WorldWideScience

Sample records for ddd sss kkk

  1. SSS* = AB+TT

    NARCIS (Netherlands)

    A. Plaat (Aske); J. Schaeffer; W.H.L.M. Pijls (Wim); A. de Bruin (Arie)

    1995-01-01

    textabstractIn 1979 Stockman introduced the SSS* minimax search algorithm that dominates alpha-beta in the number of leaf nodes expanded. Further investigation of the algorithm showed that it had three serious drawbacks, which prevented its use by practitioners: it is difficult to understand, it has

  2. [Validation of the IBS-SSS].

    Science.gov (United States)

    Betz, C; Mannsdörfer, K; Bischoff, S C

    2013-10-01

    Irritable bowel syndrome (IBS) is a functional gastrointestinal disorder characterised by abdominal pain, associated with stool abnormalities and changes in stool consistency. Diagnosis of IBS is based on characteristic symptoms and exclusion of other gastrointestinal diseases. A number of questionnaires exist to assist diagnosis and assessment of severity of the disease. One of these is the irritable bowel syndrome - severity scoring system (IBS-SSS). The IBS-SSS was validated 1997 in its English version. In the present study, the IBS-SSS has been validated in German language. To do this, a cohort of 60 patients with IBS according to the Rome III criteria, was compared with a control group of healthy individuals (n = 38). We studied sensitivity and reproducibility of the score, as well as the sensitivity to detect changes of symptom severity. The results of the German validation largely reflect the results of the English validation. The German version of the IBS-SSS is also a valid, meaningful and reproducible questionnaire with a high sensitivity to assess changes in symptom severity, especially in IBS patients with moderate symptoms. It is unclear if the IBS-SSS is also a valid questionnaire in IBS patients with severe symptoms because this group of patients was not studied. © Georg Thieme Verlag KG Stuttgart · New York.

  3. Another view on the SSS* algorithm

    NARCIS (Netherlands)

    W.H.L.M. Pijls (Wim); A. de Bruin (Arie)

    1990-01-01

    textabstractA new version of the SSS* algorithm for searching game trees is presented. This algorithm is built around two recursive procedures. It finds the minimax value of a game tree by first establishing an upper bound to this value and then successively trying in a top down fashion to tighten

  4. Segmental stiff skin syndrome (SSS): A distinct clinical entity.

    Science.gov (United States)

    Myers, Kathryn L; Mir, Adnan; Schaffer, Julie V; Meehan, Shane A; Orlow, Seth J; Brinster, Nooshin K

    2016-07-01

    Stiff skin syndrome (SSS) is a noninflammatory, fibrosing condition of the skin, often affecting the limb girdles. We present 4 new patients with SSS with largely unilateral, segmental distribution. To date, reported cases of SSS have been grouped based on generally accepted clinical and histopathologic findings. The purpose of this study was to analyze differences in clinical and histopathologic findings between previously reported SSS cases. This is a retrospective review of 4 new cases and 48 previously published cases of SSS obtained from PubMed search. Of 52 total cases, 18 (35%) were segmentally distributed and 34 (65%) were widespread. The average age of onset was 4.1 years versus 1.6 years for segmental versus widespread SSS, respectively. Limitation in joint mobility affected 44% of patients with segmental SSS and 97% of patients with widespread SSS. Histopathologic findings were common between the 2 groups. This was a retrospective study of previously published cases limited by the completeness and accuracy of the reviewed cases. We propose a distinct clinical entity, segmental SSS, characterized by a segmental distribution, later age of onset, and less severe functional limitation. Both segmental SSS and widespread SSS share common diagnostic histopathologic features. Copyright © 2016 American Academy of Dermatology, Inc. All rights reserved.

  5. 40 CFR 129.101 - DDT, DDD and DDE.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false DDT, DDD and DDE. 129.101 Section 129... POLLUTANT EFFLUENT STANDARDS Toxic Pollutant Effluent Standards and Prohibitions § 129.101 DDT, DDD and DDE. (a) Specialized definitions. (1) DDT Manufacturer means a manufacturer, excluding any source which is...

  6. The SSS classical nova V5116 Sgr

    Science.gov (United States)

    Sala, G.; Ness, J.; Greiner, J.; Hernanz, M.

    2017-10-01

    XMM-Newton observed the nova V5116 Sgr during its supersoft phase (SSS). V5116 Sgr showed a decrease of the flux by a factor around 8 during 2/3 of the orbital period. The broad band EPIC spectra remain unchanged during the different flux phases, suggesting an occultation of the central source in a high inclination system. While the global SED does not change significantly, the RGS spectrum is changing between the high and the low flux phases. The non-occultation phase shows a typical white dwarf atmosphere spectrum, dominated by absorption lines. During the low flux periods an extra component of emission lines is superimposed to the soft X-ray continuum. This supports the picture of V5116 Sgr as the clearest example of a system switching between the SSa class of SSS novae, with spectra dominated by absorption lines, and the SSe class, showing an emission lines component. In addition, the simultaneous OM images allow us to find a phase solution for the X-ray light-curve. A thick rim of the accretion disk as the one developed for the SSSs CAL 87, RX J0019.8, and RX J0513.9 could provide a plausible model both for the optical and the X-ray light curve of V5116 Sgr.

  7. Quantitative toxoplasma gondii oocyst detection by a modified Kato Katz test using Kinyoun staining (KKK in ME49 strain experimentally infected cats Detecção quantitativa de oocistos de Toxoplasma gondii, por um teste modificado de Kato Katz usando coloração de Kinyoun (KKK, em gatos infectados experimentalmente com a cepa ME49

    Directory of Open Access Journals (Sweden)

    Luciana Regina Meireles

    2008-06-01

    Full Text Available We detected Toxoplasma gondii oocysts in feces of experimentally infected cats, using a Kato Katz approach with subsequent Kinyoun staining. Animals serologically negative to T. gondii were infected orally with 5x10² mice brain cysts of ME49 strain. Feces were collected daily from the 3rd to the 30th day after challenge. Oocysts were detected by qualitative sugar flotation and the quantitative modified Kato Katz stained by Kinyoun (KKK. In the experimentally infected cats, oocysts were detected from the 7th to 15th day through sugar flotation technique, but oocysts were found in KKK from the 6th to 16th day, being sensitive for a larger period, with permanent documentation. The peak of oocysts excretion occurred between the 8th to 11th days after challenge, before any serological positive result. KKK could be used in the screening and quantification of oocysts excretion in feces of suspected animals, with reduced handling of infective material, decreasing the possibility of environmental and operator contamination.Detectamos oocistos de Toxoplasma gondii em fezes de gatos experimentalmente infectados, usando a abordagem de Kato Katz, com subseqüente coloração pelo método de Kinyoun. Animais sorologicamente negativos ao T. gondii foram infectados por via oral com 5x10² cistos da cepa ME49 de cérebros de camundongos. Fezes foram colhidas diariamente a partir do 3º até o 30º dia pós-infecção. Oocistos foram detectados por centrífugo-flutuação em sacarose qualitativa e pelo método quantitativo de Kato Katz modificado corado pela técnica de Kinyoun (KKK. Em gatos experimentalmente infectados, oocistos foram detectados do 7º ao 15º dia pela técnica de centrífugo-flutuação em sacarose, mas oocistos foram detectados do 6º ao 16º dia pelo KKK, sendo sensível por um período maior, com documentação permanente. O pico da excreção de oocistos ocorreu entre 8º a 11º dia pós-infecção, antes de resultado sorológico positivo

  8. SOS switch system (SSS) in the radiation treatment room

    International Nuclear Information System (INIS)

    Komiyama, Takafumi; Motoyama, Tsuyoshi; Nakamura, Koji; Onishi, Hiroshi; Araya, Masayuki; Sano, Naoki

    2009-01-01

    We applied patient's self-breath hold irradiation system to a device to declare the patient's intentions (SOS switch system: SSS) in the radiation room and examined a utility for problem recognition and improvement of risk management during radiation therapy by induction of SSS. Between May 2005 and October 2006, we used SSS with 65 patients. The study involved 32 men and 33 women with a median age of 65 (range, 26-88) years. The reason for using SSS was as a shell in 57, a history of laryngectomy in 2, a cough in 6, convulsions in 1, and anxiety in 3. The treatment with SSS was performed 1,120 times. The hand switch was pushed 11 times. The reasons the switch was pushed were for nausea, aspiration, pain, and cough one time each. For the others, the reasons were unclear, and it was thought due to the clouding of consciousness from brain metastases. No problems were observed with the use of SSS. SSS was a useful device for improvement of risk management during the radiation therapy. (author)

  9. U.S. Geoid Heights, Scientific Model (G96SSS)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This 2' geoid height grid for the conterminous United States is the G96SSS model. The computation used about 1.8 million terrestrial and marine gravity data held in...

  10. Improved anchoring of SSS with vacuum barrier to avoid displacement

    CERN Document Server

    Capatina, O; Foreste, A; Parma, V; Renaglia, T; Quesnel, J

    2009-01-01

    As presented in the previous speech, the incident in sector 3-4 of the LHC caused a high pressure build-up inside the cryostat insulation vacuum resulting in high longitudinal forces acting on the insulation vacuum barriers. This resulted in braking floor and floor fixations of the SSS with vacuum barrier. The strategy of improving anchoring of SSS with vacuum barrier to avoid displacement is presented and discussed.

  11. Einstein SSS+MPC observations of Seyfert type galaxies

    Science.gov (United States)

    Holt, S. S.; Turner, T. J.; Mushotzky, R. F.; Weaver, K.

    1989-01-01

    The X-ray spectra of 27 Seyfert galaxies measured with the Solid State Spectrometer (SSS) onboard the Einstein Observatory is investigated. This new investigation features the utilization of simultaneous data from the Monitor Proportional Counter (MPC) and automatic correction for systematic effects in the SSS. The new results are that the best-fit single power law indices agree with those previously reported, but that soft excesses are inferred for at least 20 percent of the measured spectra. The soft excesses are consistent with either an approximately 0.25 keV black body or Fe-L line emission.

  12. MR PROSTATE SEGMENTATION VIA DISTRIBUTED DISCRIMINATIVE DICTIONARY (DDD) LEARNING.

    Science.gov (United States)

    Guo, Yanrong; Zhan, Yiqiang; Gao, Yaozong; Jiang, Jianguo; Shen, Dinggang

    2013-01-01

    Segmenting prostate from MR images is important yet challenging. Due to non-Gaussian distribution of prostate appearances in MR images, the popular active appearance model (AAM) has its limited performance. Although the newly developed sparse dictionary learning method[1, 2] can model the image appearance in a non-parametric fashion, the learned dictionaries still lack the discriminative power between prostate and non-prostate tissues, which is critical for accurate prostate segmentation. In this paper, we propose to integrate deformable model with a novel learning scheme, namely the Distributed Discriminative Dictionary ( DDD ) learning, which can capture image appearance in a non-parametric and discriminative fashion. In particular, three strategies are designed to boost the tissue discriminative power of DDD. First , minimum Redundancy Maximum Relevance (mRMR) feature selection is performed to constrain the dictionary learning in a discriminative feature space. Second , linear discriminant analysis (LDA) is employed to assemble residuals from different dictionaries for optimal separation between prostate and non-prostate tissues. Third , instead of learning the global dictionaries, we learn a set of local dictionaries for the local regions (each with small appearance variations) along prostate boundary, thus achieving better tissue differentiation locally. In the application stage, DDDs will provide the appearance cues to robustly drive the deformable model onto the prostate boundary. Experiments on 50 MR prostate images show that our method can yield a Dice Ratio of 88% compared to the manual segmentations, and have 7% improvement over the conventional AAM.

  13. MASTER prediscovery observations of SSS130101:122222-311525

    Science.gov (United States)

    Levato, H.; Saffe, C.; Mallamaci, C.; Lopez, C.; Podest, F.; Denisenko, D.; Lipunov, V.; Gorbovskoy, E.; Balanutsa, P.; Yecheistov, V.; Tiurina, N.; Kornilov, V.; Belinski, A.; Shatskiy, N.; Chazov, V.; Kuznetsov, A.; Zimnukhov, D.; Krushinsky, V.; Zalozhnih, I.; Popov, A.; Bourdanov, A.; Punanova, A.; Ivanov, K.; Yazev, S.; Budnev, N.; Konstantinov, E.; Chuvalaev, O.; Poleshchuk, V.; Gress, O.; Parkhomenko, A.; Tlatov, A.; Dormidontov, D.; Senik, V.; Yurkov, V.; Sergienko, Y.; Varda, D.; Sinyakov, E.; Shumkov, V.; Shurpakov, S.; Podvorotny, P.

    2013-01-01

    Following the announcement of a bright transient SSS130101:122222-311525 detected by CRTS (Drake et al., ATel #4699) we have checked the archival observations of this field by MASTER-ICATE very wide field camera (72-mm f/1.2 lens + 11 Mpx CCD, FOV=24x16 sq. deg.) located at OAFA near San Juan, Argentina. The object is present on two combined images obtained on 2012 Dec. 16.357 UT (total exposure time 122 sec) and 2012 Dec.

  14. [Measurement of antimicrobial consumption using DDD per 100 bed-days versus DDD per 100 discharges after the implementation of an antimicrobial stewardship program].

    Science.gov (United States)

    Collado, Roberto; Losa, Juan Emilio; Álvaro, Elena Alba; Toro, Piedad; Moreno, Leonor; Pérez, Montserrat

    2015-12-01

    Monitoring antimicrobial consumption in hospitals is a necessary measure. The indicators commonly employed do not clearly reflect the antibiotic selection pressure. The objective of this study is to evaluate two different methods that analyze antimicrobial consumption based on DDD, per stay and per discharge, before and after the implementation an antimicrobial stewardship program. Comparative pre-post study of antimicrobial consumption with the implementation of an antimicrobial stewardship program using DDD per 100 bed-days and DDD per 100 discharges as indicators. Hospital bed days remained stable and discharges increased slightly along the period of study Antibiotic consumption in DDD per 100 bed-days decreased by 2.5% versus 3.8% when expressed as DDD per 100 discharges. Antifungal consumption decreased by more than 50%. When average hospital stay decreases, reductions in the consumption of antimicrobials with an antimicrobial stewardship program system occur at the expense of reducing the number of patients receiving treatment, while increases occur due to longer durations of treatment.

  15. A Confirmatory Factor Analysis of an Abbreviated Social Support Instrument: The MOS-SSS

    Science.gov (United States)

    Gjesfjeld, Christopher D.; Greeno, Catherine G.; Kim, Kevin H.

    2008-01-01

    Objective: Confirm the factor structure of the original 18-item Medical Outcome Study Social Support Survey (MOS-SSS) as well as two abbreviated versions in a sample of mothers with a child in mental health treatment. Method: The factor structure, internal consistency, and concurrent validity of the MOS-SSS were assessed using a convenience sample…

  16. Spatial δ18Osw-SSS relationship across the western tropical Pacific Ocean

    Science.gov (United States)

    Thompson, D. M.; Conroy, J. L.; Wyman, A.; Read, D.

    2017-12-01

    Dynamic hydroclimate processes across the western tropical Pacific lead to strong spatial and temporal variability in δ18Osw and sea-surface salinity (SSS) across the western Pacific. Corals in this region have therefore provided key information about past SSS variability, as δ18Osw contributes strongly to coral δ18O across this region. However, uncertainties in the δ18Osw-SSS relationship across space and time often limit quantitative SSS reconstructions from such coral records. Recent work demonstrates considerable variability in the δ18Osw-SSS relationship across the Pacific, which may lead to over- or under-estimation of the contribution of SSS to coral δ18O, particularly across the western tropical Pacific (Conroy et al. 2017). Here we assess the spatial δ18Osw-SSS relationship across the dynamic western tropical Pacific, capitalizing on a transit between Subic Bay, Philippines and Townsville, Australia aboard the International Ocean Discovery program's JOIDES Resolution. Water samples and weather conditions were collected 3 times daily (6:00, 12:00, 18:00) en route, resulting in a network of 47 samples spaced at semi-regular 130-260 km intervals across the western Pacific from 14°N to 18°S. The route also crossed near long-term δ18Osw monitoring sites at Papua New Guinea and Palau (Conroy et al. 2017), allowing us to compare the spatial and temporal δ18Osw-SSS relationships at these sites and test the space-for-time assumption. We present the δ18Osw-SSS relationship across this region, compare the relationship across space and time, and discuss the implications of our results for SSS reconstructions from coral δ18O.

  17. An AAA-DDD triply hydrogen-bonded complex easily accessible for supramolecular polymers.

    Science.gov (United States)

    Han, Yi-Fei; Chen, Wen-Qiang; Wang, Hong-Bo; Yuan, Ying-Xue; Wu, Na-Na; Song, Xiang-Zhi; Yang, Lan

    2014-12-15

    For a complementary hydrogen-bonded complex, when every hydrogen-bond acceptor is on one side and every hydrogen-bond donor is on the other, all secondary interactions are attractive and the complex is highly stable. AAA-DDD (A=acceptor, D=donor) is considered to be the most stable among triply hydrogen-bonded sequences. The easily synthesized and further derivatized AAA-DDD system is very desirable for hydrogen-bonded functional materials. In this case, AAA and DDD, starting from 4-methoxybenzaldehyde, were synthesized with the Hantzsch pyridine synthesis and Friedländer annulation reaction. The association constant determined by fluorescence titration in chloroform at room temperature is 2.09×10(7)  M(-1) . The AAA and DDD components are not coplanar, but form a V shape in the solid state. Supramolecular polymers based on AAA-DDD triply hydrogen bonded have also been developed. This work may make AAA-DDD triply hydrogen-bonded sequences easily accessible for stimuli-responsive materials. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. SSS: A code for computing one dimensional shock and detonation wave propagation

    International Nuclear Information System (INIS)

    Sun Chengwei

    1986-01-01

    The one-dimensional hydrodynamic code SSS for shock and detonation wave propagation in inert and reactive media is described. The elastic-plastic-hydrodynamic model and four burn techniques (the Arrhenius law, C-J volume, sharp shock and Forest Fire) are used. There are HOM and JWL options for the state equation of detonation products. Comparing with the SIN code published by LANL, the SSS code has several new options: laser effects, blast waves, diverging and instantaneous detonation waves with arbitrary initiation positions. Two examples are given to compare the SSS and SIN calculations with the experimental data

  19. Drosophila QVR/SSS modulates the activation and C-type inactivation kinetics of Shaker K+ channels

    Science.gov (United States)

    Dean, Terry; Xu, Rong; Joiner, William; Sehgal, Amita; Hoshi, Toshinori

    2011-01-01

    The quiver/sleepless (qvr/sss) gene encodes a small, glycosylphosphatidylinositol-anchored protein that plays a critical role in the regulation of sleep in Drosophila. Loss-of-function mutations in qvr/sss severely suppress sleep and effect multiple changes in in situ Shaker K+ currents, including decreased magnitude, slower time-to-peak, and cumulative inactivation. Recently, we demonstrated that SLEEPLESS (SSS) protein modulates Shaker channel activity, possibly through a direct interaction at the plasma membrane. We show here that SSS accelerates the activation of heterologously expressed Shaker channels with no effect on deactivation or fast N-type inactivation. Furthermore, this SSS-induced acceleration is sensitive to the pharmacological disruption of lipid rafts and sufficiently accounts for the slower time-to-peak of in situ Shaker currents seen in qvr/sss mutants. We also find that SSS decreases the rate of C-type inactivation of heterologously expressed Shaker channels, providing a potential mechanism for the cumulative inactivation phenotype induced by qvr/sss loss of function mutations. Kinetic modeling based on the in vitro results suggests that the SSS-dependent regulation of channel kinetics accounts for nearly 40% of the decrease in Shaker current magnitude in flies lacking SSS. Sleep duration in qvr/sss null mutants is restored to normal by a qvr/sss transgene that fully rescues the Shaker kinetic phenotypes but only partially rescues the decrease in current magnitude. Together, these results suggest that the role of SSS in the regulation of sleep in Drosophila correlates more strongly with the effects of SSS on Shaker kinetics than current magnitude. PMID:21813698

  20. Drosophila QVR/SSS modulates the activation and C-type inactivation kinetics of Shaker K(+) channels.

    Science.gov (United States)

    Dean, Terry; Xu, Rong; Joiner, William; Sehgal, Amita; Hoshi, Toshinori

    2011-08-03

    The quiver/sleepless (qvr/sss) gene encodes a small, glycosylphosphatidylinositol-anchored protein that plays a critical role in the regulation of sleep in Drosophila. Loss-of-function mutations in qvr/sss severely suppress sleep and effect multiple changes in in situ Shaker K(+) currents, including decreased magnitude, slower time-to-peak, and cumulative inactivation. Recently, we demonstrated that SLEEPLESS (SSS) protein modulates Shaker channel activity, possibly through a direct interaction at the plasma membrane. We show here that SSS accelerates the activation of heterologously expressed Shaker channels with no effect on deactivation or fast N-type inactivation. Furthermore, this SSS-induced acceleration is sensitive to the pharmacological disruption of lipid rafts and sufficiently accounts for the slower time-to-peak of in situ Shaker currents seen in qvr/sss mutants. We also find that SSS decreases the rate of C-type inactivation of heterologously expressed Shaker channels, providing a potential mechanism for the cumulative inactivation phenotype induced by qvr/sss loss-of-function mutations. Kinetic modeling based on the in vitro results suggests that the SSS-dependent regulation of channel kinetics accounts for nearly 40% of the decrease in Shaker current magnitude in flies lacking SSS. Sleep duration in qvr/sss-null mutants is restored to normal by a qvr/sss transgene that fully rescues the Shaker kinetic phenotypes but only partially rescues the decrease in current magnitude. Together, these results suggest that the role of SSS in the regulation of sleep in Drosophila correlates more strongly with the effects of SSS on Shaker kinetics than current magnitude.

  1. effect of o,p'-DDD on the in vivo incorporation of 3H-thymidine into DNA

    International Nuclear Information System (INIS)

    Lund, B.-O.; Brandt, I.; Busk, L.; Hellmann, B.

    1990-01-01

    The effects of o,p'-DDD on the DNA synthesis in the C57Bl mouse lung and liver were studied. As determined by 3 H-thymidine incorporation into DNA, a selective increase in the lung DNA synthesis (+59%) was observed 2 day after a single intraperiotoneal injection of 100 mg/kg o,p'-DDD. Microautoradiography showed that incorporated 3 H-thymidine was confined to a restricted number of heavily labelled cells, presumably proliferating type II cells. At the most, a 9 times higher rate of cell proliferation was observed in the lung 4 days after an intraperitoneal injection of 500 mg/kg o,p'-DDD. Using mouse lung or liver S-9 as activating system, no mutagenic activity of o,p'-DDD was detected in the Ames test. The induced cell proliferation may indicate a tissue-selective promotor activity of o,p'-DDD in the mouse lung. (author)

  2. Guided Iterative Substructure Search (GI-SSS) - A New Trick for an Old Dog.

    Science.gov (United States)

    Weskamp, Nils

    2016-07-01

    Substructure search (SSS) is a fundamental technique supported by various chemical information systems. Many users apply it in an iterative manner: they modify their queries to shape the composition of the retrieved hit sets according to their needs. We propose and evaluate two heuristic extensions of SSS aimed at simplifying these iterative query modifications by collecting additional information during query processing and visualizing this information in an intuitive way. This gives the user a convenient feedback on how certain changes to the query would affect the retrieved hit set and reduces the number of trial-and-error cycles needed to generate an optimal search result. The proposed heuristics are simple, yet surprisingly effective and can be easily added to existing SSS implementations. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. The somatic symptom scale-8 (SSS-8): a brief measure of somatic symptom burden.

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Kroenke, Kurt; Spangenberg, Lena; Zenger, Markus; Brähler, Elmar; Löwe, Bernd

    2014-03-01

    Somatic symptoms are the core features of many medical diseases, and they are used to evaluate the severity and course of illness. The 8-item Somatic Symptom Scale (SSS-8) was recently developed as a brief, patient-reported outcome measure of somatic symptom burden, but its reliability, validity, and usefulness have not yet been tested. To investigate the reliability, validity, and severity categories as well as the reference scores of the SSS-8. A national, representative general-population survey was performed between June 15, 2012, and July 15, 2012, in Germany, including 2510 individuals older than 13 years. The SSS-8 mean (SD), item-total correlations, Cronbach α, factor structure, associations with measures of construct validity (Patient Health Questionnaire-2 depression scale, Generalized Anxiety Disorder-2 scale, visual analog scale for general health status, 12-month health care use), severity categories, and percentile rank reference scores. The SSS-8 had excellent item characteristics and good reliability (Cronbach α = 0.81). The factor structure reflects gastrointestinal, pain, fatigue, and cardiopulmonary aspects of the general somatic symptom burden. Somatic symptom burden as measured by the SSS-8 was significantly associated with depression (r = 0.57 [95% CI, 0.54 to 0.60]), anxiety (r = 0.55 [95% CI, 0.52 to 0.58]), general health status (r = -0.24 [95% CI, -0.28 to -0.20]), and health care use (incidence rate ratio, 1.12 [95% CI, 1.10 to 1.14]). The SSS-8 severity categories were calculated in accordance with percentile ranks: no to minimal (0-3 points), low (4-7 points), medium (8-11 points), high (12-15 points), and very high (16-32 points) somatic symptom burden. For every SSS-8 severity category increase, there was a 53% (95% CI, 44% to 63%) increase in health care visits. The SSS-8 is a reliable and valid self-report measure of somatic symptom burden. Cutoff scores identify individuals with low, medium, high, and very high somatic

  4. Biochemical, Kinetic, and Spectroscopic Characterization of Ruegeria pomeroyi DddW--A Mononuclear Iron-Dependent DMSP Lyase.

    Directory of Open Access Journals (Sweden)

    Adam E Brummett

    Full Text Available The osmolyte dimethylsulfoniopropionate (DMSP is a key nutrient in marine environments and its catabolism by bacteria through enzymes known as DMSP lyases generates dimethylsulfide (DMS, a gas of importance in climate regulation, the sulfur cycle, and signaling to higher organisms. Despite the environmental significance of DMSP lyases, little is known about how they function at the mechanistic level. In this study we biochemically characterize DddW, a DMSP lyase from the model roseobacter Ruegeria pomeroyi DSS-3. DddW is a 16.9 kDa enzyme that contains a C-terminal cupin domain and liberates acrylate, a proton, and DMS from the DMSP substrate. Our studies show that as-purified DddW is a metalloenzyme, like the DddQ and DddP DMSP lyases, but contains an iron cofactor. The metal cofactor is essential for DddW DMSP lyase activity since addition of the metal chelator EDTA abolishes its enzymatic activity, as do substitution mutations of key metal-binding residues in the cupin motif (His81, His83, Glu87, and His121. Measurements of metal binding affinity and catalytic activity indicate that Fe(II is most likely the preferred catalytic metal ion with a nanomolar binding affinity. Stoichiometry studies suggest DddW requires one Fe(II per monomer. Electronic absorption and electron paramagnetic resonance (EPR studies show an interaction between NO and Fe(II-DddW, with NO binding to the EPR silent Fe(II site giving rise to an EPR active species (g = 4.29, 3.95, 2.00. The change in the rhombicity of the EPR signal is observed in the presence of DMSP, indicating that substrate binds to the iron site without displacing bound NO. This work provides insight into the mechanism of DMSP cleavage catalyzed by DddW.

  5. Approaches for increasing the cooperation between Member States and IAEA under SSS

    International Nuclear Information System (INIS)

    Rheem, Karp-Soon; Park, Wan-Sou; Kim, Byung-Koo

    1997-01-01

    With introduction of the Strengthened Safeguards System (SSS), both the IAEA and Member States are concerned about the limited resources to carry out the SSS activity and the potential increase of additional cost and burdens. Even though the IAEA has recently prepared a procedure of the generalized New Partnership Approach (NPA), its wider application to the general Member States is difficult at the present time. For the generalized NPA necessitates that SSACs of the Member States have sufficient technical capability in safeguards to carry out the necessary activities. Unfortunately a few Member States seem to be qualified to have the sufficient technical capability that the IAEA desires. In this topic, a new approach to increase the cooperation between Member States and IAEA under SSS is proposed such that effective supports can be provided to all of its Member States that are not technically competent in terms of safeguards experience. This is realized by so called 'tunneling effort', meaning that desired goals are accomplished by efforts from both Member States and the IAEA. The Member States having high technical competence in safeguards provide technical assistance to the Member States that are not competent until they attain to a certain level in technical capability, while the IAEA provides the guidelines, and coordinates the process. The formal introduction of the Quality Control concept to the safeguards management is proposed as well so as to efficiently reduce burdens from the implementation of the SSS. (author)

  6. Indocyanine green videoangiography (ICGV)-guided surgery of parasagittal meningiomas occluding the superior sagittal sinus (SSS).

    Science.gov (United States)

    d'Avella, Elena; Volpin, Francesco; Manara, Renzo; Scienza, Renato; Della Puppa, Alessandro

    2013-03-01

    Maximal safe resection is the goal of correct surgical treatment of parasagittal meningiomas, and it is intimately related to the venous anatomy both near and directly involved by the tumor. Indocyanine green videoangiography (ICGV) has already been advocated as an intra-operative resourceful technique in brain tumor surgery for the identification of vessels. The aim of this study was to investigate the role of ICGV in surgery of parasagittal meningiomas occluding the superior sagittal sinus (SSS). In this study, we prospectively analyzed clinical, radiological and intra-operative findings of patients affected by parasagittal meningioma occluding the SSS, who underwent ICGV assisted-surgery. Radiological diagnosis of complete SSS occlusion was pre-operatively established in all cases. ICGV was performed before dural opening, before and during tumor resection, at the end of the procedure. Five patients were included in our study. In all cases, ICGV guided dural opening, tumor resection, and venous management. The venous collateral pathway was easily identified and preserved in all cases. Radical resection was achieved in four cases. Surgery was uneventful in all cases. Despite the small number of patients, our study shows that ICG videoangiography could play a crucial role in guiding surgery of parasagittal meningioma occluding the SSS. Further studies are needed to define the role of this technique on functional and oncological outcome of these patients.

  7. Sodium concentration in home made salt – sugar – solution (sss ...

    African Journals Online (AJOL)

    In a cohort of 210 young mothers, selected through cluster sampling technique from Ogida health district of Egor Local Government Area of Edo State, the electrolyte concentration of prepared salt-sugar-solutions (SSS) were evaluated. This was predicated on the need to determine the effects of introduction of various ...

  8. Increasing synthetic serum substitute (SSS) concentrations in P1 glucose/phosphate-free medium improves implantation rate: a comparative study.

    Science.gov (United States)

    Ben-Yosef, D; Yovel, I; Schwartz, T; Azem, F; Lessing, J B; Amit, A

    2001-11-01

    To assess the comparative efficacy of IVF medium (MediCult, with 5.2 mM glucose) and a glucose/phosphate-free medium, P1 (Irvine Scientific), and to investigate the influence of increasing the serum supplementation (synthetic serum substitute; SSS; Irvine Scientific) to P1 on embryo development and implantation. Patients were randomly assigned to IVF medium (Group 1, cycles n = 172) or P1 supplemented with 10% SSS (Group 2, cycles n = 229) according to the medium scheduled for use on the day of oocyte retrieval. Another 555 IVF consequent cycles (Group 3) were performed using increased SSS concentrations (20%) in P1 medium. In this large series of IVF cycles, we herein demonstrate that significantly higher pregnancy and implantation rates were found when embryos were cultured in glucose/phosphate-free medium P1 supplemented with 20% SSS compared to supplementation with the lower SSS concentration and with IVF medium.

  9. Agent-based Decision Support System for the Third Generation Distributed Dynamic Decision-making (DDD-III) Simulator

    National Research Council Canada - National Science Library

    Meirina, Candra; Ruan, Sui; Yu, Feili; Zhu, Liang; Pattipati, Krishna R; Kleinman, David L

    2004-01-01

    ...) based on the third-generation distributed dynamic decision-making (DDD-III) simulator and contingency theory to increase the organizational cognitive capacity and to facilitate the processes of adaptation...

  10. The Assembly of the LHC Short Straight Sections (SSS) at CERN Project Status and Lessons Learned

    CERN Document Server

    Parma, Vittorio; Dos Santos de Campos, Paulo M; Feitor, Rogerio C; Gandel, Makcim; López, R; Schmidlkofer, Martin; Slits, Ivo

    2005-01-01

    The series production of the LHC SSS has started in the beginning of 2004 and is foreseen to last until end 2006. The production consists in the assembly of 474 cold masses housing superconducting quadrupoles and corrector magnets within their cryostats. 87 cold mass variants, resulting from various combinations of main quadrupole and corrector magnets, have to be assembled in 55 cryostat types, depending on the specific cryogenic and electrical powering schemes required by the collider topology. The assembly activity features the execution of more than 5 km of leak-tight welding of stainless steel and aluminium cryogenic lines, designed for 20-bar pressure, according to high qualification standards and undergoing severe QA inspections. Some 2500 leak detection tests, using He mass spectrometry, are required to check the tightness of the cryogenic circuits. Extensive electrical control work, to check the integrity of the magnet instrumentation and electrical circuits throughout the assembly of the SSS, is als...

  11. Einstein SSS and MPC observations of Aql X-1 and 4U1820-30

    Science.gov (United States)

    Kelley, R. L.; Christian, D. J.; Schoelkopf, R. J.; Swank, J. H.

    1989-01-01

    The results of timing and spectral analyses of the X-ray sources Aql X-1 (X1908+005) and 4U1820-30 (NGC6624) are reported using data obtained with the Einstein SSS (Solid State Spectrometer) and MPC (Monitor Proportional Counter) instruments. A classic type I burst was observed from Aql X-1 in both detectors and a coherent modulation with a period of 131.66 + or - 0.02 ms and a pulsed fraction of 10 percent was detected in the SSS data. There is no evidence for a loss of coherance during the approximately 80 sec when the burst is observable. The 2 sigma upper limit on the rate of change of the pulse period is 0.00005s/s. It is argued that an asymmetrical burst occurring on a neutron star rotating at 7.6 Hz offers a plausible explanation for the oscillation. The data from 4U1820-30 show that the amplitude of the 685 sec modulation, identified as the orbital period, is independent of energy down to 0.6 keV. The SSS data show that the light curve in the 0.6 to 4.5 keV band is smoother than at higher energies.

  12. Unita di consumo dei farmaci e valutazioni farmacoeconomiche: uso e misuso di DDD e PDD

    Directory of Open Access Journals (Sweden)

    Mario Eandi

    2002-12-01

    Full Text Available In pharmacoeconomical evaluations the quantification of drug utilization has to be done on the basis of measurement units that allow comparisons among series of longitudinal and transversal data. The most common techniques used for the analysis and the comparison of drug utilization patterns are based either on the Defined Daily Dose (DDD, a unit system proposed by WHO’s Drug Utilization Research Group, or on the Prescribed Daily Dose (PDD, a statistical parameter obtained from the analysis of drug prescriptions. This article illustrates the meaning of the main indicators of drug consumption that can be build with these techniques, underlining their utility and limitations. The DDD is the conventionally established theoretical mean daily dose of a drug, referred to a way of administration and to its main indication. It is, therefore, a mere technical measurement unit that cannot be interpreted as mean prescribed or consumed dose, and even less as recommended dose. The PDD, on the contrary, is not a measurement unit but a statistical mean value, that expresses the central tendency of the prescription variability in a defined setting. Starting from Italian data on the consumption of wide-spread antibiotics, the use and interpretation of various indicators based on the DDDs and PDDs are discussed. The parameters derived with the DDD technique are suitable for monitoring drug utilization and pharmaceutical expenditure. The PDD method is more direct, indicates the mean quantities actually prescribed and permits the estimation of the total dose consumed per therapeutic cycle and of other clinically relevant parameters, but requires the acquisition of more data than the other technique does. It is also important to remark the fact that both methods can’t be directly used for economical evaluations trying to assess the efficiency of resource allocation, as they are not correlated to the clinical outcomes of the therapy.

  13. Modelling Coastal Cliff Recession Based on the GIM-DDD Method

    Science.gov (United States)

    Gong, Bin; Wang, Shanyong; Sloan, Scott William; Sheng, Daichao; Tang, Chun'an

    2018-04-01

    The unpredictable and instantaneous collapse behaviour of coastal rocky cliffs may cause damage that extends significantly beyond the area of failure. Gravitational movements that occur during coastal cliff recession involve two major stages: the small deformation stage and the large displacement stage. In this paper, a method of simulating the entire progressive failure process of coastal rocky cliffs is developed based on the gravity increase method (GIM), the rock failure process analysis method and the discontinuous deformation analysis method, and it is referred to as the GIM-DDD method. The small deformation stage, which includes crack initiation, propagation and coalescence processes, and the large displacement stage, which includes block translation and rotation processes during the rocky cliff collapse, are modelled using the GIM-DDD method. In addition, acoustic emissions, stress field variations, crack propagation and failure mode characteristics are further analysed to provide insights that can be used to predict, prevent and minimize potential economic losses and casualties. The calculation and analytical results are consistent with previous studies, which indicate that the developed method provides an effective and reliable approach for performing rocky cliff stability evaluations and coastal cliff recession analyses and has considerable potential for improving the safety and protection of seaside cliff areas.

  14. 188Re-SSS lipiodol: radiolabelling and biodistribution following injection into the hepatic artery of rats bearing hepatoma.

    Science.gov (United States)

    Garin, Etienne; Denizot, Benoit; Noiret, Nicolas; Lepareur, Nicolas; Roux, Jerome; Moreau, Myriam; Herry, Jean-Yves; Bourguet, Patrick; Benoit, Jean-Pierre; Lejeune, Jean-Jacques

    2004-10-01

    Although intra-arterial radiation therapy with 131I-lipiodol is a useful therapeutic approach to the treatment of hepatocellular carcinoma, various disadvantages limit its use. To describe the development of a method for the labelling of lipiodol with 188Re-SSS (188Re (S2CPh)(S3CPh)2 complex) and to investigate its biodistribution after injection into the hepatic artery of rats with hepatoma. 188Re-SSS lipiodol was obtained after dissolving a chelating agent, previously labelled with 188Re, in cold lipiodol. The radiochemical purity (RCP) of labelling was checked immediately. The 188Re-SSS lipiodol was injected into the hepatic artery of nine rats with a Novikoff hepatoma. They were sacrificed 1, 24 and 48 h after injection, and used for ex vivo counting. Labelling of 188Re-SSS lipiodol was achieved with a yield of 97.3+/-2.1%. The immediate RCP was 94.1+/-1.7%. Ex vivo counting confirmed a predominantly hepatic uptake, with a good tumoral retention of 188Re-SSS lipiodol, a weak pulmonary uptake and a very faint digestive uptake. The 'tumour/non-tumoral liver' ratio was high at 1, 24 and 48 h after injection (2.9+/-1.5, 4.1+/-/4.1 and 4.1+/-0.7, respectively). Using the method described here, 188Re-SSS lipiodol can be obtained with a very high yield and a satisfactory RCP. The biodistribution in rats with hepatoma indicates a good tumoral retention of 188Re-SSS lipiodol associated with a predominant hepatic uptake, a weak pulmonary uptake and a very faint digestive uptake. This product should be considered for intra-arterial radiation therapy in human hepatoma.

  15. Psychometric testing of the Chinese version of the medical outcomes study social support survey (MOS-SSS-C).

    Science.gov (United States)

    Yu, Doris S F; Lee, Diana T F; Woo, Jean

    2004-04-01

    The purpose of this study was to assess the psychometric properties of the Chinese version of the Medical Outcomes Study Social Support Survey (MOS-SSS-C) in a sample of 110 patients. Criterion-related and construct validities of the MOS-SSS-C were evaluated by correlations with the Chinese version of the Multidimensional Perceived Social Support Survey (r =.82) and the Hospital Anxiety and Depression Scale (r = -.58). Confirmatory factor analysis affirmed the four-factor structure of the MOS-SSS-C in measuring the functional aspects of perceived social support. Cronbach's alphas for the subscales ranged from.93 to.96, whereas the alpha for the overall scale was.98. The 2-week test-retest reliability of the MOS-SSS-C as measured by the intraclass correlation coefficient was.84. The MOS-SSS-C is a psychometrically sound multidimensional measure for the evaluation of functional aspects of perceived social support by Chinese patients with chronic disease. Copyright 2004 Wiley Periodicals, Inc.

  16. Sensory-specific satiety for a food is unaffected by the ad libitum intake of other foods during a meal. Is SSS subject to dishabituation?

    Science.gov (United States)

    Meillon, S; Thomas, A; Havermans, R; Pénicaud, L; Brondel, L

    2013-04-01

    Sensory-specific satiety (SSS) is defined as a decrease in the pleasantness of a specific food that has just been eaten to satiation, while other non-eaten foods remain pleasant. The objectives of this study were the following: (1) to investigate whether SSS for a food is affected by the ad libitum intake of other foods presented sequentially during a meal, (2) to compare the development of SSS when foods are presented simultaneously or sequentially during a meal, and (3) to examine whether SSS is modified when foods are presented in an unusual order within a meal. Twelve participants participated in three tasting sessions. In session A, SSS for protein-, fat- and carbohydrate-rich sandwiches was measured after the ad libitum consumption of single type of each of these foods. In session B, SSS was measured for the same three foods consumed ad libitum but presented simultaneously. Session C was identical to session A, except that the presentation order of the three foods was reversed. The results indicate that once SSS for a given food is reached, the ad libitum consumption of other foods with different sensory characteristics does not decrease SSS, regardless of the order in which the foods are presented. Once reached, SSS is thus not subject to dishabituation during a meal. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Evaluation of Polymerase Chain Reaction (PCR with Slit Skin Smear Examination (SSS to Confirm Clinical Diagnosis of Leprosy in Eastern Nepal.

    Directory of Open Access Journals (Sweden)

    Shraddha Siwakoti

    2016-12-01

    Full Text Available Detection of Mycobacterium leprae in slit skin smear (SSS is a gold standard technique for the leprosy diagnosis. Over recent years, molecular diagnosis by using PCR has been increasingly used as an alternative for its diagnosis due to its higher sensitivity. This study was carried out for comparative evaluation of PCR and SSS microscopy in a cohort of new leprosy cases diagnosed in B. P. Koirala Institute of health Sciences, Dharan, Nepal.In this prospective crossectional study, 50 new clinically diagnosed cases of leprosy were included. DNA was extracted from SSS and PCR was carried out to amplify 129 bp sequence of M. leprae repetitive element. Sensitivity of SSS and PCR was 18% and 72% respectively. Improvement of 54% case detection by PCR clearly showed its advantage over SSS. Furthermore, PCR could confirm the leprosy diagnosis in 66% of AFB negative cases indicating its superiority over SSS. In the paucibacillary (PB patients, whose BI was zero; sensitivity of PCR was 44%, whereas it was 78% in the multibacillary patients.Our study showed PCR to be more sensitive than SSS microscopy in diagnosing leprosy. Moreover, it explored the characteristic feature of PCR which detected higher level of early stage(PB cases tested negative by SSS. Being an expensive technique, PCR may not be feasible in all the cases, however, it would be useful in diagnosis of early cases of leprosy as opposed to SSS.

  18. Evaluation of Polymerase Chain Reaction (PCR) with Slit Skin Smear Examination (SSS) to Confirm Clinical Diagnosis of Leprosy in Eastern Nepal.

    Science.gov (United States)

    Siwakoti, Shraddha; Rai, Keshav; Bhattarai, Narayan Raj; Agarwal, Sudha; Khanal, Basudha

    2016-12-01

    Detection of Mycobacterium leprae in slit skin smear (SSS) is a gold standard technique for the leprosy diagnosis. Over recent years, molecular diagnosis by using PCR has been increasingly used as an alternative for its diagnosis due to its higher sensitivity. This study was carried out for comparative evaluation of PCR and SSS microscopy in a cohort of new leprosy cases diagnosed in B. P. Koirala Institute of health Sciences, Dharan, Nepal. In this prospective crossectional study, 50 new clinically diagnosed cases of leprosy were included. DNA was extracted from SSS and PCR was carried out to amplify 129 bp sequence of M. leprae repetitive element. Sensitivity of SSS and PCR was 18% and 72% respectively. Improvement of 54% case detection by PCR clearly showed its advantage over SSS. Furthermore, PCR could confirm the leprosy diagnosis in 66% of AFB negative cases indicating its superiority over SSS. In the paucibacillary (PB) patients, whose BI was zero; sensitivity of PCR was 44%, whereas it was 78% in the multibacillary patients. Our study showed PCR to be more sensitive than SSS microscopy in diagnosing leprosy. Moreover, it explored the characteristic feature of PCR which detected higher level of early stage(PB) cases tested negative by SSS. Being an expensive technique, PCR may not be feasible in all the cases, however, it would be useful in diagnosis of early cases of leprosy as opposed to SSS.

  19. The role of SSAC in the implementation of SSS Part 2

    International Nuclear Information System (INIS)

    Min, K. S.; Lee, B. D.; Soh, D. S.

    1998-01-01

    Conventional role of SSAC is known to the support of the Agency's inspection and the implementation of national inspection according to the law. The change of international safeguards system requires the change of the role of SSAC. This paper illustrated the role of SSAC in the conventional safeguards system and analyzed the role of SSAC in the new system of safeguards. State has an obligation to reserve nuclear material existing in its territory according to the safeguards agreement and thus the systematic SSAC should be maintained for the purpose of the reservation of the nuclear material. Additional role of the SSAC due to the implementation of the SSS can be divided into two; Firstly the aid of the researcher for the expanded declaration and secondly reduction of the amount of IAEA inspection through the cooperation and confidence building measures

  20. The results of electromagnetic studies of the Bragin-Loev ledge and the Chernihiv block of the DDD

    OpenAIRE

    Kushnir, A. N.; Burakhovich, T. R.

    2017-01-01

    The distribution of geomagnetic variations and the electric field on the Earth’s surface was obtained as a result of the modern experimental observations conducted in 2013 (10 points) in the northwestern part of the Dnieper-Donets depression (DDD) by the methods of magnetotelluric sounding (MTS) and magnetovariation profiling (MVP). It is possible to estimate the value of the electric conductivity and vertical and horizontal geoelectric structure. The processing of these data is done using th...

  1. [Cultural adaptation and validation of the Medical Outcomes Study Social Support Survey questionnaire (MOS-SSS)].

    Science.gov (United States)

    Alonso Fachado, A; Montes Martinez, A; Menendez Villalva, C; Pereira, M Graça

    2007-01-01

    The aim of this study was the assesment of psychometric properties of the Portuguese version of the instrument "Medical Outcomes Study - Social Support Survey (MOSSSS)". This questionnaire has been translated and adapted in a Portuguese sample of 101 patients with chronic illness of a rural health centre in Portugal. The average age of patients was 63.4 years, 56.4% female. 29% were illiterate and 2% had completed high school. 78% had arterial hypertension and the 56.4% had diabetes mellitus type 2. The internal consistency was evaluated using Cronbach's alpha. Exploratory and Confirmatory factor analysis were performed in order to confirm reliability and validity of the scale and its multidimensional characteristics. The 2-week test-retest reliability was estimated using weighted kappa for the ordinals variables and intraclass coefficient correlation for the quantitative variables. Cronbach's alphas for the subscales ranged from 0.873 to 0.967 at test, and 0.862 to 0.972 at retest. Exploratory factor analysis revealed the existence of four factors (emotional, tangible, positive interaction and affection support) that explain the 72.71% of the variance. Confirmatory factor analysis supported the existence of four factors that allowed the application of the scale with original items. The goodness-of-fit measures corroborate the initial structure, with chi2/ df=2.01, GFI=0.998, CFI=0.999, AGFI=0.998, TLI=0.999, NFI=0.998, SRMR=0.332, RMSEA=0.76. The 2-weeks test-retest reliability of the Portuguese MOS-SSS as measured by the intraclass correlation coefficient was ranged from 0.941 to 0.966 for the four dimensions and the overall support index. The weighted kappa was ranged from 0.67 to 0.87 for all the items. The MOS-SSS Portuguese version demonstrates good psychometric properties and seems to be useful to measure multidimensional aspects of social support in the Portuguese population.

  2. The Dichotic Digits difference Test (DDdT): Development, Normative Data, and Test-Retest Reliability Studies Part 1.

    Science.gov (United States)

    Cameron, Sharon; Glyde, Helen; Dillon, Harvey; Whitfield, Jessica; Seymour, John

    2016-06-01

    The dichotic digits test is one of the most widely used assessment tools for central auditory processing disorder. However, questions remain concerning the impact of cognitive factors on test results. To develop the Dichotic Digits difference Test (DDdT), an assessment tool that could differentiate children with cognitive deficits from children with genuine dichotic deficits based on differential test results. The DDdT consists of four subtests: dichotic free recall (FR), dichotic directed left ear (DLE), dichotic directed right ear (DRE), and diotic. Scores for six conditions are calculated (FR left ear [LE], FR right ear [RE], and FR total, as well as DLE, DRE, and diotic). Scores for four difference measures are also calculated: dichotic advantage, right-ear advantage (REA) FR, REA directed, and attention advantage. Experiment 1 involved development of the DDdT, including error rate analysis. Experiment 2 involved collection of normative and test-retest reliability data. Twenty adults (aged 25 yr 10 mo to 50 yr 7 mo, mean 36 yr 4 mo) took part in the development study; 62 normal-hearing, typically developing, primary-school children (aged 7 yr 1 mo to 11 yr 11 mo, mean 9 yr 4 mo) and 10 adults (aged 25 yr 0 mo to 51 yr 6 mo, mean 34 yr 10 mo) took part in the normative and test-retest reliability study. In Experiment 1, error rate analysis was conducted on the 36 digit-pair combinations of the DDdT. Normative data collected in Experiment 2 were arcsine transformed to achieve a distribution that was closer to a normal distribution and z-scores calculated. Pearson product-moment correlations were used to determine the strength of relationships between DDdT conditions. The development study revealed no significant differences in the adult population between test and retest on any DDdT condition. Error rates on 36 digit pairs ranged from 1.5% to 16.7%. The most and the least error-prone digits were removed before commencement of the normative data study, leaving 25

  3. Superhumps linked to X-ray emission. The superoutbursts of SSS J122221.7-311525 and GW Lib

    Science.gov (United States)

    Neustroev, V. V.; Page, K. L.; Kuulkers, E.; Osborne, J. P.; Beardmore, A. P.; Knigge, C.; Marsh, T.; Suleimanov, V. F.; Zharikov, S. V.

    2018-03-01

    Context. We present more than 4 years of Swift X-ray observations of the 2013 superoutburst, subsequent decline and quiescence of the WZ Sge-type dwarf nova SSS J122221.7-311525 (SSS J122222) from 6 days after discovery. Aims: Only a handful of WZ Sge-type dwarf novae have been observed in X-rays, and until recently GW Lib was the only binary of this type with complete coverage of an X-ray light curve throughout a superoutburst. We collected extensive X-ray data of a second such system to understand the extent to which the unexpected properties of GW Lib are common to the WZ Sge class. Methods: We collected 60 Swift-XRT observations of SSS J122222 between 2013 January 6 and 2013 July 1. Four follow-up observations were performed in 2014, 2015, 2016 and 2017. The total exposure time of our observations is 86.6 ks. We analysed the X-ray light curve and compared it with the behaviour of superhumps which were detected in the optical light curve. We also performed spectral analysis of the data. The results were compared with the properties of GW Lib, for which new X-ray observations were also obtained. Results: SSS J122222 was variable and around five times brighter in 0.3-10 keV X-rays during the superoutburst than in quiescence, mainly because of a significant strengthening of a high-energy component of the X-ray spectrum. The post-outburst decline of the X-ray flux lasted at least 500 d. The data show no evidence of the expected optically thick boundary layer in the system during the outburst. SSS J122222 also exhibited a sudden X-ray flux change in the middle of the superoutburst, which occurred exactly at the time of the superhump stage transition. A similar X-ray behaviour was also detected in GW Lib. Conclusions: We show that the X-ray flux exhibits changes at the times of changes in the superhump behaviour of both SSS J122222 and GW Lib. This result demonstrates a relationship between the outer disc and the white dwarf boundary layer for the first time, and

  4. Comparison of SSS and SRS calculated from normal databases provided by QPS and 4D-MSPECT manufacturers and from identical institutional normals.

    Science.gov (United States)

    Knollmann, Daniela; Knebel, Ingrid; Koch, Karl-Christian; Gebhard, Michael; Krohn, Thomas; Buell, Ulrich; Schaefer, Wolfgang M

    2008-02-01

    There is proven evidence for the importance of myocardial perfusion-single-photon emission computed tomography (SPECT) with computerised determination of summed stress and rest scores (SSS/SRS) for the diagnosis of coronary artery disease (CAD). SSS and SRS can thereby be calculated semi-quantitatively using a 20-segment model by comparing tracer-uptake with values from normal databases (NDB). Four severity-degrees for SSS and SRS are normally used: or =14. Manufacturers' NDBs (M-NDBs) often do not fit the institutional (I) settings. Therefore, this study compared SSS and SRS obtained with the algorithms Quantitative Perfusion SPECT (QPS) and 4D-MSPECT using M-NDB and I-NDB. I-NDBs were obtained using QPS and 4D-MSPECT from exercise stress data (450 MBq (99m)Tc-tetrofosmin, triple-head-camera, 30 s/view, 20 views/head) from 36 men with a low post-stress test CAD probability and visually normal SPECT findings. Patient group was 60 men showing the entire CAD-spectrum referred for routine perfusion-SPECT. Stress/rest results of automatic quantification of the 60 patients were compared to M-NDB and I-NDB. After reclassifying SSS/SRS into the four severity degrees, kappa values were calculated to objectify agreement. Mean values (vs M-NDB) were 9.4 +/- 10.3 (SSS) and 5.8 +/- 9.7 (SRS) for QPS and 8.2 +/- 8.7 (SSS) and 6.2 +/- 7.8 (SRS) for 4D-MSPECT. Thirty seven of sixty SSS classifications (kappa = 0.462) and 40/60 SRS classifications (kappa = 0.457) agreed. Compared to I-NDB, mean values were 10.2 +/- 11.6 (SSS) and 6.5 +/- 10.4 (SRS) for QPS and 9.2 +/- 9.3 (SSS) and 7.2 +/- 8.6 (SRS) for 4D-MSPECT. Forty four of sixty patients agreed in SSS and SRS (kappa = 0.621 resp. 0.58). Considerable differences between SSS/SRS obtained with QPS and 4D-MSPECT were found when using M-NDB. Even using identical patients and identical I-NDB, the algorithms still gave substantial different results.

  5. Lung Cancer Signature Biomarkers: tissue specific semantic similarity based clustering of Digital Differential Display (DDD data

    Directory of Open Access Journals (Sweden)

    Srivastava Mousami

    2012-11-01

    Full Text Available Abstract Background The tissue-specific Unigene Sets derived from more than one million expressed sequence tags (ESTs in the NCBI, GenBank database offers a platform for identifying significantly and differentially expressed tissue-specific genes by in-silico methods. Digital differential display (DDD rapidly creates transcription profiles based on EST comparisons and numerically calculates, as a fraction of the pool of ESTs, the relative sequence abundance of known and novel genes. However, the process of identifying the most likely tissue for a specific disease in which to search for candidate genes from the pool of differentially expressed genes remains difficult. Therefore, we have used ‘Gene Ontology semantic similarity score’ to measure the GO similarity between gene products of lung tissue-specific candidate genes from control (normal and disease (cancer sets. This semantic similarity score matrix based on hierarchical clustering represents in the form of a dendrogram. The dendrogram cluster stability was assessed by multiple bootstrapping. Multiple bootstrapping also computes a p-value for each cluster and corrects the bias of the bootstrap probability. Results Subsequent hierarchical clustering by the multiple bootstrapping method (α = 0.95 identified seven clusters. The comparative, as well as subtractive, approach revealed a set of 38 biomarkers comprising four distinct lung cancer signature biomarker clusters (panel 1–4. Further gene enrichment analysis of the four panels revealed that each panel represents a set of lung cancer linked metastasis diagnostic biomarkers (panel 1, chemotherapy/drug resistance biomarkers (panel 2, hypoxia regulated biomarkers (panel 3 and lung extra cellular matrix biomarkers (panel 4. Conclusions Expression analysis reveals that hypoxia induced lung cancer related biomarkers (panel 3, HIF and its modulating proteins (TGM2, CSNK1A1, CTNNA1, NAMPT/Visfatin, TNFRSF1A, ETS1, SRC-1, FN1, APLP2, DMBT1

  6. Comparison of SSS and SRS calculated from normal databases provided by QPS and 4D-MSPECT manufacturers and from identical institutional normals

    International Nuclear Information System (INIS)

    Knollmann, Daniela; Knebel, Ingrid; Gebhard, Michael; Krohn, Thomas; Buell, Ulrich; Schaefer, Wolfgang M.; Koch, Karl-Christian

    2008-01-01

    There is proven evidence for the importance of myocardial perfusion-single-photon emission computed tomography (SPECT) with computerised determination of summed stress and rest scores (SSS/SRS) for the diagnosis of coronary artery disease (CAD). SSS and SRS can thereby be calculated semi-quantitatively using a 20-segment model by comparing tracer-uptake with values from normal databases (NDB). Four severity-degrees for SSS and SRS are normally used: 99m Tc-tetrofosmin, triple-head-camera, 30 s/view, 20 views/head) from 36 men with a low post-stress test CAD probability and visually normal SPECT findings. Patient group was 60 men showing the entire CAD-spectrum referred for routine perfusion-SPECT. Stress/rest results of automatic quantification of the 60 patients were compared to M-NDB and I-NDB. After reclassifying SSS/SRS into the four severity degrees, kappa (κ) values were calculated to objectify agreement. Mean values (vs M-NDB) were 9.4 ± 10.3 (SSS) and 5.8 ± 9.7 (SRS) for QPS and 8.2 ± 8.7 (SSS) and 6.2 ± 7.8 (SRS) for 4D-MSPECT. Thirty seven of sixty SSS classifications (κ = 0.462) and 40/60 SRS classifications (κ = 0.457) agreed. Compared to I-NDB, mean values were 10.2 ± 11.6 (SSS) and 6.5 ± 10.4 (SRS) for QPS and 9.2 ± 9.3 (SSS) and 7.2 ± 8.6 (SRS) for 4D-MSPECT. Forty four of sixty patients agreed in SSS and SRS (κ = 0.621 resp. 0.58). Considerable differences between SSS/SRS obtained with QPS and 4D-MSPECT were found when using M-NDB. Even using identical patients and identical I-NDB, the algorithms still gave substantial different results. (orig.)

  7. A multi-physics analysis for the actuation of the SSS in opal reactor

    Directory of Open Access Journals (Sweden)

    Ferraro Diego

    2018-01-01

    Full Text Available OPAL is a 20 MWth multi-purpose open-pool type Research Reactor located at Lucas Heights, Australia. It was designed, built and commissioned by INVAP between 2000 and 2006 and it has been operated by the Australia Nuclear Science and Technology Organization (ANSTO showing a very good overall performance. On November 2016, OPAL reached 10 years of continuous operation, becoming one of the most reliable and available in its kind worldwide, with an unbeaten record of being fully operational 307 days a year. One of the enhanced safety features present in this state-of-art reactor is the availability of an independent, diverse and redundant Second Shutdown System (SSS, which consists in the drainage of the heavy water reflector contained in the Reflector Vessel. As far as high quality experimental data is available from reactor commissioning and operation stages and even from early component design validation stages, several models both regarding neutronic and thermo-hydraulic approaches have been developed during recent years using advanced calculations tools and the novel capabilities to couple them. These advanced models were developed in order to assess the capability of such codes to simulate and predict complex behaviours and develop highly detail analysis. In this framework, INVAP developed a three-dimensional CFD model that represents the detailed hydraulic behaviour of the Second Shutdown System for an actuation scenario, where the heavy water drainage 3D temporal profiles inside the Reflector Vessel can be obtained. This model was validated, comparing the computational results with experimental measurements performed in a real-size physical model built by INVAP during early OPAL design engineering stages. Furthermore, detailed 3D Serpent Monte Carlo models are also available, which have been already validated with experimental data from reactor commissioning and operating cycles. In the present work the neutronic and thermohydraulic

  8. A multi-physics analysis for the actuation of the SSS in opal reactor

    Science.gov (United States)

    Ferraro, Diego; Alberto, Patricio; Villarino, Eduardo; Doval, Alicia

    2018-05-01

    OPAL is a 20 MWth multi-purpose open-pool type Research Reactor located at Lucas Heights, Australia. It was designed, built and commissioned by INVAP between 2000 and 2006 and it has been operated by the Australia Nuclear Science and Technology Organization (ANSTO) showing a very good overall performance. On November 2016, OPAL reached 10 years of continuous operation, becoming one of the most reliable and available in its kind worldwide, with an unbeaten record of being fully operational 307 days a year. One of the enhanced safety features present in this state-of-art reactor is the availability of an independent, diverse and redundant Second Shutdown System (SSS), which consists in the drainage of the heavy water reflector contained in the Reflector Vessel. As far as high quality experimental data is available from reactor commissioning and operation stages and even from early component design validation stages, several models both regarding neutronic and thermo-hydraulic approaches have been developed during recent years using advanced calculations tools and the novel capabilities to couple them. These advanced models were developed in order to assess the capability of such codes to simulate and predict complex behaviours and develop highly detail analysis. In this framework, INVAP developed a three-dimensional CFD model that represents the detailed hydraulic behaviour of the Second Shutdown System for an actuation scenario, where the heavy water drainage 3D temporal profiles inside the Reflector Vessel can be obtained. This model was validated, comparing the computational results with experimental measurements performed in a real-size physical model built by INVAP during early OPAL design engineering stages. Furthermore, detailed 3D Serpent Monte Carlo models are also available, which have been already validated with experimental data from reactor commissioning and operating cycles. In the present work the neutronic and thermohydraulic models, available for

  9. 3D DDD modelling of dislocation-precipitate interaction in a nickel-based single crystal superalloy under cyclic deformation

    Science.gov (United States)

    Lin, Bing; Huang, Minsheng; Zhao, Liguo; Roy, Anish; Silberschmidt, Vadim; Barnard, Nick; Whittaker, Mark; McColvin, Gordon

    2018-06-01

    Strain-controlled cyclic deformation of a nickel-based single crystal superalloy has been modelled using three-dimensional (3D) discrete dislocation dynamics (DDD) for both [0 0 1] and [1 1 1] orientations. The work focused on the interaction between dislocations and precipitates during cyclic plastic deformation at elevated temperature, which has not been well studied yet. A representative volume element with cubic γ‧-precipitates was chosen to represent the material, with enforced periodical boundary conditions. In particular, cutting of superdislocations into precipitates was simulated by a back-force method. The global cyclic stress-strain responses were captured well by the DDD model when compared to experimental data, particularly the effects of crystallographic orientation. Dislocation evolution showed that considerably high density of dislocations was produced for [1 1 1] orientation when compared to [0 0 1] orientation. Cutting of dislocations into the precipitates had a significant effect on the plastic deformation, leading to material softening. Contour plots of in-plane shear strain proved the development of heterogeneous strain field, resulting in the formation of shear-band embryos.

  10. Successful treatment of Cushing's disease with o,p - DDD followed by pituitary irradiation in a 19-year-old male patient

    International Nuclear Information System (INIS)

    Dickerman, Z.; Kaufman, H.; Laron, Z.; Tel Aviv Univ.

    1979-01-01

    A 19-year-old male patient with Cushing's disease was treated for 15 months with a gastric-insoluble preparation of o.p'-DDD. 12 months after the start of the o.p'-DDD therapy, the dose was reduced from 6 to 2 g/day and external pituitary irradiation (4,480 rads) was initiated. No disturbance in the secretion of human growth hormone, thyroid-stimulating hormone, luteinizing hormone, follicle-stimulating hormone or prolactin was revealed. The clinical and laboratory signs of Cushing's disease disappeared gradually, and the patient tolerated the drug well, even at a dose of 12 g/day. At present, two years after the discontinuation of o.p'-DDD therapy and pituitary irradiation, the patient is symptom free and receives no medication. (B.G.)

  11. Immobilization of Deoxyadenosine Kinase from Dictyostelium discoideum (DddAK) and Its Application in the 5’-Phosphorylation of Arabinosyladenine and Arabinosyl-2-fluoroadenine

    DEFF Research Database (Denmark)

    Serra, Immacolata; Ubiali, Daniela; Piskur, Jure

    2017-01-01

    Deoxyadenosine kinase from Dictyostelium discoideum (DddAK) phosphorylates its natural substrate (2’‐deoxyadenosine, dAdo) as well as the arabinosyladenine analogues vidarabine (araA) and fludarabine (F‐araA) to their corresponding 5’‐monophosphates. DddAK has been here immobilized by ionic...... interaction on an aminated epoxy‐functionalized support (SepabeadsTM EC‐EP), and cross‐linked with oxidized dextran. The final activity recovery was 33–42 %, depending on the protein loading. Immobilization enhanced the stability of DddAK at pH 10 and, to a lesser extent, at 45 °C. Phosphorylation of d...

  12. Effect of a 188 Re-SSS lipiodol/131I-lipiodol mixture, 188 Re-SSS lipiodol alone or 131I-lipiodol alone on the survival of rats with hepatocellular carcinoma.

    Science.gov (United States)

    Garin, Elienne; Rakotonirina, Hervé; Lejeune, Florence; Denizot, Benoit; Roux, Jerome; Noiret, Nicolas; Mesbah, Habiba; Herry, Jean-Yues; Bourguet, Patrick; Lejeune, Jean-Jacques

    2006-04-01

    It has been shown that the use of a cocktail of isotopes of different ranges of action leads to an increase in the effectiveness of metabolic radiotherapy. The purpose of the present study was to compare with a control group the effectiveness of three different treatments in rats bearing hepatocellular carcinoma (HCC), using (1) a mixture of lipiodol labelled with both I and Re, (2) lipiodol labelled with I alone and (3) lipiodol labelled with Re alone. Four groups were made up, each containing 14 rats with the N1-S1 tumour cell line. Group 1 received a mixture composed of 22 MBq of Re-SSS lipiodol and 7 MBq I-lipiodol. Group 2 received 14 MBq I-lipiodol. Group 3 received 44 MBq of Re-SSS lipiodol and group 4 acted as the control. The survival of the various groups was compared by a non-parametric test of log-rank, after a follow-up of 60, 180 and 273 days. Compared with the controls, the rats treated with a mixture of Re-SSS lipiodol and I-lipiodol show an increase in survival, but only from day 60 onwards (P=0.05 at day 60 and 0.13 at days 180 and 273). For the rats treated with I-lipiodol, there was a highly significant increase in survival compared with the controls at day 60, day 180 and day 273 (P=0.03, 0.04 and 0.04, respectively). There is no significant increase in survival for the rats treated with Re-SSS lipiodol, irrespective of the follow-up duration (P=0.53 at day 60, 0.48 at day 180, and 0.59 at day 273). In this study, I-lipiodol is the most effective treatment in HCC-bearing rats, because this is the only method that leads to a prolonged improvement of survival. These results cannot necessarily be extrapolated to humans because of the relatively small size and unifocal nature of the lesions in this study. It appears necessary to carry out a study in humans with larger tumours in order to compare these three treatments, particularly with a view to replacing I-labelled lipiodol by Re-labelled lipiodol. However, this study clearly demonstrated that

  13. Preclinical models for an innovative glioblastoma therapeutical strategy by 188Re-SSS encapsulated in nano-tools: translational view

    International Nuclear Information System (INIS)

    Cikankowitz, A.; Belloche, C.; Verger, E.; Garcion, E.; Hindre, F.; Chassain, G.; Fellah, B.; Abadie, J.; Chouin, N.; Ibisch, C.; Davodeau, F.; Couez, D.; Lepareur, N.; Lacoeuille, F.; Menei, P.

    2015-01-01

    Full text of publication follows. Aim: Glioblastoma (GBM) is the most frequent cancer of the nervous system and therapies currently used cannot treat definitively this disease. By the way of NucSan (Nuclear for health) program which supports research development about the use of radio pharmaceutics in oncology, the aim of the proposed work is to provide evidences that internal radiotherapy through lipid nanocapsules loaded with Rhenium-188 (LNC 188 Re-SSS) is an alternative therapeutic strategy for GBM that can be translated to human medicine. Previous works have shown a remarkable efficiency of this tool among syngeneic rats linked with local and peripheral recruitments of the immune system's effectors. In this context, two animal models have been chosen to validate the feasibility of this new innovative therapy design (LNC 188 Re-SSS stereotactic injection). Materials and methods: the syngeneic six weeks old C57BL/6J female mice were treated 6 or 12 days after stereotactic GL261 cells implantation, by a single injection of increasing activities of LNC 188 Re-SSS (0,925; 1,85 and 2,7 MBq/5μl). MRI was used to follow tumor progression to determine the mass volume through the selection of regions of interest. The increased median survival time (IMST) was also assessed for treated mice versus control mice (stereotactic injection of saline solution). For long time survival animals (3 times the median survival time), they were rechallenged through the same procedure in the other hemisphere. The brachy-cephalic dog bearing spontaneous tumor will lead to additional evidences to specifically highlight the potential of this innovative technology for GBM treatment. In order to validate procedures of intracerebral injections, a stereotactic head frame specially designed for dog has been conceived which allow both images acquisition (MRI-SPECT and PET) and the achievement of biopsies. Results/Perspectives: as previously observed on rat models, the preliminary data show

  14. Time-resolved analysis of the emission of sidestream smoke (SSS) from cigarettes during smoking by photo ionisation/time-of-flight mass spectrometry (PI-TOFMS): towards a better description of environmental tobacco smoke.

    Science.gov (United States)

    Streibel, T; Mitschke, S; Adam, T; Zimmermann, R

    2013-09-01

    In this study, the chemical composition of sidestream smoke (SSS) emissions of cigarettes are characterised using a laser-based single-photon ionisation time-of-flight mass spectrometer. SSS is generated from various cigarette types (2R4F research cigarette; Burley, Oriental and Virginia single-tobacco-type cigarettes) smoked on a single-port smoking machine and collected using a so-called fishtail chimney device. Using this setup, a puff-resolved quantification of several SSS components was performed. Investigations of the dynamics of SSS emissions show that concentration profiles of various substances can be categorised into several groups, either depending on the occurrence of a puff or uninfluenced by the changes in the burning zone during puffing. The SSS emissions occurring directly after a puff strongly resemble the composition of mainstream smoke (MSS). In the smouldering phase, clear differences between MSS and SSS are observed. The changed chemical profiles of SSS and MSS might be also of importance on environmental tobacco smoke which is largely determined by SSS. Additionally, the chemical composition of the SSS is strongly affected by the tobacco type. Hence, the higher nitrogen content of Burley tobacco leads to the detection of increased amounts of nitrogen-containing substances in SSS.

  15. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    International Nuclear Information System (INIS)

    Bedogni, R.; Gómez-Ros, J.M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-01-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  16. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Science.gov (United States)

    Bedogni, R.; Gómez-Ros, J. M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-08-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  17. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Gomez-Ros, J.M. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Perez, L. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Angelone, M. [ENEA C.R. Frascati, C.P. 65, 00044 Frascati (Italy); Tana, L. [A.O. Universitaria Pisana-Ospedale S. Chiara, Via Bonanno Pisano, Pisa (Italy)

    2012-08-21

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  18. Development and validation of a five-factor sexual satisfaction and distress scale for women: the Sexual Satisfaction Scale for Women (SSS-W).

    Science.gov (United States)

    Meston, Cindy; Trapnell, Paul

    2005-01-01

    This article presents data based on the responses of over 800 women who contributed to the development of the Sexual Satisfaction Scale for Women (SSS-W). The aim of this study was to develop a comprehensive, multifaceted, valid, and reliable self-report measure of women's sexual satisfaction and distress. Phase I involved the initial selection of items based on past literature and on interviews of women diagnosed with sexual dysfunction and an exploratory factor analysis. Phase II involved an additional administration of the questionnaire, factor analyses, and refinement of the questionnaire items. Phase III involved administration of the final questionnaire to a sample of women with clinically diagnosed sexual dysfunction and controls. Psychometric evaluation of the SSS-W conducted in a sample of women meeting DSM-IV-TR criteria for female sexual dysfunction and in a control sample provided preliminary evidence of reliability and validity. The ability of the SSS-W to discriminate between sexually functional and dysfunctional women was demonstrated for each of the SSS-W domain scores and total score. The SSS-W is a brief, 30-item measure of sexual satisfaction and sexual distress, composed of five domains supported by factor analyses: contentment, communication, compatibility, relational concern, and personal concern. It exhibits sound psychometric properties and has a demonstrated ability to discriminate between clinical and nonclinical samples.

  19. Prevalence of conduction delay of the right atrium in patients with SSS: implications for pacing site selection.

    Science.gov (United States)

    Verlato, Roberto; Zanon, Francesco; Bertaglia, Emanuele; Turrini, Pietro; Baccillieri, Maria Stella; Baracca, Enrico; Bongiorni, Maria Grazia; Zampiero, Aldo; Zonzin, Pietro; Pascotto, Pietro; Venturini, Diego; Corbucci, Giorgio

    2007-09-01

    To evaluate the prevalence of severe right atrial conduction delay in patients with sinus node dysfunction (SND) and atrial fibrillation (AF) and the effects of pacing in the right atrial appendage (RAA) and in the inter-atrial septum (IAS). Forty-two patients (15 male, 72 +/- 7 years) underwent electrophysiologic study to measure the difference between the conduction time from RAA to coronary sinus ostium during stimulation at 600 ms and after extrastimulus (DeltaCTos). Patients were classified as group A if DeltaCTos > 60 ms and group B if IAS pacing and algorithms ON/OFF. Fifteen patients (36%, group A) had DeltaCTos = 76 +/- 11 ms and 27 patients (64%, group B) had DeltaCTos = 36 +/- 20 ms. Twenty-two patients were paced at the RAA and 20 at the IAS. During the study, no AF recurrences were reported in 11 of 42 (26%) patients, independently of RAA or IAS pacing. Patients from group A and RAA pacing had 0.79 +/- 0.81 episodes of AF/day during DDD, which increased to 1.52 +/- 1.41 episodes of AF/day during DDDR + Alg (P = 0.046). Those with IAS pacing had 0.5 +/- 0.24 episodes of AF/day during DDD, which decreased to 0.06 +/- 0.08 episodes of AF/day during DDDR + Alg (P = 0.06). In group B, no differences were reported between pacing sites and pacing modes. Severe right atrial conduction delay is present in one-third of patients with SND and AF: continuous pacing at the IAS is superior to RAA for AF recurrences. In patients without severe conduction delay, no differences between pacing site or mode were observed.

  20. Simultaneous determination of diastereoisomeric and enantiomeric impurities in SSS-octahydroindole-2-carboxylic acid by chiral high-performance liquid chromatography with pre-column derivatization.

    Science.gov (United States)

    Wang, Jin Zhao; Zeng, Su; Hu, Gong Yun; Wang, Dan Hua

    2009-04-10

    SSS-Octahydroindole-2-carboxylic acid (SSS-Oic) is a key intermediate used in the synthesis of some angiotensin-converting enzyme (ACE) inhibitors. The separation of diastereoisomers and enantiomers of Oic was performed using a pre-column derivatization chiral HPLC method. Phenyl isothiocyanate (PITC) was used as the derivatization reagent. Three PITC derivatives of Oic stereoisomers were separated on an Ultron ES-OVM chiral column (150 mm x 4.6 mm, 5 microm). Derivatization conditions such as reaction temperature, reaction time and derivatization reagent concentration were investigated. The chromatographic conditions for separation of the three PITC-Oic derivatives were optimized. The method was successfully applied in the diastereoisomeric and enantiomeric purity test of SSS-Oic.

  1. Role of radiolytically generated species in radiation induced polymerization of sodium p-styrene sulphonate (SSS) in aqueous solution: Steady state and pulse radiolysis study

    International Nuclear Information System (INIS)

    Bhardwaj, Y.K.; Mohan, H.; Sabharwal, S.; Majali, A.B.

    2000-01-01

    Radiation induced polymerization of sodium p-styrene sulphonate (SSS) in aqueous solution has been investigated by steady state and pulse radiolysis techniques. Effect of dose, dose rate, monomer concentration, pH and ambient conditions on polymerization was investigated. The reactions of primary radicals of water radiolysis such as OH radical, e - aq , H atom, O· - and some oxidizing radicals like N· 3 , Cl· - 2 ,Br· - 2 , and reducing specie like CO· - 2 with SSS have also been investigated. SSS reacts with OH radical with a rate constant of 5.9x10 9 dm 3 mol -1 s -1 at pH 6.3. The results indicate that ∼83% of OH radicals undergo electron transfer reaction resulting in a cation radical species while remaining ∼17% react via addition reaction. The hydrated electron reacts with SSS with a rate constant 1.3x10 10 dm 3 mol -1 s -1 to form an anion that undergoes fast protonation to form H-adduct at pH 6.3. At high pH (>10) the anion is able to transfer electron to methyl vilogen and p-nitro aceto phenone (p-NAP) where as H-adduct is unable to transfer electron. At pH ∼1 H atom reaction with SSS is diffusion controlled with a rate constant of 5x10 9 dm 3 mol -1 s -1 and results in formation of H adduct. It was seen that anion reacts with solute an order faster than cation generated radiolytically indicating anionic initiation of polymerization of SSS. Molecular weight of the polymer formed by radiation polymerization, determined by viscosity measurement, are of the order of 10 7 and higher molecular weight polymers are obtained at lower dose rates. In presence of a crosslinking agent gelation of polymer is much faster than the monomer and a polymer concentration ∼20% is most efficiently crosslinked. (author)

  2. Assessing somatic symptom burden: a psychometric comparison of the patient health questionnaire-15 (PHQ-15) and the somatic symptom scale-8 (SSS-8).

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Toussaint, Anne; Wahl, Inka; Brünahl, Christian A; Murray, Alexandra M; Löwe, Bernd

    2015-04-01

    The Patient Health Questionnaire-15 (PHQ-15) is a frequently used questionnaire to assess somatic symptom burden. Recently, the Somatic Symptom Scale-8 (SSS-8) has been published as a short version of the PHQ-15. This study examines whether the instruments' psychometric properties and estimates of symptom burden are comparable. Psychosomatic outpatients (N=131) completed the PHQ-15, the SSS-8 and other questionnaires (PHQ-9, GAD-7, WI-7, SF-12). Item characteristics and measures of reliability, validity, and symptom severity were determined and compared. The reliabilities of the PHQ-15 and SSS-8 were α=0.80 and α=0.76, respectively and both scales were highly correlated (r=0.83). The item characteristics were comparable. Both instruments showed the same pattern of correlations with measures of depression, anxiety, health anxiety and health-related quality of life (r=0.32 to 0.61). On both scales a 1-point increase was associated with a 3% increase in health care use. The percentile distributions of the PHQ-15 and the SSS-8 were similar. Using the same thresholds for somatic symptom severity (5, 10, and 15 points), both instruments identified nearly identical subgroups of patients with respect to health related quality of life. The PHQ-15 and the SSS-8 showed similar reliability and validity but the comparability of severity classifications needs further evaluation in other populations. Until then we recommend the use of the previously established thresholds. Overall, the SSS-8 performed well as a short version of the PHQ-15 which makes it preferable for assessment in time restricted settings. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Studies on surface grafting of AAc/SSS binary monomers onto polytetrafluoroethylene by dielectric barrier discharge initiation

    International Nuclear Information System (INIS)

    Xi Zhenyu; Xu Youyi; Zhu Liping; Liu Fu; Zhu Baoku

    2008-01-01

    Polytetrafluoroethylene (PTFE) films were pre-treated by dielectric barrier discharge in atmospheric pressure with air as carrier gas. And then the hydrophilic sulfonate groups were introduced by the single step grafting method with binary monomer solution of acrylic acid (AAc) and sodium 4-styrenesulfonate (SSS). The effects of binary monomer ratio, reaction solution concentration and polymerization time on the degree of grafting were investigated. The surface chemical change was determined by Fourier transform infrared attenuated total reflection spectroscopy (FTIR-ATR) and X-ray photoelectron spectroscopy (XPS). Morphological changes on the film surface were described using field emitting scanning electron microscopy (SEM) and atomic force microscopy (AFM). The surface hydrophilicity of the modified film was characterized through water contact angle measurement. It was found that the water contact angle of the film surface reduced significantly when compared with the original one, indicating the introduction of hydrophilic groups and improvement of the surface hydrophilicity

  4. Socio-demographic characteristics, types and Slit Skin Smear (SSS) of the leprosy patients: a hospital based study.

    Science.gov (United States)

    Sarker, U K; Mohammad, Q D; Uddin, M J; Chowdhury, R N; Bhattacharjee, M; Mondol, G; Roy, N

    2014-07-01

    This study was aimed to identify the socio-demographic profile, to know the types and to find out the Slit Skin Smear (SSS) result associated with leprosy. It was a descriptive type of cross sectional study. Total 62 patients having clinical features of leprosy, attending in Department of Neurology of Mymensingh Medical College Hospital (MMCH) and Mymensingh Tuberculosis and Leprosy Hospital, Mymensingh from January 2010 to December 2011 were included. Patients underwent a detailed clinical evaluation followed by laboratory investigations. Out of 62 cases, the results showed that the mean age of leprosy patients were 37.8±14.6 years with the age range 12-80 years and the peak incidence was between 20-40 years. The frequency of male and female was 70.9% and 29.1% respectively with M: F of 2.4:1. From rural area 74.2% leprosy patients and 25.8% patients were from urban area and mainly day-labours (25.8%) and housewife (24.2%) by occupation. Married was 87.1% of patients and 12.9% were unmarried. Twenty one percent (21%) leprosy patients were found contact with leprosy. It was observed in this study that, 35.5% patients were PB (Pauci Bacillary) group and 64.5% of the patients were in MB (Multi Bacillary) group. Lepromatous Leprosy (LL) patients were (17.7%) and Borderline Lepromatous (BL) patients were (11.3%). Patients with Tuberculoid Type (TT) were (3.2%) and patients with Borderline Tuberculoid (BT) were (61.3%). The result of Slit skin smear (SSS) examination was negative in 59.7% patients and positive in 40.3%.

  5. Passive sampling of DDT, DDE and DDD in sediments: accounting for degradation processes with reaction-diffusion modeling.

    Science.gov (United States)

    Tcaciuc, A Patricia; Borrelli, Raffaella; Zaninetta, Luciano M; Gschwend, Philip M

    2018-01-24

    Passive sampling is becoming a widely used tool for assessing freely dissolved concentrations of hydrophobic organic contaminants in environmental media. For certain media and target analytes, the time to reach equilibrium exceeds the deployment time, and in such cases, the loss of performance reference compounds (PRCs), loaded in the sampler before deployment, is one of the common ways used to assess the fractional equilibration of target analytes. The key assumption behind the use of PRCs is that their release is solely diffusion driven. But in this work, we show that PRC transformations in the sediment can have a measurable impact on the PRC releases and even allow estimation of that compound's transformation rate in the environment of interest. We found that in both field and lab incubations, the loss of the 13 C 2,4'-DDT PRC from a polyethylene (PE) passive sampler deployed at the sediment-water interface was accelerated compared to the loss of other PRCs ( 13 C-labeled PCBs, 13 C-labeled DDE and DDD). The DDT PRC loss was also accompanied by accumulation in the PE of its degradation product, 13 C 2,4'-DDD. Using a 1D reaction-diffusion model, we deduced the in situ degradation rates of DDT from the measured PRC loss. The in situ degradation rates increased with depth into the sediment bed (0.14 d -1 at 0-10 cm and 1.4 d -1 at 30-40 cm) and although they could not be independently validated, these rates compared favorably with literature values. This work shows that passive sampling users should be cautious when choosing PRCs, as degradation processes can affect some PRC's releases from the passive sampler. More importantly, this work opens up the opportunity for novel applications of passive samplers, particularly with regard to investigating in situ degradation rates, pathways, and products for both legacy and emerging contaminants. However, further work is needed to confirm that the rates deduced from model fitting of PRC loss are a true reflection of DDT

  6. Monitoring somatic symptoms in patients with mental disorders: Sensitivity to change and minimal clinically important difference of the Somatic Symptom Scale - 8 (SSS-8).

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Hagemann-Goebel, Marion; Löwe, Bernd; Nestoriuc, Yvonne

    2017-09-01

    The SSS-8 is a brief questionnaire for the assessment of somatic symptom burden. This study examines its sensitivity to change and the minimal clinically important difference (MCID) in patients with mental disorders. 55 outpatients with mental disorders completed the SSS-8 and measures of anxiety, depression, and disability before and after receiving treatment. Effect sizes and correlations between the change scores were calculated. The MCID was estimated using a one standard error of measurement threshold and the change in disability as an external criterion. There was a medium decline in somatic symptom burden for the complete sample (n=55, d z =0.53) and a large decline in a subgroup with very high somatic symptom burden at baseline (n=11, d z =0.94). Decreases in somatic symptom burden were associated with decreases in anxiety (r=0.68, pSSS-8 is sensitive to change. A 3-point decrease reflects a clinically important improvement. Due to its brevity and sound psychometric properties, the SSS-8 is useful for monitoring somatic symptom burden. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Sequential sentinel SNP Regional Association Plots (SSS-RAP): an approach for testing independence of SNP association signals using meta-analysis data.

    Science.gov (United States)

    Zheng, Jie; Gaunt, Tom R; Day, Ian N M

    2013-01-01

    Genome-Wide Association Studies (GWAS) frequently incorporate meta-analysis within their framework. However, conditional analysis of individual-level data, which is an established approach for fine mapping of causal sites, is often precluded where only group-level summary data are available for analysis. Here, we present a numerical and graphical approach, "sequential sentinel SNP regional association plot" (SSS-RAP), which estimates regression coefficients (beta) with their standard errors using the meta-analysis summary results directly. Under an additive model, typical for genes with small effect, the effect for a sentinel SNP can be transformed to the predicted effect for a possibly dependent SNP through a 2×2 2-SNP haplotypes table. The approach assumes Hardy-Weinberg equilibrium for test SNPs. SSS-RAP is available as a Web-tool (http://apps.biocompute.org.uk/sssrap/sssrap.cgi). To develop and illustrate SSS-RAP we analyzed lipid and ECG traits data from the British Women's Heart and Health Study (BWHHS), evaluated a meta-analysis for ECG trait and presented several simulations. We compared results with existing approaches such as model selection methods and conditional analysis. Generally findings were consistent. SSS-RAP represents a tool for testing independence of SNP association signals using meta-analysis data, and is also a convenient approach based on biological principles for fine mapping in group level summary data. © 2012 Blackwell Publishing Ltd/University College London.

  8. Study of DDT and its derivatives DDD, DDE adsorption and degradation over Fe-SBA-15 at low temperature

    Institute of Scientific and Technical Information of China (English)

    Hailin Wang; Hua Tian; Zhengping Hao

    2012-01-01

    Mesoporous SBA-15 with different Fe2O3 loading were synthesized by an in-situ coating progress for removals of dichlorodiphenyltrichloroethane(DDT)and its derivatives,i.e.,1,1-dichloro-2,2-bis-(p-chlorophenyl)ethane(DDD)and 1,l-dichloro-2,2-bis-(4-chloro -phenyl)ethane(DDE).The results from XRD(X-ray diffractometer),TEM(transmission electron microscopy)indicated that the iron could be well dispersed on SBA-15 within 6 wt.% Fe2O3 loading.Nitrogen adsorption-desorption tests indicated that the synthesized materials were characterized by ordered meso-structure,high surface area and large pore volume.DDTs were removed from aqueous media in 12-hr treatment and high removal efficiency of DDTs was achieved at over 94%.DDTs could be completely degraded at 350℃ under the existence of SBA-15 with 4 wt.% Fe2O3 loading.The final degradation products of DDT were dichlorobenzophenone (DCB)and bis-(4-chloro-phenyl)methane(DDM),suggesting a complete dechlorination from trichloromethyl.

  9. Occurrences and fate of DDT principal isomers/metabolites, DDA, and o,p'-DDD enantiomers in fish, sediment and water at a DDT-impacted Superfund site.

    Science.gov (United States)

    Garrison, A W; Cyterski, M; Roberts, K D; Burdette, D; Williamson, J; Avants, J K

    2014-11-01

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring data collected from 1988, after remediation, through 2011 showed annual decreases approximating first-order decay in concentrations of total DDT and its six principal congeners (p,p'-DDT, o,p'-DDT, p,p'-DDD, o,p'-DDD, p,p'-DDE and o,p'-DDE) in filets from three species of fish. As of 2013, these concentrations met the regulatory requirements of 5 mg/kg or less total DDT for each fish tested. The enantiomer fractions (EF) of chiral o,p'-DDD in smallmouth buffalo and channel catfish were always below 0.5, indicating preferential decay of the (+)-enantiomer of this congener; this EF did not change significantly over 15 years. The often-neglected DDT metabolite p,p'-DDA was found at a concentration of about 20 μg/l in the ecosystem water. Published by Elsevier Ltd.

  10. The Sensation Seeking Scale (SSS-V and Its Use in Latin American Adolescents: Alcohol Consumption Pattern as an External Criterion for Its Validation

    Directory of Open Access Journals (Sweden)

    Vanina Schmidt

    2017-11-01

    Full Text Available Sensation Seeking is a trait defined by the seeking of varied, novel, complex, and intense situations and experiences, and the willingness to take physical, social, and financial risks for the sake of such experience. The Sensation Seeking Scale (SSS-V is the most widely used measure to assess this construct. In previous studies a variety of psychometric limitations were found when using the SSS-V with Latin American population. The purpose of this study is to present additional psychometric properties for its use with Latin American adolescents. It was applied to a 506 adolescent sample (from 12 to 20 years. The result is a scale of 22 items that cover four factors. It seems that sensation seeking among Latin American adolescents can be described in terms of four factors, but with some slightly content differences from what is usually found in adult samples from other countries. Future lines of research are proposed.

  11. The Sensation Seeking Scale (SSS-V) and Its Use in Latin American Adolescents: Alcohol Consumption Pattern as an External Criterion for Its Validation.

    Science.gov (United States)

    Schmidt, Vanina; Molina, María Fernanda; Raimundi, María Julia

    2017-11-01

    Sensation Seeking is a trait defined by the seeking of varied, novel, complex, and intense situations and experiences, and the willingness to take physical, social, and financial risks for the sake of such experience. The Sensation Seeking Scale (SSS-V) is the most widely used measure to assess this construct. In previous studies a variety of psychometric limitations were found when using the SSS-V with Latin American population. The purpose of this study is to present additional psychometric properties for its use with Latin American adolescents. It was applied to a 506 adolescent sample (from 12 to 20 years). The result is a scale of 22 items that cover four factors. It seems that sensation seeking among Latin American adolescents can be described in terms of four factors, but with some slightly content differences from what is usually found in adult samples from other countries. Future lines of research are proposed.

  12. Short Straight Sections in the LHC Matching Sections (MS SSS) An Extension of the Arc Cryostats to Fulfil Specific Machine Functionalities

    CERN Document Server

    Parma, V; Lutton, F

    2005-01-01

    The LHC insertions require 50 specific superconducting quadrupoles in the matching sections, operating either in 1.9 K superfluid helium or in boiling helium at 4.5 K. These magnets are assembled together with corrector magnets in cold masses, and are inserted in individual cryostats to form the MS Short Straight Sections (MS SSS). The variety of quadrupoles and corrector magnets leads to 10 families of cold masses, with lengths ranging from 5 to 12 m and weights ranging from 60 to 140 kN. The MS SSS need to fulfil specific requirements related to the collider topology, its cryogenic layout and the powering scheme. Most MS SSS are standalone cryogenic and super-conducting units, i.e. they are not in the continuous arc cryostat, and therefore need dedicated cryogenic and electrical feeding. Specially designed cryostat end-caps are required to close the vacuum vessels at each end, which include low heat in-leak Cold-to-Warm transitions (CWT) for the beam tubes and 6 kA local electrical feedthrough for powering...

  13. The LHC SSS cold mass inside the cryostat. The complexity of the bus-bars for the power supply of the magnets and cryogenic links can be seen. The two apertures in the centre will house the beam lines

    CERN Document Server

    2003-01-01

    The LHC SSS cold mass inside the cryostat. The complexity of the bus-bars for the power supply of the magnets and cryogenic links can be seen. The two apertures in the centre will house the beam lines

  14. Identification of Quantitative Trait Loci That Determine Plasma Total-Cholesterol and Triglyceride Concentrations in DDD/Sgn and C57BL/6J Inbred Mice

    Directory of Open Access Journals (Sweden)

    Jun-ichi Suto

    2017-01-01

    Full Text Available DDD/Sgn mice have significantly higher plasma lipid concentrations than C57BL/6J mice. In the present study, we performed quantitative trait loci (QTL mapping for plasma total-cholesterol (CHO and triglyceride (TG concentrations in reciprocal F2 male intercross populations between the two strains. By single-QTL scans, we identified four significant QTL on chromosomes (Chrs 1, 5, 17, and 19 for CHO and two significant QTL on Chrs 1 and 12 for TG. By including cross direction as an interactive covariate, we identified separate significant QTL on Chr 17 for CHO but none for TG. When the large phenotypic effect of QTL on Chr 1 was controlled by composite interval mapping, we identified three additional significant QTL on Chrs 3, 4, and 9 for CHO but none for TG. QTL on Chr 19 was a novel QTL for CHO and the allelic effect of this QTL significantly differed between males and females. Whole-exome sequence analysis in DDD/Sgn mice suggested that Apoa2 and Acads were the plausible candidate genes underlying CHO QTL on Chrs 1 and 5, respectively. Thus, we identified a multifactorial basis for plasma lipid concentrations in male mice. These findings will provide insight into the genetic mechanisms of plasma lipid metabolism.

  15. Translation and cultural adaptation of the Shame and Stigma Scale (SSS) into Portuguese (Brazil) to evaluate patients with head and neck cancer.

    Science.gov (United States)

    Pirola, William Eduardo; Paiva, Bianca Sakamoto Ribeiro; Barroso, Eliane Marçon; Kissane, David W; Serrano, Claudia Valéria Maseti Pimenta; Paiva, Carlos Eduardo

    Head and neck cancer is the sixth leading cause of death from cancer worldwide and its treatment may involve surgery, chemotherapy and/or radiation therapy. The surgical procedure may cause mutilating sequelae, that can alter patient self-image. Thus, head and neck cancer is often connected to the negative stigma with decreased quality of life. Few studies assess the social stigma and shame perceived by patients with head and neck cancer. To perform the translation and cultural adaptation of the Shame and Stigma Scale (SSS) into Portuguese (Brazil). Two independent translations (English into Portuguese) were carried out by two professionals fluent in the English language. After the synthesis of the translations, two independent back-translations (from Portuguese into English) were performed by two translators whose native language is English. All translations were critically assessed by a committee of experts consisting of five members. A sample of 15 patients answered the Brazilian Portuguese version of the SSS to carry out the pretest. At this step, the patients were able to suggest modifications and evaluate the understanding of the items. There was no need to change the scale after this step. Based on the previous steps, we obtained the Portuguese (Brazil) version of the SSS, which was called "Escala de Vergonha e Estigma". The Portuguese (Brazil) version of the SSP was shown to be adequate to be applied to the population with HNC and, therefore, the psychometric properties of the tool will be evaluated during following steps. Copyright © 2016 Associação Brasileira de Otorrinolaringologia e Cirurgia Cérvico-Facial. Published by Elsevier Editora Ltda. All rights reserved.

  16. Role of ptsP, orfT, and sss recombinase genes in root colonization by Pseudomonas fluorescens Q8r1-96.

    Science.gov (United States)

    Mavrodi, Olga V; Mavrodi, Dmitri V; Weller, David M; Thomashow, Linda S

    2006-11-01

    Pseudomonas fluorescens Q8r1-96 produces 2,4-diacetylphloroglucinol (2,4-DAPG), a polyketide antibiotic that suppresses a wide variety of soilborne fungal pathogens, including Gaeumannomyces graminis var. tritici, which causes take-all disease of wheat. Strain Q8r1-96 is representative of the D-genotype of 2,4-DAPG producers, which are exceptional because of their ability to aggressively colonize and maintain large populations on the roots of host plants, including wheat, pea, and sugar beet. In this study, three genes, an sss recombinase gene, ptsP, and orfT, which are important in the interaction of Pseudomonas spp. with various hosts, were investigated to determine their contributions to the unusual colonization properties of strain Q8r1-96. The sss recombinase and ptsP genes influence global processes, including phenotypic plasticity and organic nitrogen utilization, respectively. The orfT gene contributes to the pathogenicity of Pseudomonas aeruginosa in plants and animals and is conserved among saprophytic rhizosphere pseudomonads, but its function is unknown. Clones containing these genes were identified in a Q8r1-96 genomic library, sequenced, and used to construct gene replacement mutants of Q8r1-96. Mutants were characterized to determine their 2,4-DAPG production, motility, fluorescence, colony morphology, exoprotease and hydrogen cyanide (HCN) production, carbon and nitrogen utilization, and ability to colonize the rhizosphere of wheat grown in natural soil. The ptsP mutant was impaired in wheat root colonization, whereas mutants with mutations in the sss recombinase gene and orfT were not. However, all three mutants were less competitive than wild-type P. fluorescens Q8r1-96 in the wheat rhizosphere when they were introduced into the soil by paired inoculation with the parental strain.

  17. Validation of the MOS Social Support Survey 6-item (MOS-SSS-6) measure with two large population-based samples of Australian women.

    Science.gov (United States)

    Holden, Libby; Lee, Christina; Hockey, Richard; Ware, Robert S; Dobson, Annette J

    2014-12-01

    This study aimed to validate a 6-item 1-factor global measure of social support developed from the Medical Outcomes Study Social Support Survey (MOS-SSS) for use in large epidemiological studies. Data were obtained from two large population-based samples of participants in the Australian Longitudinal Study on Women's Health. The two cohorts were aged 53-58 and 28-33 years at data collection (N = 10,616 and 8,977, respectively). Items selected for the 6-item 1-factor measure were derived from the factor structure obtained from unpublished work using an earlier wave of data from one of these cohorts. Descriptive statistics, including polychoric correlations, were used to describe the abbreviated scale. Cronbach's alpha was used to assess internal consistency and confirmatory factor analysis to assess scale validity. Concurrent validity was assessed using correlations between the new 6-item version and established 19-item version, and other concurrent variables. In both cohorts, the new 6-item 1-factor measure showed strong internal consistency and scale reliability. It had excellent goodness-of-fit indices, similar to those of the established 19-item measure. Both versions correlated similarly with concurrent measures. The 6-item 1-factor MOS-SSS measures global functional social support with fewer items than the established 19-item measure.

  18. Relationships between molecular structure and kinetic and thermodynamic controls in lipid systems. Part II: Phase behavior and transformation paths of SSS, PSS and PPS saturated triacylglycerols--effect of chain length mismatch.

    Science.gov (United States)

    Bouzidi, Laziz; Narine, Suresh S

    2012-01-01

    The kinetic phase behavior and phase transformation paths of purified tristearoylglycerol (SSS), 3-palmitoyl-1,2-distearoyl-sn-glycerol (PSS) and 1,2-dipalmitoyl-3-stearoyl-sn-glycerol (PPS) were investigated in terms of polymorphism, crystallization and melting. The details of the phase transformation paths were obtained using the heating cycles of two sets of experiments: (a) cooling rate was varied and heating rate fixed and (b) cooling rate was fixed and heating rate varied. Kinetic effects were manifest in all measured properties, underscoring the complexity of the phase transformation paths for each TAG, and the intricate thermodynamics-molecular relationships. For the first time, XRD data obtained for SSS, PSS and PPS TAGs, cooled at rates higher than 0.5°C/min, suggested the formation of a transient structure similar to the so-called α(2)-phase which has been observed in mixed saturated-unsaturated TAGs quenched from the melt. The more stable phases (β' in PSS and PPS, and β in SSS) were only observed for cooling rates lower than 1.0°C/min. The kinetic and thermodynamic differences observed in the crystallization, structure and melting of SSS, PSS and PPS are proposed to be mainly due to the disturbances introduced at the "terrace" level via methyl-end group interactions, i.e., the missing of two or four CH(2) groups compared to SSS. The symmetrical SSS with a relatively flat "terrace" crystallizes preferably in the most stable β-form. Two missing CH(2) groups at the sn-1 position (PSS) introduces enough structural disturbances to promote the relative prevalence and persistence of the β'-phase, and four missing CH(2) groups at the sn-1 and sn-2 positions (PPS) is relatively too large of a disturbance and therefore favors the α-form. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  19. The analysis of the Tectonics - SSS - Seismicity System in the 3D-model of the Rasvumchorr Mine - Central Open Pit Natural and Technical System (Khibiny)

    Science.gov (United States)

    Zhirov, Dmitry; Klimov, Sergey; Zhirova, Anzhela; Panteleev, Alexey; Rybin, Vadim

    2017-04-01

    Main hazardous factors during the operation of deposits represent tectonics (structural dislocation), strain and stress state (SSS), and seismicity. The cause and effect relationships in the Fault Tectonics - SSS - Seismicity system were analyzed using a 3D geological and structural Rasvumchorr Mine - Central Open Pit model. This natural and technical system (NTS) has resulted from the development of the world-class apatite-nepheline deposits the Apatite Circus and Rasvumchorr Plateau. The 3D model integrates various spatial data on the earth's surface topography before and after mining, geometry of mines and dumps, SSS measurements and rock pressure, seismicity, fault tectonics and etc. The analysis of the 3D model has clearly demonstrated the localization of three main seismic emanation zones in the areas of maximum anthropogenic variation of the initial rock state, and namely: ore pass zone under the Southern edge of the Central open pit, collapse and joining zone of the Rasvumchorr Mine and NW edge of the open pit, and zone under the Apatite Circus plate - collapse console. And, on the contrary, in the area of a large dump under the underground mine, a perennial seismic minimum zone was identified. The relation of the seismicity and fault tectonics was revealed only in three local sectors near come certain echelon fissures of the Main Fault(MF). No confinement of increased seismicity areas to the MF and other numerous echelon fissures is observed. The same picture occurs towards manifestations of rock pressure. Only an insignificant part of echelon fissures (including low rank of hierarchy) controls hazardous manifestations of rock pressure (dumps, strong deformations of the mine contour, etc.). It is shown that the anthropogenic factor (explosive, geometry and arrangement of mined spaces and collapse console), as well as the time factor significantly change orientation and structure (contrast and heterogeneity) of the stress fields. Time series of natural

  20. An Evaluation of Integrated Curriculum as It Exists in Mathematics and Science SSS as Well as the Subsequent Supportive Presentation of Those Standards in Eighth Grade Mathematics and Science Textbooks

    Science.gov (United States)

    Gill, Clara Joanne Schneberger

    2010-01-01

    This study attempted to verify points of intersection (POIs) between mathematics and science in the eighth grade Sunshine State Standards (SSS), and to develop a valid and reliable instrument to evaluate these POIs as they were presented in the respective mathematics and science textbooks approved for use in Florida public schools. Shannon and…

  1. Growth of gas hydrate mounds and gas chimneys of the eastern margin of Japan Sea as revealed by MBES, SSS and SBP of AUV

    Science.gov (United States)

    Matsumoto, R.; Satoh, M.; Hiromatsu, M.; Tomaru, H.; Machiyama, H.

    2010-12-01

    A series of PC, ROV and SCS surveys to study the origin and evolution of gas hydrate systems along the eastern margin of Japan Sea have identified a number of shallow GH accumulations on the mounds, 300m to 500m in diameter and 30m to 40m high, on the Umitaka spur and Joetsu knoll in Joetsu basin with the WD of 880m to 1200m (Matsumoto et al., 2005; 2009). All of the hydrate mounds develop on gas chimneys as recognized by seismic profiles, and some are associated with gigantic methane plumes, 600m to 700m high. Multi Beam Echo Sounder (MBES), Side Scan Sonar (SSS) and Sub-Bottom Profiler (SBP) of AUV Urashima have revealed ultra-high resolution topographic features and subsurface structures of the mounds and adjacent areas during the JAMSTEC YK10-08 cruise, July 2010. AUV Urashima ran over the spur and knoll at 50m to 80m above seafloor at a cruising speed of 2.4 knots. MBES and SSS mosaics demonstrate two types of mounds. One is a low swell with smooth surface and weak reflectance, while the other is characterized by rough and uneven topographic features with strong SSS images due to incrustation by methane-induced carbonate concretions and gas hydrates. SBP provides clear stratigraphic and structural relations down to 50mbsf to 80mbsf and recognizes three stratigraphic units as I: upper massive unit (5-10m thick), II: middle evenly bedded unit (15-25m thick) and III: lower slightly bedded unit (> 15-25m thick). Gas chimneys grow up toward the seafloor through Units III, II, and I. When the ceiling of gas chimney stays within Unit III or II, the mound above the chimney is either low swell or nearly flat, while the swell grows up higher when the ceiling reaches to Unit I or the seafloor. Eventually, the ceiling breaks through the seafloor and protrudes to form GH mound up to 40m to 50m high, and then start to decay probably due to mechanical collapse and chemical dissolution of gas hydrates. The ceiling of gas chimneys is often represented by high amplitude, uneven

  2. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  3. Relationships between molecular structure and kinetic and thermodynamic controls in lipid systems. Part III. Crystallization and phase behavior of 1-palmitoyl-2,3-stearoyl-sn-glycerol (PSS) and tristearoylglycerol (SSS) binary system.

    Science.gov (United States)

    Bouzidi, Laziz; Narine, Suresh S

    2012-01-01

    The phase behavior of 1-palmitoyl-2,3-distearoyl-sn-glycerol (PSS)/tristearoylglycerol (SSS) binary system was investigated in terms of polymorphism, crystallization and melting behavior, microstructure and solid fat content (SFC) using widely different constant cooling rates. Kinetic phase diagrams were experimentally determined from the DSC heating thermograms and analyzed using a thermodynamic model to account for non-ideality of mixing. The kinetic phase diagram presented a typical eutectic behavior with a eutectic point at the 0.5(PSS) mixture with a probable precipitation line from 0.5(PSS) to 1.0(PSS), regardless of the rate at which the sample was cooled. The eutectic temperature decreased only slightly with increasing cooling rate. PSS has a strong effect on the physical properties of the PSS-SSS mixtures. In fact, the overall phase behavior of the PSS-SSS binary system was determined, for a very large part, by the asymmetrical TAG. Moreover, PSS is a key driver of the high stability observed in crystal growth, polymorphism and phase development. Levels as low as 10% PSS, when cooled slowly, and 30% when cooled rapidly, were found to be sufficient to suppress the effect of thermal processing. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  4. Determinación de la condición saturada y seca superficialmente (S.S.S. de agregados orgánicos para hormigón ligero

    Directory of Open Access Journals (Sweden)

    Jaime Salazar Contreras

    1988-01-01

    Full Text Available Como parte del provecto de grado titulado "DOSIFICACION DE HORMIGONES LIGEROS UTILIZANDO COMO ARIDO LA CASCARILLA DE CAFE II PARTE", se desarrolló un procedimiento para determinar la condición saturada y seca superficialmente (S.S.S. de la cascarilla de café debido a que no existe ninguna literatura técnica que establezca los pasos a seguir para hallar la condición s.s.s de agregados ligeros, como si la hay para los agregados tradicionales del hormigón. Puesto que los agregados orgánicos presentan una elevada absorción, se hace necesario determinar un procedimiento de ensaya que permita obtener la condición s.s.s., del agregado de una manera precisa y más confiable que la obtenida mediante la inspección visual, procedimiento éste utilizado hasta ahora en el diseño de mezclas para los agregados ligeros de naturaleza orgánica. El ensayo consiste básicamente en someter a un proceso de secado una muestra de cascarilla saturada hasta que desaparece el agua libre contenida en ella, hecho que se manifiesta por la variación de la temperatura del bulbo húmedo medida por un termómetro colocado en el centro de la muestra; la humedad determinada en este momento corresponde a la condición s.s.s. de la cascarilla, valor éste que se utilizará posteriormente para determinar las propiedades físicas requeridas para el diseño y en especial para establecer con gran aproximación la relación agua-cemento (A/c parámetro fundamental que rige la resistencia del hormigón. Estos ensayos se realizaron en el laboratorio de Ingeniería Agrícola de la Universidad Nacional de Bogotá

  5. Maine's MOLLOCKET and METALLAK: Adherents of God's Secret Spirit Signal, SSS, Applied Physicists of the EMF/Manitou, Doctors, Reincarnationists, "Potlachers," Confidants of the Powerful, and, they Did Own the Land.

    Science.gov (United States)

    Andrade, Jennifer; Ferreira, Nadja; Mc Leod, Roger D.

    2007-04-01

    Northeastern ``Indians,'' reputed to ``make the weather,'' actually, from youth, observed earth phenomena, including SSS. These are subtle and barely detectable visual artifacts of the electromagnetic field, special information that led/leads to their spiritual belief in reincarnation, which came from the EMF/SSS communication, backward and forward, (up to) seven generations. It commands communal, democratic, ``potlatch'' redistribution of accumulated wealth, Mother Earth's bounty, from their land, gifted by ``The Great Spirit,'' Manitou, Peru's Ñari Huallac, ``Serpent God.'' Genetics established the non-Asian origins of 1/3 of North American Indians. Linguistics indicates a major impact westwards to us. MILLInocket is ``Adherent of God (Spirit-signal) monk Cathar.'' Katahdin, with a shared root, has Manitou. After 1820, Gov. E. Lincoln and at least one US senator went westward to MetALLAk; his biography is by a Rumford, ME Knight of Pythias. Why? MOLLOCKET frequently asserted ownership of western Maine. ``Great Council Fires,'' religious ``Law Things,'' were at Merrymeeting Bay in pre-Colonial times. ``Medicine men/priests'' often participated as their applied scientist-statesmen. To cite this abstract, use the following reference: http://meetings.aps.org/link/BAPS.2007.NES07.C2.1

  6. Measurement of CP Asymmetry in B0 --> K+K-K0S Decays

    International Nuclear Information System (INIS)

    Dujmic, D

    2004-01-01

    The authors present preliminary measurements of the CP asymmetry parameters and CP content in B 0 --> K + K - K s 0 decays, with φK s 0 events excluded. In a sample of 227 M B(bar B) pairs collected by the BABAR detector at the PEP-II B Factory at SLAC, they find the CP parameters to be S = -0.42 ± 0.17 ± 0.04 and C = 0.10 ± 0.14 ± 0.06, where the first error is statistical and the second systematic. Extracting the fraction of CP-even final states from angular moments f even = 0.89 ± 0.08 ± 0.06, and setting C = 0, they determine sin 2β = 0.55 ± 0.22 ± 0.04 ± 0.11, where the last error is due to uncertainty on the CP content

  7. Dalitz Plot Analysis of the Decay B+ -> K+K+K-

    Energy Technology Data Exchange (ETDEWEB)

    Dvoretskii, Alexei; /SLAC /Caltech

    2006-05-05

    The authors perform an analysis of the three-body charmless decay B{sup {+-}} {yields} K{sup {+-}}K{sup {+-}}K{sup {-+}} using a sample of 226.0 {+-} 2.5 million B{bar B} pairs collected by the BABAR detector and measure the total branching fraction and Cp asymmetry to be {beta} = (35.2 {+-} 0.9 {+-} 1.6) x 10{sup -6} and A{sub CP} = (-1.7 {+-} 2.6 {+-} 1.5)%. They fit the Dalitz plot distribution using an isobar model and report the measured values of magnitudes and phases of the production coefficients. The decay dynamics is dominated by the K{sup +}K{sup -} S-wave, for which we perform a partial-wave analysis in the region m(K{sup +}K{sup -}) < 2 GeV/c{sup 2}. They find no evidence of CP violation for individual components of the isobar model.

  8. Rapport final de la Collaboration CERN-CNRS pour la construction du LHC Accord Technique d'Exécution No 2 Cryostats et assemblage des sections droites courtes (SSS) du LHC

    CERN Document Server

    Bergot, JB; Poncet, A; Rohmig, P; Roy, E; Vincent, D

    2006-01-01

    Depuis 1995 et suite à la signature du protocole de Collaboration, le CERN, le CEA et le CNRS ont étroitement collaboré dans le cadre de la contribution exceptionnelle de la France à la construction du LHC. Pour le CNRS, l'Institut de Physique Nucléaire d'Orsay a pris en charge deux Accords Techniques d'Exécution. Le premier concerne la conception et l'assemblage des Sections Droites Courtes de la machine, et le deuxième, l'étalonnage des thermomètres cryogéniques du LHC. Dans le cadre de l'Accord Technique d'Exécution N°2, le Bureau d'Etudes de la Division Accélérateur de l'IPNO et le groupe AT-CRI du CERN ont travaillé de concert pour mener à bien la conception des SSS (Short Straight Section) et de tous les équipements nécessaires à l'assemblage. Ce rapport a donc pour objectif de dresser, en termes d'historique, d'organisation, de résultats quantitatifs et qualitatifs et de moyens mis en ?uvre, un tableau aussi complet que possible du déroulement de cette Collaboration entre le CERN e...

  9. SSS-A spacecraft and experiment description.

    Science.gov (United States)

    Longanecker, G. W.; Hoffman, R. A.

    1973-01-01

    The scientific objectives of the Explorer-45 mission are discussed. The primary objective is the study of the ring current responsible for the main phase of magnetic storms. Closely associated with this objective is the determination of the relationship between magnetic storms, substorms, and the acceleration of charged particles in the magnetosphere. Further objectives are the measurement of a wide range of proton, electron and alpha-particle energies, and studies of wave-particle interactions responsible for particle transport and loss in the inner magnetosphere. The orbital parameters, the spacecraft itself, and some of its unique features, such as the data handling system, which is programmable from the ground, are described.

  10. Estimulação DDD com eletrodo único usando estimulação atrial bifásica simultânea: primeiros resultados clínicos

    Directory of Open Access Journals (Sweden)

    Fernando A LUCCHESE

    1997-01-01

    Full Text Available A estimulação de dupla câmara (DDD com eletrodo único usando eletrodo atrial flutuante está limitada em função dos altos limiares encontrados para captura atrial. Avaliamos um sistema novo de cabo eletrodo para estimulação atrial que utiliza dois anéis atriais com pulsos de onda quadrada simultâneos unipolares lançados com polaridade oposta. O primeiro pulso é aplicado ao pólo distal do eletrodo e é positivo, o segundo pulso é aplicado ao pólo proximal do eletrodo e é negativo, ambos em relação à carcaça do gerador. O atraso entre os dois pulsos é programável entre 0,0 ms e 1,0 ms. A distância entre os anéis a nível atrial é de 10 mm e a distância entre o pólo distal atrial e o eletrodo ventricular unipolar pode ser selecionado entre 11, 13 e 15 cm. O posicionamento dos anéis a nível atrial é selecionado de acordo com a medida do limiar de estimulação do pulso bifásico simultâneo, incluindo manobras respiratórias para confirmar a captura/sense contínuos. O gerador de pulso tem uma única conexão para o eletrodo e a capacidade de aplicar os pulsos programáveis de onda quadrada com polaridades opostas, com atrasos programáveis de 0,0 a 1,0 ms. O gerador pode ser programado para estimulação VDD com eletrodo único. Este sistema foi implantado em 4 pacientes com bloqueio AV total e função sinusal normal. Os limiares de estimulação atrial e diafragmático foram medidos com várias configurações do pulso, larguras e atrasos, intra e pós-operatórios. A porção média do átrio direito foi selecionada como a melhor posição para os anéis atriais com captura contínua durante inspiração profunda. As medidas intra-operatórias e pós-operatórias (48 horas foram: Limiar Intra-operatório Pós-operatório atrial unipolar 3,2 + 0,47 V não realizada atrial (bifásico simultâneo 1,6 + 0,37 V 3,37 + 0,84 V diafragmático acima de 7 V 5,21 + 0,3 V sense de onda P 2,35 + 1,3 mV 1,27 + 0,8 mV Os pacientes

  11. H_Hyd_Shktub_Mshock_III, JJJ, KKK (S01,S02,S03) on the National Ignition Facility

    Energy Technology Data Exchange (ETDEWEB)

    Desjardins, Tiffany [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Schmidt, Derek William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Di Stefano, Carlos [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Flippo, Kirk Adler [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Doss, Forrest William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Merritt, Elizabeth Catherine [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-12-15

    These experiments are the first experiments in the Mshock campaign at the National Ignition Facility. The experiment is scheduled to be conducted on Dec. 14, 2017. The goal of the Mshock campaign is to study feedthrough dynamics of the Richtmyer- Meshkov instability in a thin layer. These dynamics will be studied in both a reshock configuration (initially) and then in a multi-shock configuration where it is planned to reshock the RM instability up to 3 times (four shocks total).

  12. DDT, DDD, AND DDE DECHLORINATION BY ZERO-VALENT IRON

    Science.gov (United States)

    Traditionally, destruction of DDT [1,1,1-trichIoro-2,2-bis(p-chlorophenyl)ethane] for environmental remediation required high-energy processes such as incineration. Here, the capability of powdered zero-valent iron to dechlorinate DDT and related compounds at room tempera...

  13. SSS-A attitude control prelaunch analysis and operations plan

    Science.gov (United States)

    Werking, R. D.; Beck, J.; Gardner, D.; Moyer, P.; Plett, M.

    1971-01-01

    A description of the attitude control support being supplied by the Mission and Data Operations Directorate is presented. Descriptions of the computer programs being used to support the mission for attitude determination, prediction, control, and definitive attitude processing are included. In addition, descriptions of the operating procedures which will be used to accomplish mission objectives are provided.

  14. The biomechanical assessment of the cervical inter-vertebral kinematics, between DDD patients ICR based study

    Science.gov (United States)

    Saveh, Amir Hossein; Zali, Ali Reza; Seddighi, Amir Saeed; Zarghi, Afsaneh; Chizari, Mahmoud; Hanafiah, Yussof

    2012-01-01

    Abstract: It is very important to pay more attention to spine from the biomechanical perspective. It would allow the analysis of initial conditions of the vertebral disc degeneration syndrome and adopting of normal spine kinematics to compare and match it with a degenerated disc and providing a biomechanical index as an indicator for the conduct of any surgical intervention including arthroplasty to maximize restoring spinal biomechanical motion. It is clear that the head movement is possible with the help of muscles. However, the shape and type of motion depends on the structure and shape of the cervical spine and the interaction between them. Cervical spine kinematics depends on the anatomy of the bones and joints. Bazhdok et al (2000) investigated the cervical kinematics and mechanical behavior of the spine and its anatomical connections. They have examined the atlanto- occipital joint motion during flexion-extension and rotation as well as the mechanism of paradoxical motion of atlanto- axial joint by radiography. Bifalkou et al (2011) studied the inter-vertebral motion based on arc kinematic commentary of video fluoroscopy. They showed that the diagnosis of biomechanical instability can be done based on the kinematic examination of the spine obtained in sagittal images. They also declared that the fluoroscopy can be used as a tool for study. Using an automated algorithm, image adaption was carried out and the motion direction of vertebrae was tracked. In the present study, some patients were selected among patients with cervical disc degeneration. Following imaging by fluoroscopy, the instantaneous center of the spinal action was calculated. It was used as a biomechanical criterion and the treatment group was compared with the healthy group. The loci of the instantaneous centers of the two groups were compared and its difference with the value of healthy group was calculated. A biomechanical criterion was introduced as a basis for comparison of normal and degenerated discs. Keywords: Cervical, Degeneration, Cases selection

  15. Levels of PCBs, DDT, DDE and DDD in Italian human blood samples

    Energy Technology Data Exchange (ETDEWEB)

    Rocca, C. La; Abate, V.; Alivernini, S.; Iacovella, N.; Mantovani, A.; Turrio-Baldassarri, L. [Ist. Superiore di Sanita, Roma (Italy); Silvestroni, L.; Spera, G. [Dept. of Medical Pathophysiology, Univ. (Italy)

    2004-09-15

    The environmental contamination from polychlorinated biphenyls (PCBs) is effecting the exposure of the general population in a direct way through air inhalation, ingestion of particulate matter and dermal absorption and, most of all, in an indirect way through diet. Diet represents, in fact, the main way of human exposure to PCBs. PCBs have potential teratogenic, carcinogenic, hormonal and immunological effects. An association between endometriosis and high levels of PCB in plasma has also been reported3. Moreover, some congeners (PCB 105, PCB 118, PCB 153) have effects on thyroid hormones in animal models, although the PCB dose used in these experiments was an order of magnitude higher than the estimated human exposure. Humans are, however, exposed to a complex mixtures of PCB congeners. In this study identification and quantification of 60 PCB congeners and 3 chlorinated pesticides in human whole blood samples are presented. The subjects examined in this pilot study were a small group of patients with possible endocrine-related problems and unknown specific exposure. The aim of this study was to increase the present understanding about the distribution of the PCBs in human whole blood. The levels of DDT and metabolites were measured as well, since these compounds are consistently reported to contribute to the whole body burden of persistent chlorinated compounds, together with PCBs.

  16. Dicty_cDB: SFH765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mni**ikhnknqyylyiysnii*ifknwktffknwktllkkein*flii kkk--- ---xxxxxxxxxxvxxxxxxxxxxxxxxxxxxxxxxxxxxxyaxqgnvxqxxxxxv*xxx...yifivtlyeylkigkhflkigkhy*kkk*idf*l* kk--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxmlxkxm*xxrxxxx...fnxxy xlxxx*smhffix*kwcmyxnxhlysnsicnsncypxcysncypncytnrysnrypnsny nc Frame C: cwptgnlfvsyeh

  17. Dicty_cDB: Contig-U01121-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LRWPLENTPD LSEPQFAEIDKYTIANTYHFN*ilstlen*c*k*kstlasil*sttstrinfiiynk*in kkk*k**nnkiikli*lflydk Translated Am...WEDNKQYYLDMQKSVERLKYILRWPLENTPD LSEPQFAEIDKYTIANTYHFN*ilstlen*c*k*kstlasil*sttstrinfiiynk*in kkk*k**nnkiikli

  18. ISSR markers as a tool to distinguish Idt and SSS populations of Zea mays L

    OpenAIRE

    TIAROVSKÁ, Jana; SENKOVÁ, Slavomíra; BEŽO, Milan; RAŽNÁ, Katarína; MASNICA, Miloslav; LABAJOVÁ, Mária

    2013-01-01

    Maintaining genetic diversity for crop improvement and improving the quality of genetic resource management is both an inevitable part of nowadays maize breeding. ISSR markers brings the potential of finding a marker system to discriminate Iowa Stiff Stalk Synthetic and Iodent Reid populations of Zea mays, L. and on the base on coefficients of genetic distance and UPGMA grouping appropriate maize genotypes for the best potential for hybridization can be selected. The work presents the potenti...

  19. Modulation of SST, SSS over northern Bay of Bengal on ISO time scale

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, S.A.; Saha, S.K.; Pokhrel, S.; Sundar, D.; Dhakate, A.R.; Mahapatra, S.; Ali, S.; Chaudhari, H.S.; Shreeram, P.; Suneel, V.; Srikanth, A.S.; Suresh, R.R.V.

    of temperature and salinity. The amount of rainfall received at observation site could not explain the observed freshening, thus an extensive analysis using wavelet coherence is done to find out the source of advected fresh water to the observed location...

  20. A Neutron Star Binary Merger Model for GW170817/GRB 170817A/SSS17a

    Energy Technology Data Exchange (ETDEWEB)

    Murguia-Berthier, A.; Ramirez-Ruiz, E.; Kilpatrick, C. D.; Foley, R. J.; Coulter, D. A.; Pan, Y.-C.; Prochaska, J. X.; Rojas-Bravo, C.; Siebert, M. R. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Kasen, D. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Lee, W. H. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Circuito Exterior, C.U., A. Postal 70-264, 04510 Cd. de México, México (Mexico); Piro, A. L.; Drout, M. R.; Madore, B. F.; Shappee, B. J.; Simon, J. D. [The Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Rest, A. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2017-10-20

    The merging neutron star gravitational-wave event GW170817 has been observed throughout the entire electromagnetic spectrum from radio waves to γ -rays. The resulting energetics, variability, and light curves are shown to be consistent with GW170817 originating from the merger of two neutron stars, in all likelihood followed by the prompt gravitational collapse of the massive remnant. The available γ -ray, X-ray, and radio data provide a clear probe for the nature of the relativistic ejecta and the non-thermal processes occurring within, while the ultraviolet, optical, and infrared emission are shown to probe material torn during the merger and subsequently heated by the decay of freshly synthesized r -process material. The simplest hypothesis, that the non-thermal emission is due to a low-luminosity short γ -ray burst (sGRB), seems to agree with the present data. While low-luminosity sGRBs might be common, we show here that the collective prompt and multi-wavelength observations are also consistent with a typical, powerful sGRB seen off-axis. Detailed follow-up observations are thus essential before we can place stringent constraints on the nature of the relativistic ejecta in GW170817.

  1. (188)Re-SSS/Lipiodol: Development of a Potential Treatment for HCC from Bench to Bedside.

    Science.gov (United States)

    Lepareur, Nicolas; Ardisson, Valérie; Noiret, Nicolas; Garin, Etienne

    2012-01-01

    Hepatocellular carcinoma (HCC) is the 5th most common tumour worldwide and has a dark prognosis. For nonoperable cases, metabolic radiotherapy with Lipiodol labelled with β-emitters is a promising therapeutic option. The Comprehensive Cancer Centre Eugène Marquis and the National Graduate School of Chemistry of Rennes (ENSCR) have jointly developed a stable and efficient labelling of Lipiodol with rhenium-188 (E(βmax) = 2.1 MeV) for the treatment of HCC. The major "milestones" of this development, from the first syntheses to the recent first injection in man, are described.

  2. A Spectral Geometrical Model for Compton Scatter Tomography Based on the SSS Approximation

    DEFF Research Database (Denmark)

    Kazantsev, Ivan G.; Olsen, Ulrik Lund; Poulsen, Henning Friis

    2016-01-01

    The forward model of single scatter in the Positron Emission Tomography for a detector system possessing an excellent spectral resolution under idealized geometrical assumptions is investigated. This model has the form of integral equations describing a flux of photons emanating from the same ann...

  3. Proton Radiation Effects on Dark Signal Distribution of PPD CMOS Image Sensors: Both TID and DDD Effects.

    Science.gov (United States)

    Xue, Yuanyuan; Wang, Zujun; Chen, Wei; Liu, Minbo; He, Baoping; Yao, Zhibin; Sheng, Jiangkun; Ma, Wuying; Dong, Guantao; Jin, Junshan

    2017-11-30

    Four-transistor (T) pinned photodiode (PPD) CMOS image sensors (CISs) with four-megapixel resolution using 11µm pitch high dynamic range pixel were radiated with 3 MeV and 10MeV protons. The dark signal was measured pre- and post-radiation, with the dark signal post irradiation showing a remarkable increase. A theoretical method of dark signal distribution pre- and post-radiation is used to analyze the degradation mechanisms of the dark signal distribution. The theoretical results are in good agreement with experimental results. This research would provide a good understanding of the proton radiation effects on the CIS and make it possible to predict the dark signal distribution of the CIS under the complex proton radiation environments.

  4. 40 CFR Appendix A to Subpart Ddd... - Free Formaldehyde Analysis of Insulation Resins by the Hydroxylamine Hydrochloride Method

    Science.gov (United States)

    2010-07-01

    ... values should conform to the following statistical precision: Variance = 0.005 Standard deviation = 0.07... example levels: Expected percent free formaldehyde Sample size, grams 2 30.0 5 12.0 8 7.5 10 6.0 12 5.0 15... 30 0.5 60 ii. If the milliliters of titrant are less than 5 mL or greater than 30 mL, reestimate the...

  5. Plane-dependent ML scatter scaling: 3D extension of the 2D simulated single scatter (SSS) estimate

    Science.gov (United States)

    Rezaei, Ahmadreza; Salvo, Koen; Vahle, Thomas; Panin, Vladimir; Casey, Michael; Boada, Fernando; Defrise, Michel; Nuyts, Johan

    2017-08-01

    Scatter correction is typically done using a simulation of the single scatter, which is then scaled to account for multiple scatters and other possible model mismatches. This scaling factor is determined by fitting the simulated scatter sinogram to the measured sinogram, using only counts measured along LORs that do not intersect the patient body, i.e. ‘scatter-tails’. Extending previous work, we propose to scale the scatter with a plane dependent factor, which is determined as an additional unknown in the maximum likelihood (ML) reconstructions, using counts in the entire sinogram rather than only the ‘scatter-tails’. The ML-scaled scatter estimates are validated using a Monte-Carlo simulation of a NEMA-like phantom, a phantom scan with typical contrast ratios of a 68Ga-PSMA scan, and 23 whole-body 18F-FDG patient scans. On average, we observe a 12.2% change in the total amount of tracer activity of the MLEM reconstructions of our whole-body patient database when the proposed ML scatter scales are used. Furthermore, reconstructions using the ML-scaled scatter estimates are found to eliminate the typical ‘halo’ artifacts that are often observed in the vicinity of high focal uptake regions.

  6. VizieR Online Data Catalog: NGC3115 & NGC1399 VEGAS-SSS globular clusters (Cantiello+, 2018)

    Science.gov (United States)

    Cantiello, M.; D'Abrusco, R.; Spavone, M.; Paolillo, M.; Capaccioli, M.; Limatola, L.; Grado, A.; Iodice, E.; Raimondo, G.; Napolitano, N.; Blakeslee, J. P.; Brocato, E.; Forbes, D. A.; Hilker, M.; Mieske, S.; Peletier, R.; van de Ven, G.; Schipani, P.

    2017-11-01

    Photometric catalogs for globular cluster (GC) candidates over the the 1 sq. degree area around NGC3115 and NGC1399 (ngc3115.dat and ngc1399.dat). The catalogues are based on u-, g- and i- band images from the VST elliptical galaxies survey (VEGAS). Aperture magnitudes, corrected for aperture correction are reported. We also provide the full catalogs of matched sources, which also include the matched background and foreground sources in the frames (ngc3115_full.dat and ngc1399_full.dat). (4 data files).

  7. Dicty_cDB: SSL830 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfdll kkk Translated Ami...sscvwnssvpncprlplvtaplvsyttflgatkyhl**y*ss*cqssws m*remcdkiigdddyfkwlpgggwwstlcgcftalvasmftfashr*ikkslkvfrfd

  8. Dicty_cDB: AFL715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available All Frames) Frame A: KFIFIIQILNSYFIFLYIVTFHKKKKKKKXKKSXFLKKK--- ---xxxxxxxxxxxfxxvxxxxxxxxxxxxxxxxxxxxxwsxx*xxvxxx...qrry Frame B: nsfllyky*ihilffyil*hfikkkkkkxlknxlf*kkk--- ---xxxxxxxxxxxxxwxxxxxxxxxxxxxxxxxxxxxxgxxixxwyxxxcxxixw*xxx

  9. Dicty_cDB: CHB672 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqilnsyfiflyivtfhkkkkkkknlkxplf*kkk--- ---fxxxxxxxxvxxxxxxxxkxnxxxxwxlx*xxgxxxfvxhxw*xxxxxs*gxx*xxx cxxxxxxqxryxxx...hilffyil*hfikkkkkkki*kxpffekk--- ---fxxxxxxxxxxxxxxxxxkxxxxxxgx*xkxxvxxxlxnixgkxxxxxvegxxnxxx vxxxixxkxgxpxx

  10. Dicty_cDB: AFM417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkkxlkxxlf*kkk--- ---xxxxxgxxxxxxxrxx*yxxcxxxxxxxxryxxxxxxixfxwxxixxwxxxx...ENVKTKI QDKEGIP Frame C: ihfyytnikfifyffiycnis*KKKKKKKXKXSXFLKKK--- ---xxxxwxxxxxxxxxxxixxxxxxxxxxxkvxxxxxkx

  11. Occurences and Fate of DDT Principal Isomers/Metabolites, DDA, and o,p'-DDD Enantiomers in Fish, Sediment and Water at a DDT-Impacted Superfund Site

    Science.gov (United States)

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring ...

  12. Is Continuing Contumely Relative to Mc Leod's Vision and ``Secret Sacred Science, (SSS),'': Contagiously Counterproductive in Science, or an Unhealthy Artifact of ``Turf Wars''?

    Science.gov (United States)

    Leod, Roger

    2007-04-01

    Mc Leod confirmed, with physics, his models for vision, and for electromagnetic artifacts, by traditional methods, associated with phenomena like tornados, hurricanes, and earthquakes. The latter confirmations are evidently apparent across current ethnology, cultures, linguistics, religion, rituals, exotic astronomy, somewhat concealed evidence of native record-keeping/writing, and iconography. Use of cultural anthropology while observing a modern Peruvian sacred-site-sweeping at Cuzco, coupled with their assertion that Ñari Huallac means ``serpent God,'' plus electromagnet information, reveals that their religious world-view include(s)(d) applied science that is still otherwise unacknowledged. Alexander Thom's precise megalithic site-measurements also imply that ``The Ancients' Serpent'' made/makes precise tracks that convey valuable information. The linguistics of words like Seminole, and unusual visual effects, reveal some traditionalists have done better than most scientists, for vision, and observational physics, and earth science. Tornado and hurricane tracks are predictable, as are some earthquakes. Tornado ``detuning'' or shutdown is electromagnetically possible. To cite this abstract, use the following reference: http://meetings.aps.org/link/BAPS.2007.NES07.C2.7

  13. Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

    Science.gov (United States)

    Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

    2010-03-01

    The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

  14. Einstein Observatory SSS and MPC observations of the complex X-ray spectra of Seyfert galaxies. [Solid State Spectrometer and Monitor Proportional Counter

    Science.gov (United States)

    Turner, T. J.; Weaver, K. A.; Mushotzky, R. F.; Holt, S. S.; Madejski, G. M.

    1991-01-01

    The X-ray spectra of 25 Seyfert galaxies measured with the Solid State Spectrometer on the Einstein Observatory have been investigated. This new investigation utilizes simultaneous data from the Monitor Proportional Counter, and automatic correction for systematic effects in the Solid State Spectrometer which were previously handled subjectively. It is found that the best-fit single-power-law indices generally agree with those previously reported, but that soft excesses of some form are inferred for about 48 percent of the sources. One possible explanation of the soft excess emission is a blend of soft X-ray lines, centered around 0.8 keV. The implications of these results for accretion disk models are discussed.

  15. Dicty_cDB: VSI166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KK Translated Amino Acid sequence (All Frames) Frame A: QKHKTIYKYQHCYFLQIFFLTHYHTKFFLILFNTHTFKKK--- ---gxxxxxxxxxxxxxfxxxfffxxx...ppxffffffspxff*kkkkkxxxxfffxtpxxf ffxxkkkk Frame B: knikqstniniaifykfff*hittpsfs*fylthill...kkk--- ---GXXXXXXXKXXXXFFXXFFFXXXXPPXFFFFFFPPXFFKKKKKKXFXXFFFXPXXXF FXPXKKKK Frame C: kt*nnlqistllfftnfffntl...phqvflnfi*htyf*kk--- ---xxxxxxxxxxxxxffxxfffxxxppxfffffffpplflkkkkkkxfxfffxnpxxxf

  16. Dicty_cDB: CFI279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fvymni**ikhnknxiiyifivtlyeylkigkhflkigkhy*kkk*idf*l*kk--- ---xxxxxxxxxxxxxxxxxxxxxxxaxfxxvxxvyxxxxxxxxx...lxxxlxlxxxlxlxl xxxllxxpllqplpqlq Frame C: lfi*tfnk*ntikxilfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---xxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxcmxxxxxxxxxsxcxxxcxxxcxxxc xxxcyxxrysnrypns Homology vs CS

  17. Dicty_cDB: AFL617 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkki*kxxffekk--- ---fxxxpxgxxxxxxxr*xxxxxxxxxiqxxxgxsxrsxxxxfxw*xxxxxx...QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI TLEVEGSDNIENVXTKIQDKEGI Frame C: ihfyytnikfifyffiycnis*kkkkkknlkxxlf*kkk--- ---xxx...pxrxxxxxxxkvvxxxxxxxxxsx*xrvfxqixxvxfxxvxxxxmxglxxxtis kknxlstwssx*xvvckxlskh*lvrps

  18. Dicty_cDB: VSF233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lllks*vit*eimvikilisc*nqldlilrikknnnnnki*msl Frame B: ***sptrisctyc*kvr*llkr*wllry*ylvktn*i*f*elkkiiiiikfkch...y*nk*i kkk--- ---***sptrisctyc*kvr*llkr*wllry*ylvktn*i*f*elkkiiiiikfkch Frame C:

  19. Randomized controlled trials of COX-2 inhibitors

    DEFF Research Database (Denmark)

    Stefansdottir, Gudrun; De Bruin, Marie L; Knol, Mirjam J

    2011-01-01

    trials after the 2004 market withdrawal of rofecoxib were excluded. RESULTS: Median defined daily dose (DDD) of celecoxib (2.00) was higher than the median DDD of rofecoxib (1.00; p ... celecoxib after the withdrawal of rofecoxib because the overall median DDD of celecoxib was substantially higher than the median DDD of rofecoxib, while non-selective NSAID DDDs were comparable....

  20. Predictors of Sick Sinus Syndrome in Patients after Successful Radiofrequency Catheter Ablation of Atrial Flutter

    OpenAIRE

    Song, Changho; Jin, Moo-Nyun; Lee, Jung-Hee; Kim, In-Soo; Uhm, Jae-Sun; Pak, Hui-Nam; Lee, Moon-Hyoung; Joung, Boyoung

    2014-01-01

    Purpose The identification of sick sinus syndrome (SSS) in patients with atrial flutter (AFL) is difficult before the termination of AFL. This study investigated the patient characteristics used in predicting a high risk of SSS after AFL ablation. Materials and Methods Out of 339 consecutive patients who had undergone radiofrequency ablation for AFL from 1991 to 2012, 27 (8%) had SSS (SSS group). We compared the clinical characteristics of patients with and without SSS (n=312, no-SSS group). ...

  1. VEGAS-SSS. II. Comparing the globular cluster systems in NGC 3115 and NGC 1399 using VEGAS and FDS survey data. The quest for a common genetic heritage of globular cluster systems

    Science.gov (United States)

    Cantiello, Michele; D'Abrusco, Raffaele; Spavone, Marilena; Paolillo, Maurizio; Capaccioli, Massimo; Limatola, Luca; Grado, Aniello; Iodice, Enrica; Raimondo, Gabriella; Napolitano, Nicola; Blakeslee, John P.; Brocato, Enzo; Forbes, Duncan A.; Hilker, Michael; Mieske, Steffen; Peletier, Reynier; van de Ven, Glenn; Schipani, Pietro

    2018-04-01

    We analyze the globular cluster (GC) systems in two very different galaxies, NGC 3115 and NGC 1399. With the papers of this series, we aim at highlighting common and different properties in the GC systems in galaxies covering a wide range of parameter space. We compare the GCs in NGC 3115 and NGC 1399 as derived from the analysis of one square degree u-, g-, and i-band images taken with the VST telescope as part of the VST early-type galaxy survey (VEGAS) and Fornax deep survey (FDS). We selected GC candidates using as reference the morpho-photometric and color properties of confirmed GCs. The surface density maps of GCs in NGC 3115 reveal a morphology similar to the light profile of field stars; the same is true when blue and red GCs are taken separately. The GC maps for NGC 1399 are richer in structure and confirm the existence of an intra-cluster GC component. We confirm the presence of a spatial offset in the NGC 1399 GC centroid and find that the centroid of the GCs for NGC 3115 coincides well with the galaxy center. Both GC systems show unambiguous color bimodality in (g - i) and (u - i); the color-color relations of the two GC systems are slightly different with NGC 3115 appearing more linear than NGC 1399. The azimuthal average of the radial density profiles in both galaxies reveals a larger spatial extent for the total GCs population with respect to the galaxy surface brightness profile. For both galaxies, the red GCs have radial density profiles compatible with the galaxy light profile, while the radial profiles for blue GCs are shallower. As for the specific frequency of GCs, SN, we find it is a factor of two higher in NGC 1399 than for NGC 3115; this is mainly the result of extra blue GCs. By inspecting the radial behavior of the specific frequency, SN(

  2. Selection of permanent pacing position of cardiac ventricle in patients with complete right bundle branch block

    International Nuclear Information System (INIS)

    Yang Minquan; Zhou Jun; Zhu Yan; Wang Jin; Rong Xin; Zhang Xiaoyi

    2005-01-01

    Objective: To find out the optimal pacing localization by comparing different pacing positions of the right ventricle in brady-cardiacarrhythmia patients with complete right bundle branch block. Methods: DDD type of double lumen permanent pacemaker was implanted in each of the 8 cases of sick sinus syndrome (SSS) and/or III degree atrioventricular block (III degree AVB) with complete right bundle branch block in normal heart function or class I. For each patient, four pacing positions in right ventricle were compared and the QRS pacing durations were recorded. The position with the shortest the QRS duration was chosen as the permanent pacing position. Heart function, chest X-rays and left ventricle ejection fraction (LVEF) were followed up after the operation. Results: In all the 8 cases, the posterior septum of the right ventricle were chosen as the permanent pacing position, with the shorter pacing QRS duration than that of pre-operation (P<0.05) and other pacing positions of the right ventricle. All parameters of this permanent pacing position were within the normal range. During the follow-up of 6-36 months, no abnormity was found in cardiac functions. Conclusion: In brady-cardiacarrhythmia patients with complete right bundle branch block, the implantation of permanent pacemaker should be at the junction region of inlet and outlet tracts, of the posterior septum of the right ventricle with ideal physiological function. (authors)

  3. Clinical characteristics of RA patients with secondary SS and association with joint damage

    OpenAIRE

    Brown, Lindsay E.; Frits, Michelle L.; Iannaccone, Christine K.; Weinblatt, Michael E.; Shadick, Nancy A.; Liao, Katherine P.

    2014-01-01

    Objectives. Secondary SS (sSS) is a common extra-articular manifestation of RA. There are conflicting data regarding the association of sSS with worse joint damage. This study aims to characterize sSS patients in an RA cohort and study the association between sSS and joint damage.

  4. Dynamic performances of wet turbine and steam-separator-superheater and their mathematical simulation as objects of temperature control

    International Nuclear Information System (INIS)

    Golovach, E.A.

    1985-01-01

    A mathematical model of a turbine and steam-separator-superheater (SSS) as applied to solution of the tasks of steam temperature regulaton after SSS has been developed. SSS as objects of steam temperature control are considerably less inertial, than intermediate superheaters (IS) of power units in thermal power plants, since for typical SSS and IS considered the duration of transition process according to steam temperature after SSS is 5-10 times loweA than for IS

  5. Dicty_cDB: CFH601 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available plhsklkvvttlrm*kqkfktkk vshqi Translated Amino Acid sequence (All Frames) Frame A: iiqilnsyfiflyivtfhkkkkkkkn*kixffekk--- ---xxixxxxx...xkxvxxxxxxfxxxgxxxkxxxxxxxxxxkxxtxpxgpxixrwyanxcq xixw*xhhs*segsdnienvkxxiqdkegippd...*fsd*evvckfl*klslvkplhsklkvvttlrm*kqkfktkk vshqi Frame C: ytnikfifyffiycnis*kkkkkkklknxlf*kkk--- ---xnxxxx...xxxxgxxxxxxxxfxw*xlxxxgxxxxxxxkxnxxsxwssx*xvvckxlsx hxlvxpsllk*glr*y*kc*xkxsrqrrypx

  6. Dicty_cDB: SFD729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cid sequence laywknvk*ikkkkkxkkxfxrf*kgxvlikkkkxpxfxxxkkx*kxkkkkxkkxxxgxx rgxxxkkkglkkxxkfxkxkkkxkkkxf*XXXXX... Acid sequence (All Frames) Frame A: laywknvk*ikkkkkxkkxfxrf*kgxvlikkkkxpxfxxxkkx*kxkkkkxkkxxxgxx rgxxxkkkgl...falhysp q Frame B: wptgkmsnk*kkkkkxkkxlxgfkrxxf**kkkkxpffxxxkkxkx*kkkxxkkxxxxxp ggxxxkkrv*kkxknfxkxkkkxkknxfxpxxxfxgxxx...kkxxggfxppxxgxpxpxpkx lgxpxxgppxxpggxpxxxxgxflxgxxxfxxkkff*kkkkkgxlxpxxv*kgpif*kkk kkflkxffxxxkgg...fnkkkkxpxffxgkkkxkxkkkkxkkkxxxxxp gaxxkkkgfkkkxkifxxxkkxxkktflxxxxxfxglxxkxxxgxxxplxxxxxpxxxkx wgppkxxpxxx

  7. How Does the Political Nature of the Defense Acquisition Process Affect Cost Growth

    Science.gov (United States)

    2006-09-01

    using the following equations. 100*% k k k BCWP COCO = (5) Where: k = the kth year of DAES reporting and, kKk BCWPACWPCO −= (6) The...F-16 270 F-35 Joint Strike Fighter (JSF) 6 FAAD C2I 64 FAAD NLOS Fiber Optic Guided-Missile 7 FBCB2 19 FDS 60 FFG-7 271 Future Aircraft Carrier

  8. 128 | P a g e

    African Journals Online (AJOL)

    Fr. Ikenga

    1Office of the High Commissioner for Human Rights, (OHCHR) 'Migration and Human .... led states to reduce their services in areas of social welfare, education and ... murder of black families by members of the Ku Klux Klan (KKK); Indian caste .... emphasis here will be on crime against humanity as provided for under the ...

  9. Supplement table 1 Collection localities of C. mystaceus in Thailand.

    Indian Academy of Sciences (India)

    Acer

    . 2, CPm, 5, Chaiyaphum, Mueang, Northeast. 3, KKk, 5, KhonKaen, Kranuan, Northeast. 4, KKm, 5, KhonKaen, Mueang, Northeast. 5, KKu, 4, KhonKaen, Ubolratana, Northeast. 6, KSh, 3, Kalasin, HuaiMek, Northeast. 7, LEn, 1, Loei, NongHin ...

  10. Supplementary data:

    Indian Academy of Sciences (India)

    Acer

    Supplementary data: Table 1. Collection localities of C. mystaceus in Thailand. Pop. Code N. Province. District. Region. 1. BRk. 9. Buri Ram. Krasang. Northeast. 2. CPm. 5. Chaiyaphum. Mueang. Northeast. 3. KKk. 5. Khon Kaen. Kranuan. Northeast. 4. KKm. 5. Khon Kaen. Mueang. Northeast. 5. KKu. 4. Khon Kaen.

  11. Dicty_cDB: SFG429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKKKKKFKXSXFLKKK--- ---XNVXXXIXXXXVXPXXXTXXXFXXVXN*xxgxxxxxxxnxqkxxnxptwssxlxrvv xkxlsxtltgktixles*glr*y*kc*...ence (All Frames) Frame A: llaywifsnsfllyky*ihilffyil*HFIKKKKKKKFKXSXFLKKK--- ---lxm*xxxxxixrxxxxxxqxxxfxw*x...fvktltgktitlevegsdnienvk tkiqdk* Frame B: cwptgffqihfyytnikfifyffiycnis*kkkkkknlkxxxf*kkk--- ---*xckxxdxx*xgxxxxxnxvxxxxgkxlxxwxxxxxx...-XNVXXXIXXXXVXPXXXTXXXFXXVXN*xxgxxxxxxxnxqkxxnxptwssxlxrvv xkxlsxtltgktixles*glr*y*kc*nkdsrqrryptrptkinfrw*t

  12. Dicty_cDB: CHC625 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkknlkxxlf*kkk--- ---xxxxxxxvxx*xxl*xxkxkxxxxxkvfxxxx...xxxxfxxvnn*xrvxxxxxxiskkn qxfxlvlrlxgwyanxcqnixw*dhhx*s*...qledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle vegsdnienvktkiqdkegip Frame B: nsfllyky*ihilffyil*hfikkkkkkki*kxxffekk--- ---xxxxxx...kxxgsxxfxnxkxxxxxkxrfsxxxxxvxixxw*tikxgxxxx*xqypkri xfsxwsxd*xggmqxfvktlxgktitxevegqiilk

  13. ulinganishi wa muundo wa vitomeo katika kamusi mbili za kiswahili

    African Journals Online (AJOL)

    ULINGANISHI WA MUUNDO WA VITOMEO KATIKA KAMUSI MBILI ZA KISWAHILI - KIINGEREZA. E.K.F Chiduo. Abstract. Ulinganishi wa Kamusi Sanifu ya Kiswahili-Kiingereza (KSKK, 1993) na Kamusi ya Kiswahili- Kiingereza (KKK, TUKI 2001) unazingatia mtazamo wa Nkweti-Azel. Mtizamo huu unazingatia vipengelele ...

  14. Subjective Social Status and Well-Being: The Role of Referent Abstraction.

    Science.gov (United States)

    Haught, Heather M; Rose, Jason; Geers, Andrew; Brown, Jill A

    2015-01-01

    Subjective social status (SSS) has been shown to predict well-being and mental health, above and beyond objective social status (OSS). However, little is known about the factors that moderate this relationship. Two studies explored whether the link between SSS and well-being varied depending upon the referent used for comparison in SSS judgments. Participants judged their well-being and SSS in comparison to referents that varied in abstraction. A confirmatory factor analysis on SSS judgments yielded two factors: (a) SSS perceptions toward global referents and (b) SSS perceptions toward local referents. SSS relative to a global referent was a better predictor of depression (Studies 1 and 2), life satisfaction (Studies 1 and 2), and self-esteem (Study 2) than SSS relative to a local referent. These findings have theoretical implications for understanding how people differentiate between local vs. global referents and practical implications for status-related health disparities.

  15. PODAAC-AQR50-3SUCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  16. PODAAC-SMP20-3SMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS level 3, monthly gridded product is based on the first release of the validated standard mapped sea surface salinity (SSS) data from the...

  17. PODAAC-SMP20-3SPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS level 3, 8-Day running mean gridded product is based on the first release of the validated standard mapped sea surface salinity (SSS) data...

  18. PODAAC-AQR50-3Y7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  19. PODAAC-AQR50-3S3CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  20. Air quality permits in Texas and New Mexico

    International Nuclear Information System (INIS)

    Fusselman, D.K.; Hofmann, J.E.

    1991-01-01

    Permitting gas processing equipment ranges from fairly simple procedures under the Texas Air Control Board (TACB) Standard Exemption List and the New Mexico Environmental Improvement Division (NMEID) Registration Regulations to an extremely complicated procedure requiring a federal Prevention of Significant Deterioration (PSD) and/or non-attainment review. The following topics relating to obtaining air permits for gas plants will be addressed in this paper: Type of permit/exemption necessary for construction, Specific permit/exemption requirements, New Source Performance Standards (NSPS) Subparts KKK, LLL, GG, K, Ka and Kb, Potential effects of the Federal Clean Air Act Amendments (FCAA). This paper only addresses specific permitting concerns and requirements that apply to the natural gas production industry. The same requirements apply to other industries, with possible additional requirements of National Emission Standards for Hazardous Air Pollutants (NESHAP), NSPS other than Subparts KKK, LLL, GG, K, Ka and Kb, and non-attainment review for pollutants other than ozone

  1. Dicty_cDB: CHC347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHC347 (Link to dictyBase) - - - - CHC347P (Link to Original s...ite) CHC347F 184 CHC347Z 431 CHC347P 595 - - Show CHC347 Library CH (Link to library) Clone ID CHC347 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...KRNKLIFNYKKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT

  2. First observation of the decay Bs 0 → φ K̄*0

    NARCIS (Netherlands)

    Aaij, R.; Abellan Beteta, C.; Adeva, B.; Adinolfi, M.; Adrover, C.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Anderlini, L.; Anderson, J.; Andreassen, P.R.; Appleby, R. B.; Aquines Gutierrez, O.; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Bachmann, S.; Back, J. J.; Baesso, C.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Benayoun, M.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M-O.; Van Beuzekom, Martin; Bien, A.; Bifani, S.; Bird, T.D.; Bizzeti, A.; Bjørnstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brambach, T.; Van Den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N. H.; Brown, H.; Burducea, I.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Campora Perez, D.; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Castillo Garcia, L.; Cattaneo, M.; Cauet, Ch; Charles, M.; Charpentier, Ph; Chen, P.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Cid Vidal, X.; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coca-Pelaz, A.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Cunliffe, S.; Currie, C.R.; D'Ambrosio, C.; David, P.; David, P. N.Y.; Davis, A.; De Bonis, I.; De Bruyn, K.; De Capua, S.; De Cian, M.; de Miranda, J. M.; Paula, L.E.; da-Silva, W.S.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Dogaru, M.; Donleavy, S.; Dordei, F.; Dosil Suárez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Van Eijk, D.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Elsby, D.; Falabella, A.; Färber, C.; Fardell, G.; Farinelli, C.; Farry, S.; Fave, V.; Ferguson, D.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fitzpatrick, C.; Fontana, Mark; Fontanelli, F.; Forty, R.; De Aguiar Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Furcas, S.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Garosi, P.; Garra Tico, J.; Garrido, L.; Carvalho-Gaspar, M.; Gauld, Rhorry; Gersabeck, E.; Gersabeck, M.; Gershon, T. J.; Ghez, Ph; Gibson, V.; Gligorov, V. V.; Göbel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.Q.; Head-Gordon, Teresa; Grabalosa Gándara, M.; Graciani Diaz, R.; Granado Cardoso, L. A.; Graugés, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Grünberg, O.; Gui, B.; Gushchin, E.; Guz, Yu; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hampson, T.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hartmann, T.; He, J.; Heijne, V.; Hennessy, K.; Henrard, P.; Hernando Morata, J. A.; van Herwijnen, E.; Hicheur, A.; Hicks, G.E.; Hill, D.; Hoballah, M.; Holtrop, M.; Hombach, C.; Hopchev, P.; Hulsbergen, W.; Hunt, P.; Huse, J.T.; Hussain, N.; Hutchcroft, D. E.; Hynds, D.; Iakovenko, V.; Idzik, M.; Ilten, P.; Jacobsson, R.; Jaeger, A.; Jans, E.; Jaton, P.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Kaballo, M.; Kandybei, S.; Karacson, M.; Karbach, T. M.; Kenyon, I. R.; Kerzel, U.; Ketel, T.; Keune, A.; Khanji, B.; Kochebina, O.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G. D.; Lai, A.; Lambert, D.M.; Lambert, R. W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Latham, T. E.; Lazzeroni, C.; Le Gac, R.; Van Leerdam, J.; Lees, J. P.; Lefèvre, R.; Leflat, A.; Lefrançois, J.; Di Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Li Gioi, L.; Liles, M.; Lindner, R.; Linn, S.C.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lopez Asamar, E.; Lopez-March, N.; Lu, H.; Lucchesi, D.; Luisier, J.; Luo, H.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Marconi, U.; Märki, R.; Marks, J.; Martellotti, G.; Martens, A.; Martín Sánchez, A.; Martinelli-Boneschi, F.; Martinez-Santos, D.; Martins Tostes, D.; Massafferri, A.; Matev, R.; Mathe, Z.; Matteuzzi, C.; Maurice, E.; Mazurov, A.; McCarthy, J.; Mcnab, A.; McNulty, R.; Meadows, B. T.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. N.; Molina Rodriguez, J.; Monteil, S.; Moran-Zenteno, D.; Morawski, P.; Morello, M. J.; Mountain, R.; Mous, I.; Muheim, F.; Müller, Karl; Muresan, R.; Muryn, B.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neufeld, N.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Nomerotski, A.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Orlandea, M.; Otalora Goicochea, J. M.; Owen, R.P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrick, G. N.; Patrignani, C.; Pavel-Nicorescu, C.; Pazos Alvarez, A.; Pellegrino, A.; Penso, G.; Pepe Altarelli, M.; Perazzini, S.; Perego, D. L.; Perez Trigo, E.; Pérez-Calero Yzquierdo, A.; Perret, P.; Perrin-Terrin, M.; Pessina, G.; Petridis, K.; Petrolini, A.; Phan, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilař, T.; Pinci, D.; Playfer, S.; Plo Casasus, M.; Polci, F.; Polok, G.; Poluektov, A.; Polycarpo, E.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pritchard, C.A.; Prouve, C.; Pugatch, V.; Puig Navarro, A.; Punzi, G.; Qian, Y.W.; Rademacker, J. H.; Rakotomiaramanana, B.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Redford, S.; Reid, M.; dos Reis, A. C.; Ricciardi, S.; Richards, Al.; Rinnert, K.; Rives Molina, V.; Roa Romero, D. A.; Robbe, P.; Rodrigues, L.E.T.; Rodriguez Perez, P.; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, van Hapere; Ruiz Valls, P.; Sabatino, G.; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Salzmann, C.; Sanmartin Sedes, B.; Sannino, M.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schaack, P.; Schiller, M.; Schindler, R. H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Sepp, I.; Serra, N.; Serrano, J.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shatalov, P.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, O.; Shevchenko, V.; Shires, A.; Silva Coutinho, R.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, M.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; de Souza, D.K.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stoica, S.; Stone, S.; Storaci, B.; Straticiuc, M.; Straumann, U.; Subbiah, V. K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; Van Tilburg, J.; Tisserand, V.; Tobin, M. N.; Tolk, S.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, N.T.M.T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Ubeda Garcia, M.; Ukleja, A.; Urner, D.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vazquez Gomez, R.; Vazquez Regueiro, P.; Vecchi, S.; Velthuis, M.J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voß, C.; Voss, H.; Waldi, R.; Wallace, R.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Webber, A. D.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiechczynski, J.; Wiedner, D.; Wiggers, L.; Wilkinson, G.; Williams, M.P.; Williams, M.; Wilson, James F; Wishahi, J.; Witek, M.; Wotton, S. A.; Wright, S.J.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Yang, Z.; Young, D. R.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.

    2013-01-01

    The first observation of the decay Bs 0 → φK̄*0 is reported. The analysis is based on a data sample corresponding to an integrated luminosity of 1.0 fb-1 of pp collisions at √s = 7 TeV, collected with the LHCb detector. A yield of 30 ± 6 Bs 0 → (K+K-)(K -π+) decays is found in the mass windows

  3. CP violation in b → s penguin decays and T, CPT violation at BaBar and BELLE

    International Nuclear Information System (INIS)

    Emery-Schrenk, S.

    2014-01-01

    We report on the first direct observation of time reversal violation at BABAR in the interference between direct decay and decay with B 0 - B-bar 0 mixing, as well as on the most precise search for CPT violation in B 0 - B-bar 0 mixing at BELLE. We then present recent CP violation studies at BABAR in rare b → s penguin decays B → KKK and B → K*l + l - . (author)

  4. Eddy-induced salinity pattern in the North Pacific

    Science.gov (United States)

    Abe, H.; Ebuchi, N.; Ueno, H.; Ishiyama, H.; Matsumura, Y.

    2017-12-01

    This research examines spatio-temporal behavior of sea surface salinity (SSS) after intense rainfall events using observed data from Aquarius. Aquarius SSS in the North Pacific reveals one notable event in which SSS is locally freshened by intense rainfall. Although SSS pattern shortly after the rainfall reflects atmospheric pattern, its final form reflects ocean dynamic structure; an anticyclonic eddy. Since this anticyclonic eddy was located at SSS front created by precipitation, this eddy stirs the water in a clockwise direction. This eddy stirring was visible for several months. It is expected horizontal transport by mesoscale eddies would play significant role in determining upper ocean salinity structure.

  5. MR imaging of degenerative disc disease

    International Nuclear Information System (INIS)

    Farshad-Amacker, Nadja A.; Farshad, Mazda; Winklehner, Anna; Andreisek, Gustav

    2015-01-01

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided

  6. MR imaging of degenerative disc disease

    Energy Technology Data Exchange (ETDEWEB)

    Farshad-Amacker, Nadja A., E-mail: nadja.farshad@usz.ch [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland); Farshad, Mazda [Department of Orthopaedic Surgery, Balgrist University Hospital, Zurich (Switzerland); Winklehner, Anna; Andreisek, Gustav [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland)

    2015-09-15

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided.

  7. Subjective social status and health.

    Science.gov (United States)

    Euteneuer, Frank

    2014-09-01

    Subjective social status (SSS) predicts health outcomes above and beyond traditional objective measures of social status, such as education, income and occupation. This review summarizes and integrates recent findings on SSS and health. Current studies corroborate associations between low SSS and poor health indicators by extending previous findings to further populations and biological risk factors, providing meta-analytic evidence for adolescents and by demonstrating that negative affect may not confound associations between SSS and self-rated health. Recent findings also highlight the relevance of SSS changes (e.g. SSS loss in immigrants) and the need to consider cultural/ethnical differences in psychological mediators and associations between SSS and health. SSS is a comprehensive measure of one's social position that is related to several poor health outcomes and risk factors for disease. Future investigation, particularly prospective studies, should extend research on SSS and health to further countries/ethnic groups, also considering additional psychological and biological mediators and dynamic aspects of SSS. Recently developed experimental approaches to manipulate SSS may also be promising.

  8. Sensory-specific satiety is intact in rats made obese on a high-fat high-sugar choice diet.

    Science.gov (United States)

    Myers, Kevin P

    2017-05-01

    Sensory-specific satiety (SSS) is the temporary decreased pleasantness of a recently eaten food, which inhibits further eating. Evidence is currently mixed whether SSS is weaker in obese people, and whether such difference precedes or follows from the obese state. Animal models allow testing whether diet-induced obesity causes SSS impairment. Female rats (n = 24) were randomly assigned to an obesogenic high-fat, high-sugar choice diet or chow-only control. Tests of SSS involved pre-feeding a single palatable, distinctively-flavored food (cheese- or cocoa-flavored) prior to free choice between both foods. Rats were tested for short-term SSS (2 h pre-feeding immediately followed by 2 h choice) and long-term SSS (3 day pre-feeding prior to choice on day 4). In both short- and long-term tests rats exhibited SSS by shifting preference towards the food not recently eaten. SSS was not impaired in obese rats. On the contrary, in the long-term tests they showed stronger SSS than controls. This demonstrates that neither the obese state nor a history of excess energy consumption fundamentally causes impaired SSS in rats. The putative impaired SSS in obese people may instead reflect a specific predisposition, properties of the obesogenic diet, or history of restrictive dieting and bingeing. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Documentation Driven Development for Complex Real-Time Systems

    Science.gov (United States)

    2004-12-01

    This paper presents a novel approach for development of complex real - time systems , called the documentation-driven development (DDD) approach. This... time systems . DDD will also support automated software generation based on a computational model and some relevant techniques. DDD includes two main...stakeholders to be easily involved in development processes and, therefore, significantly improve the agility of software development for complex real

  10. Impact of pacing modality and biventricular pacing on cardiac output and coronary conduit flow in the post-cardiotomy patient.

    LENUS (Irish Health Repository)

    Healy, David G

    2012-02-03

    We have previously demonstrated the role of univentricular pacing modalities in influencing coronary conduit flow in the immediate post-operative period in the cardiac surgery patient. We wanted to determine the mechanism of this improved coronary conduit and, in addition, to explore the possible benefits with biventricular pacing. Sixteen patients undergoing first time elective coronary artery bypass grafting who required pacing following surgery were recruited. Comparison of cardiac output and coronary conduit flow was performed between VVI and DDD pacing with a single right ventricular lead and biventricular pacing lead placement. Cardiac output was measured using arterial pulse waveform analysis while conduit flow was measured using ultrasonic transit time methodology. Cardiac output was greatest with DDD pacing using right ventricular lead placement only [DDD-univentricular 5.42 l (0.7), DDD-biventricular 5.33 l (0.8), VVI-univentricular 4.71 l (0.8), VVI-biventricular 4.68 l (0.6)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.023) and VVI-biventricular pacing (P=0.001) but there was no significant advantage to DDD-biventricular pacing (P=0.45). In relation to coronary conduit flow, DDD pacing again had the highest flow [DDD-univentricular 55 ml\\/min (24), DDD-biventricular 52 ml\\/min (25), VVI-univentricular 47 ml\\/min (23), VVI-biventricular 50 ml\\/min (26)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.006) pacing but not significantly different to VVI-biventricular pacing (P=0.109) or DDD-biventricular pacing (P=0.171). Pacing with a DDD modality offers the optimal coronary conduit flow by maximising cardiac output. Biventricular lead placement offered no significant benefit to coronary conduit flow or cardiac output.

  11. Comparing the Performance of Popular MEG/EEG Artifact Correction Methods in an Evoked-Response Study

    DEFF Research Database (Denmark)

    Haumann, Niels Trusbak; Parkkonen, Lauri; Kliuchko, Marina

    2016-01-01

    We here compared results achieved by applying popular methods for reducing artifacts in magnetoencephalography (MEG) and electroencephalography (EEG) recordings of the auditory evoked Mismatch Negativity (MMN) responses in healthy adult subjects. We compared the Signal Space Separation (SSS......) and temporal SSS (tSSS) methods for reducing noise from external and nearby sources. Our results showed that tSSS reduces the interference level more reliably than plain SSS, particularly for MEG gradiometers, also for healthy subjects not wearing strongly interfering magnetic material. Therefore, tSSS...... is recommended over SSS. Furthermore, we found that better artifact correction is achieved by applying Independent Component Analysis (ICA) in comparison to Signal Space Projection (SSP). Although SSP reduces the baseline noise level more than ICA, SSP also significantly reduces the signal—slightly more than...

  12. Fate of DDT in grape juice when fermented and distilled into arak

    International Nuclear Information System (INIS)

    Kawar, N.S.

    1975-01-01

    Since DDT is still used on grapevines to control insect pests, the fate of this insecticide in grape juice fermented and distilled into arak was investigated. Fermentation of the juice resulted in extensive conversion of DDT to DDD. Distillation of the fermented juice resulted in further conversion of DDT to DDD. Moreover, the major portion of both DDT and DDD remained in the undistilled fraction. The second distillation resulted in further distribution of DDT and DDD among the four fractions, thus leaving very low levels of both compounds in the finished product. DDT residue in arak constituted only 2% of the amount added to the fresh juice. (author)

  13. A pilot study and novel angiographic classification for superior sagittal sinus stenting in patients with non-thrombotic intracranial venous occlusive disease.

    Science.gov (United States)

    Raper, Daniel M S; Buell, Thomas J; Ding, Dale; Pomeraniec, I Jonathan; Crowley, R Webster; Liu, Kenneth C

    2018-01-01

    Safety and efficacy of superior sagittal sinus (SSS) stenting for non-thrombotic intracranial venous occlusive disease (VOD) is unknown. The aim of this retrospective cohort study is to evaluate outcomes after SSS stenting. We evaluated an institutional database to identify patients who underwent SSS stenting. Radiographic and clinical outcomes were analyzed and a novel angiographic classification of the SSS was proposed. We identified 19 patients; 42% developed SSS stenosis after transverse sinus stenting. Pre-stent maximum mean venous pressure (MVP) in the SSS of 16.2 mm Hg decreased to 13.1 mm Hg after stenting (p=0.037). Preoperative trans-stenosis pressure gradient of 4.2 mm Hg decreased to 1.5 mm Hg after stenting (pSSS stenosis distal to the stent construct was noted. Improvement in headache, tinnitus, and visual obscurations was reported by 66.7%, 63.6%, and 50% of affected patients, respectively, at mean follow-up of 5.2 months. We divided the SSS into four anatomically equal segments, numbered S1-S4, from the torcula to frontal pole. SSS stenosis typically occurs in the S1 segment, and the anterior extent of SSS stents was deployed at the S1-S2 junction in all but one case. SSS stenting is reasonably safe, may improve clinical symptoms, and significantly reduces maximum MVP and trans-stenosis pressure gradients in patients with VOD with SSS stenosis. The S1 segment is most commonly stenotic, and minimum pressure gradients for symptomatic SSS stenosis may be lower than for transverse or sigmoid stenosis. Additional studies and follow-up are necessary to better elucidate appropriate clinical indications and long-term efficacy of SSS stenting. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  14. Detecting Myocardial Ischemia With 99mTechnetium-Tetrofosmin Myocardial Perfusion Imaging in Ischemic Stroke.

    Science.gov (United States)

    Giannopoulos, Sotirios; Markoula, Sofia; Sioka, Chrissa; Zouroudi, Sofia; Spiliotopoulou, Maria; Naka, Katerina K; Michalis, Lampros K; Fotopoulos, Andreas; Kyritsis, Athanassios P

    2017-10-01

    To assess the myocardial status in patients with stroke, employing myocardial perfusion imaging (MPI) with 99m Technetium-tetrofosmin ( 99m Tc-TF)-single-photon emission computed tomography (SPECT). Fifty-two patients with ischemic stroke were subjected to 99m Tc-TF-SPECT MPI within 1 month after stroke occurrence. None of the patients had any history or symptoms of coronary artery disease or other heart disease. Myocardial perfusion imaging was evaluated visually using a 17-segment polar map. Myocardial ischemia (MIS) was defined as present when the summed stress score (SSS) was >4; MIS was defined as mild when SSS was 4 to 8, and moderate/severe with SSS ≥9. Patients with SSS >4 were compared to patients with SSS SSS >9 were compared to patients with SSS SSS, with the oldest age exhibiting the highest SSS ( P = .01). The association of age with SSS remained statistically significant in the multivariate analysis ( P = .04). The study suggested that more than half of patients with stroke without a history of cardiac disease have MIS. Although most of them have mild MIS, we suggest a thorough cardiological evaluation in this group of patients for future prevention of severe myocardial outcome.

  15. Communication Strategy: Proper Structure Necessary but not Sufficient

    Science.gov (United States)

    2010-12-01

    Information, (1998), http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd00073 (accessed November 12, 2010). “The multidimensional...Biotechnology Information (1998). http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd000 73 (accessed November 12, 2010

  16. 47 CFR 80.324 - Transmission of distress message by station not itself in distress.

    Science.gov (United States)

    2010-10-01

    ... authorities who may be able to assist. (b) Transmission must be made on the international distress frequencies... radiotelegraphy is used: (i) The signal DDD SOS SOS SOS DDD: (ii) The word DE; (iii) The call sign of the... three times; (ii) The words THIS IS; (iii) The call sign or other identification of the transmitting...

  17. Enantiomeric ratios as an indicator of exposure processes for persistent pollutants in human placentas

    DEFF Research Database (Denmark)

    Shen, Heqing; Virtanen, H E; Main, Katharina M

    2006-01-01

    The enantiomeric ratios (ER) of alpha-HCH and o,p'-DDT ((+)-isomer concentration/(-)-isomer concentration) and o,p'-DDD (first eluting enantiomer/second enantiomer) were investigated in 112 human placentas from Finnish boys collected 1997-2001. Both o,p'-DDD and alpha-HCH showed changes in their ER...

  18. Microstructurally Based Cross-slip Mechanisms and Their Effects on Dislocation Microstructure Evolution in fcc Crystals

    Science.gov (United States)

    2015-01-01

    incorporated into DDD simulations. Accordingly, the motivation of the current work is to incorporate an atomistically informed cross-slip model into DDD... nudged elastic band method, Acta Mater. 59 (19) (2011) 7135–7144. [54] S.I. Rao, D.M. Dimiduk, J.A. El-Awady, T.A. Parthasarathy, M.D. Uchic, C. Woodward

  19. L. Sumera: Symphony No. 5 / Michael Scott Rohan

    Index Scriptorium Estoniae

    Rohan, Michael Scott

    1997-01-01

    L. Sumera: Symphony No. 5; Music for Chamber Orchestra, In memorian. Malmö Symphony Orchestra / Paavo Järvi. BIS CD-770. 64-35 DDD; Various. Searching for Roots - music from Estonia. Virgin VC 5 43242 2; 71: 34 DDD

  20. Eddy-induced Sea Surface Salinity changes in the tropical Pacific

    Science.gov (United States)

    Delcroix, T. C.; Chaigneau, A.; Soviadan, D.; Boutin, J.

    2017-12-01

    We analyse the Sea Surface Salinity (SSS) signature of westward propagating mesoscale eddies in the tropical Pacific by collocating 5 years (2010-2015) of SMOS (Soil Moisture and Ocean Salinity) SSS and altimetry-derived sea level anomalies. The main characteristics of mesoscale eddies are first identified in SLA maps. Composite analyses in the Central and Eastern ITCZ regions then reveal regionally dependent impacts with opposite SSS anomalies for the cyclonic and anticyclonic eddies. In the Central region (where we have the largest meridional SSS gradient), we found dipole-like SSS changes with maximum anomalies on the leading edge of the eddy. In the Eastern region (where we have the largest near-surface vertical salinity gradient) we found monopole-like SSS changes with maximum anomalies in the eddy centre. These dipole/monopole patterns and the rotational sense of eddies suggest the dominant role of horizontal and vertical advection in the Central and Eastern ITCZ regions, respectively.

  1. Evaluation of Aquarius Version-5 Sea Surface Salinity on various spatial and temporal scales

    Science.gov (United States)

    Lee, T.

    2017-12-01

    Sea surface salinity (SSS) products from Aquarius have had three public releases with progressive improvement in data quality: Versions 2, 3, and 4, with the last one being released in October 2015. A systematic assessment of the Version-4, Level-3 Aquarius SSS product was performed on various spatial and temporal scales by comparing it with gridded Argo products (Lee 2016, Geophys. Res. Lett.). The comparison showed that the consistency of Aquarius Version-4 SSS with gridded Argo products is comparable to that between two different gridded Argo products. However, significant seasonal biases remain in high-latitude oceans. Further improvements are being made by the Aquarius team. Aquarius Version 5.0 SSS is scheduled to be released in October 2017 as the final version of the Aquarius Project. This presentation provides a similar evaluation of Version-5 SSS as reported by Lee (2016) and contrast it with the current Version-4 SSS.

  2. Analgetikaforbrug, -overdosering og -dødsfald i Danmark 1979-1986

    DEFF Research Database (Denmark)

    Ott, P; Hansen, P B; Dalhoff, K P

    1990-01-01

    During 1978-1987 the annual sale of analgetics increased by 28% to 164 millions defined daily doses (mDDD) per year. Paracetamol changed status to over-the-counter drug by 1.1.1984 as did combinations of acetylicsalicylic acid and codein 14.5.1984. The consumption of paracetamol increased rapidly...... to 47 mDDD/-year, the mortality steadily decreasing to 0.07 deaths/mDDD in 1986. The consumption of salicylics decreased from 113 to 94 mDDD, of which the salicylic/codein combination constituted an increasing fraction. The mortality of salicylics increased from 0.05 death/mDDD in 1983 to 0.27/m...

  3. Perceived Socioeconomic Status: A New Type of Identity which Influences Adolescents’ Self Rated Health

    Science.gov (United States)

    Goodman, Elizabeth; Huang, Bin; Schafer-Kalkhoff, Tara; Adler, Nancy E.

    2007-01-01

    Purpose The cognitive, social, and biological transitions of adolescence suggest that subjective perceptions of social position based on the socioeconomic hierarchy may undergo important changes during this period, yet how such perceptions develop is poorly understood and no studies assess if changes in such perceptions influence adolescents’ health. This study describes adolescents’ subjective perceptions of familial socioeconomic status (SSS), how SSS changes over time, and how age, race, and objective socioeconomic status (SES) indicators influence SSS. In addition, the study determines if SSS independently influences adolescents’ self-rated health, an important predictor of morbidity and health service utilization. Methods 1179 non-Hispanic black and white baseline 7–12th graders from a Midwestern public school district completed a validated, teen-specific measure of SSS annually for 4 consecutive years. A parent provided information on SES. Markov modeling assessed transitions in SSS over time. Results SSS declined with age (p=.001) and stabilized among older teens. In addition to age, SES and race, but not gender, were significant correlates of SSS, but the relationships between these factors were complex. In cross-sectional and longitudinal analyses, black teens from families with low parent education had higher SSS than white teens from similarly educated families, while white teens from highly educated families had higher SSS than black teens from highly educated families. Lower SSS and changes in SSS predicted poor self rated health even when adjusting for race and objective SES measures. Conclusion Subjective evaluations of socioeconomic status predict adolescents’ global health ratings even when adjusting for the sociodemographic factors which shape them. PMID:17950168

  4. Mothers' knowledge, Perceptions and practices of Home based ...

    African Journals Online (AJOL)

    Almost all the respondents (99.0%) were aware of oral rehydration solution/salt sugar solution (ORS/SSS); and 87.7% agreed that ORS/SSS is effective for the treatment of diarrhea, but only 44.3% gave ORS/SSS, while 29.4% gave antibiotics/antidiarhea drugs to their children who suffered diarrhea. Only 40.9% knew how ...

  5. Soil Moisture Ocean Salinity (SMOS) salinity data validation over Malaysia coastal water

    International Nuclear Information System (INIS)

    Reba, M N M; Rosli, A Z; Rahim, N A

    2014-01-01

    The study of sea surface salinity (SSS) plays an important role in the marine ecosystem, estimation of global ocean circulation and observation of fisheries, aquaculture, coral reef and sea grass habitats. The new challenge of SSS estimation is to exploit the ocean surface brightness temperature (Tb) observed by the Microwave Imaging Radiometer with Aperture Synthesis (MIRAS) onboard the Soil Moisture Ocean Salinity (SMOS) satellite that is specifically designed to provide the best retrieval of ocean salinity and soil moisture using the L band of 1.4 GHz radiometer. Tb observed by radiometer is basically a function of the dielectric constant, sea surface temperature (SST), wind speed (U), incidence angle, polarization and SSS. Though, the SSS estimation is an ill-posed inversion problem as the relationship between the Tb and SSS is non-linear function. Objective of this study is to validate the SMOS SSS estimates with the ground-truth over the Malaysia coastal water. The LM iteratively determines the SSS of SMOS by the reduction of the sum of squared errors between Tb SMOS and Tb simulation (using in-situ) based on the updated geophysical triplet in the direction of the minimum of the cost function. The minimum cost function is compared to the desired threshold at each iteration and this recursive least square process updates the SST, U and SSS until the cost function converged. The designed LM's non-linear inversion algorithm simultaneously estimates SST, U and SSS and thus, map of SSS over Malaysia coastal water is produced from the regression model and accuracy assessment between the SMOS and in-situ retrieved SSS. This study found a good agreement in the validation with R square of 0.9 and the RMSE of 0.4. It is concluded that the non-linear inversion method is effective and practical to extract SMOS SSS, U and SST simultaneously

  6. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem

    OpenAIRE

    Liu, Guangzeng; Zhang, Dajun; Pan, Yangu; Ma, Yuanxiao; Lu, Xingyue

    2017-01-01

    In this study, we examined subjective social status (SSS) and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7–12). The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminar...

  7. Sequence Classification: 889924 [

    Lifescience Database Archive (English)

    Full Text Available the Sec61p translocation complex (Sec61p-Sss1p-Sbh1p) that forms a channel for passage of secretory protein...s through the endoplasmic reticulum membrane, and of the Ssh1p complex (Ssh1p-Sbh2p-Sss1p); interacts with Ost4p and Wbp1p; Sss1p || http://www.ncbi.nlm.nih.gov/protein/6320291 ...

  8. Subclavian steal syndrome without subclavian stenosis

    Directory of Open Access Journals (Sweden)

    Matt Cwinn, MD

    2017-09-01

    Full Text Available Subclavian steal syndrome (SSS has been well described in the setting of subclavian stenosis. We describe an unusual case of SSS caused by a high-flow arteriovenous dialysis fistula in the absence of subclavian stenosis, provide a review of the literature, and propose that arteriovenous fistula-induced SSS is an underdiagnosed cause of syncope in this population of patients.

  9. Treatment practices and quantification of antimicrobial drug usage in conventional and organic dairy farms in Wisconsin.

    Science.gov (United States)

    Pol, M; Ruegg, P L

    2007-01-01

    The objective of this study was to develop a method to quantify antimicrobial drug usage and treatment practices on conventional and organic dairy farms that had been recruited to represent a broad spectrum of potential exposure to antimicrobial drugs. Data on disease prevalence and treatment practices of organic (n = 20) and conventional (n = 20) farms were obtained during a farm visit using a survey instrument. A standardized estimate of antimicrobial drug usage was developed using a defined daily dose (DDD) of selected compounds. Density of antimicrobial drug usage was expressed as the number of DDD per adult cow per year. Differences in prevalence and management of selected diseases between conventional and organic farms were identified. The overall estimated prevalence of selected diseases was greater for conventional farms compared with organic farms. Organic farmers reported use of a variety of nonantimicrobial compounds for treatment and prevention of disease. Conventional farmers reported that penicillin was the compound most commonly used for dry cow therapy and cephapirin was most commonly used for treatment of clinical mastitis. On conventional farms, the estimated overall exposure to antimicrobial drugs was 5.43 DDD per cow per year composed of 3.58 and 1.85 DDD of intramammary and parenteral antimicrobial drugs, respectively. Of total intramammary antimicrobial drug usage, treatment of clinical mastitis contributed 2.02 DDD compared with 1.56 DDD attributed to the use of dry cow therapy. Of total parenteral treatments, the distribution of exposure was 0.52 (dry cow therapy), 1.43 (clinical mastitis treatment), 0.39 (treatment of foot disease), 0.14 (treatment of respiratory disease), and 0.32 (treatment of metritis) DDD. For treatments of foot infections (0.33 DDD), respiratory infections (0.07 DDD), and metritis (0.19 DDD), the mean density of ceftiofur usage was significantly greater compared with other compounds.

  10. Multicenter, prospective, randomized safety and efficacy study of a new atrial-based managed ventricular pacing mode (MVP) in dual chamber ICDs.

    Science.gov (United States)

    Sweeney, Michael O; Ellenbogen, Kenneth A; Casavant, David; Betzold, Robert; Sheldon, Todd; Tang, Feng; Mueller, Megan; Lingle, John

    2005-08-01

    Ventricular desynchronization caused by right ventricular pacing may impair ventricular function and increase risk of heart failure (CHF), atrial fibrillation (AF), and death. Conventional DDD/R mode often results in high cumulative percentage ventricular pacing (Cum%VP). We hypothesized that a new managed ventricular pacing mode (MVP) would safely provide AAI/R pacing with ventricular monitoring and DDD/R during AV block (AVB) and reduce Cum%VP compared to DDD/R. MVP RAMware was downloaded in 181 patients with Marquis DR ICDs. Patients were initially randomized to either MVP or DDD/R for 1 month, then crossed over to the opposite mode for 1 month. ICD diagnostics were analyzed for cumulative percentage atrial pacing (Cum%AP), Cum%VP, and duration of DDD/R pacing for spontaneous AVB. Baseline characteristics included age 66 +/- 12 years, EF 36 +/- 14%, and NYHA Class II-III 36%. Baseline PR interval was 190 +/- 53 msec and programmed AV intervals (DDD/R) were 216 +/- 50 (paced)/189 +/- 53 (sensed) msec. Mean Cum%VP was significantly lower in MVP versus DDD/R (4.1 +/- 16.3 vs 73.8 +/- 32.5, P MVP were 85.0 and 99.9, respectively. Mean Cum%AP was not different between MVP versus DDD/R (48.7 +/- 38.5 vs 47.3 +/- 38.4, P = 0.83). During MVP overall time spent in AAI/R was 89.6% (intrinsic conduction), DDD/R 6.7% (intermittent AVB), and DDI/R 3.7% (AF). No adverse events were attributed to MVP. MVP safely achieves functional atrial pacing by limiting ventricular pacing to periods of intermittent AVB and AF in ICD patients, significantly reducing Cum%VP compared to DDD/R. MVP is a universal pacing mode that adapts to AVB and AF, providing both atrial pacing and ventricular pacing support when needed.

  11. Subjective social status predicts in vivo responsiveness of β-adrenergic receptors.

    Science.gov (United States)

    Euteneuer, Frank; Mills, Paul J; Rief, Winfried; Ziegler, Michael G; Dimsdale, Joel E

    2012-07-01

    Several poor health outcomes, including cardiovascular risk, have been associated with both subjective social status (SSS) and sympathetic overactivity. Because prolonged sympathetic overactivation down regulates beta adrenergic receptor (β-AR) function, reduced β-AR responsiveness is considered an indicator of sympathetic overactivity and a cardiovascular risk factor. Though prior research has focused on objective social status and β-AR function, no studies have examined the association between SSS and β-AR function. We aimed to learn whether SSS predicts the in vivo responsiveness of β-ARs. We assessed the chronotropic 25 dose (CD25), an in vivo marker of β-AR responsiveness, in 94 healthy participants. The MacArthur scales of subjective social status were used to assess SSS in the U.S.A. (SSS-USA) and in the local community (SSS-C). Objective social status was analyzed by calculating the Hollingshead two-factor index. β-AR responsiveness was reduced (as indicated by higher CD25 values) in participants with lower SSS-USA (p = .007) and lower SSS-C (p social status. Our results indicate that β-AR function may be an important component of the link between SSS and health.

  12. X-ray spectral models of Galactic bulge sources - the emission-line factor

    International Nuclear Information System (INIS)

    Vrtilek, S.D.; Swank, J.H.; Kallman, T.R.

    1988-01-01

    Current difficulties in finding unique and physically meaningful models for the X-ray spectra of Galactic bulge sources are exacerbated by the presence of strong, variable emission and absorption features that are not resolved by the instruments observing them. Nine Einstein solid state spectrometer (SSS) observations of five Galactic bulge sources are presented for which relatively high resolution objective grating spectrometer (OGS) data have been published. It is found that in every case the goodness of fit of simple models to SSS data is greatly improved by adding line features identified in the OGS that cannot be resolved by the SSS but nevertheless strongly influence the spectra observed by SSS. 32 references

  13. Axisymmetric thermoviscoelastoplastic state of branched laminar shells, taking account of transverse-shear and torsional deformation

    International Nuclear Information System (INIS)

    Galishin, A.Z.

    1995-01-01

    The nonaxisymmetric thermoelastic stress-strain state (SSS) of branched laminar orthotropic shells was considered; the axisymmetric thermoviscoelastic SSS of branched laminar orthotropic shells was considered; and the axisymmetric thermoviscoelastoplastic SSS of branched laminar isotropic shells was considered, taking into account of the transverse-shear deformation. In the present work, in contrast, the axisymmetric thermoviscoelastoplastic SSS of branched laminar isotropic shells is considered, taking account of transverse-shear and torsional deformation. Layers that are made from orthotropic materials and deform in the elastic region may be present

  14. Evaluation of higher brain function by MRI. Flow measurement in the superior sagittal sinus using phase contrast method

    International Nuclear Information System (INIS)

    Ono, Mototsugu

    1997-01-01

    To assess the higher brain function, flow measurement in the superior sagittal sinus (SSS) was performed noninvasively using a phase contrast MRI in 76 patients with suspicious of impaired higher brain function including dementias (senile dementia of Alzheimer type; SDAT and multi-infarct dementia; MID), strokes, and others. Thirty-one normal controls were consisted of 18 healthy volunteers and 13 patients with tension headache whose higher brain function was proved be normal. Mean flow velocity was measured in the distal portion of the SSS adjoining to the occipital lobes and was multiplied by cross-sectional area of the SSS at the measuring point to obtain mean flow volume. For intellectual index, cross-cultural cognitive examination (CCCE) was applied to all cases excluding volunteers. Normal value of SSS flow volume measured by MRI was 6.92±0.66 ml/s. Significant differences in both SSS flow and CCCE score from normal controls were found in SDAT group, MID group, and non-dementia group. No substantial differences between SDAT group and MID group were noted in both CCCE score and SSS flow. In normal controls, there was no correlation between SSS flow and age, whereas, significant inverse correlation of SSS flow with age was found in all cases. Between CCCE score and SSS flow, there were nearly linear relationships in all cases, SDAT group, MID group, and non-dementia group. Significant but relatively poor correlation was found in normals. (K.H.)

  15. Low childhood subjective social status and telomere length in adulthood: The role of attachment orientations.

    Science.gov (United States)

    Murdock, Kyle W; Seiler, Annina; Chirinos, Diana A; Garcini, Luz M; Acebo, Sally L; Cohen, Sheldon; Fagundes, Christopher P

    2018-04-01

    Low subjective social status (SSS) in childhood places one at greater risk of a number of health problems in adulthood. Theoretical and empirical evidence indicates that exposure to supportive parenting may buffer the negative effects of low childhood SSS on adult health. Given the importance of supportive caregivers and close others for the development of attachment orientations throughout the lifespan, attachment theory may be important for understanding why some individuals are resilient to the negative effects of low childhood SSS on adult health while others are not. We examined if attachment anxiety and attachment avoidance altered the association between childhood subjective social status (SSS) and length of telomeres in white blood cells in adulthood. Shorter telomere length is associated with increased risk of age-related diseases including cancer, type 2 diabetes, and cardiovascular disease. Participants (N = 128) completed self-report measures of childhood SSS and attachment orientations, as well as a blood draw. We found that among those with low childhood SSS, low attachment anxiety was associated with longer telomere length in white blood cells in comparison to high attachment anxiety controlling for participant age, sex, race, body mass index, and adult SSS. Among those with high childhood SSS, low attachment anxiety was associated with a slight decrease in telomere length. Attachment avoidance was unrelated to length of telomeres. Such findings provide further evidence for the role that close relationships may have on buffering SSS related health disparities. © 2018 Wiley Periodicals, Inc.

  16. Body Mass Index and Subjective Social Status: The Coronary Artery Risk Development in Young Adults Study.

    Science.gov (United States)

    Dhurandhar, Emily J; Pavela, Gregory; Kaiser, Kathryn A; Dutton, Gareth R; Fontaine, Kevin R; Kim, Daniel; Shikany, James M; Allison, David B; Lewis, Cora E

    2018-02-01

    Subjective social status (SSS), or perceived social status, may explain, in part, the relationship between socioeconomic status (SES) and obesity. The objective of this study was to test whether SSS mediates the relationship between two indicators of SES (income and education) and body mass index (BMI). A cross-sectional, structural equation path analysis was applied to the Coronary Artery Risk Development in Young Adults (CARDIA) study (n = 2,624). The analysis tested whether SSS (MacArthur scale), education, and income were associated with BMI at the year 20 examination (adjusting for sex, age, and race), and it was hypothesized that the associations of education and income with BMI would be at least partly mediated by SSS. SSS had a significant direct effect on BMI (-0.21, P = 0.018). Education had a significant direct relationship with SSS (0.11, P SSS (-0.02, P = 0.022). Although income did not have a significant direct relationship with BMI, it did have a significant indirect relationship through SSS (b = -0.05, P = 0.019). Results are consistent with the hypothesized model in which SSS partially mediates the relationship between SES indicators and BMI. © 2017 The Obesity Society.

  17. Choice of Magnetometers and Gradiometers after Signal Space Separation.

    Science.gov (United States)

    Garcés, Pilar; López-Sanz, David; Maestú, Fernando; Pereda, Ernesto

    2017-12-16

    Modern Elekta Neuromag MEG devices include 102 sensor triplets containing one magnetometer and two planar gradiometers. The first processing step is often a signal space separation (SSS), which provides a powerful noise reduction. A question commonly raised by researchers and reviewers relates to which data should be employed in analyses: (1) magnetometers only, (2) gradiometers only, (3) magnetometers and gradiometers together. The MEG community is currently divided with regard to the proper answer. First, we provide theoretical evidence that both gradiometers and magnetometers result from the backprojection of the same SSS components. Then, we compare resting state and task-related sensor and source estimations from magnetometers and gradiometers in real MEG recordings before and after SSS. SSS introduced a strong increase in the similarity between source time series derived from magnetometers and gradiometers (r² = 0.3-0.8 before SSS and r² > 0.80 after SSS). After SSS, resting state power spectrum and functional connectivity, as well as visual evoked responses, derived from both magnetometers and gradiometers were highly similar (Intraclass Correlation Coefficient > 0.8, r² > 0.8). After SSS, magnetometer and gradiometer data are estimated from a single set of SSS components (usually ≤ 80). Equivalent results can be obtained with both sensor types in typical MEG experiments.

  18. Simple introduction of sulfonic acid group onto polyethylene by radiation-induced cografting of sodium styrenesulfonate with hydrophilic monomers

    International Nuclear Information System (INIS)

    Tsuneda, Satoshi; Saito, Kyoichi; Furusaki, Shintaro; Sugo, Takanobu; Makuuchi, Keizo

    1993-01-01

    The sulfonic acid (SO 3 H) group was readily introduced into a polyethylene (PE) membrane by radiation-induced cografting of sodium styrenesulfonate (SSS) with hydrophilic monomers such as acrylic acid (AAc) and hydroxyethyl methacrylate (HEMA). The density of SSS grafted onto the PE membrane was determined as a function of molar ratio of hydrophilic monomer to SSS in the monomer mixture. Immersion of the electron-beam-irradiated PE membrane into the mixture of SSS and HEMA for 5 h at 323 K provided to the SO 3 H density of 2.5 mol/kg of the H-type product

  19. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    OpenAIRE

    Hiscock, Rosemary; Bauld, Linda; Arnott, Deborah; Dockrell, Martin; Ross, Louise; McEwen, Andy

    2015-01-01

    The UK Stop Smoking Services (SSS) are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883) and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801). SSS monitoring data suggested 2% of clients were using e-...

  20. Mutation of the dengue virus type 2 envelope protein heparan sulfate binding sites or the domain III lateral ridge blocks replication in Vero cells prior to membrane fusion

    International Nuclear Information System (INIS)

    Roehrig, John T.; Butrapet, Siritorn; Liss, Nathan M.; Bennett, Susan L.; Luy, Betty E.; Childers, Thomas; Boroughs, Karen L.; Stovall, Janae L.; Calvert, Amanda E.; Blair, Carol D.; Huang, Claire Y.-H.

    2013-01-01

    Using an infectious cDNA clone we engineered seven mutations in the putative heparan sulfate- and receptor-binding motifs of the envelope protein of dengue virus serotype 2, strain 16681. Four mutant viruses, KK122/123EE, E202K, G304K, and KKK305/307/310EEE, were recovered following transfection of C6/36 cells. A fifth mutant, KK291/295EE, was recovered from C6/36 cells with a compensatory E295V mutation. All mutants grew in and mediated fusion of virus-infected C6/36 cells, but three of the mutants, KK122/123EE, E202K, G304K, did not grow in Vero cells without further modification. Two Vero cell lethal mutants, KK291/295EV and KKK307/307/310EEE, failed to replicate in DC-SIGN-transformed Raji cells and did not react with monoclonal antibodies known to block DENV attachment to Vero cells. Additionally, both mutants were unable to initiate negative-strand vRNA synthesis in Vero cells by 72 h post-infection, suggesting that the replication block occurred prior to virus-mediated membrane fusion. - Highlights: • Heparan sulfate- and receptor-binding motifs of DENV2 envelope protein were mutated. • Four mutant viruses were isolated—all could fuse C6/36 cells. • Two of these mutants were lethal in Vero cells without further modification. • Lethal mutations were KK291/295EV and KKK305/307/310EEE. • Cell attachment was implicated as the replication block for both mutants

  1. Mutation of the dengue virus type 2 envelope protein heparan sulfate binding sites or the domain III lateral ridge blocks replication in Vero cells prior to membrane fusion

    Energy Technology Data Exchange (ETDEWEB)

    Roehrig, John T., E-mail: jtr1@cdc.gov [Division of Vector-Borne Diseases, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States); Butrapet, Siritorn; Liss, Nathan M. [Division of Vector-Borne Diseases, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States); Bennett, Susan L. [Arthropod-borne and Infectious Diseases Laboratory, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523 (United States); Luy, Betty E.; Childers, Thomas; Boroughs, Karen L.; Stovall, Janae L.; Calvert, Amanda E. [Division of Vector-Borne Diseases, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States); Blair, Carol D. [Arthropod-borne and Infectious Diseases Laboratory, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523 (United States); Huang, Claire Y.-H. [Division of Vector-Borne Diseases, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States)

    2013-07-05

    Using an infectious cDNA clone we engineered seven mutations in the putative heparan sulfate- and receptor-binding motifs of the envelope protein of dengue virus serotype 2, strain 16681. Four mutant viruses, KK122/123EE, E202K, G304K, and KKK305/307/310EEE, were recovered following transfection of C6/36 cells. A fifth mutant, KK291/295EE, was recovered from C6/36 cells with a compensatory E295V mutation. All mutants grew in and mediated fusion of virus-infected C6/36 cells, but three of the mutants, KK122/123EE, E202K, G304K, did not grow in Vero cells without further modification. Two Vero cell lethal mutants, KK291/295EV and KKK307/307/310EEE, failed to replicate in DC-SIGN-transformed Raji cells and did not react with monoclonal antibodies known to block DENV attachment to Vero cells. Additionally, both mutants were unable to initiate negative-strand vRNA synthesis in Vero cells by 72 h post-infection, suggesting that the replication block occurred prior to virus-mediated membrane fusion. - Highlights: • Heparan sulfate- and receptor-binding motifs of DENV2 envelope protein were mutated. • Four mutant viruses were isolated—all could fuse C6/36 cells. • Two of these mutants were lethal in Vero cells without further modification. • Lethal mutations were KK291/295EV and KKK305/307/310EEE. • Cell attachment was implicated as the replication block for both mutants.

  2. An exploration of the subjective social status construct in patients with acute coronary syndrome.

    Science.gov (United States)

    Tang, Karen L; Pilote, Louise; Behlouli, Hassan; Godley, Jenny; Ghali, William A

    2018-02-06

    Perception of low subjective social status (SSS) relative to others in society or in the community has been associated with increased risk of cardiovascular disease. Our objectives were to determine whether low SSS in society was associated with barriers to access to care or hospital readmission in patients with established cardiovascular disease, and whether perceptions of discordantly high SSS in the community modified this association. We conducted a prospective cohort study from 2009 to 2013 in Canada, United States, and Switzerland in patients admitted to hospital with acute coronary syndrome (ACS). Data on access to care and SSS variables were obtained at baseline. Readmission data were obtained 12 months post-discharge. We conducted multivariable logistic regression to model the odds of access to care and readmission outcomes in those with low versus high societal SSS. One thousand ninety patients admitted with ACS provided both societal and community SSS rankings. The low societal SSS cohort had greater odds of reporting that their health was affected by lack of health care access (OR 1.48, 95% CI 1.11, 1.97) and of experiencing cardiac readmissions (1.88, 95% CI 1.15, 3.06). Within the low societal SSS cohort, there was a trend toward fewer access to care barriers for those with discordantly high community SSS though findings varied based on the outcome variable. There were no statistically significant differences in readmissions based on community SSS rankings. Low societal SSS is associated with increased barriers to access to care and cardiac readmissions. Though attenuated, these trends remained even when adjusting for clinical and sociodemographic factors, suggesting that perceived low societal SSS has health effects above and beyond objective socioeconomic factors. Furthermore, high community SSS may potentially mitigate the risk of experiencing barriers to access to health care in those with low societal SSS, though these associations were not

  3. Adrenal metabolism of mitotane and related compounds

    International Nuclear Information System (INIS)

    Djanegara, T.K.S.

    1989-01-01

    Mitotane (o,p'-DDD; 1-[2-chlorophenyl]-1-[4-chlorophenyl]-2,2-dichloroethane) has been used in the treatment of Cushing's syndrome due to adrenal hyperfunction and it the drug of choice for adrenocortical carcinoma. The object of this investigation is to study the biotransformation of o,p'-DDD and p,p'-DDD in dogs and bovine adrenal cortex to explain its selective toxicity and mechanism of action. The in vitro biotransformation of 14 C-labeled o,p'-DDD and p,p'-DDD by dog and bovine adrenal cortex as studied. Of the cortex subcellular fractions, the cytosol fraction was found to be the most active in metabolizing the substrates, followed by the mitochondrial fraction. This metabolism including that in cytosolic fractions, did not take place with boiled enzyme preparations and required an NADPH generating system. This study has been directed towards establishing the metabolic activation mechanism which may account for the adrenocorticolytic effect of mitotane in contrast to detoxication by the liver. HPLC and TLC metabolic profiles have been generated from incubations of bovine and dog adrenal cortex homogenates and their subfractions for 14 C-labeled p,p'-DDD, o,p'-DDD and its monochloroethylene derivative, o,p'-DDMU

  4. Diversity of bacterial dimethylsulfoniopropionate degradation genes in surface seawater of Arctic Kongsfjorden.

    Science.gov (United States)

    Zeng, Yin-Xin; Qiao, Zong-Yun; Yu, Yong; Li, Hui-Rong; Luo, Wei

    2016-09-08

    Dimethylsulfoniopropionate (DMSP), which is the major source of organic sulfur in the world's oceans, plays a significant role in the global sulfur cycle. This compound is rapidly degraded by marine bacteria either by cleavage to dimethylsulfide (DMS) or demethylation to 3-methylmercaptopropionate (MMPA). The diversity of genes encoding bacterial demethylation (dmdA) and DMS production (dddL and dddP) were measured in Arctic Kongsfjorden. Both dmdA and dddL genes were detected in all stations along a transect from the outer to the inner fjord, while dddP gene was only found in the outer and middle parts of the fjord. The dmdA gene was completely confined to the Roseobacter clade, while the dddL gene was confined to the genus Sulfitobacter. Although the dddP gene pool was also dominated by homologs from the Roseobacter clade, there were a few dddP genes showing close relationships to both Alphaproteobacter and Gammaproteobacter. The results of this study suggest that the Roseobacter clade may play an important role in DMSP catabolism via both demethylation and cleavage pathways in surface waters of Kongsfjorden during summer.

  5. 3K3A-activated protein C stimulates postischemic neuronal repair by human neural stem cells in mice

    DEFF Research Database (Denmark)

    Wang, Yaoming; Zhao, Zhen; Rege, Sanket V

    2016-01-01

    -APC (Lys191-193Ala) mutant in which three Lys residues (KKK191-193) were replaced with alanine, and/or its other mutants with reduced (>90%) anticoagulant activity, engineered to reduce APC-associated bleeding risk while retaining normal cell-signaling activity, have shown benefits in preclinical models...... of ischemic stroke, brain trauma, multiple sclerosis, amyotrophic lateral sclerosis, sepsis, ischemic and reperfusion injury of heart, kidney and liver, pulmonary, kidney and gastrointestinal inflammation, diabetes and lethal body radiation. On the basis of proof-of-concept studies and an excellent safety...

  6. How to employ {\\overline{B}}_d^0\\to J/ψ (π η, \\overline{K}K) decays to extract information on π η scattering

    Science.gov (United States)

    Albaladejo, M.; Daub, J. T.; Hanhart, C.; Kubis, B.; Moussallam, B.

    2017-04-01

    We demonstrate that dispersion theory allows one to deduce crucial information on π η scattering from the final-state interactions of the light mesons visible in the spectral distributions of the decays {\\overline{B}}_d^0\\to J/ψ ({π}^0η, {K}+{K}-,{K}^0{\\overline{K}}^0) . Thus high-quality measurements of these differential observables are highly desired. The corresponding rates are predicted to be of the same order of magnitude as those for {\\overline{B}}_d^0\\to J/ψ {π}+{π}- measured recently at LHCb, letting the corresponding measurement appear feasible.

  7. Subband structure comparison between n- and p- type double delta-doped Ga As quantum wells

    International Nuclear Information System (INIS)

    Rodriguez V, I.; Gaggero S, L.M.

    2004-01-01

    We compute the electron level structure (n-type) and the hole subband structure (p-type) of double -doped GaAs (DDD) quantum wells, considering exchange effects. The Thomas-Fermi (TF), and Thomas-Fermi-Dirac (TFD) approximations have been applied in order to describe the bending of the conduction and valence band, respectively. The electron and the hole subband structure study indicates that exchange effects are more important in p-type DDD quantum wells than in n-type DDD Also our results agree with the experimental data available. (Author) 33 refs., 2 tabs., 5 figs

  8. Academic Attitudes and Achievement in Students of Urban Public Single-Sex and Mixed-Sex High Schools

    Science.gov (United States)

    Else-Quest, Nicole M.; Peterca, Oana

    2015-01-01

    Publicly funded single-sex schooling (SSS) has proliferated in recent years and is touted as a remedy to gaps in academic attitudes and achievement, particularly for low-income students of color. Research on SSS is rife with limitations, stemming from selective admissions processes, selection effects related to socioeconomic status, a lack of…

  9. Surgical Treatment of Snapping Scapula Syndrome Due to Malunion of Rib Fractures.

    Science.gov (United States)

    Ten Duis, Kaj; IJpma, Frank F A

    2017-02-01

    This report describes a case of snapping scapula syndrome (SSS) caused by malunited rib fractures. Abrasion of the deformed ribs was performed with good results. SSS as a cause of shoulder pain after thoracic trauma has to be considered and can be treated by a surgical abrasion technique. Copyright © 2017 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  10. Impact of Interactive Engagement on Reducing the Gender Gap in Quantum Physics Learning Outcomes among Senior Secondary School Students

    Science.gov (United States)

    Adegoke, Benson Adesina

    2012-01-01

    In this study, the author examines the extent to which an interactive engagement approach can reduce the gender gap in senior secondary school (SSS) (age 16-18 years) students' learning outcomes in quantum physics. One hundred and twenty one (male = 65; female = 56) SSS 3 students participated in this study. They were randomly selected from two…

  11. Relationships Between Dimensions of Anxiety and Sensation Seeking

    Science.gov (United States)

    Burkhart, Barry R.; And Others

    1978-01-01

    Undergraduates (130 males, 112 females) completed the Sensation Seeking Scale (SSS) and the S-R Inventory of General Trait Anxiousness (S-R GTA). The intercorrelations among the five scales from the SSS and the four scales from the S-R GTA were computed and compared. Findings were consistent with rational and theoretical notions. (Author)

  12. Social Support Seeking in Relation to Parental Attachment and Peer Relationships among Victims of Cyberbullying

    Science.gov (United States)

    Ševcíková, Anna; Machácková, Hana; Wright, Michelle F.; Dedková, Lenka; Cerná, Alena

    2015-01-01

    Victims use social support seeking (SSS) to buffer the negative effects of cyberbullying. It is unknown whether cybervictims' perceptions of harm and having poor peer and parental relationships influence SSS. Using a sample of 451 cyberbullying-victims, aged 12-18, 68% girls, this study examined relationships of gender, harm, peer rejection,…

  13. Low-Frequency Surface Backscattering Strengths Measured in the Critical Sea Test Experiments

    Science.gov (United States)

    2017-01-19

    same vessel over a 0.5- to 1-h period, where they exploded at depth, resulting in a bistatic source-receiver geometry. Spatially- Hammed beams with...CST-8 Run B18. 63 5. CROSS-RUN CST SSS EXAMPLES Fig. 5-1 − Cross-CST SUS SSS results at (a) 85 Hz and (b) 1360 Hz, color

  14. Precision transport of LHC superconducting magnet

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    These photos show tests of the first convoy with a prototype short straight section (SSS) quadrupole in the LHC tunnel. There is little free space in the tunnel as the SSS convoy passes alongside a dipole vacuum vessel. These convoys feature infrared guidance, which offsets the minimal clearance in the tunnel and limits vibration, both of which could damage the fragile magnets.

  15. Associations of subjective social status with accelerometer-based physical activity and sedentary time among adolescents.

    Science.gov (United States)

    Rajala, Katja; Kankaanpää, Anna; Laine, Kaarlo; Itkonen, Hannu; Goodman, Elizabeth; Tammelin, Tuija

    2018-06-11

    This study examined the associations of subjective social status (SSS) with physical activity (PA) and sedentary time (ST) among adolescents. The study population consisted of 420 Finnish adolescents aged 13 to 14 years. The adolescents reported their own SSS within their school (school SSS) and their family's social position within society (society SSS) based on the youth version of the Subjective Social Status Scale. Adolescents' moderate- to vigorous-intensity physical activity (MVPA) and ST were measured objectively by accelerometers and analyzed separately for the whole day and the school day. The associations between SSS and MVPA and ST outcomes were analyzed using multilevel modeling. School SSS was positively associated with whole-day MVPA and negatively associated with school-time ST. Society SSS was not significantly associated with objectively measured MVPA or ST. Both MVPA and ST are important behavioral determinants of health. As an important correlate of MVPA and ST, school SSS should be addressed by providers when discussing obesity risk and healthy behaviors with adolescents.

  16. The dural entrance of cerebral bridging veins into the superior sagittal sinus: an anatomical comparison between cadavers and digital subtraction angiography

    International Nuclear Information System (INIS)

    Han, Hui; Tao, Wei; Zhang, Ming

    2007-01-01

    Intracranial venous structures have received increasing attention due to improved neuroimaging techniques and increased awareness of cerebral venous disease. To date, few studies have attempted to investigate the dural entrance of the cerebral bridging vein (BV). The aim of this study was to use the superior sagittal sinus (SSS) as an example to identify anatomical features of the dural entrance of the BVs into the SSS in both human cadavers and digital subtraction angiography (DSA) images. A total of 30 adult and 7 fetal human cadavers and 36 patients were examined with anatomical dissections, vascular casting and DSA. The number, diameter and angle of the BVs entering the SSS were measured and compared between the cadavers and DSA images. The results demonstrated that (1) the way a BV entered the SSS varied in three dimensions, and thus the BV dural entrance was difficult to precisely localize by DSA, (2) the distribution pattern of the dural entrance of the BVs into the SSS was relatively constant and a nontributary segment of the SSS was centered at the coronal suture and was identifiable by DSA, and (3) nearly all the BVs (97%, 561/581) entered the SSS at an angle opposite to the direction of blood flow. Unique anatomical features of the dural entrance of a BV into the SSS should be considered in neuroimaging interpretation of the sinus and its associated veins. (orig.)

  17. Effects of complexity and intensity on sensory specific satiety and food acceptance after repeated consumption

    NARCIS (Netherlands)

    Weijzen, P.L.G.; Zandstra, E.H.; Graaf, de C.

    2008-01-01

    The objectives of the present work were (1) to study the effects of complexity and intensity of foods on sensory specific satiety (SSS) and their acceptance after repeated consumption, and (2) to determine the predictive value of SSS for acceptance over repeated consumption. Two studies were

  18. Transient reduction in theta power caused by interictal spikes in human temporal lobe epilepsy.

    Science.gov (United States)

    Manling Ge; Jundan Guo; Yangyang Xing; Zhiguo Feng; Weide Lu; Xinxin Ma; Yuehua Geng; Xin Zhang

    2017-07-01

    The inhibitory impacts of spikes on LFP theta rhythms(4-8Hz) are investigated around sporadic spikes(SSs) based on intracerebral EEG of 4 REM sleep patients with temporal lobe epilepsy(TLE) under the pre-surgical monitoring. Sequential interictal spikes in both genesis area and extended propagation pathway are collected, that, SSs genesis only in anterior hippocampus(aH)(possible propagation pathway in Entorhinal cortex(EC)), only in EC(possible propagation pathway in aH), and in both aH and EC synchronously. Instantaneous theta power was estimated by using Gabor wavelet transform, and theta power level was estimated by averaged over time and frequency before SSs(350ms pre-spike) and after SSs(350ms post-spike). The inhibitory effect around spikes was evaluated by the ratio of theta power level difference between pre-spike and post-spike to pre-spike theta power level. The findings were that theta power level was reduced across SSs, and the effects were more sever in the case of SSs in both aH and EC synchronously than either SSs only in EC or SSs only in aH. It is concluded that interictal spikes impair LFP theta rhythms transiently and directly. The work suggests that the reduction of theta power after the interictal spike might be an evaluation indicator of damage of epilepsy to human cognitive rhythms.

  19. Screening and identification of steroidal saponins from Anemarrhena asphodeloides employing UPLC tandem triple quadrupole linear ion trap mass spectrometry.

    Science.gov (United States)

    Xia, Yong-Gang; Guo, Xin-Dong; Liang, Jun; Yang, Bing-You; Kuang, Hai-Xue

    2017-09-01

    This study presents a practical and valid strategy for the screening and structural characterization of Anemarrhena asphodeloides Bge steroidal saponins (SSs) using ultra-high performance liquid chromatography coupled with triple quadrupole linear ion trap mass spectrometry. The whole analytical protocols integrate four-step procedures in the positive mode: (1) rational deduction of mass fragmentation pathways of A. asphodeloides SSs; (2) untargeted screening of potential A. asphodeloides SSs by multiple-ion monitoring-information-dependent-acquiring-enhanced product ion (MIM-IDA-EPI) scan through reverse phase liquid chromatography; (3) comprehensive construction of an ammoniated precursor ion database by combining untargeted MIM-IDA-EPI scans and data literature; and (4) structural interpretation of targeted A. asphodeloides SSs using MIM-IDA-EPI and multiple reaction monitoring (MRM)-IDA-EPI with an energy-resolved technique. The protocols were used to analyze SSs in A. asphodeloides; of the 87 detected SSs that were unambiguously characterized or tentatively identified, 19 compounds were the first to be reported from A. asphodeloides and 13 ones were characterized as potential new compounds. Accuracy of the analytical procedure was demonstrated by structural identification of three SSs by NMR spectroscopy. The proposed schemes hold an excellent promise in the structural prediction and interpretation of complex SSs from plant medicines by mass spectrometry. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Analysis of the competitive position of short sea shipping : Development of policy measures

    NARCIS (Netherlands)

    Peeters, C.; Verbeke, A.; Declercq, E.; Wijnolst, N.

    1995-01-01

    This study on the potentialof Short Sea Shipping (SSS) in Europe, with a focus on four corridors, consists of four parts. In the first part (Chapter I) the existing intra-European SSS-traffic is identified and analyzed for each relevant category of goods and transport corridor. In the second part

  1. One-Month to 10-Year Survival in the Copenhagen Stroke Study

    DEFF Research Database (Denmark)

    Andersen, Klaus Kaae; Olsen, Tom Skyhøj

    2011-01-01

    .0 years; 56% women; mean Scandinavian Stroke Scale [SSS], 38.0 ± 17.4). Evaluation included stroke severity (based on the SSS), computed tomography scan, and a cardiovascular risk profile. Using logistic regression models, we examined the relevance of the SSS on mortality at 1 month and 1, 5, and 10 years....... We analyzed the proportion of the variation explained by the models and bias of risk factors estimates with and without the SSS in the model. Mortality rate was 16.6% at 1 month, 31.5% at 1 year, 60.2% at 5 years, and 81.3% at 10 years. In models including the SSS, 22.4%, 20.9%, 32.8%, and 39.......5% of the variance was explained for the endpoints of 1 month, 1 year, 5 years, and 10 years, respectively. When SSS was left out of the model, the corresponding values were 6.9%, 13.3%, 29.0%, and 35.1%. Factors significantly associated with survival were SSS at 1 month; SSS, age, diabetes, and stroke type at 1...

  2. Sensory specific satiety and intake: The difference between nibble- and bar-size snacks

    NARCIS (Netherlands)

    Weijzen, P.L.G.; Liem, D.G.; Zandstra, E.H.; Graaf, de C.

    2008-01-01

    The present study investigated (1) whether consumption of a nibble-size snack, as compared to a bar-size snack, leads to more sensory specific satiety (SSS) and a lower intake; and (2) whether attention to consumption, as compared to usual consumption, leads to more SSS and a lower intake. Subjects

  3. Subjective Social Status and Positive Indicators of Well-Being among Emerging Adult College Students

    Science.gov (United States)

    Zorotovich, Jennifer; Johnson, Elizabeth I.; Linn, Rebekah

    2016-01-01

    The current study extends research on social status and well-being among young people by examining whether subjective social status (SSS) is related to life satisfaction and happiness. Emerging adults (n = 383) between 18 and 29 provided data on demographic characteristics, SSS, life satisfaction, and happiness via an online survey. Regression…

  4. Synaesthetic perception of colour and visual space in a blind subject: An fMRI case study

    NARCIS (Netherlands)

    Niccolai, V.; Leeuwen, T.M. van; Blakemore, C.; Störig, P.

    2012-01-01

    In spatial sequence synaesthesia (SSS) ordinal stimuli are perceived as arranged in peripersonal space. Using fMRI, we examined the neural bases of SSS and colour synaesthesia for spoken words in a late-blind synaesthete, JF. He reported days of the week and months of the year as both coloured and

  5. Subjective Social Status, Mental and Psychosocial Health, and Birth Weight Differences in Mexican-American and Mexican Immigrant Women.

    Science.gov (United States)

    Fleuriet, K Jill; Sunil, T S

    2015-12-01

    Recent Mexican immigrant women on average have an unexpectedly low incidence of low birth weight (LBW). Birth weights decline and LBW incidence increases in post-immigrant generations. This pilot project tested the hypothesis that subjective social status (SSS) of pregnant women predicts variation in birth weight between Mexican immigrant and Mexican-American women. 300 low-income pregnant Mexican immigrant and Mexican-American women in South Texas were surveyed for SSS, depression, pregnancy-related anxiety, perceived social stress and self-esteem and subsequent birth weight. No significant difference in SSS levels between pregnant Mexican immigrant and Mexican-American women were found. However, SSS better predicted variation in birth weight across both groups than mental and psychosocial health variables. Results suggest distinct relationships among SSS, mental and psychosocial health that could impact birth weight. They underscore the relevance of a multilevel, biopsychosocial analytical framework to studying LBW.

  6. Dysfunctional illness perception and illness behaviour associated with high somatic symptom severity and low quality of life in general hospital outpatients in China.

    Science.gov (United States)

    Zhang, Yaoyin; Fritzsche, Kurt; Leonhart, Rainer; Zhao, Xudong; Zhang, Lan; Wei, Jing; Yang, Jianzhong; Wirsching, Michael; Nater-Mewes, Ricarda; Larisch, Astrid; Schaefert, Rainer

    2014-09-01

    In primary care populations in Western countries, high somatic symptom severity (SSS) and low quality of life (QoL) are associated with adverse psychobehavioural characteristics. This study assessed the relationship between SSS, QoL and psychobehavioural characteristics in Chinese general hospital outpatients. This multicentre cross-sectional study enrolled 404 patients from 10 outpatient departments, including Neurology, Gastroenterology, Traditional Chinese Medicine [TCM] and Psychosomatic Medicine departments, in Beijing, Shanghai, Chengdu and Kunming. A structured interview was used to assess the cognitive, affective and behavioural features associated with somatic complaints, independent of their origin. Several standard instruments were used to assess SSS, emotional distress and health-related QoL. Patients who reported low SSS (PHQ-15Western countries, high SSS was associated with negative illness and self-perception, low physical QoL with avoidance behaviour, and low mental QoL with reassurance seeking in Chinese general hospital outpatients. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Acute MRI changes in progressive ischemic stroke

    DEFF Research Database (Denmark)

    Kalowska, E.; Rostrup, E.; Rosenbaum, S.

    2008-01-01

    as a permanent decrease of >or=3 Scandinavian Stroke Scale (SSS) points for speech or >or=2 SSS points for consciousness or >or=2 SSS points for limb strength, when assessed at baseline compared to the day after admission and daily during the following week. Patients were followed up on day 90 and assessed using...... the modified Rankin Scale, Barthel Index and SSS score. Patients with and without SIP were compared using both clinical and MRI data obtained on admission, on day 7 and after 3 months. RESULTS: Fifteen patients (37%) developed SIP. Increased DWI lesion volume on day 7 in all strokes was associated with SIP...... (chi(2), p = 0.005). All lacunar infarcts with a DWI volume >1.5 cm(3) at baseline (4 patients) developed SIP (p SSS scores with severer symptoms than non-SIP patients (p Udgivelsesdato: 2008...

  8. LA phonons scattering of surface electrons in Bi2Se3

    International Nuclear Information System (INIS)

    Huang, Lang-Tao; Zhu, Bang-Fen

    2013-01-01

    Within the Boltzmann equation formalism we evaluate the transport relaxation time of Dirac surface states (SSs) in the typical topological insulator(TI) Bi 2 Se 3 due to the phonon scattering. We find that although the back-scattering of the SSs in TIs is strictly forbidden, the in-plane scattering between SSs in 3-dimensional TIs is allowed, maximum around the right-angle scattering. Thus the topological property of the SSs only reduces the scattering rate to its one half approximately. Besides, the larger LA deformation potential and lower sound velocity of Bi 2 Se 3 enhance the scattering rate significantly. Compared with the Dirac electrons in graphene, we find the scattering rate of SSs in Bi 2 Se 3 are two orders of magnitudes larger, which agree with the recent transport experiments

  9. Tumor necrosis factor inhibitor therapy but not standard therapy is associated with resolution of erosion in the sacroiliac joints of patients with axial spondyloarthritis

    DEFF Research Database (Denmark)

    Pedersen, Susanne J; Wichuk, Stephanie; Chiowchanwisawakit, Praveena

    2014-01-01

    Research Consortium of Canada (SPARCC) MRI Sacroiliac Joint (SIJ) Structural Score (SSS) assesses a spectrum of structural lesions (erosion, fat metaplasia, backfill, ankylosis) and its potential to discriminate between therapies requires evaluation. METHODS: The SSS score assesses five consecutive coronal...... (ANOVA), discrimination was assessed using Guyatt's effect size, and treatment group differences were assessed using t-tests and the Mann-Whitney test. We identified baseline demographic and structural damage variables associated with change in SSS score by univariate analysis and analyzed the effect...... of treatment by multivariate stepwise regression adjusted for severity of baseline structural damage and demographic variables. RESULTS: A significant increase in mean SSS score for fat metaplasia (P = 0.017) and decrease in mean SSS score for erosion (P = 0.017) was noted in anti-TNFα treated patients...

  10. LA phonons scattering of surface electrons in Bi{sub 2}Se{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Lang-Tao [State Key Laboratory of Low-Dimensional Quantum Physics, Department of Physics, Tsinghua University, Beijing 100084 (China); Zhu, Bang-Fen [State Key Laboratory of Low-Dimensional Quantum Physics, Department of Physics, Tsinghua University, Beijing 100084, China and Institute of Advanced Study, Tsinghua University, Beijing 100084 (China)

    2013-12-04

    Within the Boltzmann equation formalism we evaluate the transport relaxation time of Dirac surface states (SSs) in the typical topological insulator(TI) Bi{sub 2}Se{sub 3} due to the phonon scattering. We find that although the back-scattering of the SSs in TIs is strictly forbidden, the in-plane scattering between SSs in 3-dimensional TIs is allowed, maximum around the right-angle scattering. Thus the topological property of the SSs only reduces the scattering rate to its one half approximately. Besides, the larger LA deformation potential and lower sound velocity of Bi{sub 2}Se{sub 3} enhance the scattering rate significantly. Compared with the Dirac electrons in graphene, we find the scattering rate of SSs in Bi{sub 2}Se{sub 3} are two orders of magnitudes larger, which agree with the recent transport experiments.

  11. A System for Series Magnetic Measurements of the LHC Main Quadrupoles

    CERN Document Server

    Smirnov, N; Chiusano, F; Dunkel, O; Legrand, P; Schloss, S; Schnizer, P; Sievers, P

    2002-01-01

    More than 400 twin aperture lattice quadrupoles are needed for the Large Hadron Collider (LHC) which is under construction at CERN. The main quadrupole is assembled with correction magnets in a common cryostat called the Short Straight Section (SSS). We plan to measure all SSS's in cold conditions with an unprecedented accuracy: integrated gradient of the field within 150 ppm, harmonics in a range of 1 to 5 ppm, magnetic axis of all elements within 0.1 mm and their field direction within 0.2 mrad. In this paper we describe the automatic measurement system that we have designed, built and calibrated. Based on the results obtained on the two first prototypes of the SSS's (SSS3 and SSS4) we show that this system meets all above requirements.

  12. Hourly changes in sea surface salinity in coastal waters recorded by Geostationary Ocean Color Imager

    Science.gov (United States)

    Liu, Rongjie; Zhang, Jie; Yao, Haiyan; Cui, Tingwei; Wang, Ning; Zhang, Yi; Wu, Lingjuan; An, Jubai

    2017-09-01

    In this study, we monitored hourly changes in sea surface salinity (SSS) in turbid coastal waters from geostationary satellite ocean color images for the first time, using the Bohai Sea as a case study. We developed a simple multi-linear statistical regression model to retrieve SSS data from Geostationary Ocean Color Imager (GOCI) based on an in situ satellite matched-up dataset (R2 = 0.795; N = 41; Range: 26.4 to 31.9 psμ). The model was then validated using independent continuous SSS measurements from buoys, with the average percentage difference of 0.65%. The model was applied to GOCI images from the dry season during an astronomical tide to characterize hourly changes in SSS in the Bohai Sea. We found that the model provided reasonable estimates of the hourly changes in SSS and that trends in the modeled and measured data were similar in magnitude and direction (0.43 vs 0.33 psμ, R2 = 0.51). There were clear diurnal variations in the SSS of the Bohai Sea, with a regional average of 0.455 ± 0.079 psμ (0.02-3.77 psμ). The magnitude of the diurnal variations in SSS varied spatially, with large diurnal variability in the nearshore, particularly in the estuary, and small variability in the offshore area. The model for the riverine area was based on the inverse correlation between SSS and CDOM absorption. In the offshore area, the water mass of the North Yellow Sea, characterized by high SSS and low CDOM concentrations, dominated. Analysis of the driving mechanisms showed that the tidal current was the main control on hourly changes in SSS in the Bohai Sea.

  13. NEIL2 protects against oxidative DNA damage induced by sidestream smoke in human cells.

    Directory of Open Access Journals (Sweden)

    Altaf H Sarker

    Full Text Available Secondhand smoke (SHS is a confirmed lung carcinogen that introduces thousands of toxic chemicals into the lungs. SHS contains chemicals that have been implicated in causing oxidative DNA damage in the airway epithelium. Although DNA repair is considered a key defensive mechanism against various environmental attacks, such as cigarette smoking, the associations of individual repair enzymes with susceptibility to lung cancer are largely unknown. This study investigated the role of NEIL2, a DNA glycosylase excising oxidative base lesions, in human lung cells treated with sidestream smoke (SSS, the main component of SHS. To do so, we generated NEIL2 knockdown cells using siRNA-technology and exposed them to SSS-laden medium. Representative SSS chemical compounds in the medium were analyzed by mass spectrometry. An increased production of reactive oxygen species (ROS in SSS-exposed cells was detected through the fluorescent detection and the induction of HIF-1α. The long amplicon-quantitative PCR (LA-QPCR assay detected significant dose-dependent increases of oxidative DNA damage in the HPRT gene of cultured human pulmonary fibroblasts (hPF and BEAS-2B epithelial cells exposed to SSS for 24 h. These data suggest that SSS exposure increased oxidative stress, which could contribute to SSS-mediated toxicity. siRNA knockdown of NEIL2 in hPF and HEK 293 cells exposed to SSS for 24 h resulted in significantly more oxidative DNA damage in HPRT and POLB than in cells with control siRNA. Taken together, our data strongly suggest that decreased repair of oxidative DNA base lesions due to an impaired NEIL2 expression in non-smokers exposed to SSS would lead to accumulation of mutations in genomic DNA of lung cells over time, thus contributing to the onset of SSS-induced lung cancer.

  14. Meibomian Gland Dysfunction in Primary and Secondary Sjögren Syndrome.

    Science.gov (United States)

    Sullivan, David A; Dana, Reza; Sullivan, Rose M; Krenzer, Kathleen L; Sahin, Afsun; Arica, Beril; Liu, Yang; Kam, Wendy R; Papas, Athena S; Cermak, Jennifer M

    2018-01-01

    We hypothesized that women with primary (pSS) and secondary Sjögren syndrome (sSS; with systemic lupus erythematosus [SLE] or rheumatoid arthritis [RA]) have meibomian gland dysfunction (MGD). We sought to test our hypothesis. Subjects with pSS, sSS + SLE, sSS + RA, and non-SS-related MGD were recruited from the Sjögren's Syndrome Foundation or outpatient clinics at Tufts University School of Dental Medicine or Brigham and Women's Hospital. The control population was recruited from the Greater Boston area. After providing written informed consent, the subjects underwent an eye examination and/or completed two questionnaires that assess symptoms of dry eye disease (DED). Our results demonstrate that pSS and sSS patients have MGD. These subjects had meibomian gland orifice metaplasia, an increased number of occluded meibomian gland orifices, and a reduced quality of meibomian gland secretions. Further, patients with pSS, sSS + SLE, sSS + RA, and MGD had significant alterations in their tear film, lid margin, cornea, and conjunctiva. Symptoms of DED were increased ∼10-fold in all pSS, sSS, and MGD groups relative to controls. Our findings support our hypothesis and show that individuals with pSS, sSS + SLE, and sSS + RA have MGD. In addition, our study indicates that patients with pSS and sSS have both aqueous-deficient and evaporative DED. © 2018 S. Karger AG, Basel.

  15. Sibelius: Der Sturm, Op. 109, Neeme Järvi / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1990-01-01

    Uuest heliplaadist "Sibelius: Der Sturm, Op. 109, (Vorspiel und Konzertsuiten zu Shakespeares Drama), Cassazione, Op.6, Preludio, Tiera. Sinfonieorchester Göteborg, Neeme Järvi". BIS/ Disco-Center CD 448 71'43") DDD

  16. Pärt, Arvo: Seven Magnificat Antiphons / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Seven Magnificat Antiphons. Magnificat. Summa; Tormis, Veljo: The Curse Upon Iron. Karelian Destiny. BBC Singers, Bo Holton". Collins Classics 1472-2 (61 minutes: DDD)

  17. Pärt: Berliner Messe / Rob Cowan

    Index Scriptorium Estoniae

    Cowan, Rob

    1998-01-01

    Uuest heliplaadist "Pärt: Berliner Messe. The Beatitudes. Annum per Annum. Magnificat. Seven Magnificat Antiphons. De profundis. Polyphony / Steven Layton with Andrew Lucas" Hyperion CDA66960 (74 minutes:DDD)

  18. Prognosis of intervertebral disc loss from diagnosis of degenerative disc disease

    Science.gov (United States)

    Li, S.; Lin, A.; Tay, K.; Romano, W.; Osman, Said

    2015-03-01

    Degenerative Disc Disease (DDD) is one of the most common causes of low back pain, and is a major factor in limiting the quality of life of an individual usually as they enter older stages of life, the disc degeneration reduces the shock absorption available which in turn causes pain. Disc loss is one of the central processes in the pathogenesis of DDD. In this study, we investigated whether the image texture features quantified from magnetic resonance imaging (MRI) could be appropriate markers for diagnosis of DDD and prognosis of inter-vertebral disc loss. The main objective is to use simple image based biomarkers to perform prognosis of spinal diseases using non-invasive procedures. Our results from 65 subjects proved the higher success rates of the combination marker compared to the individual markers and in the future, we will extend the study to other spine regions to allow prognosis and diagnosis of DDD for a wider region.

  19. Bartok: Concerto for Orchestra Sz 116 / Edward Seckerson

    Index Scriptorium Estoniae

    Seckerson, Edward

    1992-01-01

    Uuest heliplaadist "Bartok: Concerto for Orchestra Sz 116; Enescu: Romanian Rhapsodies Op. 11-No. 1 in A major No. 2 in D major. Royal Scottish Orchestra / Neeme Järvi" Chandos CHAN8947 (66 minutes:DDD)

  20. Prokofiev: Cantata for the 20th Anniversary of the October Revolution / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1993-01-01

    Uuest heliplaadist "Prokofiev: Cantata for the 20th Anniversary of the October Revolution, Op. 74 a. The Tale of the Stone Flower - experts. Philharmonia Chorus and Orchestra / Neeme Järvi" Chandos ABTD 1597; CHAN9095 (75 minutes:DDD)

  1. Pärt, Arvo: Litany. Psalom. Trisagion / Robert Cowan

    Index Scriptorium Estoniae

    Cowan, Robert

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Litany. Psalom. Trisagion. Hilliard Ensemble, Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste; Lithuanian Chamber Orchestra, Saulius Sondeckis" ECM New Series 449 810-4; 449 810-2 (42 minutes: DDD)

  2. Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion. Crystallisatio. Requiem. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste. ECM New Series 449 459-2 (64 minutes: DDD)

  3. Stravinsky: The Rite of Spring / Hartmut, Lück

    Index Scriptorium Estoniae

    Lück, Hartmut

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum Sacrum. Requiem Canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi. Chandos CHAN 9408 (75 minutes:DDD)

  4. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  5. Pärt: Fratres in sechs Versionen. Festina lente. Summa / C. S.

    Index Scriptorium Estoniae

    C. S.

    1997-01-01

    Uuest heliplaadist "Pärt: Fratres in sechs Versionen. Festina lente. Summa. Cantus in memoriam Benjamin Britten. Orchester der Ungarischen Staatsoper, Tamas Benedek". Naxos CD 8 553 750 (WD:79'06") DDD

  6. Bernstein: Prelude, Fugue and Riffs / Edward Greenfield

    Index Scriptorium Estoniae

    Greenfield, Edward

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi. Virgin Classics VC5 45295-2 (68 minutes:DDD)

  7. Bernstein: Prelude, Fugue and Riffs / Michel Parouty

    Index Scriptorium Estoniae

    Parouty, Michel

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi" Virgin Classics VC5 45295-2 (68 minutes:DDD)

  8. Chopin: Concerto for piano and orchestra No. 2 in F minor / Christopher Headington

    Index Scriptorium Estoniae

    Headington, Christopher

    1992-01-01

    Uuest heliplaadist "Chopin: Concerto for piano and orchestra No. 2 in F minor, Op. 21; Schumann: Concerto for piano and orchestra in A minor Op. 54. Philharmonia Orchestra, Neeme Järvi". Chandos CHAN9061 (62 minutes:DDD)

  9. Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1991-01-01

    Uuest heliplaadist "Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble, Gothenburg Pro Musica Chamber Choir and Symphony Orchestra, Neeme Järvi" DG CD 431 669-2 GH2 (two discs, nas:118 minutes:DDD)

  10. Prokofiev: War and Peace - Symphonic Suite (arr. Palmer) / Ivan March

    Index Scriptorium Estoniae

    March, Ivan

    1993-01-01

    Uuest heliplaadist "Prokofiev: War and Peace - Symphonic Suite (arr. Palmer), Summer Night, Op. 123. Russian Overture, Op. 72. Philharmonia Orchestra / Neeme Järvi. Chandos ABTD 1598 CHAN9096 (64 minutes:DDD) Igor - Polovtsian Dances

  11. Various / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Various. John Keys (organ), Andrew Angus (bass). Vasari Singers / Jeremy Backhouse". EMI Eminence 7243 5 65 903 2. 74:09 DDD. Plaadil ka A. Pärdi "Summa", "The Beautitudes", "Seven Magnificat Antiphons"

  12. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  13. Pärt, Arvo: "Summa". Collage sur BACH. Fratres / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: "Summa". Collage sur BACH. Fratres. Cantus in Memoriam Benjamin Britten. Summa. Festina Lente. Tabula rasa. Tapiola Sinfonietta / Jean-Jacques Kantorow". BIS-CD-834. 62:30 DDD

  14. Stravinsky: The Rite of Spring. Canticum sacrum

    Index Scriptorium Estoniae

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum sacrum. Requiem canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi" Chandos CHAN 9408 (75 minutes:DDD)

  15. Raid, Kaljo: Symphony No. 2, "Stockholm" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Raid, Kaljo: Symphony No. 2, "Stockholm"; Tubin, Eduard: Elegy for Strings (arr. Raid). Symphony No. 11 (orch. Raid). Estonian State Symphony Orchestra, Arvo Volmer". Koch International Classics 37291-2 (48 minutes:DDD)

  16. Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter

    1990-01-01

    Uuest heliplaadist "Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris, Die Zeder und die Palme. Scottish National Orchestra, Neeme Järvi" (AD: 1989) Chandos / Koch Records CD 8805 (WD: 59'40") DDD

  17. Bartok: Der holzgeschnitzte Prinz / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1991-01-01

    Uuest heliplaadist "Bartok: Der holzgeschnitzte Prinz [The Wooden Prince complete ballet] op. 13. Ungarische Bilder [Hungarian Pictures]. Philharmonia Orchestra [The Philharmonia] Neeme Järvi". Chandos/Koch Records CD 8895 (WD:65'51") DDD

  18. Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra, Neeme Järvi / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra / Neeme Järvi. Deutsche Grammophon 453 426-2; 70:37 DDD

  19. Scatter Correction with Combined Single-Scatter Simulation and Monte Carlo Simulation Scaling Improved the Visual Artifacts and Quantification in 3-Dimensional Brain PET/CT Imaging with 15O-Gas Inhalation.

    Science.gov (United States)

    Magota, Keiichi; Shiga, Tohru; Asano, Yukari; Shinyama, Daiki; Ye, Jinghan; Perkins, Amy E; Maniawski, Piotr J; Toyonaga, Takuya; Kobayashi, Kentaro; Hirata, Kenji; Katoh, Chietsugu; Hattori, Naoya; Tamaki, Nagara

    2017-12-01

    In 3-dimensional PET/CT imaging of the brain with 15 O-gas inhalation, high radioactivity in the face mask creates cold artifacts and affects the quantitative accuracy when scatter is corrected by conventional methods (e.g., single-scatter simulation [SSS] with tail-fitting scaling [TFS-SSS]). Here we examined the validity of a newly developed scatter-correction method that combines SSS with a scaling factor calculated by Monte Carlo simulation (MCS-SSS). Methods: We performed phantom experiments and patient studies. In the phantom experiments, a plastic bottle simulating a face mask was attached to a cylindric phantom simulating the brain. The cylindric phantom was filled with 18 F-FDG solution (3.8-7.0 kBq/mL). The bottle was filled with nonradioactive air or various levels of 18 F-FDG (0-170 kBq/mL). Images were corrected either by TFS-SSS or MCS-SSS using the CT data of the bottle filled with nonradioactive air. We compared the image activity concentration in the cylindric phantom with the true activity concentration. We also performed 15 O-gas brain PET based on the steady-state method on patients with cerebrovascular disease to obtain quantitative images of cerebral blood flow and oxygen metabolism. Results: In the phantom experiments, a cold artifact was observed immediately next to the bottle on TFS-SSS images, where the image activity concentrations in the cylindric phantom were underestimated by 18%, 36%, and 70% at the bottle radioactivity levels of 2.4, 5.1, and 9.7 kBq/mL, respectively. At higher bottle radioactivity, the image activity concentrations in the cylindric phantom were greater than 98% underestimated. For the MCS-SSS, in contrast, the error was within 5% at each bottle radioactivity level, although the image generated slight high-activity artifacts around the bottle when the bottle contained significantly high radioactivity. In the patient imaging with 15 O 2 and C 15 O 2 inhalation, cold artifacts were observed on TFS-SSS images, whereas

  20. Trendy ve spotřebě léčiv z ATC skupiny A10 za období 2005-2009: porovnání situace v České a Slovenské republice

    OpenAIRE

    Písaříková, Zuzana

    2009-01-01

    This thesis describes a methodology for expressing the consumption of drugs, a system of ATC/DDD, ATC classification and DDD recommended daily dose assigment. It acquaints readers with the most appropriate data source for consumption determining and also inform about diabetes mellitus. This involves also recommended standards of medical care in diabetes by the Czech Diabetes Association, with which is comparethe actual consumption of drugs in the Czech Republic and Slovakia at the conclusion....

  1. [Variations in antihypertensive drug utilization among primary care areas in the autonomous region of Valencia (Spain)].

    Science.gov (United States)

    Sanfélix-Gimeno, Gabriel; Peiró, Salvador; Librero, Julián

    2010-01-01

    To estimate consumption of five subgroups of antihypertensive drugs by primary care areas and to analyze its variation. We performed an ecological, descriptive study of antihypertensive consumption in 239 primary care areas in the autonomous region of Valencia in 2005 followed by analysis of the variability observed. The 239 primary care areas were studied by descriptive analysis of dispensation [defined daily dose (DDD) per 1,000 inhabitants/day in pensioners (DDD/1000p/day) and in the active population (DDD/1000a/day)] and standardized consumption ratios. Small-area variation analysis was used to analyze the observed variability. Associations among dispensations of the distinct therapeutic subgroups were also analyzed. Overall antihypertensive use in the autonomous region of Valencia in 2005 was 235.6DDD/1000/day. This consumption was concentrated in pensioners (800DDD/1000p/day vs. 73DDD/1000a/day). Consumption of antihypertensive subgroups oscillated from 442DDD/1000p/day for drugs with action on the renin-angiotensin system to 32DDD/1000p/day for doxazosin. The active population showed similar patterns. Variation in consumption was moderate, with coefficients of variation from 0.20 to 0.40 (slightly greater for the active population). Associations among dispensations of the different therapeutic subgroups were strong. This study shows major variations in the overall consumption of antihypertensive drugs among primary care areas of the autonomous region of Valencia. These results suggest that variation may be associated with problems of underutilization in areas with lower consumption. Copyright © 2010 SESPAS. Published by Elsevier Espana. All rights reserved.

  2. Elucidating Turnover Pathways of Bioactive Small Molecules by Isotopomer Analysis: The Persistent Organic Pollutant DDT

    Science.gov (United States)

    Ehlers, Ina; Betson, Tatiana R.; Vetter, Walter; Schleucher, Jürgen

    2014-01-01

    The persistent organic pollutant DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane) is still indispensable in the fight against malaria, although DDT and related compounds pose toxicological hazards. Technical DDT contains the dichloro congener DDD (1-chloro-4-[2,2-dichloro-1-(4-chlorophenyl)ethyl]benzene) as by-product, but DDD is also formed by reductive degradation of DDT in the environment. To differentiate between DDD formation pathways, we applied deuterium NMR spectroscopy to measure intramolecular deuterium distributions (2H isotopomer abundances) of DDT and DDD. DDD formed in the technical DDT synthesis was strongly deuterium-enriched at one intramolecular position, which we traced back to 2H/1H fractionation of a chlorination step in the technical synthesis. In contrast, DDD formed by reductive degradation was strongly depleted at the same position, which was due to the incorporation of 2H-depleted hydride equivalents during reductive degradation. Thus, intramolecular isotope distributions give mechanistic information on reaction pathways, and explain a puzzling difference in the whole-molecule 2H/1H ratio between DDT and DDD. In general, our results highlight that intramolecular isotope distributions are essential to interpret whole-molecule isotope ratios. Intramolecular isotope information allows distinguishing pathways of DDD formation, which is important to identify polluters or to assess DDT turnover in the environment. Because intramolecular isotope data directly reflect isotope fractionation of individual chemical reactions, they are broadly applicable to elucidate transformation pathways of small bioactive molecules in chemistry, physiology and environmental science. PMID:25350380

  3. Gaas Displacement Damage Dosimeter Based on Diode Dark Currents

    Directory of Open Access Journals (Sweden)

    Warner Jeffrey H.

    2017-01-01

    Full Text Available GaAs diode dark currents are correlated over a very large proton energy range as a function of displacement damage dose (DDD. The linearity of the dark current increase with DDD over a wide range of applied voltage bias deems this device an excellent candidate for a displacement damage dosimeter. Additional proton testing performed in situ enabled error estimate determination to within 10% for simulated space use.

  4. Twenty-year trends in benzodiazepine dispensing in the Australian population.

    Science.gov (United States)

    Islam, M M; Conigrave, K M; Day, C A; Nguyen, Y; Haber, P S

    2014-01-01

    Considerable concern has been expressed about overprescribing of benzodiazepines and related harms. Past analyses have relied on World Health Organization-defined daily doses (DDD) which are sometimes out of keeping with clinical usage. This study examines 20-year (1992-2011) trends of benzodiazepine dispensing in Australia using both DDD and Ashton equivalent dose. Data from the Drug Utilisation Sub-Committee and the Pharmaceutical Benefits Scheme (PBS) website were analysed. Trends in number of prescriptions, DDD/1000 people/day and DDD/prescription were examined over time, and between states/territories. In the 20-year period, 174 080 904 scripts were recorded, with temazepam the most dispensed benzodiazepine (35% of scripts), followed by diazepam (23%). Overall recorded utilisation fell from 27.7 DDD/1000 people/day in 1992 to 20.8 in 2011 (24.9% decrease). There were striking changes in use of individual benzodiazepines over time, with reductions in oxazepam and flunitrazepam and dramatic increases in alprazolam. Since 1998, there has been a steady increase, albeit modest, in per script DDD. The DDD/1000 people/day for items dispensed through PBS/Repatriaton-PBS was highest in Tasmania and lowest in Northern Territory. Despite a modest overall decline in the amount of benzodiazepine dispensed, the level of use is still likely to reflect relative over-prescribing given the paucity of accepted indications for long-term use. Since 1998, there was a polynomial increase in quantity dispensed per script. The WHO-defined DDD for clonazepam seems inappropriate and could impede monitoring of its abuse. Other problems include lack of national data for medications not subsidised on PBS/Repatriation PBS. A broad policy approach is required, not one which targets only one particular benzodiazepine. © 2013 The Authors; Internal Medicine Journal © 2013 Royal Australasian College of Physicians.

  5. Does football cause an increase in degenerative disease of the lumbar spine?

    Science.gov (United States)

    Gerbino, Peter G; d'Hemecourt, Pierre A

    2002-02-01

    Degenerative disease of the lumbar spine is exceedingly common. Whether any specific activity increases the likelihood of developing degenerative disc disease (DDD) or facet degeneration (FD) has enormous implications. Within the field of occupational medicine there are specific activities, occupations, and morphologic characteristics that have been related to low back pain. Several specific risk factors have been conclusively linked to low back pain, and in particular DDD and FD. Within the sport of American football, there has long been the feeling that many athletes have or will develop low back pain, DDD, and FD. Proving that certain risk factors present in football will predictably lead to an increase in LBP, DDD, and FD is more difficult. At this time, it can be said that football players, in general, increase their risk of developing low back pain, DDD, and FD as their years of involvement with their sport increase. Because specific spine injuries like fracture, disc herniation, and spondylolysis are more frequent in football players, the resulting DDD and FD are greater than that of the general population. The weightlifting and violent hyperextension that are part of American football are independent risk factors for degenerative spine disease.

  6. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram.

    Science.gov (United States)

    Wu, Chung Kit; Tsang, Kim Fung; Chi, Hao Ran; Hung, Faan Hei

    2016-05-09

    Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD) systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG) is a proven biosignal that accurately and simultaneously reflects human's biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD) using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  7. Pengembangan Media Pembelajaran Fisika Menggunakan Lectora Inspire pada Materi Usaha dan Energi SMA

    Directory of Open Access Journals (Sweden)

    Inggrid Ayu Putri

    2016-12-01

    Full Text Available Abstract The development of instructional media aims to help students to do independent learning outside the classroom but still under the supervision of teachers. This study uses Research and Development (R & D DDD-E type developed by Ivers and Barron. The steps of DDD-E developing method method consist of Decide, Design, Develop, and Evaluate. Decide is determination of the project objectives, design determines the structure of the media contents to be developed, develop step is developing a media that is already planned. The evaluation exist on DDD steps, so the instructional media can be controlled. The software used in this research is Lectora Inspire. Lectora Inspire used on this research because the software user friendly or easy to use. Keywords: Lectora Inspire, media, work, energy Abstrak Pengembangan media pembelajaran ini bertujuan untuk membantu siswa dalam melakukan pembelajaran mandiri diluar kelas tetapi masih dalam pengawasan guru. Penelitian ini menggunakan metode penelitian dan pengembangan atau Research and Development (R&D tipe DDD-E yang dikembangkan oleh Ivers dan Barron. Langkah – langkah metode pengembangan DDD-E terdiri dari tahap decide, yaitu penentuan tujuan proyek, design, yaitu menentukan struktur isi dari media yang akan dikembangkan, develop adalah tahap untuk mengembangkan media pembelajaran yang sudah direncanakan. Tahap Evaluate adalah tahap evaluasi pengembangan media, dimana langkah ini terdapat pada seluruh tahapan DDD. Perangkat lunak yang digunakan adalah Lectora Inspire. Software ini dipilih karena langkah penggunaan yang user friendly atau mudah digunakan. Kata-kata kunci:Lectora Inspire, media, usaha, energi

  8. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram

    Directory of Open Access Journals (Sweden)

    Chung Kit Wu

    2016-05-01

    Full Text Available Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG is a proven biosignal that accurately and simultaneously reflects human’s biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  9. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    Directory of Open Access Journals (Sweden)

    Rosemary Hiscock

    2015-12-01

    Full Text Available The UK Stop Smoking Services (SSS are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883 and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801. SSS monitoring data suggested 2% of clients were using e-cigarettes to quit with SSS and that clients using e-cigarettes had similar quit rates to clients using Varenicline. Most SSS personnel are waiting for licenced e-cigarettes to become available before they will recommend them to clients. However, less than a quarter view e-cigarettes as “a good thing”. Managers and commissioners were more positive than practitioners. SSS personnel working for the NHS (hospitals and GP surgeries were less positive about e-cigarettes than those employed elsewhere. E-cigarettes were cited as the most important reason for the recent decline in service footfall. Thus dissemination of information about e-cigarettes needs to be examined and services should address their stance on e-cigarettes with some urgency.

  10. Improving SMOS Sea Surface Salinity in the Western Mediterranean Sea through Multivariate and Multifractal Analysis

    Directory of Open Access Journals (Sweden)

    Estrella Olmedo

    2018-03-01

    Full Text Available A new methodology using a combination of debiased non-Bayesian retrieval, DINEOF (Data Interpolating Empirical Orthogonal Functions and multifractal fusion has been used to obtain Soil Moisture and Ocean Salinity (SMOS Sea Surface Salinity (SSS fields over the North Atlantic Ocean and the Mediterranean Sea. The debiased non-Bayesian retrieval mitigates the systematic errors produced by the contamination of the land over the sea. In addition, this retrieval improves the coverage by means of multiyear statistical filtering criteria. This methodology allows obtaining SMOS SSS fields in the Mediterranean Sea. However, the resulting SSS suffers from a seasonal (and other time-dependent bias. This time-dependent bias has been characterized by means of specific Empirical Orthogonal Functions (EOFs. Finally, high resolution Sea Surface Temperature (OSTIA SST maps have been used for improving the spatial and temporal resolution of the SMOS SSS maps. The presented methodology practically reduces the error of the SMOS SSS in the Mediterranean Sea by half. As a result, the SSS dynamics described by the new SMOS maps in the Algerian Basin and the Balearic Front agrees with the one described by in situ SSS, and the mesoscale structures described by SMOS in the Alboran Sea and in the Gulf of Lion coincide with the ones described by the high resolution remotely-sensed SST images (AVHRR.

  11. The Impact of the Assimilation of Aquarius Sea Surface Salinity Data in the GEOS Ocean Data Assimilation System

    Science.gov (United States)

    Vernieres, Guillaume Rene Jean; Kovach, Robin M.; Keppenne, Christian L.; Akella, Santharam; Brucker, Ludovic; Dinnat, Emmanuel Phillippe

    2014-01-01

    Ocean salinity and temperature differences drive thermohaline circulations. These properties also play a key role in the ocean-atmosphere coupling. With the availability of L-band space-borne observations, it becomes possible to provide global scale sea surface salinity (SSS) distribution. This study analyzes globally the along-track (Level 2) Aquarius SSS retrievals obtained using both passive and active L-band observations. Aquarius alongtrack retrieved SSS are assimilated into the ocean data assimilation component of Version 5 of the Goddard Earth Observing System (GEOS-5) assimilation and forecast model. We present a methodology to correct the large biases and errors apparent in Version 2.0 of the Aquarius SSS retrieval algorithm and map the observed Aquarius SSS retrieval into the ocean models bulk salinity in the topmost layer. The impact of the assimilation of the corrected SSS on the salinity analysis is evaluated by comparisons with insitu salinity observations from Argo. The results show a significant reduction of the global biases and RMS of observations-minus-forecast differences at in-situ locations. The most striking results are found in the tropics and southern latitudes. Our results highlight the complementary role and problems that arise during the assimilation of salinity information from in-situ (Argo) and space-borne surface (SSS) observations

  12. Comparison of Tear Osmolarity in Rheumatoid Arthritis Patients With and Without Secondary Sjogren Syndrome.

    Science.gov (United States)

    Ng, Alex L K; Choy, Bonnie N K; Chan, Tommy C Y; Wong, Ian Y H; Lai, Jimmy S M; Mok, Mo Yin

    2017-07-01

    To compare tear osmolarity (TO) and other dry eye parameters in rheumatoid arthritis (RA) patients with or without secondary Sjogren syndrome (sSS). Consecutive patients with RA were divided into a sSS group and no-sSS group using conventional diagnostic criteria by rheumatologists using symptomatology, Schirmer test score, and anti-Ro or anti-La autoantibody status. The TO, Ocular Surface Disease Index, dry eye disease (DED) parameters [such as tear breakup time (TBUT) and corneal staining score] and the systemic inflammatory markers [erythrocyte sedimentation rate (ESR) and C-reactive protein (CRP)] were compared. Correlation analyses between TO and the DED parameters and inflammatory markers were also performed. A total of 42 cases with mean age 54.8 ± 12.3 were included, with 12 patients (29%) having sSS and 30 (71%) without sSS. TO was increased in both groups (329 ± 20 and 319 ± 25 mOsm/L, respectively), but no statistically significant difference was found between the 2 groups (P = 0.126). RA with sSS had significantly shorter TBUT, higher corneal staining score, and ESR CRP levels (P sSS. There was no significant correlation between TO and the Schirmer test score, and the physician could not use TO to diagnose sSS. However, TO correlated well with both DED parameters (TBUT and corneal staining score) and systemic inflammatory markers (ESR and CRP).

  13. Impacts of sea-surface salinity in an eddy-resolving semi-global OGCM

    Science.gov (United States)

    Furue, Ryo; Takatama, Kohei; Sasaki, Hideharu; Schneider, Niklas; Nonaka, Masami; Taguchi, Bunmei

    2018-02-01

    To explore the impacts of sea-surface salinity (SSS) on the interannual variability of upper-ocean state, we compare two 10-year runs of an eddy-resolving ocean general circulation model (OGCM): in one, SSS is strongly restored toward a monthly climatology (World Ocean Atlas '98) and in the other, toward the SSS of a monthly gridded Argo product. The inclusion of the Argo SSS generally improves the interannual variability of the mixed layer depth; particularly so in the western tropical Pacific, where so-called "barrier layers" are reproduced when the Argo SSS is included. The upper-ocean subsurface salinity variability is also improved in the tropics and subtropics even below the mixed layer. To understand the reason for the latter improvement, we separate the salinity difference between the two runs into its "dynamical" and "spiciness" components. The dynamical component is dominated by small-scale noise due to the chaotic nature of mesoscale eddies. The spiciness difference indicates that as expected from the upper-ocean general circulation, SSS variability in the mixed layer is subducted into the thermocline in subtropics; this signal is generally advected downward, equatorward, and westward in the equator-side of the subtropical gyre. The SSS signal subducted in the subtropical North Pacific appears to enter the Indian Ocean through the Indonesian Throughflow, although this signal is weak and probably insignificant in our model.

  14. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    Science.gov (United States)

    Hiscock, Rosemary; Bauld, Linda; Arnott, Deborah; Dockrell, Martin; Ross, Louise; McEwen, Andy

    2015-12-21

    The UK Stop Smoking Services (SSS) are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883) and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801). SSS monitoring data suggested 2% of clients were using e-cigarettes to quit with SSS and that clients using e-cigarettes had similar quit rates to clients using Varenicline. Most SSS personnel are waiting for licenced e-cigarettes to become available before they will recommend them to clients. However, less than a quarter view e-cigarettes as "a good thing". Managers and commissioners were more positive than practitioners. SSS personnel working for the NHS (hospitals and GP surgeries) were less positive about e-cigarettes than those employed elsewhere. E-cigarettes were cited as the most important reason for the recent decline in service footfall. Thus dissemination of information about e-cigarettes needs to be examined and services should address their stance on e-cigarettes with some urgency.

  15. Sexual self-schema and depressive symptoms after prostate cancer.

    Science.gov (United States)

    Hoyt, Michael A; Carpenter, Kristen M

    2015-04-01

    The years following prostate cancer treatment are characterized by changes in sexual functioning and risk for depressive symptoms. Sexual self-schema (SSS) is a cognitive generalization about sexual aspects of the self that are associated with sexual behavior, affect, and the processing of sexually relevant information. This study tested if men's SSS moderates the impact of sexual morbidity on depressive symptoms. Men (N = 66) treated for localized prostate cancer in the preceding 2 years were assessed at T1 and 4 months later (T2). Questionnaires included the Center for Epidemiologic Studies Depression Scale, Sexual Self-schema Scale for Men, Sexual Experience Scale, and Expanded Prostate Cancer Index Composite. Regressions controlled for age, sexual activity, and T1 depressive symptoms revealed no significant effect of SSS on depressive symptoms; however, better sexual functioning was related to fewer depressive symptoms (B = -0.25, p < 0.05). Results showed significant interactions between SSS and sexual outcomes. Among men with high SSS, poor sexual functioning was associated with increased depressive symptoms; loss of sexual function was particularly distressing. There was no significant effect of sexual functioning. Among men with high SSS, there was an inverse relationship between sexual engagement and depressive symptoms. Among men with lower SSS, greater frequency of sexual behavior was associated with increased depressive symptoms. SSS may be an important individual difference in determining the impact of sexual morbidity on psychological adjustment. Men high on SSS are more vulnerable to psychological consequences of lower sexual functioning and less engagement in sexual activities. Copyright © 2014 John Wiley & Sons, Ltd.

  16. Functional structural motifs for protein-ligand, protein-protein, and protein-nucleic acid interactions and their connection to supersecondary structures.

    Science.gov (United States)

    Kinjo, Akira R; Nakamura, Haruki

    2013-01-01

    Protein functions are mediated by interactions between proteins and other molecules. One useful approach to analyze protein functions is to compare and classify the structures of interaction interfaces of proteins. Here, we describe the procedures for compiling a database of interface structures and efficiently comparing the interface structures. To do so requires a good understanding of the data structures of the Protein Data Bank (PDB). Therefore, we also provide a detailed account of the PDB exchange dictionary necessary for extracting data that are relevant for analyzing interaction interfaces and secondary structures. We identify recurring structural motifs by classifying similar interface structures, and we define a coarse-grained representation of supersecondary structures (SSS) which represents a sequence of two or three secondary structure elements including their relative orientations as a string of four to seven letters. By examining the correspondence between structural motifs and SSS strings, we show that no SSS string has particularly high propensity to be found interaction interfaces in general, indicating any SSS can be used as a binding interface. When individual structural motifs are examined, there are some SSS strings that have high propensity for particular groups of structural motifs. In addition, it is shown that while the SSS strings found in particular structural motifs for nonpolymer and protein interfaces are as abundant as in other structural motifs that belong to the same subunit, structural motifs for nucleic acid interfaces exhibit somewhat stronger preference for SSS strings. In regard to protein folds, many motif-specific SSS strings were found across many folds, suggesting that SSS may be a useful description to investigate the universality of ligand binding modes.

  17. Effects of parasagittal meningiomas on intracranial venous circulation assessed by the virtual reality technology.

    Science.gov (United States)

    Wang, Shousen; Ying, Jianbin; Wei, Liangfeng; Li, Shiqing; Jing, Junjie

    2015-01-01

    This study is to investigate the compensatory intracranial venous pathways in parasagittal meningiomas (PSM) patients by virtual reality technology. A total of 48 PSM patients (tumor group) and 20 patients with trigeminal neuralgia and hemifacial spasm but without intracranial venous diseases (control group) were enrolled. All patients underwent 3D CE-MRV examination. The 3D reconstructed images by virtual reality technology were used for assessment of diameter and number of intracranial veins, tumor location, venous sinus invasion degree and collateral circulation formation. Diameter of bridging veins in posterior 1/3 superior sagittal sinus (SSS) in tumor group was significantly smaller than that of the control group (P < 0.05). For tumors located in mid 1/3 SSS, diameter of bridging veins and vein of Labbé (VL) in posterior 1/3 SSS decreased significantly (P < 0.05). For tumors located in posterior 1/3 SSS, bridging vein number and transverse sinus (TS) diameter significantly decreased while superficial Sylvian vein (SSV) diameter increased significantly (P < 0.05). Compared with tumor in posterior 1/3 SSS subgroup, number of bridging veins in the tumor in mid 1/3 SSS subgroup increased significantly (P < 0.05). Compared with control group, only the bridging vein number in anterior 1/3 SSS segment in invasion Type 3-4 tumor subgroup decreased significantly (P < 0.05). Diameter of TS and bridging veins in posterior 1/3 SSS segment in sinus invasion Type 5-6 tumor subgroup decreased significantly (P < 0.05). Compared with control group, only the diameter of VL and TS of collateral circulation Grade 1 tumor subgroup decreased significantly (P < 0.05) while in Grade 3 tumor subgroup, TS diameter decreased and SSV diameter increased significantly (P < 0.05). The intracranial blood flow is mainly drained through SSV drainage after SSS occlusion by PSM.

  18. Systematic review and meta-analysis of the epidemiology of polyautoimmunity in Sjögren's syndrome (secondary Sjögren's syndrome) focusing on autoimmune rheumatic diseases.

    Science.gov (United States)

    Alani, H; Henty, J R; Thompson, N L; Jury, E; Ciurtin, C

    2018-03-01

    The epidemiology of polyautoimmunity in Sjögren's syndrome (secondary Sjögren's syndrome - sSS) is not well defined and has not been investigated before using a systematic approach. We conducted a systematic review of the epidemiology of sSS associated with rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), scleroderma, and myositis, assessing the prevalence rates (PRs) and clinical and serological features of sSS. A systematic literature search of PubMed and Embase databases (updated to March 2016) was performed to identify all published data on PR, demographic profile, clinical manifestations, laboratory features, and causes of death associated with sSS. The PR's of sSS were summarized with PRs and 95% confidence intervals (CIs). The literature search identified 1639 citations, of which 42 fulfilled the inclusion criteria. Only 19 studies were of moderate to good quality and were selected for the meta-analysis. According to a random-effects model, the pooled PR for sSS associated with RA was 19.5% (95% CI 11.2 to 27.8) and the pooled PR for sSS associated with SLE was 13.96% (95% CI 8.88 to 19.04). The female/male ratio of sSS in the RA population was 14.7 (95% CI 7.09 to 256) and in the SLE population was 16.82 (95% CI 1.22 to 32.4). Prevalence rates of sSS vary widely in different populations. Both meta-analyses conducted in the RA and SLE populations were characterized by a high degree of study heterogeneity. The results of this meta-analysis highlight the need for better quality population studies.

  19. 22-year surface salinity changes in the Seasonal Ice Zone near 140°E off Antarctica

    Science.gov (United States)

    Morrow, Rosemary; Kestenare, Elodie

    2017-11-01

    Seasonal and interannual variations in sea surface salinity (SSS) are analyzed in the Sea Ice Zone south of 60°S, from a 22-year time series of observations near 140°E. In the northern sea-ice zone during the warming, melting cycle from October to March, waters warm by an average of 3.5 °C and become fresher by 0.1 to 0.25. In the southern sea-ice zone, the surface temperatures vary from - 1 to 1 °C over summer, and the maximal SSS range occurs in December, with a minimum SSS of 33.65 near the Southern Boundary of the ACC, reaching 34.4 in the shelf waters close to the coast. The main fronts, normally defined at subsurface, are shown to have more distinct seasonal characteristics in SSS than in SST. The interannual variations in SSS are more closely linked to variations in upstream sea-ice cover than surface forcing. SSS and sea-ice variations show distinct phases, with large biannual variations in the early 1990s, weaker variations in the 2000s and larger variations again from 2009 onwards. The calving of the Mertz Glacier Tongue in February 2010 leads to increased sea-ice cover and widespread freshening of the surface layers from 2011 onwards. Summer freshening in the northern sea-ice zone is 0.05-0.07 per decade, increasing to 0.08 per decade in the southern sea-ice zone, largely influenced by the Mertz Glacier calving event at the end of our time series. The summer time series of SSS on the shelf at 140°E is in phase but less variable than the SSS observed upstream in the Adélie Depression, and thus represents a spatially integrated index of the wider SSS variations.

  20. Subjective social status and mortality: the English Longitudinal Study of Ageing.

    Science.gov (United States)

    Demakakos, Panayotes; Biddulph, Jane P; de Oliveira, Cesar; Tsakos, Georgios; Marmot, Michael G

    2018-05-19

    Self-perceptions of own social position are potentially a key aspect of socioeconomic inequalities in health, but their association with mortality remains poorly understood. We examined whether subjective social status (SSS), a measure of the self-perceived element of social position, was associated with mortality and its role in the associations between objective socioeconomic position (SEP) measures and mortality. We used Cox regression to model the associations between SSS, objective SEP measures and mortality in a sample of 9972 people aged ≥ 50 years from the English Longitudinal Study of Ageing over a 10-year follow-up (2002-2013). Our findings indicate that SSS was associated with all-cause, cardiovascular, cancer and other mortality. A unit decrease in the 10-point continuous SSS measure increased by 24 and 8% the mortality risk of people aged 50-64 and ≥ 65 years, respectively, after adjustment for age, sex and marital status. The respective estimates for cardiovascular mortality were 36 and 11%. Adjustment for all covariates fully explained the association between SSS and cancer mortality, and partially the remaining associations. In people aged 50-64 years, SSS mediated to a varying extent the associations between objective SEP measures and all-cause mortality. In people aged ≥ 65 years, SSS mediated to a lesser extent these associations, and to some extent was associated with mortality independent of objective SEP measures. Nevertheless, in both age groups, wealth partially explained the association between SSS and mortality. In conclusion, SSS is a strong predictor of mortality at older ages, but its role in socioeconomic inequalities in mortality appears to be complex.

  1. Experimental study of fouling and cleaning of sintered stainless steel membrane in electro-microfiltration of calcium salt particles.

    Science.gov (United States)

    Qin, Frank G F; Mawson, John; Zeng, Xin An

    2011-05-30

    Sintered stainless steel (SSS) microfiltration membranes, which served as electrode directly, were used for the experiment of separating Alamin, a calcium salt and protein containing particles, found in dairy processing. Fouling and cleaning of the SSS membranes under the application of an external electric field were studied. The imposed electric field was found, diverging the pH of permeate and retentate. This in turn altered the solubility of the calcium salt and impacted the performance of electro microfiltration membrane. Using electric field as an enhanced cleaning-in-place (CIP) method in back flushing SSS membrane was also studied.

  2. Experimental Study of Fouling and Cleaning of Sintered Stainless Steel Membrane in Electro-Microfiltration of Calcium Salt Particles

    Directory of Open Access Journals (Sweden)

    Frank G. F. Qin

    2011-05-01

    Full Text Available Sintered stainless steel (SSS microfiltration membranes, which served as electrode directly, were used for the experiment of separating Alamin, a calcium salt and protein containing particles, found in dairy processing. Fouling and cleaning of the SSS membranes under the application of an external electric field were studied. The imposed electric field was found, diverging the pH of permeate and retentate. This in turn altered the solubility of the calcium salt and impacted the performance of electro microfiltration membrane. Using electric field as an enhanced cleaning-in-place (CIP method in back flushing SSS membrane was also studied.

  3. On double-degenerate type Ia supernova progenitors as supersoft X-ray sources - A population synthesis analysis using SeBa

    DEFF Research Database (Denmark)

    Nielsen, Mikkel T. B.; Nelemans, Gijs; Voss, Rasmus

    2013-01-01

    a SSS phase. Aims: We aim to examine the possibility of double-degenerate progenitor systems being SSSs, and place stringent upper limits on the maximally possible durations of any SSS phases and expected number of these systems in a galactic population. Method: We employ the binary population synthesis...... code SeBa to examine the mass-transfer characteristics of a possible SSS phase of double-degenerate type Ia SN progenitor systems for 1) the standard SeBa assumptions, and 2) an optimistic best-case scenario. The latter case establishes firm upper limits on the possible population of supersoft source...

  4. Quantitative Evaluation of 2 Scatter-Correction Techniques for 18F-FDG Brain PET/MRI in Regard to MR-Based Attenuation Correction.

    Science.gov (United States)

    Teuho, Jarmo; Saunavaara, Virva; Tolvanen, Tuula; Tuokkola, Terhi; Karlsson, Antti; Tuisku, Jouni; Teräs, Mika

    2017-10-01

    In PET, corrections for photon scatter and attenuation are essential for visual and quantitative consistency. MR attenuation correction (MRAC) is generally conducted by image segmentation and assignment of discrete attenuation coefficients, which offer limited accuracy compared with CT attenuation correction. Potential inaccuracies in MRAC may affect scatter correction, because the attenuation image (μ-map) is used in single scatter simulation (SSS) to calculate the scatter estimate. We assessed the impact of MRAC to scatter correction using 2 scatter-correction techniques and 3 μ-maps for MRAC. Methods: The tail-fitted SSS (TF-SSS) and a Monte Carlo-based single scatter simulation (MC-SSS) algorithm implementations on the Philips Ingenuity TF PET/MR were used with 1 CT-based and 2 MR-based μ-maps. Data from 7 subjects were used in the clinical evaluation, and a phantom study using an anatomic brain phantom was conducted. Scatter-correction sinograms were evaluated for each scatter correction method and μ-map. Absolute image quantification was investigated with the phantom data. Quantitative assessment of PET images was performed by volume-of-interest and ratio image analysis. Results: MRAC did not result in large differences in scatter algorithm performance, especially with TF-SSS. Scatter sinograms and scatter fractions did not reveal large differences regardless of the μ-map used. TF-SSS showed slightly higher absolute quantification. The differences in volume-of-interest analysis between TF-SSS and MC-SSS were 3% at maximum in the phantom and 4% in the patient study. Both algorithms showed excellent correlation with each other with no visual differences between PET images. MC-SSS showed a slight dependency on the μ-map used, with a difference of 2% on average and 4% at maximum when a μ-map without bone was used. Conclusion: The effect of different MR-based μ-maps on the performance of scatter correction was minimal in non-time-of-flight 18 F-FDG PET

  5. Development and preliminary validation of the spondyloarthritis research consortium of Canada magnetic resonance imaging sacroiliac joint structural score

    DEFF Research Database (Denmark)

    Maksymowych, Walter P; Wichuk, Stephanie; Chiowchanwisawakit, Praveena

    2015-01-01

    on magnetic resonance imaging (MRI), the Spondyloarthritis Research Consortium of Canada (SPARCC) SIJ Structural Score (SSS). METHODS: The SSS method for assessment of structural lesions is based on T1-weighted spin echo MRI, validated lesion definitions, slice selection according to well-defined anatomical...... in scores, and was highest for fat metaplasia when both ICC and SDC values were compared. CONCLUSION: The new SPARCC MRI SSS method can detect structural changes in the SIJ with acceptable reliability over a 1-2-year timeframe, and should be further validated in patients with SpA....

  6. Use of and barriers to access to opioid analgesics: a worldwide, regional, and national study.

    Science.gov (United States)

    Berterame, Stefano; Erthal, Juliana; Thomas, Johny; Fellner, Sarah; Vosse, Benjamin; Clare, Philip; Hao, Wei; Johnson, David T; Mohar, Alejandro; Pavadia, Jagjit; Samak, Ahmed Kamal Eldin; Sipp, Werner; Sumyai, Viroj; Suryawati, Sri; Toufiq, Jallal; Yans, Raymond; Mattick, Richard P

    2016-04-16

    Despite opioid analgesics being essential for pain relief, use has been inadequate in many countries. We aim to provide up-to-date worldwide, regional, and national data for changes in opioid analgesic use, and to analyse the relation of impediments to use of these medicines. We calculated defined daily doses for statistical purposes (S-DDD) per million inhabitants per day of opioid analgesics worldwide and for regions and countries from 2001 to 2013, and we used generalised estimating equation analysis to assess longitudinal change in use. We compared use data against the prevalence of some health disorders needing opioid use. We surveyed 214 countries or territories about impediments to availability of these medicines, and used regression analyses to establish the strength of associations between impediments and use. The S-DDD of opioid analgesic use more than doubled worldwide between 2001-03 and 2011-13, from 1417 S-DDD (95% CI -732 to 3565; totalling about 3.01 billion defined daily doses per annum) to 3027 S-DDD (-1162 to 7215; totalling about 7.35 billion defined daily doses per annum). Substantial increases occurred in North America (16,046 S-DDD [95% CI 4032-28,061] to 31,453 S-DDD [8121-54,785]), western and central Europe (3079 S-DDD [1274-4883] to 9320 S-DDD [3969-14,672]), and Oceania (2275 S-DDD [763-3787] to 9136 S-DDD [2508-15,765]). Countries in other regions have shown no substantial increase in use. Impediments to use included an absence of training and awareness in medical professionals, fear of dependence, restricted financial resources, issues in sourcing, cultural attitudes, fear of diversion, international trade controls, and onerous regulation. Higher number of impediments reported was significantly associated with lower use (unadjusted incidence rate ratio 0.39 [95% CI 0.29-0.52]; p<0.0001), but not when adjusted for gross domestic product and human development index (0.91 [0.73-1.14]; p=0.4271). Use of opioid analgesics has increased, but

  7. Trends in the Outpatient Utilization of Antipsychotic Drugs in the City of Zagreb in the Ten-Year Period as a Tool to Assess Drug Prescribing Rationality.

    Science.gov (United States)

    Polić-Vižintin, Marina; Tripković, Ingrid; Štimac, Danijela; Šostar, Zvonimir; Orban, Mirjana

    2016-12-01

    The aim was to determine distribution and trends in the outpatient utilization of antipsychotics to evaluate the rationality of antipsychotic drug prescribing during the ten year period. The epidemiological method of descriptive and analytical observation was used. Data on drug utilization from Zagreb Municipal Pharmacy were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants per day (DDD/TID) using the World Health Organization Anatomical-Therapeutic-Chemical methodology. The ratio of typical versus atypical antipsychotics served as an indicator on assessing the rationality of the utilization. Data on the use of anticholinergics in the treatment of neuroleptic side effects were also included. Outpatient utilization of antipsychotics showed a declining pattern from 14.17 in 2001 to 8.42 DDD/TID in 2010. The utilization of atypical antipsychotics increased by 60% (from 3.68 to 5.89 DDD/TID), while the utilization of typical antipsychotics decreased by 76% (from 10.49 to 2.53 DDD/TID). The drugs showing the largest increase were olanzapine (from 1.21 to 2.78 DDD/TID) and quetiapine (from 0 to 0.68 DDD/TID). The typical/atypical antipsychotic ratio changed from 1:0.4 in 2001 to 1:2.3 in 2010. A 2.3-fold decrease was recorded in the utilization of anticholinergics (from 2.05 to 0.91 DDD/TID). Total consumption of neuroleptics significantly decreased. A decrease was also recorded in the utilization of anticholinergics. Study results pointed to two favorable features, i.e. low use of typical antipsychotics and the ratio of typical and atypical antipsychotics. Implementation of the new clinical guidelines for nervous system disorders and updating of the list of reimbursable drugs with the addition of new ones contributed to the observed improvement in the prescribing patterns during the study period. Using the WHO ATC/DDD methodology and rationality indicators in the assessment of trends in the outpatient utilization of

  8. Degenerative inter-vertebral disc disease osteochondrosis intervertebralis in Europe: prevalence, geographic variation and radiological correlates in men and women aged 50 and over.

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krzysztof; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O'Neill, Terence W; Reeve, Jonathan

    2017-07-01

    To assess the prevalences across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal BMD (aBMD) and change in aBMD with time. In the population-based European Prospective Osteoporosis Study, 27 age-stratified samples of men and women from across the continent aged 50+ years had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Images from 10 132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. KL grades 3 and 4 are often used clinically to categorize radiological DDD. Highly variable European prevalences of radiologically defined DDD grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  9. Degenerative Inter-Vertebral Disc Disease (Osteochondrosis Intervertebralis) in Europe: Prevalence, Geographic Variation, and Radiological Correlates in Men and Women Aged 50 and Over

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krysztoff; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O’Neill, Terence W; Reeve, Jonathan

    2017-01-01

    Objectives To assess the prevalence across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal bone mineral density (aBMD) and change in aBMD with time. Methods In the population-based European Prospective Osteoporosis Study 27 age-stratified samples of men and women from across the continent aged 50+ had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Results Images from 10,132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. Discussion KL Grades 3 and 4 are often used clinically to categorise radiological DDD. Highly variable European prevalences of radiologically-defined DDD Grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. PMID:28398504

  10. Quality-controlled sea surface temperature, salinity and other measurements from the NCEI Global Thermosalinographs Database (NCEI-TSG)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This collection contains global in-situ sea surface temperature (SST), salinity (SSS) and other measurements from the NOAA NCEI Global Thermosalinographs Database...

  11. Long term effects of cilostazol in a dog with sick sinus syndrome.

    Science.gov (United States)

    Kanno, Nobuyuki; Suzuki, Tomohiro

    2017-06-16

    Sick sinus syndrome (SSS) is a type of bradyarrhythmia that can lead to syncope. Cilostazol has been reported to be an effective treatment for human patients with SSS and other bradyarrhythmias. This report describes the successful long-term treatment with cilostazol in a dog with SSS. A nine-year old intact male Miniature Schnauzer presented with a history of syncopal episodes and unsteady gait. After cilostazol treatment, the total heart rate (HR), mean HR, and frequency of premature ventricular contractions (PVCs) increased, while the maximum HR and maximum pause time decreased. Additionally, the number of syncopal episodes decreased. The dog died suddenly, 1,418 days after the start of cilostazol treatment. Cilostazol may be a useful therapeutic agent in canines with SSS.

  12. Effect on School Language in Assessment of Achievement

    African Journals Online (AJOL)

    Eric Wilmot

    hundred randomly selected Senior Secondary School II (SSS II) Agricultural Science ... interaction effect of treatment and gender on students' achievement in an ...... Self-concept and science achievement in co-educational and single-sex.

  13. PODAAC-SMP30-3TPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS CAP, 8-day running mean, level 3 mapped, sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP)...

  14. PODAAC-SMP40-3TPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS V4.0 CAP, 8-day running mean, level 3 mapped, sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP)...

  15. PODAAC-SMP30-2TOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS, level 2B CAP, validated sea surface salinity orbital/swath product from the NASA Soil Moisture Active Passive (SMAP)...

  16. PODAAC-AQR40-4U7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — The IPRC/SOEST Aquarius OI-SSS v4 product is a level 4, near-global, 0.5 degree spatial resolution, 7-day, optimally interpolated salinity dataset based on version...

  17. PODAAC-SMP20-2SOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS, level 2C product contains the first release of the validated sea surface salinity orbital/swath data from the NASA Soil Moisture Active...

  18. PODAAC-SMP40-3TMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS V4.0 CAP, level 3, monthly mapped sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP) observatory. It...

  19. PODAAC-SMP30-3TMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS CAP, level 3, monthly mapped sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP) observatory. It is...

  20. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem.

    Science.gov (United States)

    Liu, Guangzeng; Zhang, Dajun; Pan, Yangu; Ma, Yuanxiao; Lu, Xingyue

    2017-01-01

    In this study, we examined subjective social status (SSS) and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7-12). The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminary effect that SSS and self-esteem underlie psychological suzhi 's effect on adolescents' problem behaviors, and also are important in helping school-teachers and administrators to develop a better understanding of problem behaviors in their schools as a pre-requisite to the development of more effective behaviors management practices from the perspective of psychological suzhi. Implications and limitations in the present study have also been discussed.

  1. Sanjad-Sakati syndrome with macrocytic anemia and failure to thrive: a case from South Jordan.

    Science.gov (United States)

    Ajarmeh, Salma A; Al Tamimi, Eyad M

    2018-03-01

    Backgorund: Sanjad-Sakati syndrome (SSS) is a rare autosomal recessive disease caused by a deletion mutation (155-166del) in exon 3 of the TBCE gene on chromosome 1q42-43. The syndrome is characterized by primary hypoparathyroidism, typical dysmorphic features and severe growth retardation. We encountered a 2-year-old boy with hypocalcemia, failure to thrive and macrocytic anemia. The patient had the characteristic features of SSS and genetic testing confirmed that he was homozygous for the TBCE mutation. Although malabsorption was initially considered the cause of his symptoms, the results did not confirm that diagnosis. Our patient had cow milk protein allergy and folic acid deficiency, which has not been described in previous SSS cases. It was difficult to treat the patient's hyperphosphatemia and we ultimately selected sevelamer treatment, which was tolerated well and improved his hypocalcemia. SSS should be considered in the differential diagnosis of any infant with hypocalcemia, dysmorphism and failure to thrive.

  2. 285 Teachers‟ Experience and Students‟ Numerical Proficiency in ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... (Sixty co-educational secondary schools and their SSS111 physics teachers were ... The role of science in technological development has long been realized in many developing ..... Navinegian Elementary School Level.

  3. A new technique for the estimation of sea surface salinity in the tropical Indian Ocean from OLR

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Subrahmanyam, B.; Tilvi, V.; O'Brien, J.J.

    stream_size 109417 stream_content_type text/plain stream_name J_Geophys_Res_C_109_C12006.pdf.txt stream_source_info J_Geophys_Res_C_109_C12006.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 A new... Ocean. The estimated SSS at 2.5C176 C2 2.5C176 grid on monthly scale is nearer to the WOA98 SSS with lower differences within ±0.5–0.8 away from the coastal region. The estimated SSS also agrees reasonably with the observed SSS along the trans...

  4. Comparison of the sagittal sinus cross-sectional area between patients with multiple sclerosis, hydrocephalus, intracranial hypertension and spontaneous intracranial hypotension: a surrogate marker of venous transmural pressure?

    Science.gov (United States)

    Bateman, Grant A; Lechner-Scott, Jeannette; Copping, Ross; Moeskops, Christopher; Yap, Swee Leong

    2017-07-06

    There is evidence that patients with multiple sclerosis (MS) and hydrocephalus share some common pathophysiological mechanisms. Alterations in CSF pressure are known to affect cerebral venous sinus geometry. To further explore these mechanisms, we measured the superior sagittal sinus (SSS) cross-sectional area 3 cm above the torcular using T2 images in 20 MS, 10 spontaneous intracranial hypotension (SIH), 21 hydrocephalus and 20 idiopathic intracranial hypertension (IIH) patients and compared with 20 matched controls. The SSS area was reduced by 25% in hydrocephalus (p = 0.0008), increased by 22% (p = 0.037) in SIH and unchanged in IIH compared to matched controls. In MS there was a 16% increase in SSS area (p = 0.01).The findings suggest that changes in SSS cross-sectional are common between MS and SIH patients, while in hydrocephalus and IIH these are different.

  5. Prognostic value of gated 201Tl myocardial perfusion SPECT imaging in patients with coronary artery disease

    International Nuclear Information System (INIS)

    Li Zicheng; Chen Xiaoming; Xu Hao

    2006-01-01

    Objective: To study the prognostic value of gated 201 Tl myocardial perfusion SPECT imaging in patients with coronary artery disease and assessment of therapy strategy for the individual patient. Methods: Eighty-four patients underwent rest and exercise stress 201 Tl gated myocardial perfusion SPECT imaging and were followed up for (32.92 ± 16.77) months. Images were studied using 17 segments and 1 to 4 scoring. Global summed stress score (SSS), summed rest score (SRS) and summed difference score (SDS=SSS-SRS) were also calculated. Post-stress and rest ejection fraction (EF) were automatically measured. Results: Nine cardiac events occurred (3.90% per year). SSS, SDS, SRS and EF were the independent predictors of cardiac events (P 201 Tl myocardial perfusion SPECT imaging can provide prognostic assessment for the patients with coronary artery disease and guide in selection of therapeutic strategy. Among all of the indices SSS is the best predictors of cardiac events. (authors)

  6. An evaluation of instructional strategies used in hiv/aids preventive ...

    African Journals Online (AJOL)

    AIDS instructional strategies on JSS and SSS Students' knowledge, attitude and intentions about future sexual behaviour. Construct validity of the 12-item attitude scale was tested using factor analysis. Cronbach's alpha was utilised to determine ...

  7. Seasonal Mean SST images of Stellwagen Bank National Marine Sanctuary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Average seasonal sea surface temperatures http://podaac.jpl.nasa.gov/ Naming Convention: XXXX_SSSYYYY_SST.tif XXXX=location (Stell) SSS=season (FAL=fall, SPR=spring,...

  8. Grand Seasonal SST images of the Stellwagen Bank National Marine Sanctuary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Grand monthly mean Sea Surface Temperature http://podaac.jpl.nasa.gov/ Naming Convention: XXXX_SSSYYYY1YYYY2_GAVGSST.tif XXXX=location (Stell) SSS= season...

  9. Functional effects of treadmill-based gait training at faster speeds in stroke survivors: a prospective, single-group study.

    Science.gov (United States)

    Mohammadi, Roghayeh; Ershad, Navid; Rezayinejad, Marziyeh; Fatemi, Elham; Phadke, Chetan P

    2017-09-01

    To examine the functional effects of walking retraining at faster than self-selected speed (SSS). Ten individuals with chronic stroke participated in a 4-week training over a treadmill at walking speeds 40% faster than SSS, three times per week, 30 min/session. Outcome measures assessed before, after, and 2 months after the end of intervention were the Timed Up and Go, the 6-Minute Walk, the 10-Meter Walk test, the Modified Ashworth Scale, SSS, and fastest comfortable speed. After 4 weeks of training, all outcome measures showed clinically meaningful and statistically significant improvements (Ptraining. The results showed that a strategy of training at a speed 40% faster than SSS can improve functional activity in individuals with chronic stroke, with effects lasting up to 2 months after the intervention.

  10. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem

    Directory of Open Access Journals (Sweden)

    Guangzeng Liu

    2017-08-01

    Full Text Available In this study, we examined subjective social status (SSS and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7–12. The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminary effect that SSS and self-esteem underlie psychological suzhi’s effect on adolescents’ problem behaviors, and also are important in helping school-teachers and administrators to develop a better understanding of problem behaviors in their schools as a pre-requisite to the development of more effective behaviors management practices from the perspective of psychological suzhi. Implications and limitations in the present study have also been discussed.

  11. Can mothers safely prepare labon-gur salt-sugar solution after demonstration in a diarrhoeal hospital?

    DEFF Research Database (Denmark)

    Islam, M A; Kofoed, Poul-Erik; Begum, S

    1992-01-01

    Home-based salt-sugar solution (SSS) prepared with labon (locally produced sea salt) and gur (unrefined brown sugar) has been recommended as a cheap, locally available and a simple tool to prevent and treat diarrhoeal dehydration. Preparation of labon-gur SSS is demonstrated to the patients...... and the attendants at ICDDR, Bangladesh. To evaluate performances, 150 mothers were asked to measure labon and gur by finger pinch and first method and 100 mothers measured half a seer of water to prepare labon-gur SSS, shortly after the demonstration sessions. 4.0% of the samples exceeded the upper safety limit...... this knowledge. Our study suggests that demonstration of home-based SSS in a diarrhoeal hospital may positively affect health education and that health personnel should actively participate in increasing health awareness....

  12. Radiation graft post-polymerization of sodium styrene sulfonate onto polyethylene

    International Nuclear Information System (INIS)

    Kitaeva, N.K.; Duflot, V.R.; Ilicheva, N.S.

    2013-01-01

    Post-irradiation grafting of sodium styrene sulfonate (SSS) in the presence of acrylic acid (AA) has been investigated on polyethylene (PE) pre-exposed to gamma radiation at room temperature in the air. Special attention was paid to the effect of low molecular weight salt additives on the kinetics of graft copolymerization of SSS and AA. The presence of SSS links in the grafted PE copolymers was detected by the methods of UV and FTIR spectroscopy. Based on the FTIR spectroscopy and element analysis data, a mechanism was proposed for graft copolymerization of SSS and AA onto PE. The mechanical properties of the graft copolymers were studied. It was established that PE copolymers grafted with sulfonic acid and carboxyl groups have higher strength characteristics (16.3 MPa) compared to the samples containing only carboxyl groups (11 MPa). (author)

  13. Investigation of s stressed-strained state and optimization of the T-15 facility electromagnetic system design

    International Nuclear Information System (INIS)

    Vaulina, I.G.; Gusev, S.V.; Monoszon, N.A.; Sivkova, G.N.; Spirchenko, Yu.V.; Chvartatskij, R.V.; Churakov, G.F.

    1982-01-01

    The results of investigation of a stressed-strained state (SSS) of superconducting coils of toroidal field (TFSC) of the T-15 facility are presented. The TFSC SSS dependence on the forces acting in the coil plane is reduced to solving the plane problem of the elasticity theory. The problem is solved by the finite element method according to a specially developed program. The TFSC SSS dependence on the action of tilting forces is studied by the structural mechanics method. A refined rod theory taking into account shear strain of the rod cross-section in the direction perpendicular to its axis is used. A comparative analysis of different versions of the TFSC design is carried out. A TFSC design optimized over the SSS is chosen. It is used in constructing the electromagnetic system of the T-15 facility

  14. Results of Magnetic Axis Measurements on a Prototype Main Lattice Quadrupole for the LHC

    CERN Document Server

    Smirnov, N; Deferne, G; Parma, V; Rohmig, P; Tortschanoff, Theodor

    2004-01-01

    More than 470 twin aperture lattice quadrupoles are needed for the Large Hadron Collider (LHC) under construction at CERN. The lattice quadrupole, assembled with correction magnets in its helium enclosure - the cold mass and integrated in a common cryostat called the Short Straight Section (SSS). All SSS cold mass prototypes have been developed and built by CEA (Saclay) in collaboration with CNRS (Orsay, France). The last SSS prototype (SSS5) was used to investigate the behavior of the magnetic axis through various steps of the installation cycle for the series quadrupoles: including transportation, thermal-cycles, and being lowered into the tunnel. Results of extensive measurements before and after each of these stages are presented here, showing that the effect of transport is weak and within the window of measurement resolution. Also shown is that the long-term stability observed during two years is comparable with the requirements from magnet tolerances. To minimize systematic errors, all tests were perfo...

  15. Steam temperature variation behind a turbine steam separator-superheater during NPP start-up

    International Nuclear Information System (INIS)

    Lejzerovich, A.Sh.; Melamed, A.D.

    1979-01-01

    To determine necessary parameters of the steam temperature automatic regulator behind the steam separator-rheater supe (SSS) of an NPP turbine the static and dynamic characteristics of the temperature change behind the SSS were studied experimentally. The measurements were carried out at the K-220-44 turbine of the Kolskaja NPP in the case of both varying turbine loads and the flow rate of the heating vapor. Disturbances caused by the opening of the regulating valve at the inlet of the heating vapor are investigated as well. It is found that due to a relatively high inertiality of the SSS a rather simple structure of the start-up steam temperature regulators behind the SSS in composition with automatated driving systems of the turbine start-up without regard for the change of the dynamic characteristics can be used

  16. Operating Environment of the Future

    National Research Council Canada - National Science Library

    Hanson, Matthew

    1997-01-01

    ...), the Smart Surgical System (SSS), and the Intelligent Virtual Patient Environment (IVPE). The project is one of several targeting reduction in mortality and morbidity of the wounded soldier through improved far-forward combat casualty care...

  17. Cerebral venography and flow quantification with MR

    International Nuclear Information System (INIS)

    Mattle, H.; Elelman, R.R.; Reis, H.H.; O'Reilly, G.V.; Wentz, K.V.; O'Leary, D.H.; Finn, J.P.; Longmaid, H.E.

    1989-01-01

    The authors describe an approach for creating projection venograms of the head and quantifying flow in the cerebral veins and sinuses. A series of two- dimensional flow-compensated gradient-echo images were acquired. Signal from arteries was eliminated by application of a 5-cm-thick presaturation slab to the neck. The images were postprocessed with use of a maximum intensity projection algorithm to produce projection venograms. In addition, flow directionally, flow velocity, and, in the superior sagittal sinus (SSS), flow volume was assessed by means of a dynamic bolus tracking technique. Flow velocities in the SSS ranged from 20.1 to 45.5 cm/sec, and flow volumes from 269 to 612 mL/min. This technique was able to identify cerebral venous thrombosis and partial SSS obstruction, cerebral venous angiomas, and venous drainage of arteriovenous malformations and to demonstrate patency of the SSS with falx meningiomas

  18. Episodic chasing in pathological gamblers using the Iowa gambling task

    DEFF Research Database (Denmark)

    Linnet, J.; Rojskjaer, S.; Nygaard, Jørgen

    2006-01-01

    NPGs on the Iowa Gambling Task (IGT) and the Zuckerman Sensation Seeking Scale (SSS). The PGs showed significantly more chasing and had significantly poorer decision-making strategies than NPGs, particularly among males (F = 4.52, p

  19. Pituitary adenylate cyclase activating polypeptide and migraine

    DEFF Research Database (Denmark)

    Zagami, Alessandro S; Edvinsson, Lars; Goadsby, Peter J

    2014-01-01

    Pituitary adenylate cyclase activating peptide (PACAP) is found in human trigeminocervical complex and can trigger migraine. PACAP levels were measured using a sensitive radioimmunoassay. Stimulation of the superior sagittal sinus (SSS) in cat elevated PACAP levels in cranial blood. Patients...

  20. Boundary Conditions in the Navy Coastal Ocean Model

    National Research Council Canada - National Science Library

    Rochford, Peter

    2001-01-01

    ...) and sea surface salinity (SSS) to observed or climate fields can also be applied. For the vertical mixing submodels, the surface roughness can be specified and the BC for the turbulent kinetic energy (TKE...

  1. Comparison of the occlusion of experiemntal craniojugular saccular aneurysms with covered stents

    International Nuclear Information System (INIS)

    Zhang Haixia; Li Minghua; Cheng Yingsheng; Fang Chun; Li Min

    2006-01-01

    Objective: To assess the effectiveness and biocompatibility of balloon-expanding, stainless steel stents covered with biomembrane (BM-SSS) and polyurethane membrane (PUM-SSS) in the treatment of experimental saccular aneurysms in a canine model and to observe the ablation of aneurysm with preservation of the parent vessel. Methods: Sixteen healthy mongrel canines were included in our study. 26 of 29 successful experimental aneurysms were treated with covered stents, another 3 were untreated to serve as controls. Altogether there were fourteen BM-SSS and twelve PUM-SSS were placed endovascularly in the common carotid arteries covering the orifice of the aneurysms. Control angiography was performed immediately after the procedure and after 2 weeks, 4 weeks and 12 weeks. According to grouping time, each aneurysm together with stented arteries was removed with animals alive for histopathological examination. Enumeration data was analyzed by Fisher's Exact Test using SPSS 10.0. Results: Before stent placement, angiography of the common carotid arteries showed round, saccular side-wall aneurysms and complex pattern of flow. Immediately after stent placement the aneurysmal pouches were no longer visible and the stented common carotid arteries remained widely patent. All controlled aneurysms and common carotid arteries have been patent and unchanged for 1 year. 13 of 14 stented common carotid arteries with BM-SSS and 3 of 12 with PUM-SSS remained widely patent. The complete patency rate of BM-SSS and PUM-SSS was significantly different (P=0.0008). Histological analysis indicated that all treated aneurysmal pouches were almost filled with thrombus, as well as with fibrotic reactive scar tissue. Stent wires were found to be located deep within the vessel wall and encased by an extension of the tunica intima. The endothelium of the two groups was already mature at 12 weeks, and various degree of degenerate cells were seen under the transmission electron microscopy. Conclusion

  2. A survey of exercise professionals' barriers and facilitators to working with stroke survivors.

    Science.gov (United States)

    Condon, Marie; Guidon, Marie

    2018-03-01

    Stroke survivors (SSs) are largely inactive despite the benefits of exercise. Exercise professionals (EPs), skilled in exercise prescription and motivation, may have a role in promoting exercise among SSs. However, the number of EPs working with SSs is estimated to be low. This study aimed to investigate EPs' opinions on working with SSs by rating their agreement of barriers and facilitators to working with SSs. The study also investigated EPs skills, interest and experience working with SSs and the relationship between EPs' barriers and facilitators with their training on stroke. A descriptive cross-sectional study was conducted using a researcher-designed online survey between October and December 2015. Purposive sampling was used to survey EPs on the Register of Exercise Professionals in Ireland (n = 277). The response rate was 31% (87/277). Only 22% (19/86) of EPs had experience working with SSs. The primary barriers rated by EPs included insufficient training on psychological problems post-stroke (84%; 61/73), unsuitable equipment for SSs (69%; 50/73) and the level of supervision SSs require (56%; 41/73). The primary facilitators rated included access to suitable equipment (97%; 69/71), practical (100%; 71/71) and theoretical training (93%; 66/71) on stroke. Respondents with no training on stroke were significantly more likely to agree that insufficient training on psychological problems post-stroke and lack of experience were barriers. Seventy-six per cent of EPs (58/76) were interested in one-to-one exercise sessions with SSs but only 53% (40/76) were interested in group sessions. Eighty-two per cent of EPs (62/76) rated their motivational skills as good or very good but 42% (32/76) indicated having only acceptable skills dealing with psychological problems. Results indicate that EPs are interested in working with SSs despite limited experience and practical barriers. Training opportunities on stroke need to be developed; taking into account EPs' barriers

  3. An approach to effective UHF (S/L band) data communications for satellite Personal Communication Service (PCS)

    Science.gov (United States)

    Hayase, Joshua Y.

    1995-01-01

    Reliable signaling information transfer is fundamental in supporting the needs of data communication PCS via LMS (Land Mobile Service) SSs (satellite systems). The needs of the system designer can be satisfied only through the collection of media information that can be brought to bear on the pertinent design issues. We at ISI hope to continue our dialogue with fading media experts to address the unique data communications needs of PCS via LMS SSs.

  4. Assessment of the Sheffield Support Snood, an innovative cervical orthosis designed for people affected by neck muscle weakness

    OpenAIRE

    Pancani, Silvia; Rowson, Jennifer; Tindale, Wendy; Heron, Nicola; Langley, Joe; McCarthy, Avril D.; Quinn, Ann; Reed, Heath; Stanton, Andrew; Shaw, Pamela J.; McDermott, Christopher J.; Mazzà, Claudia

    2016-01-01

    The aim of this study was to quantify the biomechanical features of the Sheffield Support Snood (SSS), a cervical orthosis specifically designed for patients with neck weakness. The orthosis is designed to be adaptable to a patient’s level of functional limitation using adjustable removable supports, which contribute support and restrict movement only in desired anatomical planes. \\ud Methods: The SSS was evaluated along with two commercially available orthoses, the Vista and Headmaster. The ...

  5. Rainfall Imprint on Sea Surface Salinity in the ITCZ: new satellite perspectives

    Science.gov (United States)

    Boutin, J.; Viltard, N.; Supply, A.; Martin, N.; Vergely, J. L.; Hénocq, C.; Reverdin, G. P.

    2016-02-01

    The European Soil Moisture and Ocean Salinity (SMOS) satellite mission monitors sea surface salinity (SSS) over the global ocean for more than 5 years since 2010. The MADRAS microwave radiometer carried by the French (CNES) Indian (ISRO) satellite mission Megha-Tropiques sampled the 30° N-30° S region end of 2011 and in 2012, very complementary to other Global Precipitation Measurement(GPM) missions. In tropical regions, SMOS SSS contains a large imprint of atmospheric rainfall, but is also likely affected by oceanographic processes (advection and diffusion). At local and short time scales, Boutin et al. (2013, 2014) have shown that the spatio-temporal variability of SSS is dominated by rainfall as detected by satellite microwave radiometers and have demonstrated a close to linear relationship between SMOS SSS freshening under rain cells and satellite rain rate. The order of magnitude is in remarkable agreement with the theoretical renewal model of Schlussel et al. (1997) and compatible with AQUARIUS SSS observations, as well as with in situ drifters observations although the latter are local and taken at 45cm depth while satellite L-band SSS roughly correspond to the top 1cm depth and are spatially integrated over 43-150km. It is thus expected that the combined information of satellite rain rates and satellite SSS brings new constraints on the precipitation budget. We first look at the consistency between the spatial structures of SMOS SSS decrease and of rain rates derived either from the MADRAS microwave radiometer or from the CMORPH combined products that do not use MADRAS rain rates. This provides an indirect validation of the rain rates estimates. We then investigate the impact of rain history and of wind speed on the observed SMOS freshening. Based on these results, we discuss the precision on various precipitation estimates over 2012 in the ITCZ region and the major sources of uncertainties that the SPURS2 campaign could help to resolve.

  6. Flotation atomic absorption determination of bismuth in nonferrous metal alloys

    International Nuclear Information System (INIS)

    Ososkov, V.K.; Plintus, A.M.; Kornelli, M.Eh.; Zakhariya, A.N.; Lozanova, E.V.

    1986-01-01

    Technique of flotation concentration and atomic absorption determination of bismuth microquantities in alloys on the basis of copper and zinc has been developed. Fine-dispersed EhDEh-10P anionite was used as a carrier in flotation concentration. State standard samples (SSS) of brasses and German silver were used as analysed objects. Effect of macrocomponents on the results of bismuth content determination has been studied. Satisfactory coincidence of the results obtained and SSS certificates is shown

  7. Global Genetics and Invasion History of the Potato Powdery Scab Pathogen, Spongospora subterranea f.sp. subterranea

    OpenAIRE

    Gau, Rebecca D.; Merz, Ueli; Falloon, Richard E.; Brunner, Patrick C.

    2013-01-01

    Spongospora subterranea f. sp. subterranea (Sss) causes two diseases on potato (Solanum tuberosum), lesions on tubers and galls on roots, which are economically important worldwide. Knowledge of global genetic diversity and population structure of pathogens is essential for disease management including resistance breeding. A combination of microsatellite and DNA sequence data was used to investigate the structure and invasion history of Sss. South American populations (four countries, 132 sam...

  8. The relationship between caregivers' subjective social status and asthma symptoms and management for urban children.

    Science.gov (United States)

    Diep, Judy; Fagnano, Maria; Tremblay, Paul; Halterman, Jill S

    2018-03-01

    Subjective social status (SSS) is a person's perception of his/her social standing among others. We explored the relationship between caregivers' SSS and asthma symptoms, visits, and medication use among children with persistent asthma. We analyzed baseline data of children (3-10 years) from the SB-TEAM trial in Rochester, NY. Using a modified MacArthur Scale of SSS, caregivers rated themselves "a lot worse off" to "a lot better off" compared to 4 groups (e.g., neighbors). "Low SSS" was defined by a response of "a lot worse off" or "somewhat worse off" for any of the referent groups. Caregivers reported their child's asthma symptoms, healthcare visits for asthma, and medication use. Bivariate and multivariate statistics were used. We found that, of the 230 children enrolled (participation rate:78%, 62% Black, 72% Medicaid), 29% of caregivers had low SSS. Caregivers with low SSS had more depressive symptoms (46% vs. 28%) and lower social support (69.1 vs. 77.7). In multivariable analyses, children of caregivers with low SSS had fewer symptom-free days/2 weeks (5.8 vs. 7.9, p = .01). While they were more likely to have a routine asthma visit in the past year (35% vs. 23%, adjusted p = .03), there was no difference in their use of preventive medication. Many caregivers of children with persistent asthma report low SSS. While children of these caregivers had fewer symptom-free days, they were not more likely to use preventive medications. Efforts are needed to support these caregivers to ensure optimal preventive care and reduce morbidity.

  9. Swift follow-up of 1RXS J194211.9+255552

    DEFF Research Database (Denmark)

    Sidoli, L.; Fiocchi, M.; Bird, A. J.

    2011-01-01

    there is only one pointlike source, at the following position (J2000): RA(hh mm ss.s) = 19h42m11.13s, Dec(dd mm ss.s) = +25:56:07.32 (3.6 arcsec error radius). The source light curve is variable on time scale of about 1000 s (similar to the Jem-X light curve). A fit to the XRT spectrum (1-10 keV) with a power...

  10. Efficacy of a Blend of Sulfuric Acid and Sodium Sulfate against Shiga Toxin-Producing Escherichia coli, Salmonella, and Nonpathogenic Escherichia coli Biotype I on Inoculated Prerigor Beef Surface Tissue.

    Science.gov (United States)

    Scott-Bullard, Britteny R; Geornaras, Ifigenia; Delmore, Robert J; Woerner, Dale R; Reagan, James O; Morgan, J Bred; Belk, Keith E

    2017-12-01

    A study was conducted to investigate the efficacy of a sulfuric acid-sodium sulfate blend (SSS) against Escherichia coli O157:H7, non-O157 Shiga toxin-producing E. coli (STEC), Salmonella, and nonpathogenic E. coli biotype I on prerigor beef surface tissue. The suitability of using the nonpathogenic E. coli as a surrogate for in-plant validation studies was also determined by comparing the data obtained for the nonpathogenic inoculum with those for the pathogenic inocula. Prerigor beef tissue samples (10 by 10 cm) were inoculated (ca. 6 log CFU/cm 2 ) on the adipose side in a laboratory-scale spray cabinet with multistrain mixtures of E. coli O157:H7 (5 strains), non-O157 STEC (12 strains), Salmonella (6 strains), or E. coli biotype I (5 strains). Treatment parameters evaluated were two SSS pH values (1.5 and 1.0) and two spray application pressures (13 and 22 lb/in 2 ). Untreated inoculated beef tissue samples served as controls for initial bacterial populations. Overall, the SSS treatments lowered inoculated (6.1 to 6.4 log CFU/cm 2 ) bacterial populations by 0.6 to 1.5 log CFU/cm 2 (P SSS was applied to samples inoculated with any of the tested E. coli inocula; however, solution pH did have a significant effect (P SSS was applied to samples inoculated with Salmonella. Results indicated that the response of the nonpathogenic E. coli inoculum to the SSS treatments was similar (P ≥ 0.05) to that of the pathogenic inocula tested, making the E. coli biotype I strains viable surrogate organisms for in-plant validation of SSS efficacy on beef. The application of SSS at the tested parameters to prerigor beef surface tissue may be an effective intervention for controlling pathogens in a commercial beef harvest process.

  11. Starch accumulation in hulless barley during grain filling.

    Science.gov (United States)

    Zheng, Xu-Guang; Qi, Jun-Cang; Hui, Hong-Shan; Lin, Li-Hao; Wang, Feng

    2017-12-01

    Starch consists of two types of molecules: amylose and amylopectin. The objective of this study was increase understanding about mechanisms related to starch accumulation in hulless barley (Hordeum vulgare L.) grain by measuring temporal changes in (i) grain amylose and amylopectin content, (ii) starch synthase activity, and (iii) the relative expressions of key starch-related genes. The amylopectin/amylose ratio gradually declined in both Beiqing 6 and Kunlun 12. In both cultivars, the activities of adenosine diphosphate glucose pyrophosphorylase, soluble starch synthase (SSS), granule bound starch synthase (GBSS), and starch branching enzyme (SBE) increased steadily during grain filling, reaching their maximums 20-25 days after anthesis. The activities of SSS and SBE were greater in Ganken 5 than in either Beiqing 6 or Kunlun 12. The expression of GBSS I was greater in Beiqing 6 and Kunlun 12 than in Ganken 5. In contrast, the expression of SSS I, SSS II and SBE I was greater in Ganken 5 than in Beiqing 6 and Kunlun 12. The peak in GBSS I expression was later than that of SSS I, SSS II, SBE IIa and SBE IIb. The GBSS I transcript in Kunlun 12 was expressed on average 90 times more than the GBSS II transcript. The results suggest that SBE and SSS may control starch synthesis at the transcriptional level, whereas GBSS I may control starch synthesis at the post transcriptional level. GBSS I is mainly responsible for amylose synthesis whereas SSS I and SBE II are mainly responsible for amylopectin synthesis in amyloplasts.

  12. TRPM7 regulates angiotensin II-induced sinoatrial node fibrosis in sick sinus syndrome rats by mediating Smad signaling.

    Science.gov (United States)

    Zhong, Hongbin; Wang, Tingjun; Lian, Guili; Xu, Changsheng; Wang, Huajun; Xie, Liangdi

    2018-03-06

    Sinoatrial node fibrosis is involved in the pathogenesis of sinus sick syndrome (SSS). Transient receptor potential (TRP) subfamily M member 7 (TRPM7) is implicated in cardiac fibrosis. However, the mechanisms underlying the regulation of sinoatrial node (SAN) fibrosis in SSS by TRPM7 remain unknown. The aim of this study was to investigate the role of angiotensin II (Ang II)/TRPM7/Smad pathway in the SAN fibrosis in rats with SSS. The rat SSS model was established with sodium hydroxide pinpoint pressing permeation. Forty-eight rats were randomly divided into six groups: normal control (ctrl), sham operation (sham), postoperative 1-, 2-, 3-, and 4-week SSS, respectively. The tissue explant culture method was used to culture cardiac fibroblasts (CFs) from rat SAN tissues. TRPM7 siRNA or encoding plasmids were used to knock down or overexpress TRPM7. Collagen (Col) distribution in SAN and atria was assessed using PASM-Masson staining. Ang II, Col I, and Col III levels in serum and tissues or in CFs were determined by ELISA. TRPM7, smad2 and p-smad2 levels were evaluated by real-time PCR, and/or western blot and immunohistochemistry. SAN and atria in rats of the SSS groups had more fibers and higher levels of Ang II, Col I and III than the sham rats. Similar findings were obtained for TRPM7 and pSmad2 expression. In vitro, Ang II promoted CFs collagen synthesis in a dose-dependent manner, and potentiated TRPM7 and p-Smad2 expression. TRPM7 depletion inhibited Ang II-induced p-Smad2 expression and collagen synthesis in CFs, whereas increased TRPM7 expression did the opposite. SAN fibrosis is regulated by the Ang II/TRPM7/Smad pathway in SSS, indicating that TRPM7 is a potential target for SAN fibrosis therapy in SSS.

  13. Associations Between Parental SES and Children's Health-Related Quality of Life: The Role of Objective and Subjective Social Status.

    Science.gov (United States)

    Kim, Kay W; Wallander, Jan L; Peskin, Melissa; Cuccaro, Paula; Elliott, Marc N; Schuster, Mark A

    2018-06-01

    We examined (1) the relationship that parental objective social status (OSS) and subjective social status (SSS) have with children's health-related quality of life (HRQOL), (2) whether SSS mediates the association between OSS and HRQOL, and (3) whether these associations differ among Black, Latino, and White children. Data came from 4,824 Black, Latino, and White 5th graders in the Healthy PassagesTM study. OSS was measured as parent educational attainment and net equivalent household income. SSS was measured by parent rating of community and national standing on the MacArthur Scale of Subjective Social Status. Child HRQOL was measured with child report on the Pediatric Quality of Life Inventory (PedsQL) physical and psychosocial scales. Structural equation modeling path analysis was conducted using Mplus version 7.4. The data supported the hypothesized measurement and structural models. Whereas parental OSS was positively related to psychosocial HRQOL for all three racial/ethnic groups and to physical HRQOL for Latino children, parental SSS was not related to either for any of the racial/ethnic groups. Therefore, mediation by SSS was not supported for any group. OSS was confirmed to have stronger association with children's HRQOL than parental SSS. This is in contrast to some research on adults, raising the questions of how best to assess SSS relevant to children and at what point in development SSS may influence children's health and well-being. The persistent relationship found between parental OSS and child health suggests that efforts to improve low socioeconomic resources in families may contribute to improve children's health.

  14. Subjective social status predicts quit-day abstinence among homeless smokers.

    Science.gov (United States)

    Reitzel, Lorraine R; Kendzor, Darla E; Cao, Yumei; Businelle, Michael S

    2014-01-01

    Smoking prevalence is alarmingly high among the homeless. Few studies have focused on predictors of smoking abstinence in this population. Subjective social status, a person's ranking of their own social standing relative to others in the United States or in their own self-defined communities, has predicted smoking cessation among domiciled smokers in analyses adjusted for objective socioeconomic status and other demographic variables. This study examined if subjective social status predicted quit-day abstinence among homeless smokers making a quit attempt. Longitudinal study using self-reported survey data. Transitional homeless shelter in Dallas, Texas. A total of 57 homeless smokers enrolled in a cessation program. Predictors were the Subjective Social Status-U.S (SSS-U.S.) and the Subjective Social Status-Community (SSS-Community) ladders measured 1 week pre quit. Covariates were sociodemographics and tobacco dependence measured 1 week pre quit. The outcome was self-reported and biochemically verified smoking abstinence on the quit day. Analysis . Covariate-adjusted logistic regression models. Higher rankings on the SSS-U.S. ladder, but not the SSS-Community ladder, predicted abstinence on the quit day (p = .005). Lower rankings on the SSS-U.S. ladder predicted increased risk of relapse on the quit day or the inability to quit at all. The SSS-U.S. ladder might be useful in identifying homeless smokers needing additional preparation and intervention before initiating a quit attempt.

  15. Spatial and Temporal Distribution of Sea Surface Salinity in Coastal Waters of China Based on Aquarius

    International Nuclear Information System (INIS)

    Wang, Ying; Jiang, Hong; Zhang, Xiuying; Jin, Jiaxin

    2014-01-01

    Sea surface salinity (SSS) is a fundamental parameter for the study of global ocean dynamics, water cycle, and climate variability. Aquarius launched by NASA and the Space Agency of Argentina is a breakthrough which could achieve the remote sensing data of SSS. The present paper takes the coastal of China as study area, which is a representative area of ocean boundary and influenced by continental rivers (Yangtze River and Pearl River). After analyze the temporal and spatial variation of SSS in the coastal of China, the estuary area has obvious low salinity because the injected of freshwater from continent. Take the East China Sea (ECS) and South China Sea (SCS) as representative region to discuss the effect of freshwater to SSS. The salinity is almost equal in winter when the diluted water is inadequate in both rivers. However, an obvious decrease appeared in summer especial July in Yangtze River for abundance discharge inflow the ECS. This is a reasonable expression of Yangtze River discharge is remarkable influence the SSS in coastal area then Pearl River. Survey the distribution range of Yangtze River diluted water (SSS<31psu). The range is small in winter and expands to peak value in summer

  16. The Potential Explanatory Role of Perceived Stress in Associations Between Subjective Social Status and Health-Related Quality of Life Among Homeless Smokers.

    Science.gov (United States)

    Garey, Lorra; Reitzel, Lorraine R; Kendzor, Darla E; Businelle, Michael S

    2016-01-01

    Homeless individuals smoke at high rates relative to the general population and are at heightened risk of tobacco-related illnesses and poor health-related quality of life (HRQoL). Homeless smokers also report low subjective social status (SSS) or perceived social standing relative to others. SSS may contribute to poor HRQoL, potentially through perceived stress. The current study examined the role of perceived stress in the association of SSS and HRQoL among 227 (70.9% male, Mage = 43.2) homeless smokers. Participants completed self-report measures of SSS, perceived stress, and HRQoL. Perceived stress partially explained the relation between SSS (United States and Community) and HRQoL in covariate-adjusted analyses. Results suggested that perceived stress is a pathway through which SSS contributes to HRQoL among homeless smokers. Findings broaden current understanding of the impact of social disadvantage and perceived stress on HRQoL among homeless smokers. © The Author(s) 2015.

  17. Climatic variability and trends in the surface waters of coastal British Columbia

    Science.gov (United States)

    Cummins, Patrick F.; Masson, Diane

    2014-01-01

    Multi-decadal records of monthly sea surface temperature (SST) and sea surface salinity (SSS) collected at a set of lighthouse stations are used to examine climatic variability and trends in the coastal waters of British Columbia. Particular attention is given to relations between the water property anomalies and variability in coastal freshwater discharge and alongshore wind stress. Within the Strait of Georgia, SSS anomalies are closely related to Fraser River discharge anomalies. Along the Pacific coast, anomalies in alongshore wind stress and freshwater runoff have the characteristics of white noise processes. A cross-correlation analysis demonstrates that SST and SSS variability along the open west coast is consistent with the response of a first-order autoregressive process driven by anomalous alongshore wind stress and coastal freshwater discharge, respectively. Thus climatic variability of SST and SSS along the Pacific coast of British Columbia occurs, in part, through the integration of noisy atmospheric forcing and coastal precipitation. Seasonal correlations show that SST is strongly related to wind stress during winter and fall. Conversely, SSS is relatively weakly related to the alongshore wind during spring, suggesting that variability in upwelling makes only a modest contribution to variability of SSS in the nearshore environment. Consistent with previous studies, secular trends indicate long-term warming and freshening of the coastal ocean at most stations. It is shown that long-term SST trends can be obscured by the pronounced climatic variability of these waters, requiring that time series extend for several decades to be reliably detected.

  18. Low subjective socioeconomic status stimulates orexigenic hormone ghrelin - A randomised trial.

    Science.gov (United States)

    Sim, A Y; Lim, E X; Leow, M K; Cheon, B K

    2018-03-01

    Recent evidence suggests that lower perceived socioeconomic status is linked to increased appetite and intake of greater calories. Yet, whether insecurity of socioeconomic resources directly influences regulatory systems of appetite and energy intake is not known. Considering psychological states, mindsets and beliefs have shown to meaningfully affect physiological responses to food, the present study tested the hypothesis that low subjective socioeconomic status (SSS) will have a direct influence on physiological responses, such as appetite-related hormones (ghrelin, pancreatic polypeptide and insulin). Forty-eight healthy males were randomly (crossover, counterbalanced) assigned, to two experimental conditions where participants were either experimentally induced to feel low SSS or not (control; CON). Feelings of low SSS resulted in an increase in active ghrelin (an orexigenic hormone) following the SSS manipulation compared with baseline, while no change in active ghrelin was observed in CON. Furthermore, participants reported lower fullness and satiety following low SSS compared with CON. Our findings demonstrate that SSS may influence hunger regulation and appetite, and suggest that physiological systems regulating energy balance (i.e. caloric resources) may also be sensitive to perceived deprivation or imbalances in critical non-food resources (socioeconomic resources). Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Occupational asthma due to manual metal-arc welding of special stainless steels.

    Science.gov (United States)

    Hannu, T; Piipari, R; Kasurinen, H; Keskinen, H; Tuppurainen, M; Tuomi, T

    2005-10-01

    Occupational asthma (OA) can be induced by fumes of manual metal-arc welding on stainless steel. In recent years, the use of special stainless steels (SSS) with high chromium content has increased. This study presents two cases of OA caused by manual metal-arc welding on SSS. In both cases, the diagnosis of OA was based on respiratory symptoms, occupational exposure and positive findings in the specific challenge tests. In the first case, a 46-yr-old welder had experienced severe dyspnoea while welding SSS (SMO steel), but not in other situations. Challenge tests with both mild steel and stainless steel using a common electrode were negative. Welding SSS with a special electrode caused a delayed 37% drop in forced expiratory volume in one second (FEV1). In the second case, a 34-yr-old male had started to experience dyspnoea during the past few years, while welding especially SSS (Duplex steel). The workplace peak expiratory flow monitoring was suggestive of OA. Challenge tests with both mild steel and stainless steel using a common electrode did not cause bronchial obstruction. Welding SSS with a special electrode caused a delayed 31% drop in FEV1. In conclusion, exposure to manual metal-arc welding fumes of special stainless steel should be considered as a new cause of occupational asthma.

  20. The New Superfluid Helium Cryostats for the Short Straight Sections of the CERN Large Hadron Collider (LHC)

    CERN Document Server

    Cameron, W; Kurtyka, T; Parma, Vittorio; Renaglia, T; Rifflet, J M; Rohmig, P; Skoczen, Blazej; Tortschanoff, Theodor; Trilhe, P; Védrine, P; Vincent, D

    1998-01-01

    The lattice of the CERN Large Hadron Collider (LHC) contains 364 Short Straight Section (SSS) units, one in every 53 m long half-cell. An SSS consists of three major assemblies: the standard cryostat section, the cryogenic service module, and the jumper connection. The standard cryostat section of an SSS contains the twin aperture high-gradient superconducting quadrupole and two pairs of superconducting corrector magnets, operating in pressurized helium II at 1.9 K. Components for isolating cryostat insulation vacuum, and the cryogenic supply lines, have to be foreseen. Special emphasis is given to the design changes of the SSS following adoption of an external cryogenic supply line (QRL). A jumper connection connects the SSS to the QRL, linking all the cryogenic tubes necessary for the local full-cell cooling loop [at every second SSS]. The jumper is connected to one end of the standard cryostat section via the cryogenic service module, which also houses beam diagnostics, current feedthroughs, and instrument...

  1. Ehealth

    DEFF Research Database (Denmark)

    Pedersen, Natalia; Andersen, Nynne Nyboe; Végh, Zsuzsanna

    2014-01-01

    with LFD, LGG or a normal Danish/Western diet (ND) in patients with IBS fulfilling Rome III diagnostic criteria, recruited between November 2009 and April 2013. Patients were required to complete on a weekly basis the IBS severity score system (IBS-SSS) and IBS quality of life (IBS-QOL) questionnaires...... in a specially developed IBS web self-monitoring application. We investigated whether LFD or LGG could reduce IBS-SSS and improve QOL in IBS patients. RESULTS: One hundred twenty-three patients (median age 37 years, range: 18-74 years), 90 (73%) females were randomised: 42 to LFD, 41 to LGG and 40 to ND....... A significant reduction in mean ± SD of IBS-SSS from baseline to week 6 between LFD vs LGG vs ND was revealed: 133 ± 122 vs 68 ± 107, 133 ± 122 vs 34 ± 95, P SSS for baseline covariates showed statistically significant reduction of IBS-SSS in LFD group compared to ND (IBS-SSS...

  2. Synthesis and electrochemical probing of water-soluble poly(sodium 4-styrenesulfonate-co-acrylic acid)-grafted multiwalled carbon nanotubes

    International Nuclear Information System (INIS)

    Du Feipeng; Yang Yingkui; Xie Xiaolin; Wu Kangbing; Gan Tian; Liu Lang

    2008-01-01

    Water-soluble poly(sodium 4-styrenesulfonate-co-acrylic acid)-grafted multiwalled carbon nanotubes (MWNT-g-P(SSS-co-AA)) with core-shell nanostructure were successfully synthesized by in situ free radical copolymerization of sodium 4-strenesulfonate (SSS) and acrylic acid (AA) in the presence of MWNTs terminated with vinyl groups; their structure was characterized by FTIR, 1 H NMR, Raman, TGA and TEM. The results showed that the thickness and content of the copolymer layer grafted onto the MWNT surface are about 7-12 nm and 82.3%, respectively. The P(SSS-co-AA) covalently grafted on MWNTs provides MWNT-g-P(SSS-co-AA) with good hydrophilicity and solubility in water. Then a novel MWNT-g-P(SSS-co-AA)-modified glassy carbon electrode was fabricated by coating; its electrochemical properties were evaluated by electrochemical probe of K 3 [Fe(CN) 6 ], and its catalytic behaviors to the electrochemical oxidation processes of dopamine (DA) and serotonin (5-HT) were investigated. Since the MWNT-g-P(SSS-co-AA)-modified electrode possesses strong electron transfer capability, high electrochemical activity and catalytic ability, it can be used in sensitive, selective, rapid and simultaneous monitoring of biomolecules

  3. Comparison of the Retrieval of Sea Surface Salinity Using Different Instrument Configurations of MICAP

    Directory of Open Access Journals (Sweden)

    Lanjie Zhang

    2018-04-01

    Full Text Available The Microwave Imager Combined Active/Passive (MICAP has been designed to simultaneously retrieve sea surface salinity (SSS, sea surface temperature (SST and wind speed (WS, and its performance has also been preliminarily analyzed. To determine the influence of the first guess values uncertainties on the retrieved parameters of MICAP, the retrieval accuracies of SSS, SST, and WS are estimated at various noise levels. The results suggest that the errors on the retrieved SSS have not increased dues poorly known initial values of SST and WS, since the MICAP can simultaneously acquire SST information and correct ocean surface roughness. The main objective of this paper is to obtain the simplified instrument configuration of MICAP without loss of the SSS, SST, and WS retrieval accuracies. Comparisons are conducted between three different instrument configurations in retrieval mode, based on the simulation measurements of MICAP. The retrieval results tend to prove that, without the 23.8 GHz channel, the errors on the retrieved SSS, SST, and WS for MICAP could also satisfy the accuracy requirements well globally during only one satellite pass. By contrast, without the 1.26 GHz scatterometer, there are relatively large increases in the SSS, SST, and WS errors at middle/low latitudes.

  4. Aspects correlates with Scandinavian Stroke Scale for predicting early neurological impairment

    Directory of Open Access Journals (Sweden)

    Gustavo José Luvizutto

    2015-05-01

    Full Text Available Objective To investigate the correlation between the Alberta Program Early CT Score (ASPECTS and the Scandinavian Stroke Scale (SSS for the evaluation of neurological impairment in patients with acute stroke. Method 59 patients with a first acute ischemic stroke were evaluated. The ASPECTS were evaluated by 2 neurologists at admission and by another neurologist after 48 hours. The NIHSS and SSS was applied to determinate stroke severity. Correlations and agreements were analysed statistically by Spearman and Kappa tests. Results ASPECTS was correlated with National Institute of Health Stroke Scale (NIHSS at admission (r = -0.52; p < 0.001 and SSS (r = 0.50; p < 0.001. The ASPECTS and SSS items were most correlated with arm (r = 0.52; p < 0.001 and hand (r = 0.49; p < 0.001 motor power, and speech (r = 0.51; p < 0.001. The SSS of 25.5 shows sensitivity (68% and specificity (72% when associated with ASPECTS ≤ 7. Conclusion The SSS can predict worst neurological impairment when associated with lower values of ASPECTS.

  5. Numerical simulation of stress-strain state of electrophoretic shell molds

    Science.gov (United States)

    Sviridov, A. V.; Odinokov, V. I.; Dmitriev, E. A.; Evstigneev, A. I.; Bashkov, O. V.

    2017-10-01

    In the foundry engineering, castings obtained in one-piece non-gas-generating high-refractory electrophoretic shell molds (ShM) by investment patterns (IP) have an increased rejects percentage associated with low deformation resistance and crack resistance of the SM at different stages of their formation and manufacturing. Crack resistance of the ShM based on IP depends mainly on their stress-strain state (SSS) at various stages of mold forming. SSS decrease significantly improves their crack resistance and decreases their rejects percentage of castings occurring due to clogging and surface defects. In addition, the known methods of decreasing the SSS are still poorly understood. Thus, current research trends are to determine SSS at each stage of ShM forming and develop the ways to decrease it. Theoretical predicting of crack formation in multiple-layer axisymmetric shell molds is given in the work [1], and SSS of multiple-layer axisymmetric shell molds is given in the work [2]. Monolayer electrophoretic ShM had a lack of concern in this field, thus it became an argument for the present workMathematical Model of ShM SSS

  6. Existence and stability of circular orbits in general static and spherically symmetric spacetimes

    Science.gov (United States)

    Jia, Junji; Liu, Jiawei; Liu, Xionghui; Mo, Zhongyou; Pang, Xiankai; Wang, Yaoguang; Yang, Nan

    2018-02-01

    The existence and stability of circular orbits (CO) in static and spherically symmetric (SSS) spacetime are important because of their practical and potential usefulness. In this paper, using the fixed point method, we first prove a necessary and sufficient condition on the metric function for the existence of timelike COs in SSS spacetimes. After analyzing the asymptotic behavior of the metric, we then show that asymptotic flat SSS spacetime that corresponds to a negative Newtonian potential at large r will always allow the existence of CO. The stability of the CO in a general SSS spacetime is then studied using the Lyapunov exponent method. Two sufficient conditions on the (in)stability of the COs are obtained. For null geodesics, a sufficient condition on the metric function for the (in)stability of null CO is also obtained. We then illustrate one powerful application of these results by showing that three SSS spacetimes whose metric function is not completely known will allow the existence of timelike and/or null COs. We also used our results to assert the existence and (in)stabilities of a number of known SSS metrics.

  7. Improvement of spatial discretization error on the semi-analytic nodal method using the scattered source subtraction method

    International Nuclear Information System (INIS)

    Yamamoto, Akio; Tatsumi, Masahiro

    2006-01-01

    In this paper, the scattered source subtraction (SSS) method is newly proposed to improve the spatial discretization error of the semi-analytic nodal method with the flat-source approximation. In the SSS method, the scattered source is subtracted from both side of the diffusion or the transport equation to make spatial variation of the source term to be small. The same neutron balance equation is still used in the SSS method. Since the SSS method just modifies coefficients of node coupling equations (those used in evaluation for the response of partial currents), its implementation is easy. Validity of the present method is verified through test calculations that are carried out in PWR multi-assemblies configurations. The calculation results show that the SSS method can significantly improve the spatial discretization error. Since the SSS method does not have any negative impact on execution time, convergence behavior and memory requirement, it will be useful to reduce the spatial discretization error of the semi-analytic nodal method with the flat-source approximation. (author)

  8. Comparison of Long-Term Effect of Dual-Chamber Pacing and Alcohol Septal Ablation in Patients with Hypertrophic Obstructive Cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Jan Krejci

    2013-01-01

    Full Text Available Introduction. Nonpharmacological treatment of patients with hypertrophic obstructive cardiomyopathy (HOCM comprises surgical myectomy (SME, alcohol septal ablation (ASA, and dual-chamber (DDD pacing. The aim of the study was to compare the long-term effect of DDD pacing and ASA in symptomatic HOCM patients. Patients and Methods. We evaluated retrospective data from three cardiocenters; there were 24 patients treated with DDD pacing included and 52 treated with ASA followed for 101 ± 49 and 87 ± 23 months, respectively. Results. In the group treated with DDD pacing, the left ventricle outflow tract gradient (LVOTG decreased from 82 ± 44 mmHg to 21 ± 21 mmHg, and NYHA class improved from 2.7 ± 0.5 to 2.1 ± 0.6 (both P<0.001. In the ASA-treated group, a decline in LVOTG from 73 ± 38 mmHg to 24 ± 26 mmHg and reduction in NYHA class from 2.8 ± 0.5 to 1.7 ± 0.8 were observed (both P<0.001. The LVOTG change was similar in both groups (P=0.264, and symptoms were more affected by ASA (P=0.001. Conclusion. ASA and DDD pacing were similarly effective in reducing LVOTG. The symptoms improvement was more expressed in patients treated with ASA.

  9. Familial history, age and smoking are important risk factors for disc degeneration disease in Arabic pedigrees

    International Nuclear Information System (INIS)

    Livshits, Gregory; Cohen, Zvi; Higla, Orabi; Yakovenko, Konstantin

    2001-01-01

    The present study used computed tomography imaging to evaluate the extent and pattern of the intergenerational transmission of spinal disc degeneration disease (DDD) in complex pedigrees. Contribution of a number of the potential covariates was also studied using univariate and multivariate logistic regression analysis, as well as two types of complex segregation analysis models. Among 161 individuals studied, DDD was diagnosed in 60 individuals. The number of protruded discs varied from 1 to 4, mostly in lumbar or lumbosacral regions. The average age at onset of the disease was similar for both women (36.0 years) and men (34.8 years). The proportion of the individuals affected by the DDD status of their parents ranged from 10% in families of two healthy parents to 55.5% of two affected parents (p < 0.01). The results of the logistic regression analyses and complex segregation analysis were qualitatively the same: DDD status of parents, age and smoking were the main risk factors for disc herniation in the Arabic families we examined. All analyses showed a predominating role of the family history as a risk factor for DDD in offsprings. It showed, for example, four times higher risk at age 50 for individuals with two affected parents vs. those who have two non-affected parents. However, the results of models-fitting genetic analysis, did not confirm a monogenic Mendelian pattern of inheritance

  10. Outpatient utilization of psychopharmaceuticals: comparison between the cities of Zagreb and Sarajevo (2006-2009).

    Science.gov (United States)

    Catić, Tarik; Stimac, Danijela; Zivković, Krešimir; Zelić, Ana

    2012-08-01

    To determine the real outpatient utilization of psychiatric drugs in Zagreb (Croatia) and Sarajevo (Bosnia and Herzegovina) and to compare the outpatient utilization of psychiatric drugs between this two cities. Data on the outpatient utilization of psycholpetics and psychoanaleptics (N05 and N06) in both cities were received from pharmacies and collected during 2006-2009. Based on the data obtained, a number of DDD and DDD per 1000 inhabitants perday (DDD/1000/day) has been calculated. The data in Zagreb were received from all pharmacies in Zagreb, whereas only 50% of pharmacies in Sarajevo participated, thus an extrapolation of data for Sarajevo was required and accomplished. All drugs were classified according to the ATC system. Based on the data obtained, a number of DDD and DDD/1000/day was calculated for all N05 and N06 drugs. Overall utilization trend was similar between the cities Sarajevo and Zagreb and followed trends in other neighbouring countries. Total consumption of psycholeptics and psychoanaleptics in Sarajevo was 22.6% (on average) lower than in Zagreb, during the 4-year period. During the 2006-2009 period the total consumption of psychopharmaceuticals showed increasing trend with peak in 2008 with similar trend between Zagreb and Sarajevo. It is necessary to implement systematic approach to drug utilization monitoring in Sarajevo and Bosnia and Herzegovina in general in order to improve prescribing quality as it is done in Croatia.

  11. Clinical and pathological features of dense deposit disease in Chinese patients.

    Science.gov (United States)

    Wang, Jinquan; Tang, Zheng; Luo, Chunlei; Hu, Yanglin; Zeng, Caihong; Chen, Huiping; Liu, Zhihong

    2012-09-01

    Dense deposit disease (DDD) is a rare disease that has no universally effective treatment. Herein we explore the clinical and pathological features of DDD in Chinese patients and the therapeutic effect of Tripterygium wilfordii (TW). Clinical and pathological data of 10 Chinese patients with biopsy-proved DDD were collected and analyzed retrospectively. The patients consisted of 6 males and 4 females. All of them had heavy proteinuria and microscopic hematuria. Gross hematuria, renal insufficiency, anemia, hypertension and low serum complement 3 (C3) occurred in 3, 3, 5, 6 and 8 cases, respectively. Under light microscopy (LM), 8 cases exhibited membranoproliferative glomerulonephritis (MPGN). Periodic acid-Schiff (PAS) stain disclosed intense PAS-positive bright ribbon-like thickening of glomerular basement membranes (GBM). Immunofluorescence mainly showed diffuse fine granular and short linear deposition of C3 along the glomerular capillary wall. Under electron microscopy, ribbon-like electrondense intramembranous deposits were identified in the lamina densa of the GBM, along the tubule basement membranes (TBM) and wall of Bowman's capsule. Before admission, 6 cases were treated with prednisone, cyclophosphamide and/or cyclosporin A with no response. Proteinuria in 8 cases who received TW during the course decreased at different degrees. The clinical and pathological features in DDD patients were various. The effect of TW in patients with DDD merits further investigation.

  12. [Resistance of uropathogenic strains of Escherichia coli in pregnant women and other women in generative ages in comparison with antibiotics consumption in Zagreb].

    Science.gov (United States)

    Culig, Josip; Mlinarić-Dzepina, Ana; Leppée, Marcel; Vranes, Jasmina

    2010-02-01

    To compare resistance of uropathogenic strains of Escherichia coli (UPEC) to antibiotics in women in generative ages and pregnant women during two year period (2004 and 2008) in Zagreb, and comparison of resistance and the consumption of antibiotics. The standard disk-diffusion method was used for sensitivity testing to 16 different antibiotics. Data on antibiotic utilization were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants using Anatomical-Therapeutic-Chemical/DDD methodology. Data on antibiotic consumption during pregnancy were collected using a questionnaire filled in by 893 women after delivery. During 2004 resistance of UPEC to antimicrobial drugs was not different in pregnant and in non-pregnant women, with the exception of amoxicillin and nitrofurantoin, with statistically higher resistance in pregnant women (p drugs in Zagreb increased significantly, from 32 to 39 DDD/1000 inhabitants per day. The most used antibiotic was co-amoxiclav, and its utilization increased from 9.6 to 12.2 DDD/1000/day. Amoxicillin and co-amoxiclav were used during pregnancy by 9.6% interviewed women. The observed significant decrease of resistance to cefalexin makes that antibiotic the drug of choice for treatment of urinary tract infections in women in generative ages, and together with coamoxiclav can be administered in pregnancy. Constant monitoring of urinary tract pathogens resistance to antimicrobial agents ensures the effectiveness of empirical therapy, whose versatile use is limited due the potentially harmful effects of antimicrobial drugs on fetus.

  13. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  14. Evidence of CP violation in B -> hhh charmless decays

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    We present the first evidence of CP violation in the B+→ pi+pi-pi+,  B+→ K+pi+pi-, B+→ K+K-pi+ and B+→K+K-K+ decays using the 1.0 fb-1 of data collected by the LHCb experiment during 2011. The results show that the 3pi and Kpipi channels present a positive asymmetry while the KKpi and KKK modes present a negative asymmetry. We also study the variation of the CP violation effects in the phase space of each three-body decay.  We find significant inhomogeneities that reveal regions with particularly large asymmetries in the pipi and KK low mass regions in B+→pi+pi-pi+ and B+→K+K-pi+ respectively.

  15. Survival angst: Reading Hothead Paisan in the Trump era.

    Science.gov (United States)

    Barounis, Cynthia

    2018-04-25

    This essay considers Diane DiMassa's 1990s comic book series Hothead Paisan: Homicidal Lesbian Terrorist alongside the recent rise and visibility of White supremacist movements following the 2016 United States election. While Hothead's acts of queer revenge primarily target White heterosexual cismen, several issues feature Hothead taking aim at neo-Nazis and the KKK. Exploring the way in which Hothead's relationship to debility and capacity is mediated by her gender, sexuality, and race, the essay argues that a biopolitical approach, including the recent scholarly turn to the non-human, can provide a useful framework for approaching interlocking systems of violence and oppression that go beyond traditional intersectional models of resistance.

  16. Scattering from a Vegetation Layer with an Irregular Vegetation Soil Boundary

    Science.gov (United States)

    1981-10-01

    A 2)] -2jV ’L [k3 ,(k + kk)+k ’(k2 + k )]kL,)k ( kzk e z Z [k g(k. 3 + k’k’)+kf (k12+kx2 k3zkx pj •l k = k + k 2k")+k 2(k2+ ’: 3 = xk•k - - z 3z x...k1 2+(k 2 + k 𔃼) k2 "= k i(ks + •S"kl.(k 13 + k " k 2) (1 X 2) 12 2)/ 2 ift = a5 ,k: +a4 zkl)• t7 kr(k2 + kx)(2jk a S~27 bl 2k1 (k 3 + kzk ) 3 /a 8

  17. Assessing the Contribution of Sea Surface Temperature and Salinity to Coral δ18O using a Weighted Forward Model

    Science.gov (United States)

    Horlick, K. A.; Thompson, D. M.; Anderson, D. M.

    2015-12-01

    The isotopic ratio of 16O/18O (δ18O) in coral carbonate skeletons is a robust, high-resolution proxy for sea surface temperature (SST) and sea surface salinity (SSS) variability predating the instrumental record. Although SST and δ18O-water (correlated to SSS) variability both contribute to the δ18O signal in the coral carbonate archive, the paucity and limited temporal span of SST and SSS instrumental observations limit the ability to differentiate respective SST and SSS contribution to each δ18O record. From instrumental datasets such as HadISST v.3, ERSST, SODA, and Delcroix (2011), we forward model the δ18O ("pseudoproxy") signal using the linear bivariate forward model from Thompson 2011 ("pseudoproxy"= a1(SST)+a2(SSS)). By iteratively weighting (between 0 and 1 by 0.005) the relative contribution of SST and SSS terms to the δ18O "pseudoproxy" following Gorman et al. 2012 method, we derive the percent contributions of SST and SSS to δ18O at each site based on the weights that produce the optimal correlation to the observed coral δ18O signal. A Monte Carlo analysis of error propagation in the weighted and unweighted pseudoproxy time series was used to determine how well the weighted and unweighted forward models captured observed δ18O variance. Across the south-western Pacific (40 sites) we found that SST contributes from less than 8 to more than 78% of the variance. This work builds upon this simple forward model of coral δ18O and improves our understanding of potential sources of differences in the observed and forward modeled δ18O variability. These results may also improve SST and SSS reconstructions from corals by highlighting the reef areas whose coral δ18O signal is most heavily influenced by SST and SSS respectively. Using an inverse approach, creating a transfer function, local SST and SSS could also be reconstructed based on the site-specific weights and observed coral δ18O time series.

  18. Monthly Sea Surface Salinity and Freshwater Flux Monitoring

    Science.gov (United States)

    Ren, L.; Xie, P.; Wu, S.

    2017-12-01

    Taking advantages of the complementary nature of the Sea Surface Salinity (SSS) measurements from the in-situ (CTDs, shipboard, Argo floats, etc.) and satellite retrievals from Soil Moisture Ocean Salinity (SMOS) satellite of the European Space Agency (ESA), the Aquarius of a joint venture between US and Argentina, and the Soil Moisture Active Passive (SMAP) of national Aeronautics and Space Administration (NASA), a technique is developed at NOAA/NCEP/CPC to construct an analysis of monthly SSS, called the NOAA Blended Analysis of Sea-Surface Salinity (BASS). The algorithm is a two-steps approach, i.e. to remove the bias in the satellite data through Probability Density Function (PDF) matching against co-located in situ measurements; and then to combine the bias-corrected satellite data with the in situ measurements through the Optimal Interpolation (OI) method. The BASS SSS product is on a 1° by 1° grid over the global ocean for a 7-year period from 2010. Combined with the NOAA/NCEP/CPC CMORPH satellite precipitation (P) estimates and the Climate Forecast System Reanalysis (CFSR) evaporation (E) fields, a suite of monthly package of the SSS and oceanic freshwater flux (E and P) was developed to monitor the global oceanic water cycle and SSS on a monthly basis. The SSS in BASS product is a suite of long-term SSS and fresh water flux data sets with temporal homogeneity and inter-component consistency better suited for the examination of the long-term changes and monitoring. It presents complete spatial coverage and improved resolution and accuracy, which facilitates the diagnostic analysis of the relationship and co-variability among SSS, freshwater flux, mixed layer processes, oceanic circulation, and assimilation of SSS into global models. At the AGU meeting, we will provide more details on the CPC salinity and fresh water flux data package and its applications in the monitoring and analysis of SSS variations in association with the ENSO and other major climate

  19. The use of antibiotics in hospitalized adult typhoid patients in an Indonesian hospital

    Directory of Open Access Journals (Sweden)

    Anggita Bunga Anggraini

    2014-08-01

    Full Text Available AbstrakLatar belakang:Demam tifoid menduduki peringkat ke tiga dari 10 besar penyakit terbanyak pada pasien rawat inap di rumah sakit (RS di Indonesia pada tahun 2010. Selain itu terdapat peningkatan resistensi dan kasus-kasus karier, dan relaps. Penelitian ini menyajikan hasil analisis data tentang penggunaan antibiotik pada pasien tifoid dewasa rawat inap di suatu RS di Indonesia. Metode: Data penelitian diekstrak dari rekam medik pasien tifoid dewasa yang dirawat inap di RS PMI Bogor periode Juli-Desember 2012. Analisis dilakukan dengan kualitatif (DU90% dan kuantitatif (DDD/shr dengan menggunakan metode ATC/DDD. Hasil: Dari 459 pasien tifoid dewasa rawat inap diperoleh DDD/shr pasien tifoid dewasa rawat inap yang menggunakan antibiotik selama dari Juli sampai Desember 2012 sebesar 6,35 DDD/shr. Seftriakson merupakan antibiotika yang dipakai tertinggi yang setara 4,10 DDD/shr, yang berarti bahwa di antara 100 pasien tifoid, 4 pasien memakai seftriakson 2 g setiap hari. Selanjutnya, obat pada segmen 10% lebih banyak dibandingkan pada segmen 90%. Di antara 26 jenis antibiotika, 7 jenis di antaranya termasuk pada segmen DU 90% yaitu seftriakson (64,54%; levofloksasin (13,90%; ciprofloksasin (3,57%; meropenem (2,80%; metronidazol (2,52%; ampisilin-sulbaktam (1,65%; dan sefditoren pivoksil (1,60%.Kesimpulan:Antibiotik seftriakson yang paling banyak digunakan pada perawatan tifoid pasien dewasa rawat inap di rumah sakit. (Health Science Indones 2014;1:40-3Kata kunci:antibiotik, tifoid, ATC/DDD, DU 90%AbstractBackground: Typhoid fever was the third ranked disease among the top 10 diseases in hospitalized patients in Indonesia in 2011. There were increased drug resistance, increased number of carrier, and number of relapse cases. This study aimed to analyze the use of antibiotics in hospitalized adult typhoid patients in a hospital in Indonesia. Methods: The data were extracted from medical records of drug use in adult typhoid patients hospitalized

  20. Increased heart rate caused by atrial pacing with the closed-loop stimulation function prevented micturition syncope

    Directory of Open Access Journals (Sweden)

    Tatsuo Haraki, MD,PhD

    2013-10-01

    Full Text Available A 70-year-old man had been experiencing syncope several times a year. We implanted a DDD pacemaker with closed-loop stimulation (CLS function. When he urinated early in the morning, his increased atrial pacing rates elevated his heart rate (HR during and after micturition. After implantation of the DDD-CLS mode, he did not experience symptoms. In contrast, in the DDD-R mode, his intrinsic HR changed to atrial pacing after micturition but decreased to the basal rate within 2 min, and he experienced a sense of cold perspiration and presyncope. Increased HRs caused by atrial pacing with the CLS function were useful in the prevention of micturition syncope.

  1. Efficacy of Management for Rational Use of Antibiotics in Surgical Departments at a Multi-Disciplinary Hospital: Results of a 7-year Pharmacoepidemiological Research.

    Science.gov (United States)

    Korableva, A A; Yudina, E V; Ziganshina, L E

    Irrational medicine use including excessive use and abuse of antibiotics remains a crucial problem for the healthcare systems. In this regard, studies examining approaches to improving the clinical use of medicines are highly important. to assess the efficacy rate of management for the rational use of antibiotics in surgical departments of a multi-disciplinary hospital. The intervention complex combined the research, educational, and methodological activities: local protocols for perioperative antibiotic prophylaxis (PABP) for various surgical departments were developed; local PABP protocols were discussed with the physicians of specialized surgical departments; official order on implementation of PABP was issued; the list of drug prescriptions for registration of the first pre-operative antibiotic dose was changed; audit and feedback processes were introduced as well as consultations of a clinical pharmacologist were implemented. We assessed the efficacy rate of the interventions basing on the changes in consumption of antibiotics (both quantitatively and qualitatively) at surgical departments of a hospital using ATC/DDD methodology. Comparison of the studied outcomes was performed before and after the intervention implementation and between the departments (vascular and abdominal surgery). The consumption of antibacterial agents (ATCJ01) was measured as a number of defined daily doses (DDD) per 100 bed-days (DDD/100 bed-days, indicator recommended by the World Health Organization, WHO) and DDD per 100 treated patients (DDD/100 treated patients). From 2006 to 2012, a decrease in antibacterial consumption in surgical departments by 188 DDD/100 treated patients was observed. We obtained the opposite results when using an indicator of DDD/100 bed-days (increase by 2.5 DDD/100 bed-days) which could be explained by the dependence on indices of overall hospital work and its changes during the examined period. Observed changes in antibacterial consumption varied in

  2. A novel multiple-stage antimalarial agent that inhibits protein synthesis

    Science.gov (United States)

    Baragaña, Beatriz; Hallyburton, Irene; Lee, Marcus C. S.; Norcross, Neil R.; Grimaldi, Raffaella; Otto, Thomas D.; Proto, William R.; Blagborough, Andrew M.; Meister, Stephan; Wirjanata, Grennady; Ruecker, Andrea; Upton, Leanna M.; Abraham, Tara S.; Almeida, Mariana J.; Pradhan, Anupam; Porzelle, Achim; Martínez, María Santos; Bolscher, Judith M.; Woodland, Andrew; Norval, Suzanne; Zuccotto, Fabio; Thomas, John; Simeons, Frederick; Stojanovski, Laste; Osuna-Cabello, Maria; Brock, Paddy M.; Churcher, Tom S.; Sala, Katarzyna A.; Zakutansky, Sara E.; Jiménez-Díaz, María Belén; Sanz, Laura Maria; Riley, Jennifer; Basak, Rajshekhar; Campbell, Michael; Avery, Vicky M.; Sauerwein, Robert W.; Dechering, Koen J.; Noviyanti, Rintis; Campo, Brice; Frearson, Julie A.; Angulo-Barturen, Iñigo; Ferrer-Bazaga, Santiago; Gamo, Francisco Javier; Wyatt, Paul G.; Leroy, Didier; Siegl, Peter; Delves, Michael J.; Kyle, Dennis E.; Wittlin, Sergio; Marfurt, Jutta; Price, Ric N.; Sinden, Robert E.; Winzeler, Elizabeth A.; Charman, Susan A.; Bebrevska, Lidiya; Gray, David W.; Campbell, Simon; Fairlamb, Alan H.; Willis, Paul A.; Rayner, Julian C.; Fidock, David A.; Read, Kevin D.; Gilbert, Ian H.

    2015-06-01

    There is an urgent need for new drugs to treat malaria, with broad therapeutic potential and novel modes of action, to widen the scope of treatment and to overcome emerging drug resistance. Here we describe the discovery of DDD107498, a compound with a potent and novel spectrum of antimalarial activity against multiple life-cycle stages of the Plasmodium parasite, with good pharmacokinetic properties and an acceptable safety profile. DDD107498 demonstrates potential to address a variety of clinical needs, including single-dose treatment, transmission blocking and chemoprotection. DDD107498 was developed from a screening programme against blood-stage malaria parasites; its molecular target has been identified as translation elongation factor 2 (eEF2), which is responsible for the GTP-dependent translocation of the ribosome along messenger RNA, and is essential for protein synthesis. This discovery of eEF2 as a viable antimalarial drug target opens up new possibilities for drug discovery.

  3. Widespread increase of empirical carbapenem use in acute care hospitals in Catalonia, Spain.

    Science.gov (United States)

    Grau, Santiago; Fondevilla, Esther; Echeverría-Esnal, Daniel; Alcorta, Amaia; Limon, Enric; Gudiol, Francesc

    2018-04-24

    The overall increase in the use of carbapenems could lead to the selection of carbapenem-resistant bacteria. The objectives of this study were to analyze carbapenem use from 2008 to 2015 and their prescription profile in 58 hospitals affiliated to the VINCat Programme (nosocomial infection vigilance system). Retrospective, longitudinal and descriptive study of carbapenem use. Consecutive case-series study, looking for carbapenem prescription characteristics, conducted in January 2016. Use was calculated in defined daily doses (DDD)/100 patient-days (PD); prescription profiles were assessed using a standardized survey. Carbapenem use increased 88.43%, from 3.37 DDD/100-PD to 6.35 DDD/100-PD (pCatalonia. Stewardship interventions are required to prevent carbapenem overuse. Copyright © 2018 Elsevier España, S.L.U. and Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

  4. Medication usage in Majuro, Marshall Islands.

    Science.gov (United States)

    Harding, Andrew

    2005-03-01

    To conduct a drug utilisation study to determine the top 50 drugs by prescription count, top 50 drugs by cost to government and the top 30 drugs by consumption for Majuro Atoll, Marshall Islands for the year 2003. Data was collected from the Majuro Hospital computer dispensing system. All outpatient prescriptions dispensed in the year 2003 were included. The defined daily dose (DDD) methodology was employed. Drug consumption was presented as DDD/1000 population/day. The top 5 drugs by consumption in Majuro for 2003 were glibenclamide (glyburide), enalapril, ferrous sulphate, amoxycillin and ascorbic acid. Values for the DDD/1000 population/day were on average lower than many other countries. This is the first local study of medication usage in the Marshall Islands. It provided some useful baseline data.

  5. The generation and functional characterization of induced pluripotent stem cells from human intervertebral disc nucleus pulposus cells.

    Science.gov (United States)

    Zhu, Yanxia; Liang, Yuhong; Zhu, Hongxia; Lian, Cuihong; Wang, Liang; Wang, Yiwei; Gu, Hongsheng; Zhou, Guangqian; Yu, Xiaoping

    2017-06-27

    Disc degenerative disease (DDD) is believed to originate in the nucleus pulposus (NP) region therefore, it is important to obtain a greater number of active NP cells for the study and therapy of DDD. Human induced pluripotent stem cells (iPSCs) are a powerful tool for modeling the development of DDD in humans, and have the potential to be applied in regenerative medicine. NP cells were isolated from DDD patients following our improved method, and then the primary NP cells were reprogramed into iPSCs with Sendai virus vectors encoding 4 factors. Successful reprogramming of iPSCs was verified by the expression of surface markers and presence of teratoma. Differentiation of iPSCs into NP-like cells was performed in a culture plate or in hydrogel, whereby skin fibroblast derived-iPSCs were used as a control. Results demonstrated that iPSCs derived from NP cells displayed a normal karyotype, expressed pluripotency markers, and formed teratoma in nude mice. NP induction of iPSCs resulted in the expression of NP cell specific matrix proteins and related genes. Non-induced NP derived-iPSCs also showed some NP-like phenotype. Furthermore, NP-derived iPSCs differentiate much better in hydrogel than that in a culture plate. This is a novel method for the generation of iPSCs from NP cells of DDD patients, and we have successfully differentiated these iPSCs into NP-like cells in hydrogel. This method provides a novel treatment of DDD by using patient-specific NP cells in a relatively simple and straightforward manner.

  6. Coronary grafts flow and cardiac pacing modalities: how to improve perioperative myocardial perfusion.

    LENUS (Irish Health Repository)

    D'Ancona, Giuseppe

    2012-02-03

    OBJECTIVE: Aim of this study was to investigate modifications of coronary grafts flow during different pacing modalities after CABG. MATERIALS AND METHODS: Two separate prospective studies were conducted in patients undergoing CABG and requiring intraoperative epicardial pacing. In a first study (22 patients) coronary grafts flows were measured during dual chamber pacing (DDD) and during ventricular pacing (VVI). In a second study (10 patients) flows were measured during DDD pacing at different atrio-ventricular (A-V) delay periods. A-V delay was adjusted in 25 ms increments from 25 to 250 ms and flow measurements were performed for each A-V delay increment. A transit time flowmeter was used for the measurements. RESULTS: An average of 3.4 grafts\\/patient were performed. In the first study, average coronary graft flow was 47.4+\\/-20.8 ml\\/min during DDD pacing and 41.8+\\/-18.2 ml\\/min during VVI pacing (P = 0.0004). Furthermore average systolic pressure was 94.3+\\/-10.1 mmHg during DDD pacing and 89.6+\\/-12.2 mmHg during VVV pacing (P = 0.0007). No significant differences in diastolic pressure were recorded during the two different pacing modalities. In the second study, maximal flows were achieved during DDD pacing with an A-V delay of 175 ms (54+\\/-9.6 ml\\/min) and minimal flows were detected at 25 ms A-V delay (38.1+\\/-4.7 ml\\/min) (P=ns). No significant differences in systolic or diastolic blood pressure were noticed during the different A-V delays. CONCLUSION: Grafts flowmetry provides an extra tool to direct supportive measures such as cardiac pacing after CABG. DDD mode with A-V delay around 175 ms. should be preferred to allow for maximal myocardial perfusion via the grafts.

  7. [Evaluation of antimicrobial consumption en 15 Chilean hospitals: Results of a collaborative work, 2013].

    Science.gov (United States)

    Domínguez, Isabel; Rosales, Ruth; Cabello, Ángela; Bavestrello, Luis; Labarca, Jaime

    2016-06-01

    Surveillance of antimicrobial consumption is a central part in programs of antibiotic stewardship. However, in Chile there are no national data on antibiotic consumption representing a significant number of hospitals by clinical services. In 2013 a survey was sent to multiple Chilean hospitals to evaluate antimicrobial consumption in medical services (MS), surgery services (SS) and critical care units (ICU). We used the standardized methodology recommended by the WHO, using the number of DDD/100 days beds. In the MS and SS beta-lactam and no beta-lactam antibiotics commonly used were evaluated. In the ICU consumption vancomycin, linezolid, imipenem, merope-nem, colistin and tigecycline was evaluated. Fifteen hospitals reported the density of antimicrobial consumption. Ceftriaxone and cloxacillin were the most commonly used antibiotics in general services (average cloxacillin 4,9 DDD/100 bed days in MS and 8,0 DDD/100 in SS; ceftriaxone 13,5 DDD/100 in MS and 16,7 DDD/100 in SS). In the SS there was also a significant consumption of metronidazole (average 14,5 DDD/100 bed days). In the ICU there was an important variability of consumption of selected antibiotics. This study reports the average and range of antibiotic consumption in MS, SS, and ICU from a significant number of hospitals in the country, during 2013. This information allows hospitals to compare their consumption of antibiotics with a significant sample of Chilean hospitals. Analysis of this information should consider a careful interpretation according to the sample shown here and the reality of each hospital.

  8. Factors influencing anti-asthmatic generic drug consumption in Morocco: 1999-2010.

    Science.gov (United States)

    Ghanname, Imane; Ahid, Samir; Berrada, Ghizlane; Belaiche, Abdelmjid; Hassar, Mohammed; Cherrah, Yahia

    2014-01-01

    The increasing availability of generic drugs (GD) resulted in a remarkable reduction in treatment costs that allowed a better access to health care.The aim of this study is to evaluate the share of anti-asthmatic generic drugs during the period 1999-2010 in Morocco and to look at the factors influencing generic development. In this study, we used Moroccan sales data from IMS Health (Intercontinental Marketing Services). The consumption of the drugs was expressed in DDD/1000 inhabitants/day according to the WHO ATC/DDD methodology. Between 1999 and 2010, anti-asthmatic consumption increased from 3.91 to 14.43 DDD/1000 inhabitants/day. The market of anti-asthmatic generic drugs progressed from 1.83 (47%) to 2.18 (23%) DDD/1000 inhabitants/day from 1999 to 2010. In 2010, inhaled glucocorticosteroids ranked first (0.83 DDD/1000 inhabitants/day), followed by inhaled short acting beta agonists (0.73 DDD/1000 inhabitants/day). The number of brands went from 27 in 1999 to 34 in 2010, with a generic share increasing from 55.55% to 70.59%. The number of anti-asthmatic pharmaceutical preparations increased from 57 to 64 during the same period, of which 31 and 42 were generic preparations. In 2010, the total cost of anti-asthmatic dugs was about 22 million euro, the generics representing 14 million euro. Despite the introduction of a compulsory insurance scheme called "AMO", that allows a refund for 69.5% of anti-asthmatic specialties marketed in Morocco, anti-asthmatic generic drug consumption remains limited. The Moroccan market is still largely dominated by the originator drugs with still valid patents.

  9. A critique of the molecular target-based drug discovery paradigm based on principles of metabolic control: advantages of pathway-based discovery.

    Science.gov (United States)

    Hellerstein, Marc K

    2008-01-01

    Contemporary drug discovery and development (DDD) is dominated by a molecular target-based paradigm. Molecular targets that are potentially important in disease are physically characterized; chemical entities that interact with these targets are identified by ex vivo high-throughput screening assays, and optimized lead compounds enter testing as drugs. Contrary to highly publicized claims, the ascendance of this approach has in fact resulted in the lowest rate of new drug approvals in a generation. The primary explanation for low rates of new drugs is attrition, or the failure of candidates identified by molecular target-based methods to advance successfully through the DDD process. In this essay, I advance the thesis that this failure was predictable, based on modern principles of metabolic control that have emerged and been applied most forcefully in the field of metabolic engineering. These principles, such as the robustness of flux distributions, address connectivity relationships in complex metabolic networks and make it unlikely a priori that modulating most molecular targets will have predictable, beneficial functional outcomes. These same principles also suggest, however, that unexpected therapeutic actions will be common for agents that have any effect (i.e., that complexity can be exploited therapeutically). A potential operational solution (pathway-based DDD), based on observability rather than predictability, is described, focusing on emergent properties of key metabolic pathways in vivo. Recent examples of pathway-based DDD are described. In summary, the molecular target-based DDD paradigm is built on a naïve and misleading model of biologic control and is not heuristically adequate for advancing the mission of modern therapeutics. New approaches that take account of and are built on principles described by metabolic engineers are needed for the next generation of DDD.

  10. Pitfalls associated with the therapeutic reference pricing practice of asthma medication.

    Science.gov (United States)

    Kalo, Zoltan; Abonyi-Toth, Zsolt; Bartfai, Zoltan; Voko, Zoltan

    2012-07-20

    Therapeutic reference pricing (TRP) based on the WHO daily defined dose (DDD) is a method frequently employed for the cost-containment of pharmaceuticals. Our objective was to compare average drug use in the real world with DDD and to evaluate whether TRP based on DDD could result in cost savings on maintenance medication and the total direct health expenditures for asthma patients treated with Symbicort Turbuhaler (SYT) and Seretide Diskus (SED) in Hungary. Real-world data were derived from the Hungarian National Health Insurance Fund database. Average doses and costs were compared between the high-dose and medium-dose SYT and SED groups. Multiple linear regressions were employed to adjust the data for differences in the gender and age distribution of patients. 27,779 patients with asthma were included in the analysis. Average drug use was lower than DDD in all groups, 1.38-1.95 inhalations in both SED groups, 1.28-1.97 and 1.74-2.49 inhalations in the medium and high-dose SYT groups, respectively. Although the cost of SED based on the DDD would be much lower than the cost of SYT in the medium-dose groups, no difference was found in the actual cost of the maintenance therapy. No significant differences were found between the groups in terms of total medical costs. Cost-containment initiatives by payers may influence clinical decisions. TRP for inhalation asthma drugs raises special concern, because of differences in the therapeutic profile of pharmaceuticals and the lack of proven financial benefits after exclusion of the effect of generic price erosion. Our findings indicate that the presented TRP approach of asthma medications based on the daily therapeutic costs according to the WHO DDD does not result in reduced public healthcare spending in Hungary. Further analysis is required to show whether TRP generates additional expenditures by inducing switching costs and reducing patient compliance. Potential confounding factors may limit the generalisability of our

  11. Use of antibacterial agents in an intensive care unit in a hospital in Brazil.

    Science.gov (United States)

    dos Santos, E F; Lauria-Pires, L; Pereira, M G; Silva, A E; Rodrigues, I P; Maia, M O

    2007-06-01

    It is essential to monitor the utilisation of antibacterial drugs in order to establish appropriate measures for their control. The pattern of usage of antibacterial drugs, and its association with indicators of hospital infection, has been investigated in a non-specialized adult intensive care unit (ICU) located in Santa Luzia Hospital (Brasília, DF, Brazil). The study was conducted between January 2001 and June 2004. Data concerning the utilisation of systemic antibacterial drugs, classified according to the Anatomical Therapeutic Chemical/Defined Daily Dose (ATC/DDD) system, and indicators of hospital infection, defined according to the National Nosocomial Infections Surveillance (NNIS) system, were obtained from appropriate hospital archives. During the study period, the average utilisation of antibacterial drugs was 1918.5 DDD units per 1000 patient-day (DDD(1000)). The three most used drugs were penicillins/beta-lactamase inhibitors (535.3 DDD(1000)), third generation cephalosporins (239.1 DDD(1000)) and quinolones (212.5 DDD(1000)). The total utilisation of antibacterial drugs was correlated significantly with the incidence of hospital infection (R = 0.62; p < 0.01) and the index of invasive procedures (R = 0.41; p < 0.01). Furthermore, the latter two indicators were significantly and positively correlated with the use of recently commercialized, broad spectrum antibacterial drugs (except for carbapenems). It is concluded that improved infection control procedures, together with more rigorous criteria regarding the use of invasive procedures, should be implemented by the ICU studied in order to diminish the utilisation of antibacterial drugs.

  12. Detection of DDT and its metabolites in two estuaries of South China using a SPME-based device: First report of p,p'-DDMU in water column

    International Nuclear Information System (INIS)

    Xing Yuanna; Guo Ying; Xie Mei; Shen Rulang; Zeng, Eddy Y.

    2009-01-01

    A solid-phase microextration-based sampling method was employed to determine the concentrations of 1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane (DDT) and its metabolites, 1,1-dichloro-2,2-bis(p-chlorophenyl)ethane (DDD), 1,1-dichloro-2,2-bis(p-chlorophenyl)ethene (DDE) and 1-chloro-2,2-bis(p-chlorophenyl)ethene (DDMU), in two estuarine bays, Daya Bay and Hailing Bay, of South China. Six DDT components including p,p'-DDT, o,p'-DDD, p,p'-DDD, o,p'-DDE, p,p'-DDE, and p,p'-DDMU were detected in Hailing Bay, while only p,p'-DDD was found in Daya Bay. p,p'-DDD was the most abundant DDT component in both bays, sharply different from the previous finding in the water column of the Palos Verdes Shelf, California, USA that p,p'-DDE was prevalent. In addition, the occurrence of p,p'-DDMU (with a range of 0.047-0.21 ng/L in Hailing Bay) has not been reported around the globe, and its presence in our study region appeared to stem from dehydrochlorination of p,p'-DDD, favored under aerobic conditions, but further investigations are clearly needed to confirm the mechanism for generation of DDMU in estuarine environments. - DDT and its metabolites, particularly p,p'-DDMU, are detected in the water column of two estuarine bays in South China using a SPME-based sampler

  13. Characterization of a direct detection device imaging camera for transmission electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Milazzo, Anna-Clare, E-mail: amilazzo@ncmir.ucsd.edu [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Moldovan, Grigore [Department of Materials, University of Oxford, Parks Road, Oxford OX1 3PH (United Kingdom); Lanman, Jason [Department of Molecular Biology, The Scripps Research Institute, La Jolla, CA 92037 (United States); Jin, Liang; Bouwer, James C. [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Klienfelder, Stuart [University of California at Irvine, Irvine, CA 92697 (United States); Peltier, Steven T.; Ellisman, Mark H. [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States); Kirkland, Angus I. [Department of Materials, University of Oxford, Parks Road, Oxford OX1 3PH (United Kingdom); Xuong, Nguyen-Huu [University of California at San Diego, 9500 Gilman Dr., La Jolla, CA 92093 (United States)

    2010-06-15

    The complete characterization of a novel direct detection device (DDD) camera for transmission electron microscopy is reported, for the first time at primary electron energies of 120 and 200 keV. Unlike a standard charge coupled device (CCD) camera, this device does not require a scintillator. The DDD transfers signal up to 65 lines/mm providing the basis for a high-performance platform for a new generation of wide field-of-view high-resolution cameras. An image of a thin section of virus particles is presented to illustrate the substantially improved performance of this sensor over current indirectly coupled CCD cameras.

  14. Characterization of a direct detection device imaging camera for transmission electron microscopy

    International Nuclear Information System (INIS)

    Milazzo, Anna-Clare; Moldovan, Grigore; Lanman, Jason; Jin, Liang; Bouwer, James C.; Klienfelder, Stuart; Peltier, Steven T.; Ellisman, Mark H.; Kirkland, Angus I.; Xuong, Nguyen-Huu

    2010-01-01

    The complete characterization of a novel direct detection device (DDD) camera for transmission electron microscopy is reported, for the first time at primary electron energies of 120 and 200 keV. Unlike a standard charge coupled device (CCD) camera, this device does not require a scintillator. The DDD transfers signal up to 65 lines/mm providing the basis for a high-performance platform for a new generation of wide field-of-view high-resolution cameras. An image of a thin section of virus particles is presented to illustrate the substantially improved performance of this sensor over current indirectly coupled CCD cameras.

  15. Recent Progress in Discrete Dislocation Dynamics and Its Applications to Micro Plasticity

    KAUST Repository

    Po, Giacomo; Mohamed, Mamdouh S.; Crosby, Tamer; Erel, Can; El-Azab, Anter; Ghoniem, Nasr

    2014-01-01

    We present a self-contained review of the discrete dislocation dynamics (DDD) method for the numerical investigation of plasticity in crystals, focusing on recent development and implementation progress. The review covers the theoretical foundations of DDD within the framework of incompatible elasticity, its numerical implementation via the nodal method, the extension of the method to finite domains and several implementation details. Applications of the method to current topics in micro-plasticity are presented, including the size effects in nano-indentation, the evolution of the dislocation microstructure in persistent slip bands, and the phenomenon of dislocation avalanches in micro-pillar compression.

  16. Estimation of flow stress of radiation induced F/M steels using molecular dynamics and discrete dislocation dynamics approach

    International Nuclear Information System (INIS)

    More, Ameya; Dutta, B.K.; Durgaprasad, P.V.; Arya, A.K.

    2012-01-01

    Fe-Cr based Ferritic/Martensitic (F/M) steels are the candidate structural materials for future fusion reactors. In this work, a multi-scale approach comprising atomistic Molecular Dynamics (MD) simulations and Discrete Dislocation Dynamics (DDD) simulations are used to model the effect of irradiation dose on the flow stress of F/M steels. At the atomic scale, molecular dynamics simulations are used to study the dislocation interaction with irradiation induced defects, i.e. voids and He bubbles. Whereas, the DDD simulations are used to estimate the change in flow stress of the material as a result of irradiation hardening. (author)

  17. V. Tormis: "Bridge of Song / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "V. Tormis: "Bridge of Song" - Bridge of Song; Singing aboard ship; Brides Farewell; Kihnu Island Wedding Songs; 17 Estonian Wedding Songs; Three Estonian Game Songs; Four Estonian Lullabies. Estonian Radio Choir / Toomas Kapten. Finlandia 4509 96937-2; 56:52 DDD; "People of Kalevala" - God protect us from war; Vespian Winter; Eagle Flew From the North East; Plague Memory; Vainamoinen's Words of Wisdom; The Seventeenth Rune of Kalevala. National Male Choir of Estonia. Finlandia 0630 12245-2; 56:52 DDD

  18. Distribution and trends in outpatient utilization of generic versus brand name psychopharmaceuticals during a ten-year period in Croatia.

    Science.gov (United States)

    Polić-ViŽintin, Marina; Stimac, Danijela; Sostar, Zvonimir; Tripković, Ingrid

    2014-08-15

    Drug costs increasingly pose a burden upon the otherwise inadequate health care resources and rational drug utilization is an important segment of every national health policy. Optimal patient care should be the goal of rational pharmacotherapy, whereby the economic burden of treatment is just one of the elements to be considered on choosing appropriate therapy.The aim of this study was to determine distribution and trends in the outpatient utilization of generic versus brand name psychopharmaceuticals and to evaluate the rationality of prescribing psychopharmaceuticals during a ten-year period. Using the World Health Organization Anatomical-Therapeutic-Chemical classification/Defined Daily Doses (ATC/DDD) methodology, the number of DDD was calculated from data collected from pharmacies on the number and size of drug packages. The ratio of generic and brand name drug costs served as an indicator on assessing the rationality of drug utilization. Total cost for psychopharmaceuticals increased by 20.1%, more for brand name than for generic agents (32.7% vs. 7.4%). The highest share of generic psychopharmaceuticals as compared with brand name drugs according to DDD per 1000 inhabitants per day (DDD/1000/day) was in the group of psycholeptics (83.6% in 2001 vs. 82.2% in 2010), most in hypnotics and sedatives, and least in antipsychotics. The share of generic psychopharmaceuticals in total drug utilization according to financial indicators decreased by 9.6% and according to DDD/1000/day by 12%. The greatest decrease was in antidepressants, i.e. by 33.8% according to financial indicators and by 46% according to DDD/1000/day; and in antipsychotics by 30.9% according to DDD/1000/day, while showing an increase by 8.5% according to financial indicators. In the therapeutic subgroup of mood stabilizers, the share of generic drugs in total drug utilization declined by 32% according to DDD/1000/day, but increased by 25.1% according to financial indicators. The lack of uniform

  19. Recent Progress in Discrete Dislocation Dynamics and Its Applications to Micro Plasticity

    KAUST Repository

    Po, Giacomo

    2014-09-27

    We present a self-contained review of the discrete dislocation dynamics (DDD) method for the numerical investigation of plasticity in crystals, focusing on recent development and implementation progress. The review covers the theoretical foundations of DDD within the framework of incompatible elasticity, its numerical implementation via the nodal method, the extension of the method to finite domains and several implementation details. Applications of the method to current topics in micro-plasticity are presented, including the size effects in nano-indentation, the evolution of the dislocation microstructure in persistent slip bands, and the phenomenon of dislocation avalanches in micro-pillar compression.

  20. Impact of over-the-counter restrictions on antibiotic consumption in Brazil and Mexico.

    Directory of Open Access Journals (Sweden)

    Yared Santa-Ana-Tellez

    Full Text Available BACKGROUND: In Latin American countries over-the-counter (OTC dispensing of antibiotics is common. In 2010, both Mexico and Brazil implemented policies to enforce existing laws of restricting consumption of antibiotics only to patients presenting a prescription. The objective of the present study is therefore to evaluate the impact of OTC restrictions (2010 on antibiotics consumption in Brazil and Mexico. METHODS AND FINDINGS: Retail quarterly sales data in kilograms of oral and injectable antibiotics between January 2007 and June 2012 for Brazil and Mexico were obtained from IMS Health. The unit of analysis for antibiotics consumption was the defined daily dose per 1,000 inhabitants per day (DDD/TID according to the WHO ATC classification system. Interrupted time series analysis was conducted using antihypertensives as reference group to account for changes occurring independently of the OTC restrictions directed at antibiotics. To reduce the effect of (a seasonality and (b autocorrelation, dummy variables and Prais-Winsten regression were used respectively. Between 2007 and 2012 total antibiotic usage increased in Brazil (from 5.7 to 8.5 DDD/TID, +49.3% and decreased in Mexico (10.5 to 7.5 DDD/TID, -29.2%. Interrupted time series analysis showed a change in level of consumption of -1.35 DDD/TID (p<0.01 for Brazil and -1.17 DDD/TID (p<0.00 for Mexico. In Brazil the penicillins, sulfonamides and macrolides consumption had a decrease in level after the intervention of 0.64 DDD/TID (p = 0.02, 0.41 (p = 0.02 and 0.47 (p = 0.01 respectively. While in Mexico it was found that only penicillins and sulfonamides had significant changes in level of -0.86 DDD/TID (p<0.00 and -0.17 DDD/TID (p = 0.07. CONCLUSIONS: Despite different overall usage patterns of antibiotics in Brazil and Mexico, the effect of the OTC restrictions on antibiotics usage was similar. In Brazil the trend of increased usage of antibiotics was tempered after the OTC restrictions; in

  1. Correlation of radiographic and MRI parameters to morphological and biochemical assessment of intervertebral disc degeneration

    OpenAIRE

    Benneker, Lorin M.; Heini, Paul F.; Anderson, Suzanne E.; Alini, Mauro; Ito, Keita

    2004-01-01

    Degenerative disc disease (DDD) is a common finding in MRI scans and X-rays. However, their correlation to morphological and biochemical changes is not well established. In this study, radiological and MRI parameters of DDD were assessed and compared with morphological and biochemical findings of disc degeneration. Thirty-nine human lumbar discs (L1–S1), age 19–86 years, were harvested from eight cadavers. Within 48 h postmortem, MRIs in various spin-echo sequences and biplanar radiographs of...

  2. Oxidation of 5,6-diamino-1,3-dimethyl-2,4-dioxopyrimidine by perrhenate: the crystal structure of 1,3,6,8-tetramethylpyrimidopteridine-2,4,5,7-tetrone

    International Nuclear Information System (INIS)

    Booysen, Irvin; Gerber, Thomas I.A.; Mayer, Peter

    2008-01-01

    The oxidation of 5,6-diamino-1,3-dimethyl-2,4-dioxopyrimidine (H 2 ddd) by perrhenate (ReO 4 - ) led to the formation of 1,3-dimethylalloxan, which condenses with unoxidized H 2 ddd to yield the product 1,3,6,8-tetramethylpyrimidopteridine-2,4,5,7-tetrone (tppt). The structure of tppt consists of a central pyrazine ring and two terminal pyrimidine rings in cis positions. The dihedral angles between the pyrazine and pyrimidine rings are 1.08 deg and 1.20 deg. (author)

  3. Spouse's subjective social status predicts older adults' prospective cognitive functioning.

    Science.gov (United States)

    Zhang, Fan; Fung, Helene; Kwok, Timothy

    2017-12-06

    The current study aims to investigate the association between subjective social status (SSS) and prospective cognitive functioning of older adults and their spouses, and to explore the potential mediating roles of health habits and physical activities in this association. Using the longitudinal data of 512 pairs of community-dwelling older couples aged 65-91 years (M = 72.2 ± 4.6), we tested the effects of SSS in cognitive functioning using an Actor-Partner Interdependence Model. SSS was measured by a self-anchoring social ladder, and cognitive functioning was measured by the Mini-Mental State Examination at baseline and 4-year follow-up. Socioeconomic status (i.e. education) was tested as a moderator, and physical activity (measured by the Physical Activity Scale for the Elderly) as well as health habits (i.e. tobacco and alcohol consumption) were included as potential mediators. A partner effect of SSS was found only in the low-education group, in which the wife's higher level of SSS in the community was associated with the husband's better cognitive functioning in the follow-up. A small proportion of this effect was found to be partially mediated by participation in housework, such that the wife's higher SSS was associated with the husband's increased housework activity, which was related to higher prospective cognitive functioning. By examining the dyadic effects of SSS with a longitudinal design, our findings extended the understanding on how subjective social status influenced older couples' cognitive health, and provided evidence-based insights for future studies on cognitive health in later life.

  4. The blood flow changes associated with idiopathic and secondary intracranial hypertension

    International Nuclear Information System (INIS)

    Bateman, G.

    2002-01-01

    Full text: The radiological diagnosis of idiopathic intracranial hypertension (IIH) is one of exclusion and as the MR venogram is prone to flow artefacts, the diagnosis of secondary intracranial hypertension (SIH) can also be problematic. The purpose of this paper is to define the blood flow characteristics, which are useful in the diagnosis of these conditions. Twelve patients with clinical findings suggestive of IIH and 12 control subjects were investigated with MR venography and MR flow quantification studies of the cerebral arteries and veins. Total cerebral blood flow, superior sagittal sinus (SSS) and straight sinus (ST) blood flows were measured. MR venography confirmed 7 of the 12 patients had venous outflow obstruction and thus SIH. The remaining 5 patients had IIH. The control patients mean total blood flow was 855 ml/min, the SSS flow was 400ml/min and the ST flow 117 ml/min. The total blood flow in the IIH patients was 46% higher (P = 0.0002) and the ST blood flow 38% higher (P = 0.05) than the control group, the SSS flow was 17% higher but this failed to reach significance. In SIH the SSS flow was reduced by 25% (P = 0.003) compared with the control group, the total and ST blood flow were not significantly altered. In IIH there is hyperaemia and the SSS appears limited in its ability to increase flow, therefore venous collaterals carry a greater load. In SIH, selective obstruction of the SSS reduces flow in this vessel but total blood flow is normal indicating there is also increased flow in collateral veins. Presumably the limited ability of the SSS to drain blood away from the brain in each condition raises venous sinus pressure and alters CSF resorption giving raised CSF pressure. Copyright (2002) Blackwell Science Pty Ltd

  5. Excess costs from functional somatic syndromes in Germany - An analysis using entropy balancing.

    Science.gov (United States)

    Grupp, Helen; Kaufmann, Claudia; König, Hans-Helmut; Bleibler, Florian; Wild, Beate; Szecsenyi, Joachim; Herzog, Wolfgang; Schellberg, Dieter; Schäfert, Rainer; Konnopka, Alexander

    2017-06-01

    The aim of this study was to calculate disorder-specific excess costs in patients with functional somatic syndromes (FSS). We compared 6-month direct and indirect costs in a patient group with FSS (n=273) to a control group of the general adult population in Germany without FSS (n=2914). Data on the patient group were collected between 2007 and 2009 in a randomized controlled trial (speciAL). Data on the control group were obtained from a telephone survey, representative for the general German population, conducted in 2014. Covariate balance between the patient group and the control group was achieved using entropy balancing. Excess costs were calculated by estimating generalized linear models and two-part models for direct costs and indirect costs. Further, we estimated excess costs according to the level of somatic symptom severity (SSS). FSS patients differed significantly from the control group regarding 6-month costs of outpatient physicians (+€280) and other outpatient providers (+€74). According to SSS, significantly higher outpatient physician costs were found for mild (+€151), moderate (+€306) and severe (+€376) SSS. We also found significantly higher costs of other outpatient providers in patients with mild, moderate and severe SSS. Regarding costs of rehabilitation and hospital treatments, FSS patients did not differ significantly from the control group for any level of SSS. Indirect costs were significantly higher in patients with severe SSS (+€760). FSS were of major importance in the outpatient sector. Further, we found significantly higher indirect costs in patients with severe SSS. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Saturated salt solution method: a useful cadaver embalming for surgical skills training.

    Science.gov (United States)

    Hayashi, Shogo; Homma, Hiroshi; Naito, Munekazu; Oda, Jun; Nishiyama, Takahisa; Kawamoto, Atsuo; Kawata, Shinichi; Sato, Norio; Fukuhara, Tomomi; Taguchi, Hirokazu; Mashiko, Kazuki; Azuhata, Takeo; Ito, Masayuki; Kawai, Kentaro; Suzuki, Tomoya; Nishizawa, Yuji; Araki, Jun; Matsuno, Naoto; Shirai, Takayuki; Qu, Ning; Hatayama, Naoyuki; Hirai, Shuichi; Fukui, Hidekimi; Ohseto, Kiyoshige; Yukioka, Tetsuo; Itoh, Masahiro

    2014-12-01

    This article evaluates the suitability of cadavers embalmed by the saturated salt solution (SSS) method for surgical skills training (SST). SST courses using cadavers have been performed to advance a surgeon's techniques without any risk to patients. One important factor for improving SST is the suitability of specimens, which depends on the embalming method. In addition, the infectious risk and cost involved in using cadavers are problems that need to be solved. Six cadavers were embalmed by 3 methods: formalin solution, Thiel solution (TS), and SSS methods. Bacterial and fungal culture tests and measurement of ranges of motion were conducted for each cadaver. Fourteen surgeons evaluated the 3 embalming methods and 9 SST instructors (7 trauma surgeons and 2 orthopedists) operated the cadavers by 21 procedures. In addition, ultrasonography, central venous catheterization, and incision with cauterization followed by autosuture stapling were performed in some cadavers. The SSS method had a sufficient antibiotic effect and produced cadavers with flexible joints and a high tissue quality suitable for SST. The surgeons evaluated the cadavers embalmed by the SSS method to be highly equal to those embalmed by the TS method. Ultrasound images were clear in the cadavers embalmed by both the methods. Central venous catheterization could be performed in a cadaver embalmed by the SSS method and then be affirmed by x-ray. Lungs and intestines could be incised with cauterization and autosuture stapling in the cadavers embalmed by TS and SSS methods. Cadavers embalmed by the SSS method are sufficiently useful for SST. This method is simple, carries a low infectious risk, and is relatively of low cost, enabling a wider use of cadavers for SST.

  7. Sidestream smoke exposure increases the susceptibility of airway epithelia to adenoviral infection.

    Directory of Open Access Journals (Sweden)

    Priyanka Sharma

    Full Text Available Although significant epidemiological evidence indicates that cigarette smoke exposure increases the incidence and severity of viral infection, the molecular mechanisms behind the increased susceptibility of the respiratory tract to viral pathogens are unclear. Adenoviruses are non-enveloped DNA viruses and important causative agents of acute respiratory disease. The Coxsackievirus and adenovirus receptor (CAR is the primary receptor for many adenoviruses. We hypothesized that cigarette smoke exposure increases epithelial susceptibility to adenovirus infection by increasing the abundance of apical CAR.Cultured human airway epithelial cells (CaLu-3 were used as a model to investigate the effect of sidestream cigarette smoke (SSS, mainstream cigarette smoke (MSS, or control air exposure on the susceptibility of polarized respiratory epithelia to adenoviral infection. Using a Cultex air-liquid interface exposure system, we have discovered novel differences in epithelial susceptibility between SSS and MSS exposures. SSS exposure upregulates an eight-exon isoform of CAR and increases adenoviral entry from the apical surface whilst MSS exposure is similar to control air exposure. Additionally, the level of cellular glycogen synthase kinase 3β (GSK3β is downregulated by SSS exposure and treatment with a specific GSK3β inhibitor recapitulates the effects of SSS exposure on CAR expression and viral infection.This is the first time that SSS exposure has been shown to directly enhance the susceptibility of a polarized epithelium to infection by a common respiratory viral pathogen. This work provides a novel understanding of the impact of SSS on the burden of respiratory viral infections and may lead to new strategies to alter viral infections. Moreover, since GSK3β inhibitors are under intense clinical investigation as therapeutics for a diverse range of diseases, studies such as these might provide insight to extend the use of clinically relevant

  8. A CENSUS OF THE SUPERSOFT X-RAY SOURCES IN M31

    International Nuclear Information System (INIS)

    Orio, Marina; Nelson, Thomas; Bianchini, Antonio; Di Mille, Francesco; Harbeck, Daniel

    2010-01-01

    We examined X-ray, ultraviolet, and optical archival data of 89 supersoft X-ray sources (SSS) in M31. We studied the timescales of X-ray variability and searched UV and optical counterparts. Almost a third of the SSS are known classical or recurrent novae, and at least half of the others exhibit the same temporal behavior as post-outburst novae. Non-stellar objects among SSS seem to be rare: less than 10% of the classified SSS turned out to be supernova remnants, and only one source has been identified with an active galactic nucleus in the background. Not more than 20% of the SSS that are not coincident with observed novae are persistent or recurrent X-ray sources. A few of these long-lasting sources show characteristics in common with other SSS identified as white dwarf (WD) close binaries in the Magellanic Clouds and in the Galaxy, including variability on timescales of minutes, possibly indicating the spin period of a WD. Such objects are likely to be low-mass X-ray binaries with a massive WD. A third of the non-nova SSS are in regions of recent star formation, often at the position of an O or B star, and we suggest that they may be high-mass X-ray binaries. If these sources host a massive hydrogen-burning WD, as it seems likely, they may become Type Ia supernovae (SNe Ia), constituting the star formation dependent component of the SNe Ia rate.

  9. SU-E-I-07: An Improved Technique for Scatter Correction in PET

    International Nuclear Information System (INIS)

    Lin, S; Wang, Y; Lue, K; Lin, H; Chuang, K

    2014-01-01

    Purpose: In positron emission tomography (PET), the single scatter simulation (SSS) algorithm is widely used for scatter estimation in clinical scans. However, bias usually occurs at the essential steps of scaling the computed SSS distribution to real scatter amounts by employing the scatter-only projection tail. The bias can be amplified when the scatter-only projection tail is too small, resulting in incorrect scatter correction. To this end, we propose a novel scatter calibration technique to accurately estimate the amount of scatter using pre-determined scatter fraction (SF) function instead of the employment of scatter-only tail information. Methods: As the SF depends on the radioactivity distribution and the attenuating material of the patient, an accurate theoretical relation cannot be devised. Instead, we constructed an empirical transformation function between SFs and average attenuation coefficients based on a serious of phantom studies with different sizes and materials. From the average attenuation coefficient, the predicted SFs were calculated using empirical transformation function. Hence, real scatter amount can be obtained by scaling the SSS distribution with the predicted SFs. The simulation was conducted using the SimSET. The Siemens Biograph™ 6 PET scanner was modeled in this study. The Software for Tomographic Image Reconstruction (STIR) was employed to estimate the scatter and reconstruct images. The EEC phantom was adopted to evaluate the performance of our proposed technique. Results: The scatter-corrected image of our method demonstrated improved image contrast over that of SSS. For our technique and SSS of the reconstructed images, the normalized standard deviation were 0.053 and 0.182, respectively; the root mean squared errors were 11.852 and 13.767, respectively. Conclusion: We have proposed an alternative method to calibrate SSS (C-SSS) to the absolute scatter amounts using SF. This method can avoid the bias caused by the insufficient

  10. Quantification of the myocardial area at risk using coronary CT angiography and Voronoi algorithm-based myocardial segmentation

    Energy Technology Data Exchange (ETDEWEB)

    Kurata, Akira; Kono, Atsushi; Coenen, Adriaan; Saru-Chelu, Raluca G.; Krestin, Gabriel P. [Erasmus University Medical Center, Department of Radiology, Rotterdam (Netherlands); Sakamoto, Tsuyoshi [AZE inc, Development Division, Chiyoda, Tokyo (Japan); Kido, Teruhito; Mochizuki, Teruhito [Ehime University Graduate School of Medicine, Department of Radiology, Toon, Ehime (Japan); Higashino, Hiroshi [Yotsuba Circulation Clinic, Department of Radiology, Matsuyama, Ehime (Japan); Abe, Mitsunori [Yotsuba Circulation Clinic, Department of Cardiology, Matsuyama, Ehime (Japan); Feyter, Pim J. de; Nieman, Koen [Erasmus University Medical Center, Department of Radiology, Rotterdam (Netherlands); Erasmus University Medical Center, Department of Cardiology, Rotterdam (Netherlands)

    2015-01-15

    The purpose of this study was to estimate the myocardial area at risk (MAAR) using coronary computed tomography angiography (CTA) and Voronoi algorithm-based myocardial segmentation in comparison with single-photon emission computed tomography (SPECT). Thirty-four patients with coronary artery disease underwent 128-slice coronary CTA, stress/rest thallium-201 SPECT, and coronary angiography (CAG). CTA-based MAAR was defined as the sum of all CAG stenosis (>50 %) related territories (the ratio of the left ventricular volume). Using automated quantification software (17-segment model, 5-point scale), SPECT-based MAAR was defined as the number of segments with a score above zero as compared to the total 17 segments by summed stress score (SSS), difference (SDS) score map, and comprehensive SPECT interpretation with either SSS or SDS best correlating CAG findings (SSS/SDS). Results were compared using Pearson's correlation coefficient. Forty-nine stenoses were observed in 102 major coronary territories. Mean value of CTA-based MAAR was 28.3 ± 14.0 %. SSS-based, SDS-based, and SSS/SDS-based MAAR was 30.1 ± 6.1 %, 20.1 ± 15.8 %, and 26.8 ± 15.7 %, respectively. CTA-based MAAR was significantly related to SPECT-based MAAR (r = 0.531 for SSS; r = 0.494 for SDS; r = 0.814 for SSS/SDS; P < 0.05 in each). CTA-based Voronoi algorithm myocardial segmentation reliably quantifies SPECT-based MAAR. (orig.)

  11. SU-E-I-07: An Improved Technique for Scatter Correction in PET

    Energy Technology Data Exchange (ETDEWEB)

    Lin, S; Wang, Y; Lue, K; Lin, H; Chuang, K [Chuang, National Tsing Hua University, Hsichu, Taiwan (China)

    2014-06-01

    Purpose: In positron emission tomography (PET), the single scatter simulation (SSS) algorithm is widely used for scatter estimation in clinical scans. However, bias usually occurs at the essential steps of scaling the computed SSS distribution to real scatter amounts by employing the scatter-only projection tail. The bias can be amplified when the scatter-only projection tail is too small, resulting in incorrect scatter correction. To this end, we propose a novel scatter calibration technique to accurately estimate the amount of scatter using pre-determined scatter fraction (SF) function instead of the employment of scatter-only tail information. Methods: As the SF depends on the radioactivity distribution and the attenuating material of the patient, an accurate theoretical relation cannot be devised. Instead, we constructed an empirical transformation function between SFs and average attenuation coefficients based on a serious of phantom studies with different sizes and materials. From the average attenuation coefficient, the predicted SFs were calculated using empirical transformation function. Hence, real scatter amount can be obtained by scaling the SSS distribution with the predicted SFs. The simulation was conducted using the SimSET. The Siemens Biograph™ 6 PET scanner was modeled in this study. The Software for Tomographic Image Reconstruction (STIR) was employed to estimate the scatter and reconstruct images. The EEC phantom was adopted to evaluate the performance of our proposed technique. Results: The scatter-corrected image of our method demonstrated improved image contrast over that of SSS. For our technique and SSS of the reconstructed images, the normalized standard deviation were 0.053 and 0.182, respectively; the root mean squared errors were 11.852 and 13.767, respectively. Conclusion: We have proposed an alternative method to calibrate SSS (C-SSS) to the absolute scatter amounts using SF. This method can avoid the bias caused by the insufficient

  12. Spatial and Temporal Analysis of Sea Surface Salinity Using Satellite Imagery in Gulf of Mexico

    Science.gov (United States)

    Rajabi, S.; Hasanlou, M.; Safari, A. R.

    2017-09-01

    The recent development of satellite sea surface salinity (SSS) observations has enabled us to analyse SSS variations with high spatiotemporal resolution. In this regards, The Level3-version4 data observed by Aquarius are used to examine the variability of SSS in Gulf of Mexico for the 2012-2014 time periods. The highest SSS value occurred in April 2013 with the value of 36.72 psu while the lowest value (35.91 psu) was observed in July 2014. Based on the monthly distribution maps which will be demonstrated in the literature, it was observed that east part of the region has lower salinity values than the west part for all months mainly because of the currents which originate from low saline waters of the Caribbean Sea and furthermore the eastward currents like loop current. Also the minimum amounts of salinity occur in coastal waters where the river runoffs make fresh the high saline waters. Our next goal here is to study the patterns of sea surface temperature (SST), chlorophyll-a (CHLa) and fresh water flux (FWF) and examine the contributions of them to SSS variations. So by computing correlation coefficients, the values obtained for SST, FWF and CHLa are 0.7, 0.22 and 0.01 respectively which indicated high correlation of SST on SSS variations. Also by considering the spatial distribution based on the annual means, it found that there is a relationship between the SSS, SST, CHLa and the latitude in the study region which can be interpreted by developing a mathematical model.

  13. Quantification of the myocardial area at risk using coronary CT angiography and Voronoi algorithm-based myocardial segmentation

    International Nuclear Information System (INIS)

    Kurata, Akira; Kono, Atsushi; Coenen, Adriaan; Saru-Chelu, Raluca G.; Krestin, Gabriel P.; Sakamoto, Tsuyoshi; Kido, Teruhito; Mochizuki, Teruhito; Higashino, Hiroshi; Abe, Mitsunori; Feyter, Pim J. de; Nieman, Koen

    2015-01-01

    The purpose of this study was to estimate the myocardial area at risk (MAAR) using coronary computed tomography angiography (CTA) and Voronoi algorithm-based myocardial segmentation in comparison with single-photon emission computed tomography (SPECT). Thirty-four patients with coronary artery disease underwent 128-slice coronary CTA, stress/rest thallium-201 SPECT, and coronary angiography (CAG). CTA-based MAAR was defined as the sum of all CAG stenosis (>50 %) related territories (the ratio of the left ventricular volume). Using automated quantification software (17-segment model, 5-point scale), SPECT-based MAAR was defined as the number of segments with a score above zero as compared to the total 17 segments by summed stress score (SSS), difference (SDS) score map, and comprehensive SPECT interpretation with either SSS or SDS best correlating CAG findings (SSS/SDS). Results were compared using Pearson's correlation coefficient. Forty-nine stenoses were observed in 102 major coronary territories. Mean value of CTA-based MAAR was 28.3 ± 14.0 %. SSS-based, SDS-based, and SSS/SDS-based MAAR was 30.1 ± 6.1 %, 20.1 ± 15.8 %, and 26.8 ± 15.7 %, respectively. CTA-based MAAR was significantly related to SPECT-based MAAR (r = 0.531 for SSS; r = 0.494 for SDS; r = 0.814 for SSS/SDS; P < 0.05 in each). CTA-based Voronoi algorithm myocardial segmentation reliably quantifies SPECT-based MAAR. (orig.)

  14. The Potential and Challenges of Using Soil Moisture Active Passive (SMAP Sea Surface Salinity to Monitor Arctic Ocean Freshwater Changes

    Directory of Open Access Journals (Sweden)

    Wenqing Tang

    2018-06-01

    Full Text Available Sea surface salinity (SSS links various components of the Arctic freshwater system. SSS responds to freshwater inputs from river discharge, sea ice change, precipitation and evaporation, and oceanic transport through the open straits of the Pacific and Atlantic oceans. However, in situ SSS data in the Arctic Ocean are very sparse and insufficient to depict the large-scale variability to address the critical question of how climate variability and change affect the Arctic Ocean freshwater. The L-band microwave radiometer on board the NASA Soil Moisture Active Passive (SMAP mission has been providing SSS measurements since April 2015, at approximately 60 km resolution with Arctic Ocean coverage in 1–2 days. With improved land/ice correction, the SMAP SSS algorithm that was developed at the Jet Propulsion Laboratory (JPL is able to retrieve SSS in ice-free regions 35 km of the coast. SMAP observes a large-scale contrast in salinity between the Atlantic and Pacific sides of the Arctic Ocean, while retrievals within the Arctic Circle vary over time, depending on the sea ice coverage and river runoff. We assess the accuracy of SMAP SSS through comparative analysis with in situ salinity data collected by Argo floats, ships, gliders, and in field campaigns. Results derived from nearly 20,000 pairs of SMAP and in situ data North of 50°N collocated within a 12.5-km radius and daily time window indicate a Root Mean Square Difference (RMSD less than ~1 psu with a correlation coefficient of 0.82 and a near unity regression slope over the entire range of salinity. In contrast, the Hybrid Coordinate Ocean Model (HYCOM has a smaller RMSD with Argo. However, there are clear systematic biases in the HYCOM for salinity in the range of 25–30 psu, leading to a regression slope of about 0.5. In the region North of 65°N, the number of collocated samples drops more than 70%, resulting in an RMSD of about 1.2 psu. SMAP SSS in the Kara Sea shows a consistent

  15. A digital intervention to increase motivation and access to NHS Stop Smoking Services: Applying the Behaviour Change Wheel to develop the ‘Stop-app’.

    Directory of Open Access Journals (Sweden)

    Emily Fulton

    2015-10-01

    Full Text Available Background: Smokers are four times more likely to stop smoking with the help of an NHS Stop Smoking Service (SSS. However attendance is in decline, possibly due to the increase in popularity of e-cigarettes. SSS’s will support smokers who choose to use e-cigarettes as part of a quit attempt, therefore interventions are needed to encourage continued access and uptake of SSS. Aim: To design an evidence based intervention (Stop-app to increase referrals, 4 week quit rates and reduce ‘did not attend’ (DNA rates within SSS. Methods/Results: In Phase 1 we collected data to explore the barriers and facilitators to people using SSS. Smokers and ex-smokers identified a number of barriers, including a lack of knowledge about what happens at the service; the belief that there would be ’scare tactics’, ‘nagging’, that the service would be unfriendly and clinical; and a lack of perceived efficacy of the service. In Phase 2, data from extant literature and phase 1 were subject to behavioural analysis as outlined by the Behaviour Change Wheel framework. A range of factors were identified as needing to change. These aligned with capability (e.g. a lack of knowledge about the benefits of SSS, opportunity (e.g. beliefs that SSS are not easy to access and to motivation to act (e.g. beliefs that they did not need and would not benefit from SSS. We describe the content development process, illustrating the choice of 19 ‘Behaviour Change Techniques’ included in our digital intervention. In Phase 3 we assessed the acceptability of the proposed intervention by interviewing stop smoking service advisors and non-NHS provider sites (e.g. library services and children’s centres. Findings from interviews are presented and have been used to consider the best path for implementation of the web-app within service provision. Conclusion: The ‘Stop –app’ is in development and will be accessible online, linking with the SSS booking system used by Public

  16. Sexual Sensation Seeking, Sexual Compulsivity, and Gender Identity and Its Relationship With Sexual Functioning in a Population Sample of Men and Women.

    Science.gov (United States)

    Burri, Andrea

    2017-01-01

    Despite awareness of the importance of psycho-affective factors in the development of sexual problems, there is a lack of studies exploring the relation of sexual sensation seeking (SSS) and sexual compulsivity (SC) to sexual functioning. Because sex differences in SSS and SC have been reported, gender identity (GI; an individual's own experience of his or her gender that is unrelated to the actual biological sex) might act as a moderator in this relation. To understand the role of SSS and SC for men and women's sexual functioning and to explore whether these potential associations are moderated by GI. A population-based cross-sectional online survey targeted 279 individuals (69.2% women, 30.8% men; mean age = 32 years). Validated questionnaires, including the Sexual Sensation Seeking Scale, the Sexual Compulsivity Scale, the Female Sexual Function Index, the Premature Ejaculation Diagnostic Tool, and the International Index of Erectile Function, were applied. Variations in SSS and SC and their association with sexual functioning were investigated using Spearman rank correlation. Moderation analyses were conducted using regression models in which the interaction terms between SSS and GI and between SCS and GI as predictors of sexual functioning were included. A statistically significant correlation between SSS and SC could be detected in men and women (r = 0.41 and 0.33, respectively; P < .001 for the two comparisons). In women, higher levels of SSS were associated with higher levels of desire, arousal, lubrication, and orgasm and less sexual pain (P < .05 for all comparisons). No moderating effect of GI could be detected. In men, GI was a significant moderator in the relation between SC and erectile function (β = 0.47; P < .001) and between SSS and erectile and ejaculatory function (β = -0.41 and 0.30; P < .001 for the two comparisons). The present study is the first to show a link between SSS and SC and sexual functioning. The results might have important

  17. An ovine model of cerebral catheter venography for implantation of an endovascular neural interface.

    Science.gov (United States)

    Oxley, Thomas James; Opie, Nicholas Lachlan; Rind, Gil Simon; Liyanage, Kishan; John, Sam Emmanuel; Ronayne, Stephen; McDonald, Alan James; Dornom, Anthony; Lovell, Timothy John Haynes; Mitchell, Peter John; Bennett, Iwan; Bauquier, Sebastien; Warne, Leon Norris; Steward, Chris; Grayden, David Bruce; Desmond, Patricia; Davis, Stephen M; O'Brien, Terence John; May, Clive N

    2018-04-01

    OBJECTIVE Neural interface technology may enable the development of novel therapies to treat neurological conditions, including motor prostheses for spinal cord injury. Intracranial neural interfaces currently require a craniotomy to achieve implantation and may result in chronic tissue inflammation. Novel approaches are required that achieve less invasive implantation methods while maintaining high spatial resolution. An endovascular stent electrode array avoids direct brain trauma and is able to record electrocorticography in local cortical tissue from within the venous vasculature. The motor area in sheep runs in a parasagittal plane immediately adjacent to the superior sagittal sinus (SSS). The authors aimed to develop a sheep model of cerebral venography that would enable validation of an endovascular neural interface. METHODS Cerebral catheter venography was performed in 39 consecutive sheep. Contrast-enhanced MRI of the brain was performed on 13 animals. Multiple telescoping coaxial catheter systems were assessed to determine the largest wide-bore delivery catheter that could be delivered into the anterior SSS. Measurements of SSS diameter and distance from the motor area were taken. The location of the motor area was determined in relation to lateral and superior projections of digital subtraction venography images and confirmed on MRI. RESULTS The venous pathway from the common jugular vein (7.4 mm) to the anterior SSS (1.2 mm) was technically challenging to selectively catheterize. The SSS coursed immediately adjacent to the motor cortex (SSS. Attempted access with 5-Fr and 6-Fr delivery catheters was associated with longer procedure times and higher complication rates. A 4-Fr catheter (internal lumen diameter 1.1 mm) was successful in accessing the SSS in 100% of cases with no associated complications. Complications included procedure-related venous dissection in two major areas: the torcular herophili, and the anterior formation of the SSS. The

  18. Self-rated health and wellbeing among school-aged children with and without special educational needs: Differences between mainstream and special schools.

    Science.gov (United States)

    Rathmann, Katharina; Vockert, Theres; Bilz, Ludwig; Gebhardt, Markus; Hurrelmann, Klaus

    2018-05-11

    Studies among students with special educational needs (SEN) in separate special schools (SSS) and mainstream schools (MS) are particularly applicable to educational attainment and social participation. However, indicators of health and wellbeing have rarely been considered. This study investigates two related topics: first, health and wellbeing differences between students with SEN in special schools (SSS) and students without SEN in regular schools, and second, the rarely considered question whether health and wellbeing among students with SEN differ between school settings (i.e. MS vs. SSS). Bivariate and multilevel analyses are applied with data from the German National Educational Panel Study (NEPS) with 5267 students (grade 7). After having controlled for background characteristics, students in SSS report higher likelihoods of poor self-rated health compared to students in higher track schools. Self-rated health of students with SEN does not significantly differ between MS vs. SSS. For life satisfaction, students with SEN show higher likelihoods of low life satisfaction when attending MS. Teachers in inclusive settings are encouraged to establish class work and teaching that support a real change from class placement to inclusive culture in order to suitably support students with SEN. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Development of vehicle model test-bending of a simple structural surfaces model for automotive vehicle sedan

    Science.gov (United States)

    Nor, M. K. Mohd; Noordin, A.; Ruzali, M. F. S.; Hussen, M. H.; Mustapa@Othman, N.

    2017-04-01

    Simple Structural Surfaces (SSS) method is offered as a means of organizing the process for rationalizing the basic vehicle body structure load paths. The application of this simplified approach is highly beneficial in the development of modern passenger car structure design. In Malaysia, the SSS topic has been widely adopted and seems compulsory in various automotive programs related to automotive vehicle structures in many higher education institutions. However, there is no real physical model of SSS available to gain considerable insight and understanding into the function of each major subassembly in the whole vehicle structures. Based on this motivation, a real physical SSS of sedan model and the corresponding model vehicle tests of bending is proposed in this work. The proposed approach is relatively easy to understand as compared to Finite Element Method (FEM). The results prove that the proposed vehicle model test is useful to physically demonstrate the importance of providing continuous load path using the necessary structural components within the vehicle structures. It is clearly observed that the global bending stiffness reduce significantly when more panels are removed from the complete SSS model. The analysis shows the front parcel shelf is an important subassembly to sustain bending load.

  20. [Quantitative determination of the main metabolites of acetylsalicylic acid/2nd communication: the concentrations of salicylic acid and its metabolites in patients with renal insufficiency (author's transl)].

    Science.gov (United States)

    Daneels, R; Loew, D; Pütter, J

    1975-07-01

    Quantitative Determination of the Main Metabolites of Acetylsalicylic Acid / 2nd Communication: The concentrations of salicylic acid and its metabolies in patients with renal insufficiency 9 patients suffering from renal insufficiencies of varing degrees and treated regularly by hemodialysis were given 1.5 g Colfarit (microcapsulated acetyl salicylic acid) as a single dose. The concentrations of salicylic acid (SA), salicyluric acid (SU), further salicylic acid conjugates (SAC) and salicyluric acid conjugates (SUC) were determined in the blood plasma. Likewise urea and creatinine were determined. SA concentration decreased continually and, at the end of the trial (72 h after application), had vanished almost completely from the plasma of most patients. SU increased at first and decreased afterwards. With the exception of the dailysis time SAC and SUC increased during the trial. After 3 days the SUC level was more than 50% of total salicylate (SSS) in most patients. SSS (the sum of SA + SU + SAC + SUC) did not change very much before dialysis, but showed a rather high decrease during the first hours of dialysis. tafter dialysis the SSS levels rose again, apparently as a consequence of a redistribution and of the synthesis of conjugates with decreased tissue affinity. It could be shown that SSS in the blood plasma does not parallel SSS in the whole body. The interindividual variation of SA metabolism as well as the variation of the biological blank values was rather high. The results are discussed with regard to salicylate pharmacokinetics in renal insufficiency and to normal salicylate metabolism.

  1. Decision Making Model for Ro-Ro Short Sea Shipping Operations in Archipelagic Southeast Asia

    Directory of Open Access Journals (Sweden)

    Aminuddin Md Arof

    2018-03-01

    Full Text Available This study aims to develop a decision-making model for determining the potential of interstate Ro-Ro Short Sea Shipping (SSS operations in Archipelagic Southeast Asia (ASEA. It is expected to assist SSS authorities, private investors and financial institutions focus their limited resources on several key factors that could ensure the success of their undertakings. This study will begin with identifying the relevant factors that have contributed towards successful SSS operations through a process of literature review. Subsequently, a Delphi survey was conducted with sub-regional experts to identify any new determinants and assess their opinions on the relative importance of all the determinants involved. Finally the weightages of the determinants were ascertained through the Analytic Hierarchy Process (AHP. Twenty expert respondents from Brunei Darussalam. Indonesia, Malaysia and the Philippines were involved in the Delphi survey while 18 expert respondents continue to participate in the AHP survey. This study concludes with the development of a decision-making model that was tested on three interstate Ro-Ro SSS routes within the ASEA sub-region. Keywords: Archipelagic Southeast Asia, Analytic Hierarchy Process (AHP, ASEAN, Delphi, Ro-Ro, Short Sea Shipping (SSS

  2. Extremely intense (SML ≤–2500 nT substorms: isolated events that are externally triggered?

    Directory of Open Access Journals (Sweden)

    B. T. Tsurutani

    2015-05-01

    Full Text Available We examine particularly intense substorms (SML ≤–2500 nT, hereafter called "supersubstorms" or SSS events, to identify their nature and their magnetic storm dependences. It is found that these intense substorms are typically isolated events and are only loosely related to magnetic storms. SSS events can occur during super (Dst ≤–250 nT and intense (−100 nT ≥ Dst >–250 magnetic storms. SSS events can also occur during nonstorm (Dst ≥–50 nT intervals. SSSs are important because the strongest ionospheric currents will flow during these events, potentially causing power outages on Earth. Several SSS examples are shown. SSS events appear to be externally triggered by small regions of very high density (~30 to 50 cm−3 solar wind plasma parcels (PPs impinging upon the magnetosphere. Precursor southward interplanetary magnetic fields are detected prior to the PPs hitting the magnetosphere. Our hypothesis is that these southward fields input energy into the magnetosphere/magnetotail and the PPs trigger the release of the stored energy.

  3. Diagnosing leprosy: revisiting the role of the slit-skin smear with critical analysis of the applicability of polymerase chain reaction in diagnosis.

    Science.gov (United States)

    Banerjee, Surajita; Biswas, Nibir; Kanti Das, Nilay; Sil, Amrita; Ghosh, Pramit; Hasanoor Raja, Abu Hena; Dasgupta, Sarbani; Kanti Datta, Pijush; Bhattacharya, Basudev

    2011-12-01

    Diagnosing leprosy is challenging, especially in early-stage cases, and the need for a sensitive diagnostic tool is urgent. Polymerase chain reaction (PCR) holds promise as a simple and sensitive diagnostic tool, but its usefulness in the Indian context requires further evaluation. Slit-skin smear (SSS) remains the conventional method of leprosy detection. Hence, this study was undertaken to evaluate and compare the diagnostic efficacy of PCR versus that of SSS. Punch biopsy of skin and SSS were obtained from the active margins of lesions. Cases were clinically grouped according to whether they were multibacillary (MB) or paucibacillary (PB) and classified into tuberculoid (TT), borderline tuberculoid (BT), borderline lepromatous (BL), lepromatous (LL), histoid, and indeterminate groups after clinicopathological correlation. DNA was extracted from biopsy specimens, and multiplex PCR was carried out incorporating primers intended for the amplification of a specific 372-bp fragment of a repetitive sequence of Mycobacterium leprae DNA. Among 164 patients, PCR was positive in 82.3%. The sensitivity of PCR was significantly greater (P chain reaction had higher sensitivity compared with SSS, especially in diagnostically challenging and PB cases. Thus, the use of this costly but sensitive tool should be restricted to this subgroup, because SSS is sufficiently sensitive in the diagnosis of LL and histoid leprosy. © 2011 The International Society of Dermatology.

  4. Silent sinus syndrome an acquired condition and the essential role of otorhinolaryngologist consultation: a retrospective study.

    Science.gov (United States)

    Martínez-Capoccioni, Gabriel; Varela-Martínez, Ernesto; Martín-Martín, Carlos

    2016-10-01

    The silent sinus syndrome (SSS) is a rare clinical entity characterized by painless spontaneous enophthalmos, hypoglobus, and facial deformities secondary to chronic maxillary sinus atelectasis. The aim of this study was to present an SSS diagnostic feature and evaluate the relationship between nasal septum deviation and maxillary sinus volume. A retrospective chart review of the clinical characteristics of 20 patients diagnosed with SSS between January 2013 and July 2014 were analyzed by the Department of Otorhinolaryngology of University Hospital Complex of Santiago de Compostela. 14 patients were females and six males. The mean age was 43 years (range 28-67 years). The right maxillary sinus was involved in 12 patients and the left maxillary sinus in eight patients. There was no statistical difference between gender and the presence of SSS. Maxillary sinus sizes were significantly smaller on the same side as the deviation (p craneo-caudal photographs. The present study demonstrates that, in adult patients, SSS generally presents a septal deviation to the affected maxillary sinus. We recommend performing a paranasal sinus CT scan when the patient has a deviated nasal septum, retraction of the malar eminence (evidenced from the viewpoint cranio-caudal facial) and hypoglobus. FESS performing postero-anterior uncinectomy and enlargement of the maxillary ostium is recommended to restore sinus pressure and prevent progression of the enophthalmos, hypoglobus and facial deformities.

  5. Competitiveness facets and sensation seeking as predictors of problem gambling among a sample of university student gamblers.

    Science.gov (United States)

    Harris, Nicholas; Newby, Jennifer; Klein, Rupert G

    2015-06-01

    Understanding the factors that contribute to problem gambling (PG) is imperative. Individual differences in sensation seeking (SS), as measured by the Sensation Seeking Scale Form (SSS-V), have been found to be predictive of PG among university student samples. However, what is less clear, is if the four SSS-V subscales capture unique facets of SS that are particularly predictive of PG. Much less studied than SS, competitiveness has also been found to be predictive of PG. The Competitiveness Orientation Measure (COM) is a newly developed measure of competitiveness, comprising of four facets. The main purpose of the current study was to examine if these four facets of competitiveness predicted variance in PG over and above the variance predicted by the four SSS-V subscales. Participants included 158 university student gamblers. Sequential regression analysis showed that after accounting for gender, age, and the four SSS-V subscales the only facet of the COM found to be a significant predictor of PG severity was Dominant Competitiveness. Dominant Competitiveness predicted an additional 11% of PG severity. These results provide support for the Dominant Competitiveness subscale of the COM as having utility in predicting PG over and above the predictive utility of the SSS-V subscales. Practical implications for the current findings are discussed.

  6. A Novel Terpolymer as Fluid Loss Additive for Oil Well Cement

    Directory of Open Access Journals (Sweden)

    Ming Li

    2017-01-01

    Full Text Available A terpolymer comprised of sodium styrene sulfonate (SSS, fumaric acid (FA, and acrylamide (AM was synthesized by aqueous free radical copolymerization and evaluated as fluid loss additive for oil well cement. The chemical structure and performance of the terpolymer were characterized by Fourier transform infrared (FTIR spectroscopy and thermal gravimetric analysis (TGA; the molecular weight and its distribution were determined by gel permeation chromatography (GPC. The optimum reaction conditions of polymerization were obtained: a reaction temperature of 50°C, a mass ratio of SSS/FA/AM 4 : 2 : 14, initiator 0.1%, and reaction time of 4 h; characterization indicated that the SSS/FA/AM had a certain molecular weight and excellent temperature-resistant and salt-resistant properties. The results show that SSS/FA/AM has a good fluid loss performance, in which the API fluid loss of the oil cement slurry could be controlled within 100 mL at 160°C. In addition, it had little effect on the cement compressive strength. The results of scanning electron microscopy (SEM of the filter cake showed that SSS/FA/AM could be adsorbed on the surface of the cement particles and produce a hydrated layer to prevent fluid loss from the oil well cement.

  7. Global genetics and invasion history of the potato powdery scab pathogen, Spongospora subterranea f.sp. subterranea.

    Science.gov (United States)

    Gau, Rebecca D; Merz, Ueli; Falloon, Richard E; Brunner, Patrick C

    2013-01-01

    Spongospora subterranea f. sp. subterranea (Sss) causes two diseases on potato (Solanum tuberosum), lesions on tubers and galls on roots, which are economically important worldwide. Knowledge of global genetic diversity and population structure of pathogens is essential for disease management including resistance breeding. A combination of microsatellite and DNA sequence data was used to investigate the structure and invasion history of Sss. South American populations (four countries, 132 samples) were consistently more diverse than those from all other regions (15 countries, 566 samples), in agreement with the hypothesis that Sss originated in South America where potato was domesticated. A substantial genetic differentiation was found between root and tuber-derived samples from South America. Estimates of past and recent gene flow suggested that Sss was probably introduced from South America into Europe. Subsequently, Europe is likely to have been the recent source of migrants of the pathogen, acting as a "bridgehead" for further global dissemination. Quarantine measures must continue to be focussed on maintaining low global genetic diversity and avoiding exchange of genetic material between the native and introduced regions. Nevertheless, the current low global genetic diversity of Sss allows potato breeders to select for resistance, which is likely to be durable.

  8. Global genetics and invasion history of the potato powdery scab pathogen, Spongospora subterranea f.sp. subterranea.

    Directory of Open Access Journals (Sweden)

    Rebecca D Gau

    Full Text Available Spongospora subterranea f. sp. subterranea (Sss causes two diseases on potato (Solanum tuberosum, lesions on tubers and galls on roots, which are economically important worldwide. Knowledge of global genetic diversity and population structure of pathogens is essential for disease management including resistance breeding. A combination of microsatellite and DNA sequence data was used to investigate the structure and invasion history of Sss. South American populations (four countries, 132 samples were consistently more diverse than those from all other regions (15 countries, 566 samples, in agreement with the hypothesis that Sss originated in South America where potato was domesticated. A substantial genetic differentiation was found between root and tuber-derived samples from South America. Estimates of past and recent gene flow suggested that Sss was probably introduced from South America into Europe. Subsequently, Europe is likely to have been the recent source of migrants of the pathogen, acting as a "bridgehead" for further global dissemination. Quarantine measures must continue to be focussed on maintaining low global genetic diversity and avoiding exchange of genetic material between the native and introduced regions. Nevertheless, the current low global genetic diversity of Sss allows potato breeders to select for resistance, which is likely to be durable.

  9. Effects of material property changes on irradiation assisted stress corrosion cracking

    Energy Technology Data Exchange (ETDEWEB)

    Nakano, Morihito; Fukuya, Koji; Fujii, Katsuhiko [Inst. of Nuclear Safety System Inc., Mihama, Fukui (Japan)

    2002-09-01

    Irradiation assisted stress corrosion cracking (IASCC) susceptibility and radiation-induced material changes in microstructure and microchemistry under pressurized water reactor (PWR) environment were examined on irradiated stainless steels (SSs), post-irradiation annealed SSs and post-irradiation deformed SS. The yield stress and grain boundary segregation were considerably high in SSs highly irradiated to 1-8 x 10{sup 26}n/m{sup 2} (E > 0.1 MeV) in PWR at 290-320degC, resulting in a high IASCC susceptibility. Following post-irradiation annealing of highly irradiated SSs, IASCC susceptibility showed significant recovery from 89% (as-irradiated) to 8% (550degC) of %IGSCC, while the hardness recovered from Hv375 (400degC) to Hv315 (550degC). Apparent recovery of segregation at grain boundaries was not observed. The SSs irradiated to 5.3 x 10{sup 24}n/m{sup 2} (E>1MeV) in the Japan Materials Testing Reactor (JMTR) at < 400degC, which had grain boundary segregation and low hardness, showed no IASCC susceptibility. Due to post-irradiation deforming for JMTR irradiated SS, the hardness increased but IASCC did not occur. These results suggested that the hardening would be a key factor for IASCC initiation under PWR hydrogenated water and that a yield stress threshold for IASCC initiation under slow strain rate tensile (SSRT) testing would the about 600MPa. (author)

  10. Love-pursuing Patterns and Personality Traits: A Preliminary Study in Chinese University undergraduate Students

    Directory of Open Access Journals (Sweden)

    Fangfang CAI

    2009-12-01

    Full Text Available The love-pursuing pattern (LPP, or love-initiating behavior, is important in building or maintaining a relationship, but has been less studied. We hypothesize that the LPPs might be modulated by personality traits. Therefore we have administered an adjective-based LPP questionnaire, the Zuckerman-Kuhlman Personality Questionnaire (ZKPQ, the Zuckerman Sensation Seeking Scales (SSS, and the Plutchik – van Praag Depression Inventory (PVP in 164 Chinese undergraduates who were in a current heterosexual-love relationship. We did not find any differences of LPP, ZKPQ, SSS, or PVP scale scores when either referred to gender or initiator/ receiver. In initiators (13 women, 85 men, the SSS Experience Seeking was negatively correlated with LPP Impulsive scale, Disinhibition was positively correlated with Threatening scale, and the PVP was negatively correlated with Persistent scale. In all subjects, the ZKPQ Aggression-Hostility was negatively correlated with the perceived happiness from the relationship, Activity was positively correlated with relationship suitability, and the SSS Experience Seeking was negatively correlated with a future marriage probability. Low SSS Experience Seeking and Disinhibition, ZKPQ Aggression-Hostility, together with high Activity and emotionality would be helpful to initiate a love relationship, and increase chances of the perceived happiness and suitability, and a future marriage.

  11. Korean Solar Salt Ameliorates Colon Carcinogenesis in an AOM/DSS-Induced C57BL/6 Mouse Model.

    Science.gov (United States)

    Ju, Jaehyun; Kim, Yeung-Ju; Park, Eui Seong; Park, Kun-Young

    2017-06-01

    The effects of Korean solar salt on an azoxymethane (AOM)/dextran sodium sulfate (DSS)-induced colon cancer C57BL/6 mouse model were studied. Korean solar salt samples (SS-S, solar salt from S salt field; SS-Yb, solar salt from Yb salt field), nine-time-baked bamboo salt (BS-9x, made from SS-Yb), purified salt (PS), and SS-G (solar salt from Guérande, France) were orally administered at a concentration of 1% during AOM/DSS colon cancer induction, and compared for their protective effects during colon carcinogenesis in C57BL/6 mice. SS-S and SS-Yb suppressed colon length shortening and tumor counts in mouse colons. Histological evaluation by hematoxylin and eosin staining also revealed suppression of tumorigenesis by SS-S. Conversely, PS and SS-G did not show a similar suppressive efficacy as Korean solar salt. SS-S and SS-Yb promoted colon mRNA expression of an apoptosis-related factor and cell-cycle-related gene and suppressed pro-inflammatory factor. SS-Yb baked into BS-9x further promoted these anti-carcinogenic efficacies. Taken together, the results indicate that Korean solar salt, especially SS-S and SS-Yb, exhibited anti-cancer activity by modulating apoptosis- and inflammation-related gene expression during colon carcinogenesis in mice, and bamboo salt baked from SS-Yb showed enhanced anti-cancer functionality.

  12. Effects of material property changes on irradiation assisted stress corrosion cracking

    International Nuclear Information System (INIS)

    Nakano, Morihito; Fukuya, Koji; Fujii, Katsuhiko

    2002-01-01

    Irradiation assisted stress corrosion cracking (IASCC) susceptibility and radiation-induced material changes in microstructure and microchemistry under pressurized water reactor (PWR) environment were examined on irradiated stainless steels (SSs), post-irradiation annealed SSs and post-irradiation deformed SS. The yield stress and grain boundary segregation were considerably high in SSs highly irradiated to 1-8 x 10 26 n/m 2 (E > 0.1 MeV) in PWR at 290-320degC, resulting in a high IASCC susceptibility. Following post-irradiation annealing of highly irradiated SSs, IASCC susceptibility showed significant recovery from 89% (as-irradiated) to 8% (550degC) of %IGSCC, while the hardness recovered from Hv375 (400degC) to Hv315 (550degC). Apparent recovery of segregation at grain boundaries was not observed. The SSs irradiated to 5.3 x 10 24 n/m 2 (E>1MeV) in the Japan Materials Testing Reactor (JMTR) at < 400degC, which had grain boundary segregation and low hardness, showed no IASCC susceptibility. Due to post-irradiation deforming for JMTR irradiated SS, the hardness increased but IASCC did not occur. These results suggested that the hardening would be a key factor for IASCC initiation under PWR hydrogenated water and that a yield stress threshold for IASCC initiation under slow strain rate tensile (SSRT) testing would the about 600MPa. (author)

  13. Identification of Mycobacterium tuberculosis complex based on amplification and sequencing of the oxyR pseudogene from stored Ziehl-Neelsen-stained sputum smears in Brazil

    Directory of Open Access Journals (Sweden)

    Marcio Roberto Silva

    2011-02-01

    Full Text Available A cross-sectional analysis of stored Ziehl-Neelsen (ZN-stained sputum smear slides (SSS obtained from two public tuberculosis referral laboratories located in Juiz de Fora, Minas Gerais, was carried out to distinguish Mycobacterium bovis from other members of the Mycobacterium tuberculosis complex (MTC. A two-step approach was used to distinguish M. bovis from other members of MTC: (i oxyR pseudogene amplification to detect MTC and, subsequently, (ii allele-specific sequencing based on the polymorphism at position 285 of this gene. The oxyR pseudogene was successfully amplified in 100 of 177 (56.5% SSS available from 99 individuals. No molecular profile of M. bovis was found. Multivariate analysis indicated that acid-fast bacilli (AFB results and the source laboratory were associated (p < 0.05 with oxyR pseudogene amplification. SSS that were AFB++ SSS showed more oxyR pseudogene amplification than those with AFB0, possibly due to the amount of DNA. One of the two source laboratories presented a greater chance of oxyR pseudogene amplification, suggesting that differences in sputum conservation between laboratories could have influenced the preservation of DNA. This study provides evidence that stored ZN-SSS can be used for the molecular detection of MTC.

  14. Evaluation of the Sensitization of 316L Stainless Steels After the Post Weld Heat Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Junho; Jang, Changheui [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Lee, Kyoung Soo [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)

    2014-05-15

    It was observed that the PWSCC growth rate of alloy 182 was markedly decreased after PWHT. However, the PWHT of components made of stainless steels (SSs) would be limited because of the concerns about sensitization when they are exposed to temperature range of 500 to 800 .deg. C. Also, the sensitization of austenitic stainless steels could increase the susceptibility to intergrannular stress corrosion cracking. Therefore, the effect of PWHT on the sensitization behaviors of 316L SSs having predominant austenitic structure with small amount of ferrite was investigated to assess the applicability of PWHT to dissimilar weld area with austenitic stainless steels. The sensitization behaviors of two heats of 316L SSs with small amount of ferrite were investigated after heat treatment at 600, 650 and 700 .deg. C. Grain boundary sensitization was not observed in 316L SSs after the heat treatment at 600, 650 and 700 .deg. C up to 30 h. The increase in degree of sensitization (DOS) was caused by reduction of corrosion resistance in ferrite phase due to formation of chromium carbide and intermatallic phases during heat treatment. The DOS value of 316L SSs depended on the ferrite morphology. The stringer type of ferrite (316L-heat A) showed relatively higher DOS in comparison with 316L containing blocky type of ferrite (316L-heat B). It could be due to sufficient supplement of chromium in larger size of ferrite phase.

  15. Evaluation of the Sensitization of 316L Stainless Steels After the Post Weld Heat Treatment

    International Nuclear Information System (INIS)

    Lee, Junho; Jang, Changheui; Lee, Kyoung Soo

    2014-01-01

    It was observed that the PWSCC growth rate of alloy 182 was markedly decreased after PWHT. However, the PWHT of components made of stainless steels (SSs) would be limited because of the concerns about sensitization when they are exposed to temperature range of 500 to 800 .deg. C. Also, the sensitization of austenitic stainless steels could increase the susceptibility to intergrannular stress corrosion cracking. Therefore, the effect of PWHT on the sensitization behaviors of 316L SSs having predominant austenitic structure with small amount of ferrite was investigated to assess the applicability of PWHT to dissimilar weld area with austenitic stainless steels. The sensitization behaviors of two heats of 316L SSs with small amount of ferrite were investigated after heat treatment at 600, 650 and 700 .deg. C. Grain boundary sensitization was not observed in 316L SSs after the heat treatment at 600, 650 and 700 .deg. C up to 30 h. The increase in degree of sensitization (DOS) was caused by reduction of corrosion resistance in ferrite phase due to formation of chromium carbide and intermatallic phases during heat treatment. The DOS value of 316L SSs depended on the ferrite morphology. The stringer type of ferrite (316L-heat A) showed relatively higher DOS in comparison with 316L containing blocky type of ferrite (316L-heat B). It could be due to sufficient supplement of chromium in larger size of ferrite phase

  16. An equilibrium for frustrated quantum spin systems in the stochastic state selection method

    International Nuclear Information System (INIS)

    Munehisa, Tomo; Munehisa, Yasuko

    2007-01-01

    We develop a new method to calculate eigenvalues in frustrated quantum spin models. It is based on the stochastic state selection (SSS) method, which is an unconventional Monte Carlo technique that we have investigated in recent years. We observe that a kind of equilibrium is realized under some conditions when we repeatedly operate a Hamiltonian and a random choice operator, which is defined by stochastic variables in the SSS method, to a trial state. In this equilibrium, which we call the SSS equilibrium, we can evaluate the lowest eigenvalue of the Hamiltonian using the statistical average of the normalization factor of the generated state. The SSS equilibrium itself has already been observed in unfrustrated models. Our study in this paper shows that we can also see the equilibrium in frustrated models, with some restriction on values of a parameter introduced in the SSS method. As a concrete example, we employ the spin-1/2 frustrated J 1 -J 2 Heisenberg model on the square lattice. We present numerical results on the 20-, 32-, and 36-site systems, which demonstrate that statistical averages of the normalization factors reproduce the known exact eigenvalue to good precision. Finally, we apply the method to the 40-site system. Then we obtain the value of the lowest energy eigenvalue with an error of less than 0.2%

  17. Newton gauge cosmological perturbations for static spherically symmetric modifications of the de Sitter metric

    Science.gov (United States)

    Santa Vélez, Camilo; Enea Romano, Antonio

    2018-05-01

    Static coordinates can be convenient to solve the vacuum Einstein's equations in presence of spherical symmetry, but for cosmological applications comoving coordinates are more suitable to describe an expanding Universe, especially in the framework of cosmological perturbation theory (CPT). Using CPT we develop a method to transform static spherically symmetric (SSS) modifications of the de Sitter solution from static coordinates to the Newton gauge. We test the method with the Schwarzschild de Sitter (SDS) metric and then derive general expressions for the Bardeen's potentials for a class of SSS metrics obtained by adding to the de Sitter metric a term linear in the mass and proportional to a general function of the radius. Using the gauge invariance of the Bardeen's potentials we then obtain a gauge invariant definition of the turn around radius. We apply the method to an SSS solution of the Brans-Dicke theory, confirming the results obtained independently by solving the perturbation equations in the Newton gauge. The Bardeen's potentials are then derived for new SSS metrics involving logarithmic, power law and exponential modifications of the de Sitter metric. We also apply the method to SSS metrics which give flat rotation curves, computing the radial energy density profile in comoving coordinates in presence of a cosmological constant.

  18. Selective segmental sclerotherapy of the liver by transportal absolute ethanol injection: an animal experimental study

    International Nuclear Information System (INIS)

    Pan Jie; Yang Ning; Zhang Zhongzhong; Hu Libin; Chen Jie; Wu Wei; Jin Zhengyu; Liu Wei

    2003-01-01

    Objective: To evaluate the safety and efficacy of selective segmental sclerotherapy (SSS) of the liver by transportal absolute ethanol injection with an animal experimental study, and to discuss several technical points involved in this method. Methods: Thirty dogs received SSS of the liver by transportal absolute ethanol injection with the injection dose of 0.2-1.0 ml/kg, repeated examinations of blood ethanol level, WBC, and liver functions were done, and CT and pathological examinations of the liver were performed. Results: All dogs treated with SSS survived during the study. The maximum elevation of blood ethanol values occurred in group F. Its average value was (1.603 ± 0.083) mg/ml, which was much lower than that of death level. Transient elevations of blood WBC and ALT were seen. The average values of WBC and ALT were (46.36 ± 7.28) x 10 9 and (827.36 ± 147.25) U/L, respectively. CT and pathological examinations proved that the dogs given SSS by transportal absolute ethanol injection with the injection dose of 0.3-1.0 ml/kg had a complete wedge-shaped necrosis in the liver. Conclusion: Selective segmental sclerotherapy of the liver by transportal ethanol injection was quite safe and effective if the proper dose of ethanol was injected. SSS may be useful in the treatment of HCC

  19. Satellite observed salinity distributions at high latitudes in the Northern Hemisphere: A comparison of four products

    Science.gov (United States)

    Garcia-Eidell, Cynthia; Comiso, Josefino C.; Dinnat, Emmanuel; Brucker, Ludovic

    2017-09-01

    Global surface ocean salinity measurements have been available since the launch of SMOS in 2009 and coverage was further enhanced with the launch of Aquarius in 2011. In the polar regions where spatial and temporal changes in sea surface salinity (SSS) are deemed important, the data have not been as robustly validated because of the paucity of in situ measurements. This study presents a comparison of four SSS products in the ice-free Arctic region, three using Aquarius data and one using SMOS data. The accuracy of each product is assessed through comparative analysis with ship and other in situ measurements. Results indicate RMS errors ranging between 0.33 and 0.89 psu. Overall, the four products show generally good consistency in spatial distribution with the Atlantic side being more saline than the Pacific side. A good agreement between the ship and satellite measurements was also observed in the low salinity regions in the Arctic Ocean, where SSS in situ measurements are usually sparse, at the end of summer melt seasons. Some discrepancies including biases of about 1 psu between the products in spatial and temporal distribution are observed. These are due in part to differences in retrieval techniques, geophysical filtering, and sea ice and land masks. The monthly SSS retrievals in the Arctic from 2011 to 2015 showed variations (within ˜1 psu) consistent with effects of sea ice seasonal cycles. This study indicates that spaceborne observations capture the seasonality and interannual variability of SSS in the Arctic with reasonably good accuracy.

  20. Identification of a novel autoantibody against self-vimentin specific in secondary Sjögren's syndrome.

    Science.gov (United States)

    Li, Yu-Hui; Gao, Ya-Ping; Dong, Jie; Shi, Lian-Jie; Sun, Xiao-Lin; Li, Ru; Zhang, Xue-Wu; Liu, Yu; Long, Li; He, Jing; Zhong, Qun-Jie; Morand, Eric; Yang, Guang; Li, Zhan-Guo

    2018-02-12

    Sjögren's syndrome (SS) is a primary autoimmune disease (pSS) or secondarily associated with other autoimmune diseases (sSS). The mechanisms underlying immune dysregulation in this syndrome remain unknown, and clinically it is difficult to diagnose owing to a lack of specific biomarkers. We extracted immunoglobulins (Igs) from the sera of patients with sSS associated with rheumatoid arthritis (RA) and used them to screen a phage display library of peptides with random sequences. Our results show that an sSS-specific peptide, designated 3S-P, was recognized by sera of 68.2% (60 of 88) patients with sSS, 66.2% of patients with RA-sSS, and 76.5% of patients with systemic lupus erythematosus (SLE)-sSS. The anti-3S-P antibody was scarcely found in patients with pSS (1.8%), RA (1.3%), SLE (4.2%), ankylosing spondylitis (0%), and gout (3.3%), as well as in healthy donors (2%). The 3S-P-binding Igs (antibodies) were used to identify antigens from salivary glands and synovial tissues from patients with sSS. A putative target autoantigen expressed in the synovium and salivary gland recognized by anti-3S-P antibody was identified as self-vimentin. This novel autoantibody is highly specific in the diagnosis of sSS, and the underlying molecular mechanism of the disease might be epitope spreading involved with vimentin.

  1. Rainfall Effects on the Kuroshio Current East of Taiwan

    Science.gov (United States)

    Hsu, Po-Chun; Lin, Chen-Chih; Ho, Chung-Ru

    2017-04-01

    Changes of sea surface salinity (SSS) in the open oceans are related to precipitation and evaporation. SSS has been an indicator of water cycle. It may be related to the global change. The Kuroshio Current, a western boundary current originating from the North Equatorial Current, transfers warm and higher salinity to higher latitudes. It flows northward along the east coasts of Luzon Island and Taiwan Island to Japan. In this study, effects of heavy rainfall on the Kuroshio surface salinity east of Taiwan are investigated. Sea surface salinity (SSS) data taken by conductivity temperature depth (CTD) sensor on R/V Ocean Researcher I cruises, conductivity sensor on eight glider cruises, and Aquarius satellite data are used in this study. The rain rate data derived from the Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI) are also employed. A glider is a kind of autonomous underwater vehicle, which uses small changes in its buoyancy in conjunction with wings to convert vertical motion to horizontal in the underwater without requiring input from an operator. It can take sensors to measure salinity, temperature, and pressure. The TRMM/TMI data from remote sensing system are daily and are mapped to 0.25-degree grid. The results show a good correlation between the rain rate and SSS with a correlation coefficient of 0.86. The rainfall causes SSS of the Kuroshio surface water drops 0.176 PSU per 1 mm/hr rain rate.

  2. First report of the successful operation of a side stream supersaturation hypolimnetic oxygenation system in a eutrophic, shallow reservoir.

    Science.gov (United States)

    Gerling, Alexandra B; Browne, Richard G; Gantzer, Paul A; Mobley, Mark H; Little, John C; Carey, Cayelan C

    2014-12-15

    Controlling hypolimnetic hypoxia is a key goal of water quality management. Hypoxic conditions can trigger the release of reduced metals and nutrients from lake sediments, resulting in taste and odor problems as well as nuisance algal blooms. In deep lakes and reservoirs, hypolimnetic oxygenation has emerged as a viable solution for combating hypoxia. In shallow lakes, however, it is difficult to add oxygen into the hypolimnion efficiently, and a poorly designed hypolimnetic oxygenation system could potentially result in higher turbidity, weakened thermal stratification, and warming of the sediments. As a result, little is known about the viability of hypolimnetic oxygenation in shallow bodies of water. Here, we present the results from recent successful tests of side stream supersaturation (SSS), a type of hypolimnetic oxygenation system, in a shallow reservoir and compare it to previous side stream deployments. We investigated the sensitivity of Falling Creek Reservoir, a shallow (Zmax = 9.3 m) drinking water reservoir located in Vinton, Virginia, USA, to SSS operation. We found that the SSS system increased hypolimnetic dissolved oxygen concentrations at a rate of ∼1 mg/L/week without weakening stratification or warming the sediments. Moreover, the SSS system suppressed the release of reduced iron and manganese, and likely phosphorus, from the sediments. In summary, SSS systems hold great promise for controlling hypolimnetic oxygen conditions in shallow lakes and reservoirs. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Shostakovich: Six Romances on Japanese Poems, Op. 21 / David Nice

    Index Scriptorium Estoniae

    Nice, David

    1996-01-01

    Uuest heliplaadist "Shostakovich: Six Romances on Japanese Poems, Op. 21. Six Poems of Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi. DG 447 085-2GH (71 minutes:DDD)

  4. Searching for Roots. Pärt: Symphony No. 1, "Polyphonic" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1997-01-01

    Uuest heliplaadist "Searching for Roots. Pärt: Symphony No. 1, "Polyphonic". Nekrolog, Op. 3; Tubin: Symphony No. 11; Tüür: Searching for Roots. Insula deserta. Zeitraum. Royal Stockholm Philharmonic Orchestra / Paavo Järvi. Virgin Classics VC5 45212-2 (72 min.:DDD)

  5. Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid) / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid); Pärt: Nekrolog op. 5, Sinfonie nr. 1; Tüür: Searching for Roots, Insula deserta, Zeitraum. Königliches Philharmonisches Orchester Stockholm, Paavo Järvi". Virgin/EMI CD 5 45212 2 (WD:71'34") DDD

  6. Institutional profile: the national Swedish academic drug discovery & development platform at SciLifeLab.

    Science.gov (United States)

    Arvidsson, Per I; Sandberg, Kristian; Sakariassen, Kjell S

    2017-06-01

    The Science for Life Laboratory Drug Discovery and Development Platform (SciLifeLab DDD) was established in Stockholm and Uppsala, Sweden, in 2014. It is one of ten platforms of the Swedish national SciLifeLab which support projects run by Swedish academic researchers with large-scale technologies for molecular biosciences with a focus on health and environment. SciLifeLab was created by the coordinated effort of four universities in Stockholm and Uppsala: Stockholm University, Karolinska Institutet, KTH Royal Institute of Technology and Uppsala University, and has recently expanded to other Swedish university locations. The primary goal of the SciLifeLab DDD is to support selected academic discovery and development research projects with tools and resources to discover novel lead therapeutics, either molecules or human antibodies. Intellectual property developed with the help of SciLifeLab DDD is wholly owned by the academic research group. The bulk of SciLifeLab DDD's research and service activities are funded from the Swedish state, with only consumables paid by the academic research group through individual grants.

  7. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  8. Clinical features, diagnosis, treatment and molecular studies in paediatric Cushing's syndrome due to primary nodular adrenocortical hyperplasia

    DEFF Research Database (Denmark)

    Storr, Helen L; Mitchell, J H; Swords, F M

    2004-01-01

    0.2-0.8 years) from diagnosis. Hypercortisolaemia was treated preoperatively by metyrapone alone 0.50-0.75 g/day (n = 4), metyrapone 0.75-1.50 g/day + o'p'DDD/mitotane 1-2 g/day (n = 1), or ketoconazole (n = 1). Adrenal histology showed nodular cortical hyperplasia with shrinkage of intervening...

  9. Original Article

    African Journals Online (AJOL)

    Arab Journal of Nephrology and Transplantation. 2013 Sep;6(3):153-60. Original Article. AJNT. Abstract. Introduction: Dense Deposit Disease (DDD) is a devastating renal disease that leads to renal failure within. 10 years of diagnosis in about half of affected patients. In this study, we evaluated the relative prevalence and.

  10. Sibelius. Lemminkäinen-Legenden op. 22 Nr. 1-4 / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Sibelius: Lemminkäinen-Legenden op. 22 Nr. 1-4, Nächtlicher Ritt und Sonnenaufgang op. 55, Luonnotar op. 70. Stockholm Philharmoniker / Paavo Järvi. Virgin/EMI CD 545213 2 (WD:70'22")DDD

  11. Biotransformation of dichlorodiphenyltrichloroethane in the benthic polychaete, Nereis succinea: quantitative estimation by analyzing the partitioning of chemicals between gut fluid and lipid.

    Science.gov (United States)

    Wang, Fei; Pei, Yuan-yuan; You, Jing

    2015-02-01

    Biotransformation plays an important role in the bioaccumulation and toxicity of a chemical in biota. Dichlorodiphenyltrichloroethane (DDT) commonly co-occurs with its metabolites (dichlorodiphenyldichloroethane [DDD] and dichlorodiphenyldichloroethylene [DDE]), in the environment; thus it is a challenge to accurately quantify the biotransformation rates of DDT and distinguish the sources of the accumulated metabolites in an organism. The present study describes a method developed to quantitatively analyze the biotransformation of p,p'-DDT in the benthic polychaete, Nereis succinea. The lugworms were exposed to sediments spiked with DDT at various concentrations for 28 d. Degradation of DDT to DDD and DDE occurred in sediments during the aging period, and approximately two-thirds of the DDT remained in the sediment. To calculate the biotransformation rates, residues of individual compounds measured in the bioaccumulation testing (after biotransformation) were compared with residues predicted by analyzing the partitioning of the parent and metabolite compounds between gut fluid and tissue lipid (before biotransformation). The results suggest that sediment ingestion rates decreased when DDT concentrations in sediment increased. Extensive biotransformation of DDT occurred in N. succinea, with 86% of DDT being metabolized to DDD and biotransformation, and the remaining 30% was from direct uptake of sediment-associated DDD. In addition, the biotransformation was not dependent on bulk sediment concentrations, but rather on bioaccessible concentrations of the chemicals in sediment, which were quantified by gut fluid extraction. The newly established method improved the accuracy of prediction of the bioaccumulation and toxicity of DDTs. © 2014 SETAC.

  12. Drug usage by outpatients in Croatia during an 8-year period: Influence of changes in pricing policy.

    Science.gov (United States)

    Vitezic, Dinko; Madjarevic, Tomislav; Gantumur, Monja; Buble, Tonci; Vitezic, Miomira; Kovacevic, Miljenko; Mrsic-Pelcic, Jasenka; Sestan, Branko

    2012-07-01

    The aim of our study was to investigate the changes in drug usage and financial expenditure according to legal changes in Croatia during the period 2001 - 2008, especially considering pricing policy. The data on outpatient drug usage during the studied period was obtained from the Croatian National Health Insurance (CNHI). CNHI maintains a database on drugs prescribed by primary health care physicians and dispensed by pharmacies. The data was calculated and presented in defined daily doses (DDD) per inhabitant per year for antibiotics and in DDD/1,000 inhabitants/day for other drugs. The data is also presented in Euro/DDD and the financial expenditures are presented in Euros. During the investigated period drug usage increased 81.33%, while financial expenditure increased 77.23%. While total DDD/1,000 increased ~ 10% every year, financial expenditure increased 10 - 20% annually until 2006, but since then there have been no significant changes. Pricing policy changes could influence drug financial expenditure considerably in the short-term, but it is also important to apply a combination of measures for drug expenditure control. Numerous interventions from authorities from different countries all over the world, prove that there is still no so called "gold standard" which could restrain growing usage and expenditure of drugs. Clinical pharmacologists and clinical pharmacists should be included in these processes.

  13. [The outpatient use of beta lactam antibiotics in Montenegro before the introduction of new reform strategy on drug market].

    Science.gov (United States)

    Duborija-Kovacević, Natasa

    2006-01-01

    The study represents the first investigation of outpatient use of beta lactam antibiotics in Montenegro carried out in accordance with internationally approved methodology (DDD/ATC). The objective of our study was to establish both the scope and overall use of beta lactam antibiotics, and to assess their compatibility with current pharmacotherapeutic guidelines and their use in developed countries. The retrospective pharmaco-epidemiological study comprised a 100%-sample of beta lactams that were used in the period prior to introduction of new reform strategy on drug market. Beta lactam antibiotics (J01C, J01D) were the most frequently applied anti-infectives for systemic use (ATC group J) in 2000 (11.3 DDD/1000 inh./day, 61%). Penicillins (J01C) were the most utilized (8.0 DDD/1000 inh./day, 71%). Cephalosporin derivatives (cephalexin and cefaclor) accounted for the remaining 29% (3.3 DDD/1000 inh./day). Aminopenicillins were prevailing among penicillins (85%). Beta lactamase sensitive penicillins were in the second place and approximately accounted for 14%. The results of our study showed that the use of beta lactam antibacterials could be estimated as partially satisfactory. There is a need to make additional efforts with a view of further rationalization.

  14. Cost-minimization analysis of antimicrobial therapy in a tertiary ...

    African Journals Online (AJOL)

    The mean cost per defined daily dosage (DDD) of generic and branded for each antibacterial was computed. These were compared using Student's t-test. The outcome measure was potential eradication of bacterial in question by the respective antibacterial drug. The analyses showed that the use of expensive branded ...

  15. Stem-cell treatment in disc degeneration: What is the evidence?

    Directory of Open Access Journals (Sweden)

    Manuela Peletti-Figueiró

    2013-01-01

    Full Text Available To review the potential role of stem cells in treating degenerative disc disease of the intervertebral disc (IVD. A review was performed of articles from the Medline database concerning stem cells and degenerative disc disease (DDD. To discuss the data, the papers were classified as: review, in vitro, experimental, and clinical. The currently available treatments were basically for symptom reduction, not to revert the IVD degenerative process. The use of mesenchymal stem cells (MSC is being proposed as an option of treatment for DDD. In vitro studies have shown that the MSC are able to differentiate into NP cells and that the MSC also reduce the inflammatory levels of the degenerated IVD. Besides, experimental studies demonstrated that the MSC remained viable when injected into the IVD, and that they were able to regenerate partially from the degenerated IVD and its structure. The few clinical studies found in the literature presented diverging results. The use of MSC is being widely studied and shows promising results for the treatment of DDD. Although many advances are being achieved in studies in vitro and experimental, there is a lack of clinical studies to prove the role of MSC in DDD management.

  16. Ligeti: Ricercare per organo / M. K.

    Index Scriptorium Estoniae

    M. K.

    1991-01-01

    Uuest heliplaadist "Ligeti: Ricercare per organo, Vivier, Les Communiantes, Cavana, Jodl; Scelsi: In nomine Lucis; Lennot: Livre d'Orgue-extrait; Richer: Orgue 88; Pärt: Pari intervallo, Pierre Bousseau (Orgel)" (AD:1990). Adda/TIS CD 581 240 (WD:59'45") DDD

  17. Sibelius. Karelia Suite, Op. 11 / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Sibelius. Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi" DG 447 760-2GH (72 minutes: DDD)

  18. Mutations in POGLUT1, Encoding Protein O-Glucosyltransferase 1, Cause Autosomal-Dominant Dowling-Degos Disease

    DEFF Research Database (Denmark)

    Basmanav, F Buket; Oprisoreanu, Ana-Maria; Pasternack, Sandra M

    2014-01-01

    Dowling-Degos disease (DDD) is an autosomal-dominant genodermatosis characterized by progressive and disfiguring reticulate hyperpigmentation. We previously identified loss-of-function mutations in KRT5 but were only able to detect pathogenic mutations in fewer than half of our subjects. To ident...

  19. Effect of polychlorinated biphenyls (PCBs) and 1,1,1-trichloro-2,2,-bis (4-chlorophenyl)-ethane (DDT) in follicular fluid on the results of in vitro fertilization-embryo transfer (IVF-ET) programs

    Czech Academy of Sciences Publication Activity Database

    Jirsová, S.; Mašata, J.; Jech, L.; Zvárová, Jana

    2010-01-01

    Roč. 93, č. 6 (2010), s. 1831-1836 ISSN 0015-0282 Institutional research plan: CEZ:AV0Z10300504 Keywords : DDD * DDE * DDT * embryos * oocytes * PCB * pregnancy rate Subject RIV: FK - Gynaecology, Childbirth Impact factor: 3.122, year: 2010

  20. Evaluation of ecological risk limits for DDT and drins in soil : Assessment of direct toxicity and food chain transfer

    NARCIS (Netherlands)

    Smit CE; Verbruggen EMJ; MSP; M&V

    2015-01-01

    Het RIVM heeft onderzocht of de ecologische risicogrenzen in bodem voor twee groepen bestrijdingsmiddelen veilig zijn voor roofvogels. Dit betreft zogeheten drins (dieldrin, aldrin, endrin) en DDT, inclusief de bijbehorende afbraakproducten DDD en DDE. Voor endrin en het totaal aan DDT-verbindingen

  1. Toxaphene and Other Organochlorine Pesticides in Fish and Sediment from Lake Xolotlán, Nicaragua

    DEFF Research Database (Denmark)

    Calero, S.; Fomsgaard, Inge S.; Lacayo, M. L.

    1993-01-01

    and in all the sediment samples analyzed. α-BHC, heptachlor, heptachlor-epoxide, aldrin and dieldrin were detected neither in fish nor in sediment samples. DDT or its metabolites DDE or DDD (∊DDT) were present in almost all the fish and sediment samples but in low concentrations. The presence of β...

  2. Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917) / Hans-Christian Dadelsen

    Index Scriptorium Estoniae

    Dadelsen, Hans-Christian

    1991-01-01

    Uuest heliplaadist "Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917). Hamlet-Suite op. 32a. Das goldene Zeitalter [The Age of Gold] (Suite) op. 22a. Göteborger Symphoniker, Neeme Järvi". DG CD 431 688-2 (WD:77'21") DDD

  3. Comparison of adherence to generic multi-tablet regimens vs. brand multi-tablet and brand single-tablet regimens likely to incorporate generic antiretroviral drugs by breaking or not fixed-dose combinations in HIV-infected patients.

    Science.gov (United States)

    Rwagitinywa, Joseph; Lapeyre-Mestre, Maryse; Bourrel, Robert; Montastruc, Jean-Louis; Sommet, Agnès

    2018-03-05

    Adherence to antiretroviral (ARV) is crucial to achieve viral load suppression in HIV-infected patients. This study aimed to compare adherence to generic multi-tablet regimens (MTR) vs. brand MTR likely to incorporate ARV drugs without breaking fixed-dose combinations (FDC) and brand single-tablet regimens (STR) likely to incorporate generics by breaking the FDC. Patients aged of 18 years or over exposed to one of the generic or the brand of lamivudine (3TC), zidovudine/lamivudine (AZT/TC), nevirapine (NVP), or efavirenz (EFV), or the brand STR of efavirenz/emtricitabine/tenofovir (EFV/FTC/TDF). Adherence was measured by medication possession ratio (MPR) using both defined daily dose (DDD) and daily number of tablet recommended for adults (DNT). Adherence to generic MTR vs. brand MTR and brand STR was compared using Kruskal-Wallis. The overall median adherence was 0.97 (IQR 0.13) by DNT method and 0.97 (0.14) by DDD method. Adherence in patients exposed to generic MTR (n = 165) vs. brand MTR (n = 481) and brand STR (n = 470) was comparable by DNT and DDD methods. In conclusion, adherence to generic MTR was high and comparable with adherence to brand MTR and to STR. Utilization of DDD instead DNT to measure the MPR led to small but nonsignificant difference that has no clinical impact. © 2018 Société Française de Pharmacologie et de Thérapeutique.

  4. Wave Transformation Over Reefs: Evaluation of One-Dimensional Numerical Models

    Science.gov (United States)

    2009-01-01

    level estimates. DISCLAIMER: The contents of this report are not to be used for advertising , publication, or promotional purposes. Citation of trade...better with data for wave heights and mean water levels obtained with the DDD85 formula for these mono- chromatic waves. The RMSE values (rms errors

  5. Electronic Interplay between TTF and Extended-TCNQ Electrophores along a Ruthenium Bis(acetylide) Linker.

    Science.gov (United States)

    Vacher, Antoine; Auffray, Morgan; Barrière, Frédéric; Roisnel, Thierry; Lorcy, Dominique

    2017-11-17

    A bis(TTF-butadiynyl) ruthenium D-D'-D complex, with intramolecular electronic interplay between the three electron-donating electrophores, was easily converted through a cycloaddition-retroelectrocyclization with TCNQ into a D-A-D'-A-D pentad complex, which exhibits an intense intramolecular charge transfer together with an electronic interplay between the two acceptors along the conjugated organometallic bridge.

  6. From my Home: Dvarionas: Elegie; Pärt: Fratres / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric

    1997-01-01

    Uuest heliplaadist "From my Home: Dvarionas: Elegie; Pärt: Fratres; Barkauskas: Partita; Vasks: Musica Dolorosa; Pelecis: Concerto for Violin, Piano and String Orchestra, "Neverthless"; Plakidis: Two Grasshopper Dances; Tüür: Conversio. Deutsche Kammerphilharmonie, Gidon Kremer (violon), Vadim Sacharov (piano)" Teldec 0630-14654-2 (79 minutes:DDD)

  7. Facet joint orientation and tropism in lumbar degenerative disc disease and spondylolisthesis.

    Science.gov (United States)

    Pichaisak, Witchate; Chotiyarnwong, Chayaporn; Chotiyarnwong, Pojchong

    2015-04-01

    Although degenerative disc disease (DDD) and degenerative spondylolisthesis (DS) are two common causes of back pain in elderly, the association between the lumbarfacet joint angle and tropism in these conditions are still unclear. To evaluate the difference in facet joint angles between normal population and lumbar degenerative disc disease and spondylolisthesis patient. The angle of lumbar facet joints were retrospectively measured with magnetic resonance imaging (MRI) to determine whether there was a difference between degenerative diseases. MRI of patients with DDD, DS, and control group at facet joint between L3-4, L4-5 and L5-S1 level were measured in axial view (60 subjects in each group). There was no difference infacetjoint angle in DDD (44.1 ± 11.9) and control (45.6 ± 8.9), but differed in DS (40.1 ± 10. 7) and control group (p = 0.010) at L4-5 level. Facet tropism showed difference between degenerative groups and control group at L4-5 level. DS group showed difference in facet joints angle and tropism when compared with control population, while DDD showed difference only in facet tropism. In addition, longitudinal studies are needed to understand the clinical significant between facet joint angle and tropism in spinal degenerative diseases.

  8. Opioid consumption before and after the establishment of a palliative medicine unit in an Egyptian cancer centre.

    Science.gov (United States)

    Alsirafy, Samy A; Ibrahim, Noha Y; Abou-Elela, Enas N

    2012-01-01

    Opioid consumption before and after the establishment of a palliative medicine unit (PMU) in an Egyptian cancer centre was reviewed. A comparison of consumption during the year before the PMU was established to consumption during the third year after the PMU's establishment revealed that morphine consumption increased by 698 percent, fentanyl by 217 percent, and tramadol by 230 percent. Expressed in defined daily dose (DDD) and adjusted for 1,000 new cancer patients, consumption increased by 460 percent, from 4,678 DDD/1,000 new patients to 26,175 DDD/1,000 new patients. Expressed in grams of oral morphine equivalent (g OME), consumption increased by 644 percent, from 233 g OME/1,000 new patients to 1,731 g OME/1,000 new patients. The establishment of the PMU was associated with an increase in opioid consumption, especially morphine, which is an indicator of improvement in cancer pain control. The expression of opioid consumption in OME in addition to DDD may provide further information, especially when weak opioids are included in the analysis.

  9. Berwald. Symphonies - No. 1 in G minor, "Sinfonie serieuse" / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Berwald. Symphonies - No. 1 in G minor, "Sinfonie serieuse". No. 2 in D, "Sinfonie singuliere". No. 4 in E flat. Gothenburg Symphony Orchestra, Neeme Järvi. DG Masters 445 581-26 MA2 (two discs: 112 minutes: DDD)

  10. From my Home: Dvarionas: Elegie / Rob Cowan

    Index Scriptorium Estoniae

    Cowan, Rob

    1997-01-01

    Uuest heliplaadist "From my Home: Dvarionas: Elegie; Pärt: Fratres; Barkauskas: Partita; Vasks: Musica Dolorosa; Pelecis: Concerto for Violin, Piano and String Orchestra, "Neverthless"; Plakidis: Two Grasshopper Dances; Tüür: Conversio. Deutsche Kammerphilharmonie. Teldec 0630-14654-2 (79 minutes:DDD)

  11. Organochlorine pesticides and polychlorinated biphenyls in herring from the southern Baltic, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Falandysz, J

    1986-02-01

    Hexachlorobenzene (HCB), alpha-, beta-, gamma- and delta-benzenehexachloride (BHC, HCH), p,p'-DDE, o,p'-DDD, o,p'-DDT, p,p'-DDD and p,p'-DDT (sigma DDT) and polychlorinated biphenyls (PCB) levels have been determined in muscle tissue of 187 herring (Clupea harengus) netted during 1983 in a different regions in the southern part of the Baltic Sea. The mean levels found for herring muscle tissue related to wet weight (microgram/kg) were: 14 HCB, 18 alpha-BHC, 23 beta-BHC, 14 gamma-BHC, delta-BHC remained undetected, 56 sigma BHC, 115 p,p'-DDE, o,p'-DDD and o,p'-DDT remained undetected, 84 p,p'-DDD, 51 p,p'-DDT, 250 sigma DDT and 530 PCB. The levels of organochlorine pesticides determined in wet muscles or extractable lipids of herring are nearly 2-3 times as high as those noted in fish sampled in the same area in two years before, while for PCBs the wet weight levels were comparable, and when based on a lipid weight are somewhat higher. The results are compared with levels found in herring collected in different regions of the Baltic Sea during 1965-1983, and reported previously by other authors.

  12. Roussel. Sinfonien Nr. 3 g-Moll op. 42 und Nr. 4 A-Dur op. 5, Neeme Järvi / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1995-01-01

    Uuest heliplaadist "Roussel. Sinfonien Nr. 3 g-Moll op. 42 und Nr. 4 A-Dur op. 53, Bacchus et Ariane op. 43 (Zweite Orchestersuite). Sinfonietta für Streichorchester d-Moll op. 52. Detroit Symphony Orchester, N. Järvi". Chandos/Koch CD 7007(WD: 70'10") DDD

  13. Consumption, overdose and death from analgesics during a period of over-the-counter availability of paracetamol in Denmark

    DEFF Research Database (Denmark)

    Ott, P; Dalhoff, K; Hansen, P B

    1990-01-01

    During the period 1978-1986, annual sales of paracetamol in Denmark increased from 1 million defined daily doses (DDD) (3 g) to 47 million DDD, while the number of admissions and deaths from overdose increased from 26 to 202 and from 1 to 3-4, respectively. The corresponding figures for salicylates...... are a decrease in sales from 113 to 94 million DDD, an increase in admissions from 282 to 595, and an increase in deaths from 5 to 22. From 1 January 1984 paracetamol became available on an over-the-counter basis. The figures for 1983 and 1984 were an increase in sales from 14 to 28 million DDD, an increase...... in admissions from 114 to 198, and an increase in deaths from 0 to 4. The number of deaths from opioid overdose remained constant at a value of about fifty during this period, the mortality per dose being about 20-fold higher than for paracetamol and salicylates. Dextropropoxyphene-related deaths increased...

  14. Sibelius: Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi / Michael Scott Rohan

    Index Scriptorium Estoniae

    Rohan, Michael Scott

    1996-01-01

    Sibelius: Karelia Suite, Op. 11. Luonnotar, Op. 70 a. Andante festivo. The Oceanides, Op. 73. King Christian II, Op. 27-Suite. Finlandia, Op. 26a. Gothenburg Symphony Orchester, Neeme Järvi. 1 CD Deutsche Grammophon 447 760-2GH (72 minutes: DDD)

  15. Residues of Organochlorinated Pesticides in Soil from Tomato ...

    African Journals Online (AJOL)

    This work presents the concentrations of five pesticide residues, lindane, chlorpyrifos, endosulfan, p, p'-DDE and p, p'-DDD in soil samples collected from tomato fields in Ngarenanyuki, Tanzania. Endosulfan sulphate was detected in 100 % of the sample analysed with mean concentration of 0.2407 mg/kg dw. Chlorpyrifos ...

  16. Shostakovich: The Orchestral Songs Vol. 2 / Michael Tanner

    Index Scriptorium Estoniae

    Tanner, Michael

    1996-01-01

    Uuest heliplaadist "Shostakovich: The Orchestral Songs Vol. 2: Six Romances on texts by Japanese poets, Op. 21. Six Poems on Marina Tsvetayeva, Op. 143. Suite on Verses of Michelangelo, Op. 145. Gothenburg Symphony Orchestra, Neeme Järvi". DG 447 085-2GH (71 minutes:DDD)

  17. A novel multiple-stage antimalarial agent that inhibits protein synthesis

    NARCIS (Netherlands)

    Baragana, B.; Hallyburton, I.; Lee, M.C.; Norcross, N.R.; Grimaldi, R.; Otto, T.D.; Proto, W.R.; Blagborough, A.M.; Meister, S.; Wirjanata, G.; Ruecker, A.; Upton, L.M.; Abraham, T.S.; Almeida, M.J.; Pradhan, A.; Porzelle, A.; Martinez, M.S.; Bolscher, J.M.; Woodland, A.; Norval, S.; Zuccotto, F.; Thomas, J.; Simeons, F.; Stojanovski, L.; Osuna-Cabello, M.; Brock, P.M.; Churcher, T.S.; Sala, K.A.; Zakutansky, S.E.; Jimenez-Diaz, M.B.; Sanz, L.M.; Riley, J.; Basak, R.; Campbell, M.; Avery, V.M.; Sauerwein, R.W.; Dechering, K.J.; Noviyanti, R.; Campo, B.; Frearson, J.A.; Angulo-Barturen, I.; Ferrer-Bazaga, S.; Gamo, F.J.; Wyatt, P.G.; Leroy, D.; Siegl, P.; Delves, M.J.; Kyle, D.E.; Wittlin, S.; Marfurt, J.; Price, R.N.; Sinden, R.E.; Winzeler, E.A.; Charman, S.A.; Bebrevska, L.; Gray, D.W.; Campbell, S.; Fairlamb, A.H.; Willis, P.A.; Rayner, J.C.; Fidock, D.A.; Read, K.D.; Gilbert, I.H.

    2015-01-01

    There is an urgent need for new drugs to treat malaria, with broad therapeutic potential and novel modes of action, to widen the scope of treatment and to overcome emerging drug resistance. Here we describe the discovery of DDD107498, a compound with a potent and novel spectrum of antimalarial

  18. Coding and classification in drug statistics – From national to global application

    Directory of Open Access Journals (Sweden)

    Marit Rønning

    2009-11-01

    Full Text Available  SUMMARYThe Anatomical Therapeutic Chemical (ATC classification system and the defined daily dose (DDDwas developed in Norway in the early seventies. The creation of the ATC/DDD methodology was animportant basis for presenting drug utilisation statistics in a sensible way. Norway was in 1977 also thefirst country to publish national drug utilisation statistics from wholesalers on an annual basis. Thecombination of these activities in Norway in the seventies made us a pioneer country in the area of drugutilisation research. Over the years, the use of the ATC/DDD methodology has gradually increased incountries outside Norway. Since 1996, the methodology has been recommended by WHO for use ininternational drug utilisation studies. The WHO Collaborating Centre for Drug Statistics Methodologyin Oslo handles the maintenance and development of the ATC/DDD system. The Centre is now responsiblefor the global co-ordination. After nearly 30 years of experience with ATC/DDD, the methodologyhas demonstrated its suitability in drug use research. The main challenge in the coming years is toeducate the users worldwide in how to use the methodology properly.

  19. Sibelius: Scaramouche op. 71, Neeme Järvi / Rainer Wagner

    Index Scriptorium Estoniae

    Wagner, Rainer

    1991-01-01

    Uuest heliplaadist "Sibelius: Scaramouche op. 71 [World Premiere REcording of the Complete Score]. Hochzeitmarsch aus der Musik zum Drama Die Sprache der Vögel [Wedding March "The Language of the Birds"]. Göteborger Sinfoniker, Neeme Järvi. BIS/Disco-Ccenter CD 502 (WD:68'28") DDD

  20. Pärt, Arvo: De profundis / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)". Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)

  1. Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio / Marc Rochester

    Index Scriptorium Estoniae

    Rochester, Marc

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass). Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)"

  2. Medical Surveillance Monthly Report. Volume 19, Number 5

    Science.gov (United States)

    2012-05-01

    Intervertebral disc disorders DDD-related ICD-9-CM codes 723.0 Spinal stenosis , cervical 724.00, 724.01, 724.02, 724.09 Spinal stenosis ,other 723.1...4,6,7 Tick vectors of Rocky Mountain Spotted Fever (RMSF) and other diseases Dermacentor variabilis, the American dog tick or wood tick, is found in

  3. Tobias, Rudolf: Jonah's Mission / Warrack, John

    Index Scriptorium Estoniae

    Warrack, John

    1996-01-01

    Uuest heliplaadist "Tobias, Rudolf: Jonah's Mission. Pille Lill (sop), Urve Tauts (mez), Peter Svensson (ten), Raimo Laukka (bar), Mati Palm (bass); Tallinn Boys' Choir, Estonian Philharmonic Chamber Choir, Oratorio Choir, Estonian State Symphony Orchestra, Neeme Järvi" BIS CD 731/2 (two discs: 114 minutes: DDD)

  4. Spine research in companion animals

    NARCIS (Netherlands)

    Kranenburg, H.C.

    2012-01-01

    The present thesis consists of two parts. Part I consists of Chapters 3, 4, 5, 6 and 7. The aim of these chapters was to increase the knowledge of three spinal disorders (i.e., diffuse idiopathic skeletal hyperostosis (DISH), spondylosis deformans, and degenerative disc disease (DDD) due to

  5. An ethical assessment model for digital disease detection technologies.

    Science.gov (United States)

    Denecke, Kerstin

    2017-09-20

    Digital epidemiology, also referred to as digital disease detection (DDD), successfully provided methods and strategies for using information technology to support infectious disease monitoring and surveillance or understand attitudes and concerns about infectious diseases. However, Internet-based research and social media usage in epidemiology and healthcare pose new technical, functional and formal challenges. The focus of this paper is on the ethical issues to be considered when integrating digital epidemiology with existing practices. Taking existing ethical guidelines and the results from the EU project M-Eco and SORMAS as starting point, we develop an ethical assessment model aiming at providing support in identifying relevant ethical concerns in future DDD projects. The assessment model has four dimensions: user, application area, data source and methodology. The model supports in becoming aware, identifying and describing the ethical dimensions of DDD technology or use case and in identifying the ethical issues on the technology use from different perspectives. It can be applied in an interdisciplinary meeting to collect different viewpoints on a DDD system even before the implementation starts and aims at triggering discussions and finding solutions for risks that might not be acceptable even in the development phase. From the answers, ethical issues concerning confidence, privacy, data and patient security or justice may be judged and weighted.

  6. 75 FR 40729 - Residues of Quaternary Ammonium Compounds, N-Alkyl (C12-14

    Science.gov (United States)

    2010-07-14

    ... the Daily Dietary Dose (DDD) and the Estimated Daily Intake (EDI) using modified Food and Drug... survey days. The Estimated Daily Intake (EDI) calculations presented in this assessment for treated... is 0.0103 lbs a.i per gallon of treatment solution. EDI values were calculated using an approach...

  7. Liszt. Concertos for Piano and Orchestra / Bryce Morrison

    Index Scriptorium Estoniae

    Morrison, Bryce

    1993-01-01

    Uuest heliplaadist "Pärt: Te Deum. Silouans Song. "My soul yearns after the Lord...". Magnificat. Berliner Messe. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra/Tõnu Kaljuste." ECM New Series 439 162-2 (66 minutes: DDD). Texts and translations included

  8. 40 CFR 413.02 - General definitions.

    Science.gov (United States)

    2010-07-01

    ... techniques such as pH adjustment followed by clarification or filtration. (g) The term control authority is...) Aldrin Dieldrin Chlordane (technical mixture and metabolites) 4,4-DDT 4,4-DDE (p,p-DDX) 4,4-DDD (p,p-TDE...

  9. Penderecki: Konzert für Flöte und Kammerorchester; Eespere: Konzert für Flöte und Kammerorchester / Gero Schliess

    Index Scriptorium Estoniae

    Schliess, Gero

    1997-01-01

    Uuest heliplaadist "Penderecki: Konzert für Flöte und Kammerorchester; Eespere: Konzert für Flöte und Kammerorchester; Bartok: Suite paysanne hongroise für Flöte und Streichorchester. Estonian National Symphony Orchestra / Arvo Volmer". Signum/Note 1 CD X72-00 (WD:54'30")DDD

  10. Nielsen: Aladdin-Suite, FS89. Maskarade-Overture / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1996-01-01

    Uuest heliplaadist "Nielsen: Aladdin-Suite, FS89. Maskarade-Overture, Prelude, Act 2. The Cockerels' Dance. Rhapsody Overture: An imaginary journey to the Faroe Islands, FS123. Helios Overture, FS32. Saga-Drom, FS46. Pan and Syrinx, FS87. Gothenburg Symphony Orchestra, Neeme Järvi" DG 447 757-2GH (72 minutes: DDD)

  11. Spondylocarpotarsal synostosis syndrome: MRI evaluation of vertebral and disk malformation

    International Nuclear Information System (INIS)

    Breitling, Magnus; Rabin, Michael; Lemire, Edmond G.

    2006-01-01

    Spondylocarpotarsal synostosis syndrome (SSS) is a rare autosomal recessive condition characterized primarily by vertebral malsegmentation, carpal/tarsal coalition, and a dysmorphic appearance. Differentiating SSS from other congenital scoliosis syndromes requires evaluation of the vertebrae, ribs, soft tissues, and spinal cord. The enhanced resolution over plain radiographs seen with MRI allows more detailed assessment of vertebral malformation and surrounding anatomy. Diagnosis of the underlying cause of congenital scoliosis might be enhanced using this technology. We report on a 12-year-old girl of unaffected parents with SSS who was evaluated with MRI sequences of the spine to show various types of malsegmentation. Additionally, there is the new finding of fusion of teeth, with developmental failure of a canine incisor. (orig.)

  12. Coarse-grained modelling of triglyceride crystallisation: a molecular insight into tripalmitin tristearin binary mixtures by molecular dynamics simulations

    Science.gov (United States)

    Pizzirusso, Antonio; Brasiello, Antonio; De Nicola, Antonio; Marangoni, Alejandro G.; Milano, Giuseppe

    2015-12-01

    The first simulation study of the crystallisation of a binary mixture of triglycerides using molecular dynamics simulations is reported. Coarse-grained models of tristearin (SSS) and tripalmitin (PPP) molecules have been considered. The models have been preliminarily tested in the crystallisation of pure SSS and PPP systems. Two different quenching procedures have been tested and their performances have been analysed. The structures obtained from the crystallisation procedures show a high orientation order and a high content of molecules in the tuning fork conformation, comparable with the crystalline α phase. The behaviour of melting temperatures for the α phase of the mixture SSS/PPP obtained from the simulations is in qualitative agreement with the behaviour that was experimentally determined.

  13. Coarse-grained modelling of triglyceride crystallisation: a molecular insight into tripalmitin tristearin binary mixtures by molecular dynamics simulations

    International Nuclear Information System (INIS)

    Pizzirusso, Antonio; De Nicola, Antonio; Milano, Giuseppe; Brasiello, Antonio; Marangoni, Alejandro G

    2015-01-01

    The first simulation study of the crystallisation of a binary mixture of triglycerides using molecular dynamics simulations is reported. Coarse-grained models of tristearin (SSS) and tripalmitin (PPP) molecules have been considered. The models have been preliminarily tested in the crystallisation of pure SSS and PPP systems. Two different quenching procedures have been tested and their performances have been analysed. The structures obtained from the crystallisation procedures show a high orientation order and a high content of molecules in the tuning fork conformation, comparable with the crystalline α phase. The behaviour of melting temperatures for the α phase of the mixture SSS/PPP obtained from the simulations is in qualitative agreement with the behaviour that was experimentally determined. (paper)

  14. Mid-infrared optical properties of chalcogenide glasses within tin-antimony-selenium ternary system.

    Science.gov (United States)

    Lin, Ruiqiang; Chen, Feifei; Zhang, Xiaoyu; Huang, Yicong; Song, Baoan; Dai, Shixun; Zhang, Xianghua; Ji, Wei

    2017-10-16

    In this work, we investigated the mid-infrared (MIR) optical properties of selenide (Se-based) chalcogenide glasses (ChGs) within an As- and Ge-free system, namely the environment-friendly and low-cost tin-antimony-selenium (Sn-Sb-Se, SSS) ternary system, which has not been systematically studied to the best of our knowledge. As compared to ChGs within those conventional Se-based systems, SSS ChGs were found to exhibit extended infrared transmittance range as well as larger linear refractive index (n 0 ). Femtosecond Z-scan measurements show the presence of evident three-photon absorption from Urbach absorption of the SSS ChGs at MIR wavelength, which resonantly enhanced the nonlinear refractive behavior and resulted in large nonlinear refractive index (n 2 ).

  15. In vitro biochemical characterization of all barley endosperm starch synthases

    DEFF Research Database (Denmark)

    Cuesta-Seijo, Jose A.; Nielsen, Morten M.; Ruzanski, Christian

    2016-01-01

    Starch is the main storage polysaccharide in cereals and the major source of calories in the human diet. It is synthesized by a panel of enzymes including five classes of starch synthases (SSs). While the overall starch synthase (SS) reaction is known, the functional differences between the five SS....... Here we provide a detailed biochemical study of the activity of all five classes of SSs in barley endosperm. Each enzyme was produced recombinantly in E. coli and the properties and modes of action in vitro were studied in isolation from other SSs and other substrate modifying activities. Our results...... define the mode of action of each SS class in unprecedented detail; we analyze their substrate selection, temperature dependence and stability, substrate affinity and temporal abundance during barley development. Our results are at variance with some generally accepted ideas about starch biosynthesis...

  16. Reactivity Accidents in CAREM-25 Core with and Without Safety Systems Actuation

    International Nuclear Information System (INIS)

    Gimenez, Marcelo; Vertullo, Alicia; Schlamp, Miguel

    2000-01-01

    A reactivity accident in CAREM core can be provoked by different initiating events, a cold water injection in pressure vessel, a secondary side steam line breakage and a failure in the absorbing rods drive system.The present work analyses inadverted control rod withdraws transients.Maximum worth control rod (2.5 $) at normal velocity (1 cm/s) is adopted for the simulations (Reactivity ramp of 0.018 $/s).Different scenarios considering actuation of first shutdown system (FSS), second shutdown system (SSS) and selflimiting conditions were modeled.Results of the accident with actuation of FSS show that safety margins are well above critical values (DNBR and CPR).In the cases with failure of the FSS and success of SSS or selflimited, safety margins are below critical values, however, the SSS provides a reduction of elapsed time under advised margins

  17. Brief Report: Subjective Social Mobility and Depressive Symptoms in Syrian Refugees to Germany.

    Science.gov (United States)

    Euteneuer, Frank; Schäfer, Sarina J

    2018-01-16

    Previous findings indicate that refugees are at increased risk for mental health problems. In addition to stressful pre-migration experiences, post-migration factors may contribute to poor mental health outcomes. Among immigrants to the United States, downward mobility in subjective social status (SSS) was associated with depression, corroborating the potentially detrimental mental health consequences of a decline in one's perceived social position. The present study examined whether downward mobility in SSS among male refugees from Syria to Germany is associated with depression. We found that refugees who experience stronger downward mobility in SSS exhibit more severe depressive symptoms and were more likely to fulfill provisional DSM-IV criteria for a diagnosis of Major Depression. Our findings highlight the importance to consider the 'social pain' of downward social mobility during the post-migration phase.

  18. Spondylocarpotarsal synostosis syndrome: MRI evaluation of vertebral and disk malformation

    Energy Technology Data Exchange (ETDEWEB)

    Breitling, Magnus; Rabin, Michael [University of Saskatchewan, Department of Medical Imaging, Saskatoon, Saskatchewan (Canada); Lemire, Edmond G. [University of Saskatchewan, Division of Medical Genetics, Department of Pediatrics, Saskatoon (Canada)

    2006-08-15

    Spondylocarpotarsal synostosis syndrome (SSS) is a rare autosomal recessive condition characterized primarily by vertebral malsegmentation, carpal/tarsal coalition, and a dysmorphic appearance. Differentiating SSS from other congenital scoliosis syndromes requires evaluation of the vertebrae, ribs, soft tissues, and spinal cord. The enhanced resolution over plain radiographs seen with MRI allows more detailed assessment of vertebral malformation and surrounding anatomy. Diagnosis of the underlying cause of congenital scoliosis might be enhanced using this technology. We report on a 12-year-old girl of unaffected parents with SSS who was evaluated with MRI sequences of the spine to show various types of malsegmentation. Additionally, there is the new finding of fusion of teeth, with developmental failure of a canine incisor. (orig.)

  19. Heart failure in patients with sick sinus syndrome treated with single lead atrial or dual-chamber pacing

    DEFF Research Database (Denmark)

    Riahi, Sam; Nielsen, Jens Cosedis; Hjortshøj, Søren

    2012-01-01

    AIMS: Previous studies indicate that ventricular pacing may precipitate heart failure (HF). We investigated occurrence of HF during long-term follow-up among patients with sick sinus syndrome (SSS) randomized to AAIR or DDDR pacing. Furthermore, we investigated effects of percentage of ventricular...... patients (17%) with the leads in a non-apical position, HR 0.67, CI 0.45-1.00, P = 0.05. After adjustments this difference was non-significant. The incidence of HF was not associated with %VP (P = 0.57).CONCLUSION: In patients with SSS, HF was not associated with pacing mode, %VP, or ventricular lead...... localization. This suggests that DDDR pacing is safe in patients with SSS without precipitating HF....

  20. Empirical investigation of workloads of operators in advanced control rooms

    International Nuclear Information System (INIS)

    Kim, Yochan; Jung, Wondea; Kim, Seunghwan

    2014-01-01

    This paper compares the workloads of operators in a computer-based control room of an advanced power reactor (APR 1400) nuclear power plant to investigate the effects from the changes in the interfaces in the control room. The cognitive-communicative-operative activity framework was employed to evaluate the workloads of the operator's roles during emergency operations. The related data were obtained by analyzing the tasks written in the procedures and observing the speech and behaviors of the reserved operators in a full-scope dynamic simulator for an APR 1400. The data were analyzed using an F-test and a Duncan test. It was found that the workloads of the shift supervisors (SSs) were larger than other operators and the operative activities of the SSs increased owing to the computer-based procedure. From these findings, methods to reduce the workloads of the SSs that arise from the computer-based procedure are discussed. (author)

  1. Effect of Ferrite Morphology on Sensitization of 316L Austenitic Stainless Steels

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Hun; Lee, Jun Ho; Jang, Changheui [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2013-05-15

    The sensitization behaviors of L-grade SSs having predominant austenitic structure with small amount of ferrite have not been well understood. In this regard, the effect of ferrite morphology on sensitization was investigated in this study. The sensitization behaviors of three heats of 316L and 316LN SSs were investigated, Stringer type of ferrite (316L - heat A and B) showed the early sensitization by chromium depletion at ferrite. austenite interface. And, later sensitization is due to GB sensitization. On the other hand, blocky type of ferrite (316L - heat C) showed lower DOS and higher resistance to GB sensitization. It could be due to sufficient supply of chromium from relatively large ferrite phase. As a consequence, the sensitization of 316L SSs could be affected by their ferrite morphology rather than ferrite content. The sensitized region was distinguishable from results of DL-EPR tests. It can be used as an effective method for evaluation of type of sensitization.

  2. Pulsed-laser-deposited YBCO thin films using modified MTG processed targets

    CERN Document Server

    Kim, C H; Kim, I T; Hahn, T S

    1999-01-01

    YBCO thin films were deposited by pulsed laser deposition from targets fabricated using the modified melt-textured growth (MTG) method and the solid-state sintering (SSS) method. All of the films showed c-axis orientations, but the films from the MTG targets had better crystallinity than those from the SSS targets. As the substrate temperature was increased, T sub c and J sub c of the films increased. The films from the MTG targets showed better superconducting properties than those from the SSS targets. From the composition analysis of the targets, the Y-richer vapor species arriving at the substrate from the MTG targets are thought to form a thermodynamically more stable YBCO phase with less cation disorder.

  3. Thermal Performance of the LHC Short Straight Section Cryostat

    CERN Document Server

    Bergot, J B; Nielsen, L; Parma, Vittorio; Rohmig, P; Roy, E

    2002-01-01

    The LHC Short Straight Section (SSS) cryostat houses and thermally protects in vacuum the cold mass which contains a twin-aperture superconducting quadrupole magnet and superconducting corrector magnets operating at 1.9 K in superfluid helium. In addition to mechanical requirements, the cryostat is designed to minimize the heat in-leak from the ambient temperature to the cold mass. Mechanical components linking the cold mass to the vacuum vessel such as support posts and an insulation vacuum barrier are designed to have minimum heat conductivity with efficient thermalisations for heat interception. Heat in-leak by radiation is reduced by employing multilayer insulation wrapped around the cold mass and an actively cooled aluminium thermal shield. The recent commissioning and operation of two SSS prototypes in the LHC Test String 2 have given a first experimental validation of the thermal performance of the SSS cryostat in nominal operating conditions. Temperature sensors mounted in critical locations provide a...

  4. Social Inequalities and Depressive Symptoms in Adults: The Role of Objective and Subjective Socioeconomic Status.

    Science.gov (United States)

    Hoebel, Jens; Maske, Ulrike E; Zeeb, Hajo; Lampert, Thomas

    2017-01-01

    There is substantial evidence that lower objective socioeconomic status (SES)-as measured by education, occupation, and income-is associated with a higher risk of depression. Less is known, however, about associations between perceptions of social status and the prevalence of depression. This study investigated associations of both objective SES and subjective social status (SSS) with depressive symptoms among adults in Germany. Data were obtained from the 2013 special wave of the German Health Update study, a national health survey of the adult population in Germany. Objective SES was determined using a composite index based on education, occupation, and income. The three single dimensions of the index were also used individually. SSS was measured using the MacArthur Scale, which asks respondents to place themselves on a 10-rung 'social ladder'. Regression models were employed to examine associations of objective SES and SSS with current depressive symptoms, as assessed with the eight-item Patient Health Questionnaire depression scale (PHQ-8 sum score ≥10). After mutual adjustment, lower objective SES and lower SSS were independently associated with current depressive symptoms. The associations were found in both sexes and persisted after further adjustment for sociodemographic factors, long-term chronic conditions, and functional limitations. Mediation analyses revealed a significant indirect relationship between objective SES and depressive symptoms through SSS. When the three individual dimensions of objective SES were mutually adjusted, occupation and income were independently associated with depressive symptoms. After additional adjustment for SSS, these associations attenuated but remained significant. The findings suggest that perceptions of low social status in adults may be involved in the pathogenesis of depression and play a mediating role in the relationship between objective SES and depressive symptoms. Prospective studies are needed to establish

  5. Testing the effectiveness of simplified search strategies for updating systematic reviews.

    Science.gov (United States)

    Rice, Maureen; Ali, Muhammad Usman; Fitzpatrick-Lewis, Donna; Kenny, Meghan; Raina, Parminder; Sherifali, Diana

    2017-08-01

    The objective of the study was to test the overall effectiveness of a simplified search strategy (SSS) for updating systematic reviews. We identified nine systematic reviews undertaken by our research group for which both comprehensive and SSS updates were performed. Three relevant performance measures were estimated, that is, sensitivity, precision, and number needed to read (NNR). The update reference searches for all nine included systematic reviews identified a total of 55,099 citations that were screened resulting in final inclusion of 163 randomized controlled trials. As compared with reference search, the SSS resulted in 8,239 hits and had a median sensitivity of 83.3%, while precision and NNR were 4.5 times better. During analysis, we found that the SSS performed better for clinically focused topics, with a median sensitivity of 100% and precision and NNR 6 times better than for the reference searches. For broader topics, the sensitivity of the SSS was 80% while precision and NNR were 5.4 times better compared with reference search. SSS performed well for clinically focused topics and, with a median sensitivity of 100%, could be a viable alternative to a conventional comprehensive search strategy for updating this type of systematic reviews particularly considering the budget constraints and the volume of new literature being published. For broader topics, 80% sensitivity is likely to be considered too low for a systematic review update in most cases, although it might be acceptable if updating a scoping or rapid review. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Post irradiation examination of type 316 stainless steels for in-pile Oarai water loop No.2 (OWL-2)

    International Nuclear Information System (INIS)

    Shibata, Akira; Kimura, Tadashi; Nagata, Hiroshi; Aoyama, Masashi; Kanno, Masaru; Ohmi, Masao

    2010-11-01

    The Oarai water loop No.2 (OWL-2) was installed in JMTR in 1972 for the purpose of irradiation experiments of fuel element and component material for light water reactors. Type 316 stainless steels (SSs) were used for tube material of OWL-2 in the reactor. But data of mechanical properties of highly irradiated Type 316 SSs has been insufficient since OWL-2 was installed. Therefore surveillance tests of type 316 SSs which were irradiated up to 3.4x10 25 n/m 2 in fast neutron fluence (>1 MeV) were performed. Meanwhile type 316 stainless steel (SS) is widely used in JMTR such as other irradiation apparatus and irradiation capsule, and additional data of type 316 SSs irradiated higher is required. Therefore post irradiation examinations of surveillance specimens made of type 316 SSs which were irradiated up to 1.0x10 26 n/m 2 in fast neutron fluence were performed and reported in this paper. In this result of surveillance tests of type 316 SSs irradiated up to 1.0x10 26 n/m 2 , tensile strength increase with increase of Neutron fluence and total elongation decreased with increase of Neutron fluence compared to unirradiated specimens and specimens irradiated up to 3.4x10 25 n/m 2 . This tendency has good agreement with results of 10 24 - 10 25 n/m 2 in fast neutron fluence. More than 37% in total elongation was confirmed in all test conditions. It was confirmed that type 316 SS irradiated up to 1.0x10 26 n/m 2 in fast neutron fluence has enough ductility as structure material. (author)

  7. The non-flagellar type III secretion system evolved from the bacterial flagellum and diversified into host-cell adapted systems.

    Directory of Open Access Journals (Sweden)

    Sophie S Abby

    2012-09-01

    Full Text Available Type 3 secretion systems (T3SSs are essential components of two complex bacterial machineries: the flagellum, which drives cell motility, and the non-flagellar T3SS (NF-T3SS, which delivers effectors into eukaryotic cells. Yet the origin, specialization, and diversification of these machineries remained unclear. We developed computational tools to identify homologous components of the two systems and to discriminate between them. Our analysis of >1,000 genomes identified 921 T3SSs, including 222 NF-T3SSs. Phylogenomic and comparative analyses of these systems argue that the NF-T3SS arose from an exaptation of the flagellum, i.e. the recruitment of part of the flagellum structure for the evolution of the new protein delivery function. This reconstructed chronology of the exaptation process proceeded in at least two steps. An intermediate ancestral form of NF-T3SS, whose descendants still exist in Myxococcales, lacked elements that are essential for motility and included a subset of NF-T3SS features. We argue that this ancestral version was involved in protein translocation. A second major step in the evolution of NF-T3SSs occurred via recruitment of secretins to the NF-T3SS, an event that occurred at least three times from different systems. In rhizobiales, a partial homologous gene replacement of the secretin resulted in two genes of complementary function. Acquisition of a secretin was followed by the rapid adaptation of the resulting NF-T3SSs to multiple, distinct eukaryotic cell envelopes where they became key in parasitic and mutualistic associations between prokaryotes and eukaryotes. Our work elucidates major steps of the evolutionary scenario leading to extant NF-T3SSs. It demonstrates how molecular evolution can convert one complex molecular machine into a second, equally complex machine by successive deletions, innovations, and recruitment from other molecular systems.

  8. Detection and eradication of Spongospora subterranea in mini-tuber production tunnels

    Directory of Open Access Journals (Sweden)

    Jacquie E. van der Waals

    2012-05-01

    Full Text Available Powdery scab, a root and tuber disease caused by the pathogen Spongospora subterranea f.sp. subterranea (Sss, poses a major problem to potato producers worldwide because it affects potato quality. Inoculum can be seed-borne or originate from contaminated growing media or contaminated equipment. During 2006, a potato mini-tuber production facility in Ceres in the Western Cape Province of South Africa had an outbreak of powdery scab. The purpose of this study was to detect Sss in the production facility and identify the source or sources of contamination so that corrective measures could be taken to eradicate the pathogen. Swab samples were taken from numerous points in the facility in 2009 and Sss-specific primers (Sps1 and Sps2 were used in a polymerase chain reaction to detect Sss. Of 11 surfaces tested, 6 were positive for Sss. A second set of swab samples was taken after efforts were made to eradicate the pathogen through improved facility hygiene measures to determine whether these corrective measures were efficient. Corrective measures resulted in a disease-free harvest from 2009 onwards. This novel study has value for the mini-tuber industry as production tunnels can be tested for the presence of Sss and other pathogens before planting to ensure that, where suitable control measures are available, disease-free mini-tubers are produced.

  9. Individual Differences in the Rubber Hand Illusion Are Related to Sensory Suggestibility.

    Directory of Open Access Journals (Sweden)

    Angela Marotta

    Full Text Available In the rubber hand illusion (RHI, watching a rubber hand being stroked in synchrony with one's own hidden hand may induce a sense of ownership over the rubber hand. The illusion relies on bottom-up multisensory integration of visual, tactile, and proprioceptive information, and on top-down processes through which the rubber hand is incorporated into pre-existing representations of the body. Although the degree of illusory experience varies largely across individuals, the factors influencing individual differences are unknown. We investigated whether sensory suggestibility might modulate susceptibility to the RHI. Sensory suggestibility is a personality trait related to how individuals react to sensory information. Because of its sensory nature, this trait could be relevant for studies using the RHI paradigm. Seventy healthy volunteers were classified by Sensory Suggestibility Scale (SSS scores as having high or low suggestibility and assigned to either a high- (High-SSS or a low-suggestibility (Low-SSS group. Two components of the RHI were evaluated in synchronous and asynchronous stroking conditions: subjective experience of sense of ownership over the rubber hand via a 9-statement questionnaire, and proprioceptive drift as measured with a ruler. The High-SSS group was generally more susceptible to the subjective component; in the synchronous condition, they rated the statement assessing the sense of ownership higher than the Low-SSS group. The scores for this statement significantly correlated with the total SSS score, indicating that the higher the sensory suggestibility, the stronger the sense of ownership. No effect of sensory suggestibility on proprioceptive drift was observed, suggesting that the effect is specific for the subjective feeling of ownership. This study demonstrates that sensory suggestibility may contribute to participants' experience of the illusion and should be considered when using the RHI paradigm.

  10. Individual Differences in the Rubber Hand Illusion Are Related to Sensory Suggestibility.

    Science.gov (United States)

    Marotta, Angela; Tinazzi, Michele; Cavedini, Clelia; Zampini, Massimiliano; Fiorio, Mirta

    2016-01-01

    In the rubber hand illusion (RHI), watching a rubber hand being stroked in synchrony with one's own hidden hand may induce a sense of ownership over the rubber hand. The illusion relies on bottom-up multisensory integration of visual, tactile, and proprioceptive information, and on top-down processes through which the rubber hand is incorporated into pre-existing representations of the body. Although the degree of illusory experience varies largely across individuals, the factors influencing individual differences are unknown. We investigated whether sensory suggestibility might modulate susceptibility to the RHI. Sensory suggestibility is a personality trait related to how individuals react to sensory information. Because of its sensory nature, this trait could be relevant for studies using the RHI paradigm. Seventy healthy volunteers were classified by Sensory Suggestibility Scale (SSS) scores as having high or low suggestibility and assigned to either a high- (High-SSS) or a low-suggestibility (Low-SSS) group. Two components of the RHI were evaluated in synchronous and asynchronous stroking conditions: subjective experience of sense of ownership over the rubber hand via a 9-statement questionnaire, and proprioceptive drift as measured with a ruler. The High-SSS group was generally more susceptible to the subjective component; in the synchronous condition, they rated the statement assessing the sense of ownership higher than the Low-SSS group. The scores for this statement significantly correlated with the total SSS score, indicating that the higher the sensory suggestibility, the stronger the sense of ownership. No effect of sensory suggestibility on proprioceptive drift was observed, suggesting that the effect is specific for the subjective feeling of ownership. This study demonstrates that sensory suggestibility may contribute to participants' experience of the illusion and should be considered when using the RHI paradigm.

  11. Fully 3D iterative scatter-corrected OSEM for HRRT PET using a GPU

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kyung Sang; Ye, Jong Chul, E-mail: kssigari@kaist.ac.kr, E-mail: jong.ye@kaist.ac.kr [Bio-Imaging and Signal Processing Lab., Department of Bio and Brain Engineering, Korea Advanced Institute of Science and Technology (KAIST), 335 Gwahak-no, Yuseong-gu, Daejon 305-701 (Korea, Republic of)

    2011-08-07

    Accurate scatter correction is especially important for high-resolution 3D positron emission tomographies (PETs) such as high-resolution research tomograph (HRRT) due to large scatter fraction in the data. To address this problem, a fully 3D iterative scatter-corrected ordered subset expectation maximization (OSEM) in which a 3D single scatter simulation (SSS) is alternatively performed with a 3D OSEM reconstruction was recently proposed. However, due to the computational complexity of both SSS and OSEM algorithms for a high-resolution 3D PET, it has not been widely used in practice. The main objective of this paper is, therefore, to accelerate the fully 3D iterative scatter-corrected OSEM using a graphics processing unit (GPU) and verify its performance for an HRRT. We show that to exploit the massive thread structures of the GPU, several algorithmic modifications are necessary. For SSS implementation, a sinogram-driven approach is found to be more appropriate compared to a detector-driven approach, as fast linear interpolation can be performed in the sinogram domain through the use of texture memory. Furthermore, a pixel-driven backprojector and a ray-driven projector can be significantly accelerated by assigning threads to voxels and sinograms, respectively. Using Nvidia's GPU and compute unified device architecture (CUDA), the execution time of a SSS is less than 6 s, a single iteration of OSEM with 16 subsets takes 16 s, and a single iteration of the fully 3D scatter-corrected OSEM composed of a SSS and six iterations of OSEM takes under 105 s for the HRRT geometry, which corresponds to acceleration factors of 125x and 141x for OSEM and SSS, respectively. The fully 3D iterative scatter-corrected OSEM algorithm is validated in simulations using Geant4 application for tomographic emission and in actual experiments using an HRRT.

  12. Outcomes of laryngohyoid suspension techniques in an ovine model of profound oropharyngeal dysphagia.

    Science.gov (United States)

    Johnson, Christopher M; Venkatesan, Naren N; Siddiqui, M Tausif; Cates, Daniel J; Kuhn, Maggie A; Postma, Gregory M; Belafsky, Peter C

    2017-12-01

    To evaluate the efficacy of various techniques of laryngohyoid suspension in the elimination of aspiration utilizing a cadaveric ovine model of profound oropharyngeal dysphagia. Animal study. The head and neck of a Dorper cross ewe was placed in the lateral fluoroscopic view. Five conditions were tested: baseline, thyroid cartilage to hyoid approximation (THA), thyroid cartilage to hyoid to mandible (laryngohyoid) suspension (LHS), LHS with cricopharyngeus muscle myotomy (LHS-CPM), and cricopharyngeus muscle myotomy (CPM) alone. Five 20-mL trials of barium sulfate were delivered into the oropharynx under fluoroscopy for each condition. Outcome measures included the penetration aspiration scale (PAS) and the National Institutes of Health (NIH) Swallow Safety Scale (NIH-SSS). Median baseline PAS and NIH-SSS scores were 8 and 6, respectively, indicating severe impairment. THA scores were not improved from baseline. LHS alone reduced the PAS to 1 (P = .025) and NIH-SSS to 2 (P = .025) from baseline. LHS-CPM reduced the PAS to 1 (P = .025) and NIH-SSS to 0 (P = .025) from baseline. CPM alone did not improve scores. LHS-CPM displayed improved NIH-SSS over LHS alone (P = .003). This cadaveric model represents end-stage profound oropharyngeal dysphagia such as what could result from severe neurological insult. CPM alone failed to improve fluoroscopic outcomes in this model. Thyrohyoid approximation also failed to improve outcomes. LHS significantly improved both PAS and NIH-SSS. The addition of CPM to LHS resulted in improvement over suspension alone. NA. Laryngoscope, 127:E422-E427, 2017. © 2017 The American Laryngological, Rhinological and Otological Society, Inc.

  13. Social Inequalities and Depressive Symptoms in Adults: The Role of Objective and Subjective Socioeconomic Status

    Science.gov (United States)

    Maske, Ulrike E.; Zeeb, Hajo; Lampert, Thomas

    2017-01-01

    Background There is substantial evidence that lower objective socioeconomic status (SES)—as measured by education, occupation, and income—is associated with a higher risk of depression. Less is known, however, about associations between perceptions of social status and the prevalence of depression. This study investigated associations of both objective SES and subjective social status (SSS) with depressive symptoms among adults in Germany. Methods Data were obtained from the 2013 special wave of the German Health Update study, a national health survey of the adult population in Germany. Objective SES was determined using a composite index based on education, occupation, and income. The three single dimensions of the index were also used individually. SSS was measured using the MacArthur Scale, which asks respondents to place themselves on a 10-rung ‘social ladder’. Regression models were employed to examine associations of objective SES and SSS with current depressive symptoms, as assessed with the eight-item Patient Health Questionnaire depression scale (PHQ-8 sum score ≥10). Results After mutual adjustment, lower objective SES and lower SSS were independently associated with current depressive symptoms. The associations were found in both sexes and persisted after further adjustment for sociodemographic factors, long-term chronic conditions, and functional limitations. Mediation analyses revealed a significant indirect relationship between objective SES and depressive symptoms through SSS. When the three individual dimensions of objective SES were mutually adjusted, occupation and income were independently associated with depressive symptoms. After additional adjustment for SSS, these associations attenuated but remained significant. Conclusions The findings suggest that perceptions of low social status in adults may be involved in the pathogenesis of depression and play a mediating role in the relationship between objective SES and depressive symptoms

  14. The French Contribution to the Voluntary Observing Ships Network of Sea Surface Salinity

    Science.gov (United States)

    Delcroix, T. C.; Alory, G.; Téchiné, P.; Diverrès, D.; Varillon, D.; Cravatte, S. E.; Gouriou, Y.; Grelet, J.; Jacquin, S.; Kestenare, E.; Maes, C.; Morrow, R.; Perrier, J.; Reverdin, G. P.; Roubaud, F.

    2016-02-01

    Sea Surface Salinity (SSS) is an essential climate variable that requires long term in situ observation. The French SSS Observation Service (SSS-OS) manages a network of Voluntary Observing Ships equipped with thermosalinographs (TSG). The network is global though more concentrated in the tropical Pacific and North Atlantic oceanic basins. The acquisition system is autonomous with real time transmission and is regularly serviced at harbor calls. There are distinct real time and delayed time processing chains. Real time processing includes automatic alerts to detect potential instrument problems, in case raw data are outside of climatic limits, and graphical monitoring tools. Delayed time processing relies on a dedicated software for attribution of data quality flags by visual inspection, and correction of TSG time series by comparison with daily water samples and collocated Argo data. A method for optimizing the automatic attribution of quality flags in real time, based on testing different thresholds for data deviation from climatology and retroactively comparing the resulting flags to delayed time flags, is presented. The SSS-OS real time data feed the Coriolis operational oceanography database, while the research-quality delayed time data can be extracted for selected time and geographical ranges through a graphical web interface. Delayed time data have been also combined with other SSS data sources to produce gridded files for the Pacific and Atlantic oceans. A short review of the research activities conducted with such data is given. It includes observation-based process-oriented and climate studies from regional to global scale as well as studies where in situ SSS is used for calibration/validation of models, coral proxies or satellite data.

  15. Radiation Therapy for Hypersalivation: A Prospective Study in 50 Amyotrophic Lateral Sclerosis Patients

    International Nuclear Information System (INIS)

    Assouline, Avi; Levy, Antonin; Abdelnour-Mallet, Maya; Gonzalez-Bermejo, Jesus; Lenglet, Timothée; Le Forestier, Nadine

    2014-01-01

    Purpose: This study aimed to evaluate the efficiency and the tolerance of radiation therapy (RT) on salivary glands in a large series of amyotrophic lateral sclerosis (ALS) patients with hypersalivation. Methods and Materials: Fifty ALS patients that had medically failure pretreatment were included in this prospective study. RT was delivered through a conventional linear accelerator with 6-MV photons and 2 opposed beams fields including both submandibular glands and two-thirds of both parotid glands. Total RT dose was 10 Gy in 2 fractions (n=30) or 20 Gy in 4 fractions (n=20). RT efficacy was assessed with the 9-grade Sialorrhea Scoring Scale (SSS), recently prospectively validated as the most effective and sensitive tool to measure sialorrhea in ALS patients. Results: At the end of RT, all patients had improved: 46 had a complete response (92% CR, SSS 1-3) and 4 had a partial response (8% PR, SSS 4-5). A significant lasting salivary reduction was observed 6 months after RT completion: there was 71% CR and 26% PR, and there was a significant SSS reduction versus baseline (P<10 −6 ). There was no grade 3 to 4 toxicity, and most side effects (34%) occurred during RT. Nine patients (18%) underwent a second salivary gland RT course, with a 3-months mean delay from the first RT, resulting in a SSS decrease (−77%). Both RT dose regimens induced a significant SSS decrease with no significant toxicity. There were, however, more patients with CR/PR in the 20-Gy protocol (P=.02), and 8 of 9 patients (89%) receiving a second RT course had previously been treated within the 10-Gy protocol. Conclusion: Radiation therapy of 20 Gy in 4 fractions is an efficient and safe treatment for ALS patients with sialorrhea. A shorter RT course (10 Gy in 2 fractions) may be proposed in patients in poor medical condition

  16. Irradiation-Assisted Stress Corrosion Cracking of Austenitic Stainless Steels in BWR Environments

    International Nuclear Information System (INIS)

    Chen, Y.; Chopra, O. K.; Gruber, Eugene E.; Shack, William J.

    2010-01-01

    The internal components of light water reactors are exposed to high-energy neutron irradiation and high-temperature reactor coolant. The exposure to neutron irradiation increases the susceptibility of austenitic stainless steels (SSs) to stress corrosion cracking (SCC) because of the elevated corrosion potential of the reactor coolant and the introduction of new embrittlement mechanisms through radiation damage. Various nonsensitized SSs and nickel alloys have been found to be prone to intergranular cracking after extended neutron exposure. Such cracks have been seen in a number of internal components in boiling water reactors (BWRs). The elevated susceptibility to SCC in irradiated materials, commonly referred to as irradiation-assisted stress corrosion cracking (IASCC), is a complex phenomenon that involves simultaneous actions of irradiation, stress, and corrosion. In recent years, as nuclear power plants have aged and irradiation dose increased, IASCC has become an increasingly important issue. Post-irradiation crack growth rate and fracture toughness tests have been performed to provide data and technical support for the NRC to address various issues related to aging degradation of reactor-core internal structures and components. This report summarizes the results of the last group of tests on compact tension specimens from the Halden-II irradiation. The IASCC susceptibility of austenitic SSs and heat-affected-zone (HAZ) materials sectioned from submerged arc and shielded metal arc welds was evaluated by conducting crack growth rate and fracture toughness tests in a simulated BWR environment. The fracture and cracking behavior of HAZ materials, thermally sensitized SSs and grain-boundary engineered SSs was investigated at several doses (3 dpa). These latest results were combined with previous results from Halden-I and II irradiations to analyze the effects of neutron dose, water chemistry, alloy compositions, and welding and processing conditions on IASCC. The

  17. Satellite observations of rainfall effect on sea surface salinity in the waters adjacent to Taiwan

    Science.gov (United States)

    Ho, Chung-Ru; Hsu, Po-Chun; Lin, Chen-Chih; Huang, Shih-Jen

    2017-10-01

    Changes of oceanic salinity are highly related to the variations of evaporation and precipitation. To understand the influence of rainfall on the sea surface salinity (SSS) in the waters adjacent to Taiwan, satellite remote sensing data from the year of 2012 to 2014 are employed in this study. The daily rain rate data obtained from Special Sensor Microwave Imager (SSM/I), Tropical Rainfall Measuring Mission's Microwave Imager (TRMM/TMI), Advanced Microwave Scanning Radiometer (AMSR), and WindSat Polarimetric Radiometer. The SSS data was derived from the measurements of radiometer instruments onboard the Aquarius satellite. The results show the average values of SSS in east of Taiwan, east of Luzon and South China Sea are 33.83 psu, 34.05 psu, and 32.84 psu, respectively, in the condition of daily rain rate higher than 1 mm/hr. In contrast to the rainfall condition, the average values of SSS are 34.07 psu, 34.26 psu, and 33.09 psu in the three areas, respectively at no rain condition (rain rate less than 1 mm/hr). During the cases of heavy rainfall caused by spiral rain bands of typhoon, the SSS is diluted with an average value of -0.78 psu when the average rain rate is higher than 4 mm/hr. However, the SSS was increased after temporarily decreased during the typhoon cases. A possible reason to explain this phenomenon is that the heavy rainfall caused by the spiral rain bands of typhoon may dilute the sea surface water, but the strong winds can uplift the higher salinity of subsurface water to the sea surface.

  18. Detection and quantification of Spongospora subterranea f. sp. subterranea in bait plants and potato fields in Colombia using QPCR

    International Nuclear Information System (INIS)

    Garcia Bastidas, Nevar; Morales, Juan Gonzalo; Gonzalez Jaimes, Paola; Gutierrez, Pablo Andres; Marin Montoya, Mauricio

    2013-01-01

    In recent years, potato crops (Solanum tuberosum, S. phureja) have been seriously affected by powdery scab; a disease caused by Spongospora subterranea f.sp. subterranea (Sss). In Colombia, asymptomatic detection of Sss has been achieved with bait plants, PCR of its regions and ELISA tests. Unfortunately, these techniques have low sensitivity and may require long processing times. In this work, quantitative real time PCR (qPCR) was tested for detection of Sss using different sets of primers. Primers SsTQF1-SsTQR1, Spon421F-Spon494R and SscolF-SscolR (designed in this study), were tested using SYBR green, while primers sponfsponr were tested using the Taqman probe sponp. Primers Spon421F-Spon494R was discarded due to lack of specificity. Standard curves were obtained from serial dilutions of Cystosori. the 20 N. benthamiana and potato bait plants evaluated tested positive for Sss using primers SsTQF1-SsTQR1 (Ct: 10.57-29.34) and Sscolf-SscolR (Ct: 14.39-34.08) and 19 samples were positive with primers SponF-SponR-SponP, with Ct values ranging between 15,63 and 38,93. Sss was detected in 17 out of 20 root samples from potato crops in la Union (Antioquia) using primers SscolF-SscolRt with an estimated concentration of 6470 to 1,39x10 1 0 cystosori/ mL. these results suggest high levels of sss in the potato fields from this region and recall the importance of strengthening seed-certification programs in Colombia.

  19. Radiation Therapy for Hypersalivation: A Prospective Study in 50 Amyotrophic Lateral Sclerosis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Assouline, Avi, E-mail: avi.assouline@ccpsc.fr [Department of Radiation Oncology, Centre Clinique de la Porte de Saint Cloud, Boulogne-Billancourt (France); Department of Radiation Oncology, Groupe Hospitalier Pitié-Salpêtrière, Assistance Publique - Hôpitaux de Paris (APHP), Paris (France); Levy, Antonin [Department of Radiation Oncology, Gustave Roussy, Université Paris-Sud XI, Villejuif (France); Abdelnour-Mallet, Maya [Service Evaluation Pharmaceutique et Bon Usage (SEPBU), Unité Evaluation Scientifique, Bon Usage et Information (ESBUI), APHP AGEPS/pôle Pharmacie Hospitalière, Hôpitaux de Paris - PHHP, Paris (France); Gonzalez-Bermejo, Jesus [Departement of Pneumology and Intensive Care, Groupe Hospitalier Pitié-Salpêtrière, APHP, Paris (France); Lenglet, Timothée [Departement of Nervous System Diseases, Paris ALS center, Groupe Hospitalier Pitié-Salpêtrière, APHP, Paris (France); Le Forestier, Nadine [Departement of Nervous System Diseases, Paris ALS center, Groupe Hospitalier Pitié-Salpêtrière, APHP, Paris (France); Département de Recherche ES3, Emmanuel Hirsch, EA 1610 Études sur les Sciences et les Techniques, Université Paris-Sud XI, Paris (France); and others

    2014-03-01

    Purpose: This study aimed to evaluate the efficiency and the tolerance of radiation therapy (RT) on salivary glands in a large series of amyotrophic lateral sclerosis (ALS) patients with hypersalivation. Methods and Materials: Fifty ALS patients that had medically failure pretreatment were included in this prospective study. RT was delivered through a conventional linear accelerator with 6-MV photons and 2 opposed beams fields including both submandibular glands and two-thirds of both parotid glands. Total RT dose was 10 Gy in 2 fractions (n=30) or 20 Gy in 4 fractions (n=20). RT efficacy was assessed with the 9-grade Sialorrhea Scoring Scale (SSS), recently prospectively validated as the most effective and sensitive tool to measure sialorrhea in ALS patients. Results: At the end of RT, all patients had improved: 46 had a complete response (92% CR, SSS 1-3) and 4 had a partial response (8% PR, SSS 4-5). A significant lasting salivary reduction was observed 6 months after RT completion: there was 71% CR and 26% PR, and there was a significant SSS reduction versus baseline (P<10{sup −6}). There was no grade 3 to 4 toxicity, and most side effects (34%) occurred during RT. Nine patients (18%) underwent a second salivary gland RT course, with a 3-months mean delay from the first RT, resulting in a SSS decrease (−77%). Both RT dose regimens induced a significant SSS decrease with no significant toxicity. There were, however, more patients with CR/PR in the 20-Gy protocol (P=.02), and 8 of 9 patients (89%) receiving a second RT course had previously been treated within the 10-Gy protocol. Conclusion: Radiation therapy of 20 Gy in 4 fractions is an efficient and safe treatment for ALS patients with sialorrhea. A shorter RT course (10 Gy in 2 fractions) may be proposed in patients in poor medical condition.

  20. Usefulness of abdominal aortic calcification for screening of peripheral vascular disease

    International Nuclear Information System (INIS)

    Park, Chul Hi; Kim, Jeong Ho; Choi, Soo Jin; Kim, Hyung Sik; Jin, Wook; Yang, Dal Mo

    2006-01-01

    We wanted to evaluate the value of abdominal aortic calcification (AAC), as detected on CT, as a predictor of atherosclerotic stenotic disease of the lower extremity arteries. One hundred three patients who had CT angiography performed for the evaluation of peripheral vascular disease were enrolled in this retrospective study. The volume (mm 3 ) of the AAC was measured on CT. Each lower extremity was divided into 8 segments. The extent of stenosis of the lower extremity artery was manifested as the sum of the stenosis scores for 16 segments (total stenosis score: TSS). The significant stenosis scores (SSS-50 and SSS-75) were defined as the sum of scores for the lower extremity artery segments that had significant stenosis of more than 50% and 75%, respectively. AAC was correlated to the TSS, SSS-50 and SSS-75 with using Spearman's correlation coefficient. The diagnostic performance of AAC for stenosis of a lower extremity artery of more than 50% and 75%, respectively, was evaluated by using the receiver operating characteristic (ROC) curve. The Spearman's correlation coefficients were 0.728 (AAC vs. TSS), 0.662 (AAC vs. SSS-50), and 0.602 (AAC vs. SSS-75), respectively. For significant stenosis more than 50% and 75%, the areas under the ROC curve were 0.898 and 0.866, respectively. The cutoff value, sensitivity, specificity, positive predictive value, negative predictive value and accuracy were 1030 mm 3 , 87%, 88%, 89%. 86% and 87% for stenosis more than 50% and 1030 mm 3 , 87%, 80%, 79%, 88% and 84% for stenosis more than 75%, respectively. Abdominal aortic calcification detected on CT may be a useful predictor of atherosclerotic stenotic disease of lower extremity arteries

  1. Critical analysis: use of polymerase chain reaction to diagnose leprosy

    Directory of Open Access Journals (Sweden)

    Flaviane Granero Maltempe

    Full Text Available ABSTRACT Leprosy is a neglected tropical disease and an important public health problem, especially in developing countries. It is a chronic infectious disease that is caused by Mycobacterium leprae, which has a predilection for the skin and peripheral nerves. Although it has low sensitivity, slit-skin smear (SSS remains the conventional auxiliary laboratory technique for the clinical diagnosis of leprosy. Polymerase chain reaction (PCR is a molecular biology technique that holds promise as a simple and sensitive diagnostic tool. In the present study, the performance of two PCR methods, using different targets, PCR-LP and PCR-P, were compared with SSS with regard to leprosy diagnosis in a reference laboratory. M. leprae DNA was extracted from 106 lymph samples of 40 patients who had clinical suspicion of leprosy. The samples were subjected to both PCR techniques and SSS. Amplification of the human b-globin gene was used as PCR inhibitor control. The specificity of both PCR techniques was 100%, and sensitivity was 0.007 and 0.015 µg/ml for PCR-LP and PCR-P, respectively. No significant difference was found between either the PCR-LP or PCR-P results and SSS results (p > 0.05. Although PCR is not yet a replacement for SSS in the diagnosis of leprosy, this technique may be used as an efficient auxiliary tool for early detection of the disease, especially in endemic regions. This strategy may also be useful in cases in which SSS results are negative (e.g., in paucibacillary patients and cases in which skin biopsy cannot be performed.

  2. Sea surface salinity and temperature-based predictive modeling of southwestern US winter precipitation: improvements, errors, and potential mechanisms

    Science.gov (United States)

    Liu, T.; Schmitt, R. W.; Li, L.

    2017-12-01

    Using 69 years of historical data from 1948-2017, we developed a method to globally search for sea surface salinity (SSS) and temperature (SST) predictors of regional terrestrial precipitation. We then applied this method to build an autumn (SON) SSS and SST-based 3-month lead predictive model of winter (DJF) precipitation in southwestern United States. We also find that SSS-only models perform better than SST-only models. We previously used an arbitrary correlation coefficient (r) threshold, |r| > 0.25, to define SSS and SST predictor polygons for best subset regression of southwestern US winter precipitation; from preliminary sensitivity tests, we find that |r| > 0.18 yields the best models. The observed below-average precipitation (0.69 mm/day) in winter 2015-2016 falls within the 95% confidence interval of the prediction model. However, the model underestimates the anomalous high precipitation (1.78 mm/day) in winter 2016-2017 by more than three-fold. Moisture transport mainly attributed to "pineapple express" atmospheric rivers (ARs) in winter 2016-2017 suggests that the model falls short on a sub-seasonal scale, in which case storms from ARs contribute a significant portion of seasonal terrestrial precipitation. Further, we identify a potential mechanism for long-range SSS and precipitation teleconnections: standing Rossby waves. The heat applied to the atmosphere from anomalous tropical rainfall can generate standing Rossby waves that propagate to higher latitudes. SSS anomalies may be indicative of anomalous tropical rainfall, and by extension, standing Rossby waves that provide the long-range teleconnections.

  3. Real-time display of flow-pressure-volume loops.

    Science.gov (United States)

    Morozoff, P E; Evans, R W

    1992-01-01

    Graphic display of respiratory waveforms can be valuable for monitoring the progress of ventilated patients. A system has been developed that can display flow-pressure-volume loops as derived from a patient's respiratory circuit in real time. It can also display, store, print, and retrieve ventilatory waveforms. Five loops can be displayed at once: current, previous, reference, "ideal," and previously saved. Two components, the data-display device (DDD) and the data-collection device (DCD), comprise the system. An IBM 286/386 computer with a graphics card (VGA) and bidirectional parallel port is used for the DDD; an eight-bit microprocessor card and an A/D convertor card make up the DCD. A real-time multitasking operating system was written to control the DDD, while the DCD operates from in-line assembly code. The DCD samples the pressure and flow sensors at 100 Hz and looks for a complete flow waveform pattern based on flow slope. These waveforms are then passed to the DDD via the mutual parallel port. Within the DDD a process integrates the flow to create a volume signal and performs a multilinear regression on the pressure, flow, and volume data to calculate the elastance, resistance, pressure offset, and coefficient of determination. Elastance, resistance, and offset are used to calculate Pr and Pc where: Pr[k] = P[k]-offset-(elastance.V[k]) and Pc[k] = P[k]-offset-(resistance.F[k]). Volume vs. Pc and flow vs. Pr can be displayed in real time. Patient data from previous clinical tests were loaded into the device to verify the software calculations. An analog waveform generator was used to simulate flow and pressure waveforms that validated the system.(ABSTRACT TRUNCATED AT 250 WORDS)

  4. Outpatient utilization of psychopharmaceuticals in the City of Zagreb 2001-2006.

    Science.gov (United States)

    Stimac, Danijela; Culig, Josip

    2009-03-01

    A comprehensive insight into drug utilization as an economic and primarily a public health issue can only be acquired in the context of overall health state of the respective population. The objectives of the study were: 1) to determine the real outpatient utilization of psychopharmaceuticals in Zagreb, 2) to determine the psychopharmaceutical prescribing quality during the study period; and 3) to propose appropriate interventions in Zagreb on the basis of the results obtained. Data on drug utilization were obtained from all Zagreb pharmacies. The number of defined daily doses (DDD) and number of DDD per 1000 inhabitants per day (DDD/1000/day) were calculated from the number of particular drug packages. The Drug Utilization 90% (DU90%) method was used as a criterion of prescribing quality. Outpatient utilization of psychopharmaceuticals showed a declining pattern from 115.40 DDD/1000/day in 2001 to 93.15 DDD/1000/day in 2006. Anxiolytics accounted for the majority of this drug group utilization in the City of Zagreb, although the anxiolytic/antidepressant ratio decreased from 7.19 in 2001 to 3.86 in 2006. The utilization of selective serotonin reuptake inhibitors showed a 2.5-fold increase and accounted for 90% of overall antidepressant utilization. A 2.5-fold decrease was recorded in the utilization of antipsychotics, while the atypical/typical antipsychotic ratio changed from 1:2 in 2001 to 1.1:1 in 2006. Despite some improvement observed in the prescribing quality, the predominance of benzodiazepines in the utilization of psychopharmaceuticals points to the need of additional rationalization in the field.

  5. [Pharmacoeconomic indicators of cardiovascular drug utilization in the Republic of Croatia and city of Zagreb in 2008].

    Science.gov (United States)

    Stimac, Danijela; Stambuk, Ivanka

    2010-12-01

    In comparison with original drugs, generic drugs have the same efficacy but considerably lower price and should therefore be preferred to original drugs on prescribing. The aim of the present study was to assess outpatient utilization and rationality of cardiovascular drug prescribing in the City of Zagreb and Republic of Croatia based on the generic to original drug prescribing ratio. Data on the financial indicators and number of cardiovascular drug packages issued in 2008 were obtained from the Croatian Institute of Health Insurance. These data were used to calculate the number of defined daily doses (DDD) and number of DDD per 1000 inhabitants per day (DDD/1000/day). The index of generic/original drug utilization was determined for Zagreb and Croatia as a measure for assessment of prescribing rationality; the significance of difference was determined by X2-test. The rate of prescribing original cardiovascular drugs was significantly higher in Zagreb as compared with Croatia as a whole. The index of prescribing generic versus original drugs was 1.20 (249/208 DDD/1000/day) in Zagreb and 1.65 (249/151 DDD/1000/day) in Croatia. Difference in the utilization of generic drugs between Zagreb and Croatia as determined by X2-test (the level of statistical significance was set at PZagreb and 2.02 in Croatia; and hypolipemics with the generic/original drug index of 0.96 in Zagreb and 1.34 in Croatia. According to financial indicators, the generic/original drug index was 1.44 in Croatia and only 0.96 in Zagreb. The significantly greater influence of pharmaceutical industry marketing in Zagreb entailed the significantly higher rate of original drug prescribing, which is associated with considerably greater drug expenses. Measures to stimulate prescribing generic drugs should be launched at the national level.

  6. Comparison of Psychotropic Drug Prescribing Quality between Zagreb, Croatia and Sarajevo, B&H.

    Science.gov (United States)

    Polić-Vižintin, Marina; Štimac, Danijela; Čatić, Tarik; Šostar, Zvonimir; Zelić, Ana; Živković, Krešimir; Draganić, Pero

    2014-12-01

    The purpose of this paper was to compare outpatient consumption and quality of psychotropic drug prescribing between Croatia and Bosnia & Herzegovina 2006-2010. Data on drug utilization from Zagreb Municipal Pharmacy and Sarajevo Public Pharmacy were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants per day (DDD/TID) using the WHO Anatomical-Therapeutic-Chemical methodology. Total utilization of psychopharmaceuticals increased in both cities; however, it was higher in Zagreb than in Sarajevo throughout the study period. The utilization of psycholeptics increased in Zagreb by 2.4% (from 74.5 to 76.3 DDD/TID) and in Sarajevo by 3.8% (from 62.4 to 64.8 DDD/TID). The utilization of anxiolytics decreased in Zagreb by 2.1% and in Sarajevo by even 18.7%. The utilization of antidepressants increased in both cities with predominance of SSRI over TCA utilization, greater in Sarajevo (96.6%) than in Zagreb (10.2%). The anxiolytic/antidepressant ratio decreased by 11.1% in Zagreb (from 2.87 to 2.55) and by 58.7% in Sarajevo (from 5.66 to 2.34). Outpatient utilization of antipsychotics increased significantly in Sarajevo, predominated by typical ones, whereas in Zagreb the utilization of antipsychotics was stable, predominated by atypical ones. In Croatia and Bosnia & Herzegovina, there was an obvious tendency to follow western trends in drug prescribing, as demonstrated by the increased use of antidepressants and reduced use of anxiolytics. Despite some improvement observed in the prescribing quality, high use of antipsychotics with dominance of typical antipsychotics in Sarajevo points to the need of prescribing guidelines for antipsychotics.

  7. Resistance of uropathogenic strains of Escherichia coli in pregnant women and other women in generative ages in comparison with antibiotics consumption in Zagreb

    Directory of Open Access Journals (Sweden)

    Marcel Leppée,

    2010-02-01

    Full Text Available Aim To compare resistance of uropathogenic strains of Escherichia coli (UPEC to antibiotics in women in generative ages and pregnant women during two year period (2004 and 2008 in Zagreb, andcomparison of resistance and the consumption of antibiotics. Methods The standard disk-diffusion method was used for sensitivity testing to 16 different antibiotics.Data on antibiotic utilization were used to calculate the number of defined daily doses (DDD and DDD per 1000 inhabitants using Anatomical-Therapeutic-Chemical/DDD methodology.Data on antibiotic consumption during pregnancy were collected using a questionnaire filled in by 893 women after delivery.Results During 2004 resistance of UPEC to antimicrobial drugs was not different in pregnant and in non-pregnant women, with the exception of amoxicillin and nitrofurantoin, with statistically higher resistance in pregnant women (p <0.01. Four years later the statistically higher resistance to norfloxacin was observed in non-pregnant women (p <0.01. Comparing the resistance in 2004 and 2008, in the both groups of women a statistically significant decrease of resistance to cefalexin and nitrofurantoin was detected (p <0.01. Outpatient utilization of antimicrobial drugs in Zagreb increased significantly, from 32 to 39 DDD/1000 inhabitants per day. The most used antibiotic was co-amoxiclav, and its utilization increased from 9.6 to 12.2 DDD/1000/day. Amoxicillin and co-amoxiclav were used during pregnancy by 9.6% interviewed women. Conclusion The observed significant decrease of resistance to cefalexin makes that antibiotic the drug of choice for treatment of urinary tract infections in women in generative ages, and together with coamoxiclavcan be administered in pregnancy. Constant monitoring of urinary tract pathogens resistance to antimicrobial agents ensures the effectiveness of empirical therapy, whose versatile use is limited due the potentially harmful effects of antimicrobial drugs on fetus.

  8. Does reducing unnecessary right ventricular pacing improve sympathetic activity and innervation of heart in sinus node disease patients? MVP and SafeR study.

    Science.gov (United States)

    Miyamoto, Mihoko; Kimura, Yuichiro; Hosoda, Junya; Matsumoto, Katsumi; Matsushita, Kohei; Ishikawa, Toshiyuki; Umemura, Satoshi

    2012-01-01

    Ventricular desynchronization imposed by ventricular pacing causes regional disturbances of adrenergic innervation in the left ventricular myocardium and increases the risk of heart failure and atrial fibrillation (AF) in patients with sinus node disease (SND). As a result, decreased iodine-123 metaiodobenzylguanidine (I-(123 )MIBG) uptake occurs in patients with an implanted permanent pacemaker. Fourteen SND patients with an implanted pacemaker equipped with an algorithm for reducing unnecessary right ventricular pacing (RURVP) were enrolled. Pacemakers were programmed to RURVP mode for the first 12 weeks, and then reprogrammed to DDD for the last 12 weeks. At the end of each mode, data on cumulative percent ventricular pacing (%Vp), atrial high rate episodes (%AHR), I-(123 )MIBG myocardial scintigraphy, brain natriuretic peptide (BNP), human atrial natriuretic peptide (hANP), and myocardial damage indices typified by troponin T and C-reactive protein (CRP) were collected. %Vp was lower in RURVP than in DDD (0.2% versus 95.7%, P = 0.00098). BNP, hANP, troponin T, and CRP did not differ significantly between the pacing modes. However, I-(123 )MIBG findings of patients with full ventricular pacing in DDD improved in RURVP. In contrast, among patients without full ventricular pacing in DDD, their I-(123 )MIBG findings did not differ significantly between the pacing modes. In SND patients with normal cardiac function and intact atrioventricular conduction, the reduction of %Vp in RURVP was due to the reduction of ineffective pacing and fusion pacing in DDD. Therefore, these 2 types of pacing do not affect cardiac pump function.

  9. Determination of DDT and metabolites in surface water and sediment using LLE, SPE, ACE and SE.

    Science.gov (United States)

    Sibali, Linda L; Okonkwo, Jonathan O; Zvinowanda, Caliphs

    2009-12-01

    Surface water and sediment samples collected from Jukskei River in South Africa, were subjected to different extraction techniques, liquid-liquid (LLE), solid-phase extraction (SPE), activated carbon extraction (ACE) and soxhlet extraction (SE) for sediment. The samples were extracted with dichloromethane, cleaned in a silica gel column and the extracts quantified using a Varian 3800 GC-ECD. The percentage recovery test for 2,4'DDT, DDE and DDD and 4,4'DDT, DDE and DDD in water ranged from 80%-96% and 76%-95% (LLE); 56%-76% and 56%-70% (SPE) and 75%-84% (ACE), respectively; while that recoveries for sediment samples varied from 65%-95% for 2,4'DDT, DDE and DDD and 80%-91% for 4,4'DDT, DDE and DDD. The high recoveries exhibited by ACE compared very well with LLE and SE. This was not the case with SPE which exhibited the lowest value of recoveries for both 2,4 and 4,4'DDD, DDE and DDT standard samples. The mean concentrations of DDT and metabolites ranged from nd-1.10 μg/L, nd-0.80 μg/L, nd-1.21 μg/L and 1.92 μg/L for LLE, SPE, ACE and SE, respectively. The total DDT (2,4' and 4,4'-DDT) in water and sediment samples ranged from 1.20-3.25 μg/L and 1.82-5.24 μg/L, respectively. The low concentrations of the DDT metabolites obtained in the present study may suggest a recent contamination of the river by DDT.

  10. Trends in the use of antiasthmatic medications in Morocco (1999-2010).

    Science.gov (United States)

    Ghanname, Imane; Ahid, Samir; Berrada, Ghizlane; Belaiche, Abdelmjid; Hassar, Mohamed; Cherrah, Yahya

    2013-12-01

    Asthma is a big public health problem in Morocco. The drug therapy existing in Morocco is currently insufficient because of the low purchasing power and the low health insurance coverage available to the average citizen in Morocco. In this study we evaluated the consumption of antiasthmatics in Morocco during the period 1999-2010, the classes of used drugs and the generics' market share. We used sales data from the Moroccan subsidiaries of the IMS Health "Intercontinental Marketing Service". The consumption volume was converted to Defined Daily Doses (DDDs). During 1999-2010, antiasthmatics's consumption increased from 3.91 to 14.47 DDD per 1000 inhabitants per day. In 2010, the association Beta-2-mimetic-Glucocorticosteroids were the most consumed (8.53 DDD/1000 Inhabitants/day) followed by the short-acting inhaled Beta-2-mimetic (4 DDD/1000 Inhabitants/day) and inhaled Glucocorticosteroids alone accounted for 1.13 DDD/1000 Inhabitants/day. The largest consumption share in volume was held by the short-acting inhaled Beta-2-mimetic (42%) followed by the combination Beta-2-mimetic-Glucocorticosteroids (38%). Between 1999 and 2010, the market for generic antiasthmatics increased from 1.84 to 2.18 DDD/1000 Inhabitants/day. The ratio of the monthly average cost of treatment to the minimum wage in Morocco decreased from 10.8% in 1999 to 7.11% in 2010. Antiasthmatics' consumption in Morocco has undergone significant changes between 1999 and 2010. However, the availability of these drugs expressed as the Average Monthly Expenditure/Guaranteed Minimum Wage ratio improved. Despite this, the use of antiasmathics in Morocco remains low.

  11. An Overview of Starfish: A Table-Centric Tool for Interactive Synthesis

    Science.gov (United States)

    Tsow, Alex

    2008-01-01

    Engineering is an interactive process that requires intelligent interaction at many levels. My thesis [1] advances an engineering discipline for high-level synthesis and architectural decomposition that integrates perspicuous representation, designer interaction, and mathematical rigor. Starfish, the software prototype for the design method, implements a table-centric transformation system for reorganizing control-dominated system expressions into high-level architectures. Based on the digital design derivation (DDD) system a designer-guided synthesis technique that applies correctness preserving transformations to synchronous data flow specifications expressed as co- recursive stream equations Starfish enhances user interaction and extends the reachable design space by incorporating four innovations: behavior tables, serialization tables, data refinement, and operator retiming. Behavior tables express systems of co-recursive stream equations as a table of guarded signal updates. Developers and users of the DDD system used manually constructed behavior tables to help them decide which transformations to apply and how to specify them. These design exercises produced several formally constructed hardware implementations: the FM9001 microprocessor, an SECD machine for evaluating LISP, and the SchemEngine, garbage collected machine for interpreting a byte-code representation of compiled Scheme programs. Bose and Tuna, two of DDD s developers, have subsequently commercialized the design derivation methodology at Derivation Systems, Inc. (DSI). DSI has formally derived and validated PCI bus interfaces and a Java byte-code processor; they further executed a contract to prototype SPIDER-NASA's ultra-reliable communications bus. To date, most derivations from DDD and DRS have targeted hardware due to its synchronous design paradigm. However, Starfish expressions are independent of the synchronization mechanism; there is no commitment to hardware or globally broadcast clocks

  12. Associations between subjective social status and DSM-IV mental disorders: results from the World Mental Health surveys.

    Science.gov (United States)

    Scott, Kate M; Al-Hamzawi, Ali Obaid; Andrade, Laura H; Borges, Guilherme; Caldas-de-Almeida, Jose Miguel; Fiestas, Fabian; Gureje, Oye; Hu, Chiyi; Karam, Elie G; Kawakami, Norito; Lee, Sing; Levinson, Daphna; Lim, Carmen C W; Navarro-Mateu, Fernando; Okoliyski, Michail; Posada-Villa, Jose; Torres, Yolanda; Williams, David R; Zakhozha, Victoria; Kessler, Ronald C

    2014-12-01

    The inverse social gradient in mental disorders is a well-established research finding with important implications for causal models and policy. This research has used traditional objective social status (OSS) measures, such as educational level, income, and occupation. Recently, subjective social status (SSS) measurement has been advocated to capture the perception of relative social status, but to our knowledge, there have been no studies of associations between SSS and mental disorders. To estimate associations of SSS with DSM-IV mental disorders in multiple countries and to investigate whether the associations persist after comprehensive adjustment of OSS. Face-to-face cross-sectional household surveys of community-dwelling adults in 18 countries in Asia, South Pacific, the Americas, Europe, and the Middle East (N=56,085). Subjective social status was assessed with a self-anchoring scale reflecting respondent evaluations of their place in the social hierarchies of their countries in terms of income, educational level, and occupation. Scores on the 1 to 10 SSS scale were categorized into 4 categories: low (scores 1-3), low-mid (scores 4-5), high-mid (scores 6-7), and high (scores 8-10). Objective social status was assessed with a wide range of fine-grained objective indicators of income, educational level, and occupation. The Composite International Diagnostic Interview assessed the 12-month prevalence of 16 DSM-IV mood, anxiety, and impulse control disorders. The weighted mean survey response rate was 75.2% (range, 55.1%-97.2%). Graded inverse associations were found between SSS and all 16 mental disorders. Gross odds ratios (lowest vs highest SSS categories) in the range of 1.8 to 9.0 were attenuated but remained significant for all 16 disorders (odds ratio, 1.4-4.9) after adjusting for OSS indicators. This pattern of inverse association between SSS and mental disorders was significant in 14 of 18 individual countries, and in low-, middle-, and high

  13. Aryl- and heteroaryl-substituted aminobenzo[a]quinolizines as dipeptidyl peptidase IV inhibitors.

    Science.gov (United States)

    Boehringer, Markus; Fischer, Holger; Hennig, Michael; Hunziker, Daniel; Huwyler, Joerg; Kuhn, Bernd; Loeffler, Bernd M; Luebbers, Thomas; Mattei, Patrizio; Narquizian, Robert; Sebokova, Elena; Sprecher, Urs; Wessel, Hans Peter

    2010-02-01

    Synthesis and SAR are described for a structurally distinct class of DPP-IV inhibitors based on aminobenzo[a]quinolizines bearing (hetero-)aromatic substituents in the S1 specificity pocket. The m-(fluoromethyl)-phenyl derivative (S,S,S)-2g possesses the best fit in the S1 pocket. However, (S,S,S)-2i, bearing a more hydrophilic 5-methyl-pyridin-2-yl residue as substituent for the S1 pocket, displays excellent in vivo activity and superior drug-like properties. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

  14. Small satellite technologies and applications II; Proceedings of the Meeting, Orlando, FL, Apr. 21, 22, 1992

    Science.gov (United States)

    Horais, Brian J.

    The present conference on small satellite (SS) systems and their supporting technologies discusses the Medsat SS for malaria early warning and control, results of the Uosat earth-imaging system, commercial applications for MSSs, an SS family for LEO communications, videosignal signature-synthesis for fast narrow-bandwidth transmission, and NiH battery applications in SSs. Also discussed are the 'PegaStar' spacecraft concept for remote sensing, dual-cone scanning earth sensor processing algorithms, SS radiation-budget instrumentation, SDI's relevance to SSs, spacecraft fabrication and test integration, and cryocooler producibility. (For individual items see A93-28077 to A93-28100)

  15. Spondylocarpotarsal synostosis syndrome (with a posterior midline unsegmented bar)

    Energy Technology Data Exchange (ETDEWEB)

    Kaissi, A Al; Ghachem, M Ben; Nassib, N; Chehida, F Ben [Hospital d' Enfants, Service d' orthopedie infantile, Tunis (Tunisia); Kozlowski, K [Department of Medical Imaging, Sydney (Australia)

    2005-06-01

    Spondylocarpotarsal synostosis syndrome (SSS) is characterised by malsegmentation of the thoracic spine and carpal/tarsal fusions. A unilateral or bilateral unsegmented bar may be present in the thoracic spine. Presenting clinical signs are congenital scoliosis early in life, and shortening of the trunk with scoliosis and/or lordosis in older children. We report a 13-year-old girl with SSS and a midline unsegmented bar running along the spinal processes of T3 to L2 and extending into the posterior vertebral elements. (orig.)

  16. Spondylocarpotarsal synostosis syndrome (with a posterior midline unsegmented bar)

    International Nuclear Information System (INIS)

    Kaissi, A. Al; Ghachem, M. Ben; Nassib, N.; Chehida, F. Ben; Kozlowski, K.

    2005-01-01

    Spondylocarpotarsal synostosis syndrome (SSS) is characterised by malsegmentation of the thoracic spine and carpal/tarsal fusions. A unilateral or bilateral unsegmented bar may be present in the thoracic spine. Presenting clinical signs are congenital scoliosis early in life, and shortening of the trunk with scoliosis and/or lordosis in older children. We report a 13-year-old girl with SSS and a midline unsegmented bar running along the spinal processes of T3 to L2 and extending into the posterior vertebral elements. (orig.)

  17. Ion-acoustic supersolitons and double layers in plasmas with nonthermal electrons

    Science.gov (United States)

    Gao, D.-N.; Zhang, J.; Yang, Y.; Duan, W.-S.

    2017-08-01

    Supersoliton (SS) can be mainly featured in two ways, namely, by focusing on subsidiary maxima on its electric field or by meeting the requirement that the appropriate Sagdeev pseudopotential (SP) has three local extrema between the equilibrium conditions and its amplitude. In this paper, by using the SP method, double layers and ion-acoustic SSs are studied in a plasma with Maxwellian cold electrons, nonthermal hot electrons, and fluid ions. The existence of the SS regime in parameter space is obtained in a methodical fashion. The existence domains for positive solitary waves are also presented. It is found that there is no SSs at the acoustic speed.

  18. Project W-320 acceptance test report for AY-farm electrical distribution

    International Nuclear Information System (INIS)

    Bevins, R.R.

    1998-01-01

    This Acceptance Test Procedure (ATP) has been prepared to demonstrate that the AY-Farm Electrical Distribution System functions as required by the design criteria. This test is divided into three parts to support the planned construction schedule; Section 8 tests Mini-Power Pane AY102-PPI and the EES; Section 9 tests the SSS support systems; Section 10 tests the SSS and the Multi-Pak Group Control Panel. This test does not include the operation of end-use components (loads) supplied from the distribution system. Tests of the end-use components (loads) will be performed by other W-320 ATPs

  19. Unique Dispersal of the Changjiang-Diluted Water Plume in the East China Sea Revealed from Satellite Monitoring of Colored Dissolved Organic Matter (CDOM)

    OpenAIRE

    Hiroaki Sasaki; Yasushi Gomi; Takamasa Asai; Masashi Shibata; Yoko Kiyomoto; Kazumaro Okamura; Kou Nishiuchi; Toru Hasegawa; Haruya Yamada

    2014-01-01

    The optical properties of colored dissolved organic matter (CDOM) in the Changjiang (Yangtze River) plume water were investigated during the summer of 2009 and 2010. The absorption coefficient of CDOM at 325 nm (aCDOM) increased inversely with decreasing sea-surface salinity (SSS), implying that aCDOM can be used as a natural tracer of Changjiang-diluted water (CDW). This aCDOM vs. SSS relationship, however, differed between 2009 and 2010. For mapping the CDW plume, the aCDOM was retrieved fr...

  20. Natural and artificial aging response of semisolid metal processed Al–Si–Mg alloy A356

    CSIR Research Space (South Africa)

    Moller, H

    2007-12-01

    Full Text Available aging at 180uC (Table 2). It can be seen from Table 2 that it takes approximately six times longer to reach peak hardness at 160uC compared to at 180uC. The diffusivity of silicon in aluminium is about double that of magnesium in aluminium... in the content of alloying elements. In Al–Mg–Si alloys containing an excess of silicon, the decomposition of the super- saturated solid solution (SSS) is believed to occur as follows7 SSS?(MgzSi)clusters=GP(I)spherical ?b=GP(II)needles?b0rodsz...