GMM-HMM acoustic models for specific speech styles is investigated. We develop two systems for the experiments; the first employs a speech style classifier to predict the speech style of incoming speech, either spontaneous or dictated, then decodes this speech using an acoustic model specifically trained for that speech style. The second system uses both acoustic models to recognise incoming speech and decides upon a final result by calculating a confidence score of decoding. Results show that training specific acoustic models for spontaneous and dictated speech styles confers a slight recognition advantage as compared to a baseline model trained on a mixture of spontaneous and dictated training data. In addition, the speech style classifier approach of the first system produced slightly more accurate results than the confidence scoring employed in the second system.

A see-saw scenario of an $A_4$ flavour symmetric standard model

CERN Document Server

Dinh, Dinh Nguyen; Văn, Phi Quang; Vân, Nguyen Thi Hông

2016-01-01

A see-saw scenario for an $A_4$ flavour symmetric standard model is presented. As before, the see-saw mechanism can be realized in several models of different types depending on different ways of neutrino mass generation corresponding to the introduction of new fields with different symmetry structures. In the present paper, a general desription of all these see-saw types is made with a more detailed investigation on type-I models. As within the original see-saw mechanism, the symmetry structure of the standard model fields decides the number and the symmetry structure of the new fields. In a model considered here, the scalar sector consists of three standard-model-Higgs-like iso-doublets ($SU_L(2)$-doublets) forming an $A_4$ triplet. The latter is a superposition of three mass-eigen states, one of which could be identified with the recently discovered Higgs boson. A possible relation to the still-deliberated 750 GeV diphoton resonance at the 13 TeV LHC collisions is also discussed. In the lepton sector, the ...

Transmission Delay Modeling of Packet Communication over Digital Subscriber Line

Directory of Open Access Journals (Sweden)

Jiri Vodrazka

2013-01-01

Full Text Available Certain multimedia and voice services, such as VoIP, IPTV, etc., are significantly delay sensitive and their performance is influenced by the overall transmission delay and its variance. One of the most common solutions used in access networks are xDSL lines, especially ADSL2+ or VDSL2. Although these subscriber lines also use packet communication, there are several differences and mechanisms, which influence their resulting delay. Their delay characteristics are also dependent on the individual settings of each xDSL provider, therefore we decided to investigate this area for typical commercially available lines in Czech Republic. Based on the measured values and experiments with real ADSL2+ lines we also developed a potential modeling method, which is presented in this article as well. The parameters for packet jitter based on the generalized Pareto distribution were modeled.

Select neurocognitive impairment in HIV-infected women: associations with HIV viral load, hepatitis C virus, and depression, but not leukocyte telomere length.

Directory of Open Access Journals (Sweden)

Chantelle J Giesbrecht

Full Text Available Through implementation of combination antiretroviral therapy (cART remarkable gains have been achieved in the management of HIV infection; nonetheless, the neurocognitive consequences of infection remain a pivotal concern in the cART era. Research has often employed norm-referenced neuropsychological scores, derived from healthy populations (excluding many seronegative individuals at high risk for HIV infection, to characterize impairments in predominately male HIV-infected populations.Using matched-group methodology, we assessed 81 HIV-seropositive (HIV+ women with established neuropsychological measures validated for detection of HIV-related impairments, as well as additional detailed tests of executive function and decision-making from the Cambridge Neuropsychological Test Automated Battery (CANTAB.On validated tests, the HIV+ women exhibited impairments that were limited to significantly slower information processing speed when compared with 45 HIV-seronegative (HIV- women with very similar demographic backgrounds and illness comorbidities. Additionally, select executive impairments in shifting attention (i.e., reversal learning and in decision-making quality were revealed in HIV+ participants. Modifiers of neurocognition in HIV-infected women included detectable HIV plasma viral load, active hepatitis C virus co-infection, and self-reported depression symptoms. In contrast, leukocyte telomere length (LTL, a marker of cellular aging, did not significantly differ between HIV+ and HIV- women, nor was LTL associated with overall neurocognition in the HIV+ group.The findings suggest that well-managed HIV infection may entail a more circumscribed neurocognitive deficit pattern than that reported in many norm-referenced studies, and that common comorbidities make a secondary contribution to HIV-related neurocognitive impairments.

Atmospheric dispersion models of radioactivity releases

International Nuclear Information System (INIS)

Oza, R.B.

2016-01-01

In view of the rapid industrialization in recent time, atmospheric dispersion models have become indispensible 'tools' to ensure that the effects of releases are well within the acceptable limits set by the regulatory authority. In the case of radioactive releases from the nuclear facility, though negligible in quantity and many a times not even measurable, it is required to demonstrate the compliance of these releases to the regulatory limits set by the regulatory authority by carrying out radiological impact assessment. During routine operations of nuclear facility, the releases are so low that environmental impact is usually assessed with the help of atmospheric dispersion models as it is difficult to distinguish negligible contribution of nuclear facility to relatively high natural background radiation. The accidental releases from nuclear facility, though with negligible probability of occurrence, cannot be ruled out. In such cases, the atmospheric dispersion models are of great help to emergency planners for deciding the intervention actions to minimize the consequences in public domain and also to workout strategies for the management of situation. In case of accidental conditions, the atmospheric dispersion models are also utilized for the estimation of probable quantities of radionuclides which might have got released to the atmosphere. Thus, atmospheric dispersion models are an essential tool for nuclear facility during routine operation as well as in the case of accidental conditions

Developing R&D Portfolio Business Validity Simulation Model and System

Directory of Open Access Journals (Sweden)

Hyun Jin Yeo

2015-01-01

Full Text Available The R&D has been recognized as critical method to take competitiveness by not only companies but also nations with its value creation such as patent value and new product. Therefore, R&D has been a decision maker’s burden in that it is hard to decide how much money to invest, how long time one should spend, and what technology to develop which means it accompanies resources such as budget, time, and manpower. Although there are diverse researches about R&D evaluation, business factors are not concerned enough because almost all previous studies are technology oriented evaluation with one R&D technology based. In that, we early proposed R&D business aspect evaluation model which consists of nine business model components. In this research, we develop a simulation model and system evaluating a company or industry’s R&D portfolio with business model point of view and clarify default and control parameters to facilitate evaluator’s business validity work in each evaluation module by integrate to one screen.

Developing R&D Portfolio Business Validity Simulation Model and System

Science.gov (United States)

2015-01-01

The R&D has been recognized as critical method to take competitiveness by not only companies but also nations with its value creation such as patent value and new product. Therefore, R&D has been a decision maker's burden in that it is hard to decide how much money to invest, how long time one should spend, and what technology to develop which means it accompanies resources such as budget, time, and manpower. Although there are diverse researches about R&D evaluation, business factors are not concerned enough because almost all previous studies are technology oriented evaluation with one R&D technology based. In that, we early proposed R&D business aspect evaluation model which consists of nine business model components. In this research, we develop a simulation model and system evaluating a company or industry's R&D portfolio with business model point of view and clarify default and control parameters to facilitate evaluator's business validity work in each evaluation module by integrate to one screen. PMID:25893209

Why Is Improvement of Earth System Models So Elusive? Challenges and Strategies From Dust Aerosol Modeling

Science.gov (United States)

Miller, R. L.; Pérez García-Pando, C.; Perlwitz, J. P.; Ginoux, P. A.

2015-12-01

Past decades have seen an accelerating increase in computing efficiency,while climate models are representing a rapidly widening set ofphysical processes. Yet simulations of some fundamental aspects ofclimate like precipitation or aerosol forcing remain highly uncertainand resistent to progress. Dust aerosol modeling of soil particleslofted by wind erosion has seen a similar conflict between increasingmodel sophistication and remaining uncertainty. Dust aerosols perturbthe energy and water cycles by scattering radiation and acting as icenuclei, while mediating atmospheric chemistry and marinephotosynthesis (and thus the carbon cycle). These effects take placeacross scales from the dimensions of an ice crystal to theplanetary-scale circulation that disperses dust far downwind of itsparent soil. Representing this range leads to several modelingchallenges. Should we limit complexity in our model, which consumescomputer resources and inhibits interpretation? How do we decide if aprocess involving dust is worthy of inclusion within our model? Canwe identify a minimal representation of a complex process that isefficient yet retains the physics relevant to climate? Answeringthese questions about the appropriate degree of representation isguided by model evaluation, which presents several more challenges.How do we proceed if the available observations do not directlyconstrain our process of interest? (This could result from competingprocesses that influence the observed variable and obscure thesignature of our process of interest.) Examples will be presentedfrom dust modeling, with lessons that might be more broadlyapplicable. The end result will either be clinical depression or thereassuring promise of continued gainful employment as the communityconfronts these challenges.