WorldWideScience

Sample records for da cevada hordeum

  1. Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    M.A. Urchei

    1994-12-01

    Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

  2. EFICIÊNCIA E FITOTOXICIDADE DE FUNGICIDAS NO CONTROLE DE Drechslera teres EM SEMENTES DE CEVADA (Hordeum vulgare)

    OpenAIRE

    Ricardo Silveiro Balardin; Milto José Facco

    1994-01-01

    RESUMO O objetivo do experimento foi avaliar a eficiência e fitotoxicidade de cinco fungicidas aplicados no tratamento de sementes para o controle de Drechslera teres, agente causal da mancha reticulada em cevada. A produtividade da cultura foi afetada pelos fungicidas testados. Os fungicidas tebuconazole e triadimenol reduziram a altura das plântulas. enquanto que o difenoconazole reduziu significativamente a matéria seca (30g/100kg de sementes). O efeito dos fungicidas sobre a emergência mo...

  3. EFICIÊNCIA E FITOTOXICIDADE DE FUNGICIDAS NO CONTROLE DE Drechslera teres EM SEMENTES DE CEVADA (Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Ricardo Silveiro Balardin

    1994-01-01

    Full Text Available RESUMO O objetivo do experimento foi avaliar a eficiência e fitotoxicidade de cinco fungicidas aplicados no tratamento de sementes para o controle de Drechslera teres, agente causal da mancha reticulada em cevada. A produtividade da cultura foi afetada pelos fungicidas testados. Os fungicidas tebuconazole e triadimenol reduziram a altura das plântulas. enquanto que o difenoconazole reduziu significativamente a matéria seca (30g/100kg de sementes. O efeito dos fungicidas sobre a emergência mostrou que difenoconazole (30g/100kg de sementes e iprodine + thiram possibilitaram as maiores percentagens. Os fungicidas reduziram a incidência da Drechslera teres, o comprimento do coleóptilo e das radículas.

  4. Controlo de infestantes em pós-emergência na cultura da cevada em sementeira directa

    OpenAIRE

    2010-01-01

    No ano agrícola de 2009/2010 foram levados a cabo dois ensaios de campo, cujo objectivo foi estudar o efeito de doses inferiores às recomendadas de diferentes herbicidas no controlo de infestantes em pós-emergência na cultura da cevada de sementeira directa. Num dos dois ensaios estudou-se o efeito da interacção de dois herbicidas: diclofope - metilo + fenoxaprope-p-etilo + mefenepir – dietilo (Dopler) e amidosulfurão + iodosulfurão + mefenepir-dietilo (Sekator) no controlo das infestante...

  5. Controlo de Lolium rigidum Gaud e infestantes dicotiledóneas em pós-emergência na cultura da cevada em sementeira directa. Ensaio: Dopler + Sekator

    OpenAIRE

    2009-01-01

    No ano agrícola de 2008/2009, realizou-se um ensaio de campo, cujo objectivo foi estudar o efeito de doses inferiores às recomendadas de diclofope-metilo + fenoxaprope – p – etilo + mefenepir dietilo (Dopler) e amidosulfurão & iodosulfurão & mefenepir – dietilo (Sekator) no controlo de Lolium rigidum Gaud. (erva-febra) e diversas infestantes dicotiledóneas em pós-emergência, e na produção de cevada dística (Hordeum vulgare L.) em sementeira directa. Os ensaios realizaram-se na herdade Exp...

  6. Genetic similarity of Brazilian hull-less and malting barley varieties evaluated by RAPD markers Similaridade genética de variedades brasileiras de cevada nua e cevada cervejeira avaliada por marcadores RAPD

    Directory of Open Access Journals (Sweden)

    Mariela Aparecida Kroth

    2005-01-01

    Full Text Available Barley (Hordeum vulgare L. is widely used for brewing and animal feed. Recently, it has become desirable for human consumption due to its high nutritional significance, specially hull-less or naked barley. There are differences in nutritional and malting characteristics among barley varieties. RAPD procedure is able to separate barley varieties at various similarity levels. The aim of this work was the RAPD analysis of six Brazilian hull-less varieties and seven malting varieties. PCR reactions were performed with eleven random primers. A total of 34 RAPD fragments was obtained with five primers. A dendrogram was constructed based on the Jaccard similarity coefficient. Barley varieties displayed an average similarity coefficient of 0.53. Intravarietal monomorphic fragments allowed differentiation among varieties. The averages of intravarietal similarity coefficients ranged from 0.53 to 0.85. RAPD markers, detected in this work, were suitable for differentiation among Brazilian barley varieties.A cevada (Hordeum vulgare L. é amplamente empregada na produção de cerveja e na ração animal. Recentemente, este cereal tornou-se desejável na alimentação humana devido ao seu alto valor nutricional, principalmente da cevada nua ou sem casca. Existem diferenças nas características nutricionais e para malteação entre as diversas variedades de cevada. O procedimento RAPD é capaz de separar as variedades de cevada em vários níveis de similaridade. O objetivo desse trabalho foi analisar por RAPD seis variedades brasileiras de cevada nua e sete variedades de cevada cervejeira. Reações de PCR foram realizadas com onze iniciadores aleatórios. Um total de 34 fragmentos de amplificação foi obtido com cinco destes iniciadores. Baseado no coeficiente de similaridade de Jaccard, um dendrograma foi construído. As variedades de cevada apresentaram índice médio de similaridade de 0,53. Fragmentos monomórficos intravariedades permitiram a

  7. Efeito da presença das plantas daninhas no microclima da cultura da cevada Effects of the weeds on water consumption and the microclimate in a field of barley

    Directory of Open Access Journals (Sweden)

    José Roberto P. de Souza

    1997-01-01

    Full Text Available Um experimento foi realizado com cevada (Hordeum vulgare L. em condições de campo, com o objetivo de avaliar , durante um período de estiagem (82 e 89 dia após a emergência da cevada, o microclima formado pela cultura mantida na presença ou ausência de plantas daninhas desde o início do ciclo. Foram avaliados o teor de água do solo, umidade relativa, temperatura, tensão de vapor d'água, déficit de saturação de vapor d'água, potencial água e teor de água do ar nos períodos da s 8: 30 às 9:00, 11:30 às 12:00, 14:30 às 15:00 e 17:30 às 18:00 horas a 0,0m, 0,10m, 0,20m, 0,30m, 0,40m, 0,50m, 0,60m e 0,70m de altura na entrelinha da cultura. A presença das plantas daninhas na cultura durante o período de estiagem contribuiu para reduzir as perdas de água do solo para a atmosfera. Nos três primeiros períodos do dia e nas áreas mais próximas do solo, a cultura mantida no mato os menores valores de temperatura e déficit de saturação de vapor d'água do ar, e os maiores valores de umidade relativa, tensão de vapor d'água, potencial água e teor de água do ar, que proporcionaram redução do consumo de água do solo.The objective of this research was to evaluateth e effects of the weeds on water consumption and the microclimate in a field of barley (Hordeum vulgare L., during a drought period. It were evaluated the soil water contents, relative humidity, temperature, water vapor tension, water vapor saturation deficit, water potential, water content in the air at different times (8:30 to 9:00, 11:30 to 12:00, 14:30 to 15:00 and 17:30 to 17:00 and heights (0.0; 0.10; 0.20; 0.30; 0.40; 0.50; 0.60 and 0.70m. The weeds, at high population densities increased the water content in the air, the water vapor tension, the water potential and the relative humidity and decreased the temperature, the saturation déficit and the air movement in the plots. The highest water contents in the soil were observed in highly infested areas

  8. Resultados agronômicos e qualitativos da nova cultivar de cevada MN 743 Agronomic and qualitative results of the new barley cultivar MN 743

    Directory of Open Access Journals (Sweden)

    Eduardo Caierão

    2005-12-01

    Full Text Available A cevada MN 743, criada pela Cia Brasileira de Bebidas (AmBev foi lançada para cultivo no ano de 2004. Originou-se de um cruzamento simples entre as linhagens MN 681 e GIMPEL, realizado em 1992, no campo experimental da antiga Cia Brahma, no município de Encruzilhada do Sul. A cultivar MN 743 é do tipo duas fileiras, possui ciclo precoce e ampla adaptação às condições do sul do Brasil. Das cultivares disponíveis a nível de produção é a que apresenta a maior classificação comercial (grãos de primeira qualidade. Nos anos em que fez parte do ensaio de Valor de Cultivo e Uso (VCU, sempre apresentou médias competitivas em termos de rendimento corrigido em relação à testemunha de maior área no Brasil, MN 698. Com relação às características qualitativas, apresenta excelente performance no que diz respeito ao teor de extrato e poder diastásico. A cultivar é recomendada para os estados do Rio Grande do Sul, Santa Catarina e Paraná. Devido a seu ótimo desempenho no aspecto qualidade, visando a indústria cervejeira, a cultivar representa um importante avanço para o melhoramento deste cereal no Brasil, aliando os interesses do produtor e da indústria.Barley cultivar MN 743, developed by the Cia. Brasileira de Bebidas (AmBev was released in 2004. It resulted from a simple cross between lines MN 681 x GIMPEL, made in 1992, in the Brahma's Experimental Field - Encruzilhada do Sul/RS. MN 743, a two-rowed type cultivar has early cicle and is broadly adapted to southern Brazil. Among the hight producing cultivars available, it shows higher kernel plumpness (first quality kernel. Over the years it was included in the VCU (cost and use value trial, the cultivar has repeatedly showed competitive means in adjusted yield, as compared to the control occupying the largest cropped area in Brazil, MN 698. Regarding quality characteristics, it has an excellent performance as friability and diastasic power. The cultivar is recomended for all

  9. Desenvolvimento de populações duplo-haplóides de cevada cervejeira associadas à atividade das enzimas (1-3, 1-4-β-glucanases

    Directory of Open Access Journals (Sweden)

    Janaína Endres Georg-Kraemer

    2011-05-01

    Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.

  10. Controle de azevém (Lolium multiflorum L., e gorga (Spergula arvensis L. e seletividade de herbicidas as culturas de trigo, cevada e centeio Control of rye grass (Lolium multiforum L. and corn spurry (Spergula arvensis L., and selectivity of herbicides to wheat, barley, and rye crops

    Directory of Open Access Journals (Sweden)

    J. A. R. O. Velloso

    1982-12-01

    Full Text Available Foram realizados três experimentos a campo em 1980, no Centro Nacional de Pesquisa de Trigo/EMBRAPA, Passo Fundo, RS, visando conhecer o comportamento dos herbicidas diclofop, dicamba, a associação 2,4 D com dicamba e a mistura diclofop + (2,4 D + dicamba, no controle de azevém (Lolium multiflorum L. e gorga (Spergula arvensis L.. Ao mesmo tempo foi avaliada a seletividade que estes herbicidas apresentam às culturas de trigo (Triticum aestivum L., cevada (Hordeum vulgare L. e centeio (Secale cereale L.. Os resultados da avaliação visual de fitotoxicidade mostra ram que o dicamba causou o maior grau de injúria para as três culturas. Cevada mostrou ser a cultura mais sensível ao dicamba na fase inicial. Trigo, cevada e centeio foram tolerantes ao diclofop. A mistura diclofop + (2,4 D + dicamba não controlou o azevém nas três culturas. Esta mistura apresentou ainda redução no controle de gorga, nas culturas de cevada e centeio. Dicamba ocasionou redução no rendimento de grãos das culturas, mostrando ser pouco seletivo na dose testada. Centeio sofreu uma redução no rendimento de grãos causada por diclofop, enquanto que a mistura diclofop + (2,4 D + dicamba foi seletiva para todas as culturas.Three field experiments were carried out, in 1980, at the National Wheat Research Center/ EMBRAPA, Passo Fundo, RS. They aimed at testnig the responses of herbicides diclofop, dicamba, the association 2,4 D with dicamba, and the mixture diclofop + (2,4 D + dicamba in the control of rye grass (Lolium multiflorum L. and corn spurry (Spergula arvensis L.. Simultaneously, the selectivity of these herbicides to wheat (Triticum aestivum L., barley (Hordeum vulgare L., and rye (Secale cereale L. was evaluated. The results of visual evaluation of phytotoxicity showed that dicamba caused the greatest degree of injury to the three crops studied. Barley was the most sensitive crop to dicamba in the initial growth stage. Wheat, barley, and rye were

  11. Efeitos da cultura da cevada e de períodos de controle sobre o crescimento e produção de sementes de Raphanus sativus L. Effects of the culture of the Barley and of periods of control on the seed production and growth of Raphanus sativus L.

    Directory of Open Access Journals (Sweden)

    José Roberto Pinto de Souza

    1997-01-01

    Full Text Available Este experimento teve por objetivo avaliar os efeitos da cultura da cevada e de períodos de controle das plantas daninhas sobre o crescimento e produção de sementes de Raphanus sativus. Foram considerados dois tratamentos testemunha sem controle das plantas daninhas, com e sem a cultura. Nos oito demais tratamentos, a cultura esteve sempre presente, controlando-se as plantas daninhas até 10, 20, 30, 40, 50, 60, 80 e 100 dias após a emergência da cevada. A comunidade infestante da área era composta quase exclusivamente por R. .sativus. Avaliou-se o número de plantas, acúmulos de matéria seca, número médio de frutos e sementes de nabiça por planta e por unidade de área ; foram ainda avaliados o número médio de sementes por fruto, peso médio de 1.000 sementes e a contribuição das sementes na composição da matéria se catota. A análise dos resultados evidenciou que a espécie Raphanus sativus apresenta elevado potencial reprodutivo, sendo possível concluir pela ineficiência de programas de controle de curta duração, em termos de redução do banco de sementes. A presença da cultura da cevada reduziu tanto o crescimento quanto o número de sementes produzidas pela nabiça (R. sativus. Na ausência da cultura e de práticas de controle foram produzidas 5.074 sementes/m, a partir de 125 plantas/m ainda presentes na colheita da cultura.The objective of this research was to evaluate the effects of barley and weed control periods on the seed production and growth of Raphanus sativus, the major weed in the experimental area. The experiment was carried out in Botucatu, SP, Brazil. Two checks, with and without the crop, were kept weedy from seeding to harvest. In other eight treatments the crop was kept weed free up to 10, 20, 30, 40, 50, 60, 80 and 100 days after emergence. It were evaluated the number of plants, the dry matter accumulation and the number of fruits and seeds per plant and per m2, the weight of 1.000 seeds and the

  12. Chemical characterization of Brazilian hulless barley varieties, flour fractionation, and protein concentration Caracterização química de variedades brasileiras de cevada nua, fracionamento da farinha e concentração de proteína

    Directory of Open Access Journals (Sweden)

    Cristiane Vieira Helm

    2004-12-01

    Full Text Available Even though hulless barley is widely known due to its nutritional potential, in Brazil it is only grown at a few agricultural experimental stations. There is no published data about the chemical composition of Brazilian hulless barley varieties; however, research laboratories have studied their agronomical characteristics. The objectives of this study were to present the chemical characterization and effect of flour fractionation on protein concentration of six Brazilian hulless barley varieties, namely IAC IBON 214/82, IAC 8612/421, IAC 8501/31, IAC 8501/12, IAPAR 39-Acumaí, and IAC 8501/22. The analyses included: ash, ether extract, total protein, starch, total insoluble and soluble dietary fiber, and beta-glucans. Flour fractionation was carried out by sieving. The flour fractions were evaluated for crude protein, protein, and protein and non-protein nitrogen. Chemical composition varied (P Apesar de a cevada nua ser amplamente conhecida por seu potencial nutricional, no Brasil é apenas cultivada em poucas estações experimentais agronômicas. Em relação as variedades brasileiras de cevada nua, não se têm dados sobre a composição química, entretanto instituições de pesquisa têm estudado suas características agronômicas. Os objetivos deste estudo foram apresentar a caracterização química e o efeito no fracionamento da farinha obtida visando à concentração de proteína de seis variedades brasileiras de cevada nua: IAC IBON 214/82, IAC 8612/421, IAC 8501/31, IAC 8501/12, IAPAR 39-Acumaí, e IAC 8501/22. Foram realizadas análises de: cinzas, extrato etéreo, proteína total, amido, fibra alimentar total, solúvel e insolúvel e beta-glucanas. As frações das farinhas foram obtidas por peneiramento e avaliadas quanto aos teores de proteína bruta, proteína, nitrogênio protéico e não protéico. Houve variação entre as variedades testadas (P < 0,05. As variedades IAC 8501/22, IAC 8501/31 e IAC 8501/12 apresentaram o

  13. Habilidade competitiva de cultivares de cevada convivendo com azevém Competitive ability of barley cultivars against ryegrass

    Directory of Open Access Journals (Sweden)

    L Galon

    2011-12-01

    Full Text Available A determinação da habilidade competitiva de cultivares de cevada com plantas daninhas torna-se relevante para a adoção do método de manejo cultural; desse modo, podemse diminuir os custos de produção, bem como os impactos ambientais causados por outros métodos de manejo, como o químico. Este trabalho comparou as habilidades competitivas relativas de três cultivares de cevada e um biótipo de azevém. Foram realizados experimentos em casa de vegetação na estação de crescimento 2008/09, utilizando-se delineamento experimental de blocos casualizados, com quatro repetições. Os tratamentos foram arranjados em série de substituição e constituíram-se de cinco proporções de plantas de cevada e do azevém competidor com a cultura: 100:0, 75:25, 50:50, 25:75 e 0:100. A cevada foi representada pelos cultivares BRS Greta, BRS Elis e BRS 225, e o competidor, pelo azevém. A análise da competitividade foi efetuada por meio de diagramas aplicados a experimentos substitutivos, mais uso de índices de competitividade relativa. As variáveis estudadas foram: afilhamento, estatura, área foliar e massa da matéria seca da parte aérea das plantas. O azevém afetou o afilhamento, a área foliar e a massa da matéria seca da parte aérea de plantas dos cultivares de cevada BRS Greta, BRS Elis e BRS 225, demonstrando grande habilidade competitiva com a cultura pelos recursos disponíveis no meio. Entre os cultivares de cevada avaliados, BRS Elis foi o mais competitivo na presença do azevém, que é uma das espécies daninhas que necessitam de controle mesmo quando presente em baixas proporções na cultura da cevada.Characterization of the competitive ability of barley varieties against weed species is relevant for the adoption of the cultural method of weed control; thus, it is possible to reduce both the production costs and environmental impacts caused by other management methods, including the use of chemicals. This work assessed the

  14. Controle de Bipolaris sorokiniana e rendimento de grãos em cevada após aplicação de elicitores e fungicida - DOI: 10.4025/actasciagron.v29i5.749

    OpenAIRE

    Antoniazzi, Noemir; EMBRAPA; Deschamps, Cícero; UFPR

    2008-01-01

    A mancha marrom causada pelo fungo Bipolaris sorokiniana é considerada um dos problemas fitossanitários mais importantes na cevada provocando reduções na produtividade e prejuízos na qualidade cervejeira. O objetivo deste trabalho foi avaliar o efeito dos elicitores goma xantana e alicina e do fungicida epoxiconazole + piraclostrobina no controle da mancha marrom em cevada cervejeira, cultivar BRS 195 em dois ciclos de cultivo. O experimento foi conduzido na Fundação Agrária de Pesquisa Agrop...

  15. Controle de Bipolaris sorokiniana e rendimento de grãos em cevada após aplicação de elicitores e fungicida = Bipolaris sorokiniana control and grain yield in barley after application of elicitors and fungicide

    OpenAIRE

    Noemir Antoniazzi; Cícero Deschamps

    2007-01-01

    A mancha marrom causada pelo fungo Bipolaris sorokiniana é considerada um dos problemas fitossanitários mais importantes na cevada provocando reduções na produtividade e prejuízos na qualidade cervejeira. O objetivo deste trabalho foi avaliar o efeito dos elicitores goma xantana e alicina e do fungicida epoxiconazole + piraclostrobina no controle da mancha marrom em cevada cervejeira, cultivar BRS 195 em dois ciclos de cultivo. O experimento foi conduzido na Fundação Agrária de Pesquisa Agrop...

  16. Desenvolvimento de populações duplo-haplóides de cevada cervejeira associadas à atividade das enzimas (1-3, 1-4-β-glucanases Development of doubled-haploids populations in malting barley associated to activity of enzymes (1-3, 1-4-β-glucanases

    Directory of Open Access Journals (Sweden)

    Janaína Endres Georg-Kraemer

    2011-05-01

    Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.Doubled haploid populations offer special advantages in genetic analyses, since the information they provide may be maximized due to the fact that all loci are homozygous. The aim of this study was to develop two barley (Hordeum vulgare ssp.vulgare L. doubled-haploid (DHs populations segregating to (1-3, 1-4-β-glucanases activity, utilizing the anther

  17. Análise de crescimento de duas cultivares de cevada após tratamentos com elicitores e fungicidas

    Directory of Open Access Journals (Sweden)

    Antoniazzi Noemir

    2006-01-01

    Full Text Available Para o controle da mancha marrom da cevada, causada pelo fungo Bipolaris sorokiniana, têm sido utilizados fungicidas e mais recentemente foi proposto o uso de elicitores. O objetivo deste trabalho foi avaliar o desenvolvimento de duas cultivares de cevada cervejeira, "BRS 195" e "BRS 225", em resposta à aplicação de elicitores goma xantana e alicina e do fungicida epoxiconazole + pyraclostrobin, comparativamente a plantas não tratadas. O experimento foi conduzido na Fundação Agrária de Pesquisa Agropecuária (FAPA, Guarapuava - PR, no delineamento de blocos completos casualizados. Na análise de crescimento, foram determinados o índice de área foliar (IAF, a taxa de crescimento relativo (TCR e a taxa assimilatória líquida (TAL. Observou-se desenvolvimento semelhante das cultivares em todos os tratamentos. A cultivar "BRS 225" registrou maior acúmulo de matéria seca no período de avaliação por apresentar um ciclo vegetativo mais curto. O IAF aumentou até a fase de emborrachamento das plantas, com posterior decréscimo. A TCR diminuiu da primeira para a última coleta. A TAL diminuiu até 57 dias após a emergência, seguindo aumento no decorrer das avaliações.

  18. CEVADA BR 2: CULTIVAR DE CEVADA CERVEJEIRA RESISTENTE À MANCHA-RETICULAR CAUSADA POR PYRENOPHORA TERES BARLEY CULTIVAR BR 2: MALTING QUALITY AND RESISTANCE TO NET BLOTCH CAUSED BY PYRENOPHORA TERES

    Directory of Open Access Journals (Sweden)

    EUCLYDES MINELLA

    1999-11-01

    Full Text Available A Cevada BR 2, criada pela Embrapa-Centro Nacional de Pesquisa de Trigo (CNPT, foi lançada para cultivo em 1989. Originou-se de sete plantas selecionadas em F3 do cruzamento FM 424/TR 206, realizado em 1979, em Passo Fundo, RS. A BR 2 é uma cevada de primavera, do tipo de duas fileiras de grãos, com ciclo precoce, ampla adaptação e porte baixo. É a primeira cultivar brasileira resistente a Pyrenophora teres, agente causal da mancha-reticular, principal moléstia da cevada no Brasil. Em oito anos de avaliação no Ensaio Nacional de Cevada, conduzido em 12 locais da Região Sul, a BR 2 rendeu entre 1.621 e 4.014 kg/ha de grãos de primeira qualidade, superando a cultivar Antarctica 05 em 3% no RS e SC, em 13% no PR, e em 6% na média dos 96 experimentos (12 locais x 8 anos. Na lavoura, a BR 2 tem produzido rendimentos acima de 5.000 kg/ha. Aprovada como cervejeira em 1992, ocupou 30% da área semeada em 1993 e 90% em 1997. A BR 2 representa um marco no progresso do melhoramento genético da cevada no país, contribuindo decisivamente para o aumento da competitividade da produção doméstica.Barley cultivar BR 2 developed by the Embrapa-Centro Nacional de Pesquisa de Trigo (CNPT was released in 1989. BR 2 traces back to seven plants selected in the F3 from the cross FM 424/TR 206 made in Passo Fundo, RS, in 1979. BR 2 is a two row spring barley with wide adaptation, earliness and short straw. It is the first Brazilian cultivar resistant to Pyrenophora teres, causal agent of net blotch, a major barley disease in Brazil. In eight years of yield testing in the National Barley Trial in twelve locations of Southern Brazil, BR 2 yielded between 1,621and 4,014 kg/ha of plump kernels, with 3%, 13% and 6% yield increase over the check cultivar Antarctica 05 in the States of Rio Grande do Sul and Santa Catarina, Paraná and in the mean of 96 trials, respectively. On the farm fields, BR 2 has yielded over 5,000 kg/ha. Since its approval as a malting

  19. Influência dos diferentes períodos de colheita na expressão de isoenzimas em sementes de cevada

    Directory of Open Access Journals (Sweden)

    Lilian Madruga de Tunes

    2011-04-01

    Full Text Available O objetivo foi avaliar os padrões isoenzimáticos de Esterase (EST - EC 3.1.1.1, Fosfatase Ácida (ACP - EC 3.1.3.2, Malato Desidrogenase (MDH - EC 1.1.1.37, Álcool Deshidrogenase (ADH - EC 1.1.1.1 e Glutamato Oxalacetato Transaminase (GOT - EC 2.6.1.1, em sementes e plântulas de dois cultivares de cevada (MN 721 e Scarlett. As sementes foram fornecidas pela empresa Westermann, localizada no município de Piratini, Rio Grande do Sul, onde foi realizado o cultivo da cevada em 2007. Foram colhidas em três épocas com diferentes percentuais de umidade, secas a 13% de umidade e armazenadas em câmara fria. Os cinco sistemas isoenzimáticos analisados apresentaram variações na expressão, principalmente quando comparados entre sementes e plântulas. Concluiu-se que há variação no padrão de expressão das enzimas EST, ACP, MDH, ADH e GOT entre sementes e plântulas. A expressão das enzimas EST e GOT foi pouco e muito influenciada pela época de colheita, respectivamente.

  20. Reação de cultivares de cevada a Drechslera teres, e variabilidade patogênica de isolados do Sul do Brasil

    OpenAIRE

    Wordell Filho João Américo; Prestes Ariano Morais; Silva Márcio Só

    2002-01-01

    Objetivou-se avaliar a reação de 58 cultivares de cevada a Drechslera teres, agente causal da mancha-em-rede, bem como a variabilidade patogênica e freqüência de sintomas do patógeno. A reação das cultivares foi estimada com auxílio de uma escala de notas de 0 a 4, em que zero (0) representa a ausência de sintomas, e 4 representa os sintomas típicos da mancha-em-rede. O mesmo método foi utilizado para avaliar a variabilidade patogênica de 25 isolados oriundos do Sul do Brasil. Seis isolados d...

  1. Farinha do bagaço de cevada em dietas para a engorda de camarões marinhos Barley flour in diets for the fattening of marine shrimps

    Directory of Open Access Journals (Sweden)

    Ruth Gomes de Figueiredo Gadelha

    2010-02-01

    Full Text Available O objetivo deste estudo foi avaliar a qualidade do resíduo de cevada na elaboração de dietas práticas em relação à qualidade nutricional, ao crescimento e à sobrevivência do camarão Litopenaeus vannamei. Foram elaboradas cinco dietas isoprotéicas e isoenergéticas com diferentes proporções da farinha de cevada e do farelo de milho (R1, R2, R3, R4 e R5 e uma ração comercial (R6. Estas foram fornecidas a 150 camarões por um período de 60 dias. O percentual de farinha de cevada utilizado nas rações foi de 0,62; 12,5; 18,7 e 25%, substituindo o percentual de farelo de milho inicial de 25%. Camarões com peso inicial de 3g foram distribuídos em 30 aquários (cinco camarões por aquários, com 31L de água. A farinha elaborada foi analisada para a avaliação da sua qualidade nutricional, apresentando rendimento de 22,63%. A sobrevivência variou de 88 a 100%, não apresentando diferença significativa. As dietas R1 e R5 resultaram no maior ganho de peso, enquanto que a R3 resultou no menor ganho de peso. Para a taxa de crescimento, as rações R1 (3,47g/60 dias, R2 (3,22g/60 dias, R4 (3,46g/60 dias e R5 (3,62g/60 dias apresentaram valores significativos, mas não diferiram estatisticamente (P>0,05. A farinha de cevada em substituição à farinha de milho é recomendada por proporcionar um maior crescimento em camarões juvenis da espécie Litopenaeus vannamei.The aim of this study was to evaluate the barley residue in the development of practical diets in relation to nutritional quality, growth and survival of the shrimp Litopenaeus vannamei. Five isoenergetic and isonitrogenous diets were prepared with different proportions of barley flour and corn meal (R1, R2, R3, R4 and R5 and a commercial ration (R6. They were provided to 150 shrimps for a period of 60 days. The percentage of barley meal used in feed was 0.62, 12.5, 18.7 and 25% replacing the initial meal maize of 25%. Shrimps with initial weight of 3g were distributed into

  2. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  3. BRS Deméter: nova cultivar de cevada cervejeira irrigada para o Cerrado do Brasil Central BRS Deméter: new malting barley cultivar for irrigated Brazilian savanna

    Directory of Open Access Journals (Sweden)

    Renato Fernando Amabile

    2008-09-01

    Full Text Available BRS Deméter é uma cultivar de cevada dística (duas fileiras de grãos de ampla adaptação, sob irrigação, ao Cerrado do Brasil Central. Apresenta potencial produtivo de grãos acima de 5.000 kg ha-1, estabilidade de produção e alta qualidade industrial malte-cervejeira. A cultivar atende às demandas do produtor por rendimento competitivo e às da indústria malteira por alta qualidade cervejeira.BRS Deméter is a spring, two-rowed barley, widely adapted to irrigated areas of the savanna, in Central Brazil. It presents production stability and high malting quality, with yield potential above 5,000 kg ha-1. It fulfills both the farmer and malting industry expectations regarding competitive yield and brewing quality.

  4. MN 716: nova cultivar de cevada com estabilidade de produção e qualidade cervejeira Production stability and brewing quality of Barley MN 716

    Directory of Open Access Journals (Sweden)

    Eduardo Caierão

    2006-06-01

    Full Text Available A cevada MN 716, lançada em 2004, é uma das cultivares recomendadas para cultivo com maior estabilidade de produção. Nos anos em que participou do ensaio para determinação de seu valor de cultivo e uso, apresentou excelente produtividade de grãos, com média superior a 3.000 kg ha-1, e desempenho equilibrado quanto à qualidade, com destaque para seu teor de beta-glucanas e índice enzimático. A cultivar constitui um avanço do melhoramento desse cereal no Brasil, aliando características de interesse do produtor e da indústria.Barley cultivar MN 716, released in 2004, is one of the most recomended cultivars, for its high stability. In the years that it was included in the agronomic and use value trial, the cultivar MN 716 showed high yield average, exceeding 3,000 kg ha-1, as well as excellent qualitative performance, mainly in relation to beta-glucans and enzyme index. The cultivar is a breeding achievement for this cereal in Brazil, and serves the interests of both producers and industrial sector.

  5. EFEITO DO PEROLAMENTO NA ATIVIDADE ANTIOXIDANTE E COMPOSIÇÃO FENÓLICA DE CEVADA

    Directory of Open Access Journals (Sweden)

    C. F. ROSA

    2008-11-01

    Full Text Available

    Cereais são geralmente processados com o objetivo de produzir produtos aceitáveis ao consumidor. O perolamento é utilizado para remover as casca aderidas ao grão de cevada bem como o gérmem para assim aumentar o tempo de prateleira do grão e seus produtos. O objetivo deste trabalho foi avaliar a atividade antioxidante de duas variedades de cevada (nua e vestida e relacionar esta atividade com a composição fenólica. Os grãos de cevada foram perolados e as frações obtidas foram analisadas in vitro utilizando os métodos de atividade antioxidante (Método do Radical Livre DPPH e Análise ORAC e determinação dos compostos fenólicos (Método de Folin-Ciocalteau e CLAE. A atividade antioxidante em ambos métodos apresentou um decréscimo significante após o primeiro minuto do perolamento e os resultados apresentaram direta correlação com a composição fenólica. Este perfil é observado gradualmente nas amostras, até o terceiro minuto do perolamento. Faz-se necessário que o processamento de cevada seja optimizado com o objetivo de reduzir a perda destes compostos durante o fracionamento.

  6. Caracterização nutricional de grãos integrais e descascados de cultivares de cevada Chemical characterization of covered and hulness barley cultivars

    Directory of Open Access Journals (Sweden)

    Elveni Teresinha Mayer

    2007-11-01

    Full Text Available O objetivo deste trabalho foi determinar a composição de nutrientes de grãos de diferentes cultivares de cevada, na forma integral e descascada, e classificá-los em grupos com características nutricionais distintas. Foram utilizadas amostras de 17 cultivares, da Embrapa Trigo, Passo Fundo, RS, da safra de 2005. As determinações químicas foram realizadas de acordo com os métodos de análise oficial da AOAC Internacional. Foram observadas diferenças significativas entre grãos integrais de cultivares para proteína bruta, cinzas, extrato etéreo, fibra total e carboidratos não-fibrosos, porém, os teores de fibra insolúvel e fibra solúvel não diferiram. Em grãos descascados, foram observadas diferenças em todos os parâmetros analisados. Com exceção da fração de carboidratos não-fibrosos, o processo de descascamento promoveu redução em todas as frações avaliadas, em especial nos teores de fibra total e fibra insolúvel. Diferenças na composição bromatológica ocorreram devido à variabilidade genética das cultivares e ao descascamento.The objective of this work was to determine the chemical composition of different covered and hulness barley cultivars grains and to classify them according to distinctive nutritional groups. Seventeen cultivars from 2005 crop of Embrapa Trigo, Passo Fundo, RS, Brazil, were utilized. The chemical determinations were based on Official Methods of Analysis of the AOAC International. Significative differences between integral cultivars in relation to crude protein, ash, ether extract, total fiber and non-fibrous carbohydrate were observed, however, there were no differences for fiber content and soluble fiber. In the hulness grain, differences were observed. The non-fibrous carbohydrate was an exception and, in this case, the hull's process promoted the fraction's reduction, specially in the total fiber and insoluble fiber content. Variation in the bromatological composition occurs because of

  7. Uso industrial de grãos de cevada de lavouras dessecadas em pré-colheita Industrial suitability for malting of grains from desiccated pre-harvest barley

    Directory of Open Access Journals (Sweden)

    Eduardo Caierão

    2007-09-01

    Full Text Available O objetivo deste trabalho foi avaliar o impacto da antecipação da colheita de lavouras de cevada sobre a germinação dos grãos, ao longo de 12 meses de armazenamento. O ensaio de campo foi realizado em 2002 e 2003. As parcelas colhidas foram armazenadas nos anos subseqüentes aos dos ensaios em campo, e a germinação foi monitorada mensalmente. Os tratamentos avaliados foram: dessecação com os princípios ativos glifosato e paraquat, nas doses 1, 1,5 e 2 L ha-1, além das testemunhas, colhidas normalmente e de forma antecipada, sem dessecação. O delineamento utilizado foi o de blocos ao acaso, com três repetições. A colheita antecipada sem dessecação foi o tratamento de maior prejuízo qualitativo à germinação dos grãos. A deterioração qualitativa temporal dos grãos, nos tratamentos com herbicidas dessecantes, foi estatisticamente similar à observada nas amostras oriundas da testemunha colhida normalmente, sem dessecação. Não foram encontradas evidências de que o uso de herbicidas dessecantes acelere o processo de perda de germinação de grãos de cevada, ao longo do período de armazenagem, para os produtos e doses testados.The objective of this work was to assess the impact of early harvesting of barley on grain germination, along 12 months of storage. A field trial was carried out in 2002 and 2003. The plot yields were stored during the years subsequent to the field trial, and germination was monitored monthly. The following treatments were evaluated: desiccation with glyphosate and paraquat, at 1, 1.5, and 2 L ha-1, and the checks, which were normal and early harvest without desiccation. A randomized block design with three replications was utilized. The early harvest without desiccation treatment had the greatest quality loss regarding grain germination. Qualitative deterioration of grains within time was statistically similar both in treatments with desiccation and those with normal harvest without desiccation

  8. Pollen dimorphism and androgenesis in Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2014-01-01

    Full Text Available Dimorphism of binucleate pollen grains of Hordeum vulgare has been confirmed. It is considered, however, in contrast to the accepted opinions, that some of the large pollen grains with dense cytoplasm lying close to the tapetum are the outset forms for embryoids, and not the small pollen grains with scarce cytoplasm lying in the pollen sac centre.

  9. Controle de Bipolaris sorokiniana e rendimento de grãos em cevada após aplicação de elicitores e fungicida = Bipolaris sorokiniana control and grain yield in barley after application of elicitors and fungicide

    Directory of Open Access Journals (Sweden)

    Noemir Antoniazzi

    2007-12-01

    Full Text Available A mancha marrom causada pelo fungo Bipolaris sorokiniana é considerada um dos problemas fitossanitários mais importantes na cevada provocando reduções na produtividade e prejuízos na qualidade cervejeira. O objetivo deste trabalho foi avaliar o efeito dos elicitores goma xantana e alicina e do fungicida epoxiconazole + piraclostrobina no controle da mancha marrom em cevada cervejeira, cultivar BRS 195 em dois ciclos de cultivo. O experimento foi conduzido na Fundação Agrária de Pesquisa Agropecuária (FAPA, em Guarapuava, Estado do Paraná, em delineamento de blocos ao acaso, comquatro repetições. A aplicação de elicitores e fungicida resultou em maior peso de mil sementes, sem interferir no teor de proteínas e na classificação comercial. O rendimento de grãos foi superior após duas ou três aplicações de alicina. A incidência e severidade de B.sorokiniana nas folhas de plantas tratadas com elicitores foram semelhantes àquelas com fungicida.The disease spot blotch, caused by the fungi Bipolaris sorokiniana, is considered one of the most important phytosanitary problems ofbarley crop resulting on low productivity and damage on beer quality. The objective of this work was to evaluate the effect of the elicitors xanthan gum and alicin and fungicide epoxiconazole + pyraclostrobin on spot blotch control of barley cultivar BRS 195 during two cultivation cycles. The experiment was carried out at Fundação Agrária de Pesquisa Agropecuária (FAPA, Guarapuava, state of Paraná. The experimental design was in completely randomized blocks, with four replications. Treatment of barley plants withelicitors and fungicide resulted in higher thousand-seed weight without interfering on protein content and commercial classification. The grain yield increased after two or three alicin treatments. Bipolaris sorokiniana incidence and severety on the leaves of plants treated with elicitors were similar to those treated with fungicide.

  10. Extração de B-glucanas de cevada e produção de xarope de maltose a partir do amido residual

    OpenAIRE

    2012-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias. Programa de Pós-Graduação em Ciência dos Alimentos A cevada ocupa a quarta posição em produção de cereais no mundo. Porém, tem sido pouco utilizada na indústria de alimentos, sendo destinada, em sua maioria, para alimentação animal e produção de malte cervejeiro. No entanto, a cevada possui alto teor de fibra alimentar e alta proporção de fibras solúveis, especialmente ?-glucanas. Estudos têm demonstrad...

  11. Parâmetros climáticos e variação de compostos fenólicos em cevada

    Directory of Open Access Journals (Sweden)

    Aline Sobreira Bezerra

    2013-09-01

    Full Text Available Objetivou-se quantificar os compostos fenólicos em extrato hidroetanólico de grãos das cultivares de cevada ('BRS Lagoa' e 'MN 743' em dois anos consecutivos de cultivo (2005 e 2006, avaliando a influência dos fatores climáticos nesse conteúdo. Os compostos fenólicos totais foram quantificados pelo método de Folin-Ciocalteau e os teores de rutina e ácidos cafeico e ferúlico por CLAE em fase reversa. O conteúdo de compostos fenólicos totais variou de 0,97 a 1,59 mg AG g-1 de cevada e os fatores climáticos durante o período de plantio e colheita influenciaram no conteúdo. Foram identificados e quantificados nessas cultivares rutina, ácido cafeico e ácido ferúlico. A avaliação dos fatores climáticos no conteúdo de compostos fenólicos em cevada é de grande interesse, visando a sua importância nutricional e recomendação de cultivares com conteúdos expressivos de compostos bioativos.

  12. Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

    DEFF Research Database (Denmark)

    Svitashev, S.; Bryngelsson, T.; Vershinin, A.

    1994-01-01

    A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...... over all chromosomes of H. vulgare and the wild barley species H. bulbosum, H. marinum and H. murinum. Southern blot hybridization revealed different levels of polymorphism among barley species and the RFLP data were used to generate a phylogenetic tree for the genus Hordeum. Our data are in a good...

  13. Mitochondria during androgenesis in Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2014-01-01

    Full Text Available Different number of mitochondria of varying structure was observed in particular stages of the development of barley (Hordeum vulgare microspores, stimulated by the in vitro culture to form embryoids. This variability was reflected in different shape of sections, different ratio between total area of mitochondria profiles and area of cytoplasm sections, varying number of cristae, and different density of the matrix. Within the cristae of some mitochondria crystalline inclusions were observed. Mitochondria divided by a contraction. In the matrix of some mitochondria spheric bodies were formed. They were surrounded by one or two membranes. It is suggested that the bi-membrane forms constituted promitochandria, whereas unimembrane forms could constitute promicrobodies.

  14. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...... for the full length protease...

  15. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species ...

  16. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  17. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w...

  18. Caracterização de proteínas de reserva, perfil de aminoácidos e enzimas envolvidas no metabolismo de lisina em cevada (Hordeum vulgare L.) geneticamente modificada

    OpenAIRE

    Daiana Schmidt

    2011-01-01

    Os cereais representam importantes fontes de proteína para alimentação humana e animal. Entretanto, são caracterizados pela baixa qualidade nutricional de suas proteínas devido à composição desbalanceada de aminoácidos, causada pelo excesso dos aminoácidos prolina e glutamina e deficiência de lisina, treonina e triptofano. As proteínas de reserva prolaminas constituem 50% do conteúdo total de proteínas no endosperma e são as principais responsáveis por tais características nos cereais. As inf...

  19. Modelo para estimativa do potencial produtivo em trigo e cevada por meio do sensor GreenSeeker Model for yield potential estimation in wheat and barley using the GreenSeeker sensor

    Directory of Open Access Journals (Sweden)

    Daniel S. Grohs

    2009-03-01

    Full Text Available Áreas com diferentes potenciais de rendimento dentro de uma lavoura necessitam ser manejadas separadamente, para fins de aplicação da adubação nitrogenada em cobertura. O equipamento baseado em sensoriamento remoto terrestre (GreenSeeker é um dos instrumentos utilizados para separar diferentes zonas de manejo. Para fazer isso, o sensor permite a definição de classes para estimar o potencial produtivo de forma ágil, precisa e em tempo real. Com o instrumento, foi desenvolvido um modelo para estimativa do potencial produtivo em trigo e cevada, correlacionando o Índice de Vegetação por Diferença Normalizada (NDVI com a biomassa seca acumulada na parte aérea, por ocasião da emissão da sexta folha do colmo principal. A base do modelo foi a formação de classes de potencial produtivo correspondentes a zonas específicas de manejo da lavoura. Essas classes não necessitam ser específicas para diferentes cultivares e/ou espécies, visto que não se detectaram diferenças que justificassem a formação de grupos para elas. As superfícies de fundo (resíduos de restevas de soja e milho tiveram efeitos significativos nas leituras do sensor. O modelo continua válido mesmo se as leituras de NDVI forem feitas antes ou após o período recomendado para tal, podendo ser ajustado com sub ou superestimação. As análises de variabilidade espacial, futuramente, podem avaliar se, as zonas de potencial produtivo estimadas pelas classes de NDVI propostas pelo modelo, correspondem à flutuação espacial da biomassa, doses de N aplicadas e rendimento de grãos.Areas with different yield potential within a field need to be managed separately as for nitrogen application in small grain cereals. Terrestrial remote sensing-based equipment such as the GreenSeeker sensor is one of the tools available to handle different management zones. To do this, the sensor allows the definition of classes to estimate yield potential. A model which correlated the

  20. Evolutionary changes in defensive specialized metabolism in the genus Hordeum.

    Science.gov (United States)

    Ube, Naoki; Nishizaka, Miho; Ichiyanagi, Tsuyoshi; Ueno, Kotomi; Taketa, Shin; Ishihara, Atsushi

    2017-09-01

    Plants have developed defensive specialized metabolites over the course of evolution. In the genus Hordeum, which includes the important cereal crop barley, specialized metabolites such as hordatines, benzoxazinones, and gramine have been identified. Hordeum species are classified into four clades, H, Xu, Xa, and I. The presence or absence of defensive specialized metabolites was analyzed in representative Hordeum species that included all of the four clades. In the H clade, Hordeum vulgare accumulated hordatines but not benzoxazinones, whereas H. bulbosum accumulated neither compound. Some accessions in the H clade accumulated gramine. Species in the clades I and Xa accumulated benzoxazinones without hordatines. In H. murinum, a Xu clade species, neither hordatines nor benzoxazinones were detected. Two hitherto undescribed compounds were found to commonly accumulate in H. bulbosum in the H clade and H. murinum in the Xu clade. On the basis of spectroscopic analyses, they were identified as dehydrodimers of feruloylagmatine and were designated murinamides A and B. Radical coupling reactions with feruloylagmatine as a substrate by peroxidase afforded murinamides A and B. These compounds showed antifungal activities against Bipolaris sorokiniana and Fusarium asiaticum, indicating their defensive roles. Because hordatines are also dehydrodimers of hydroxycinnamic acid amides (HCAAs) of agmatine, both the H and Xu clade species are considered to accumulate the same class of compounds. Thus, when the H/Xu clades split from the I/Xa clades during evolution, the defensive metabolites shifted from benzoxazinones to dehydrodimers of agmatine HCAAs plus gramine in the H/Xu clades. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Fine structure of plastids during androgenesis in Hordeum vulgare L.

    OpenAIRE

    Fortunat Młodzianowski; Krystyna Idzikowska

    2014-01-01

    The fine structure of plastids was studied in the course of androgenesis in in the pollen of Hordeum vulgare L. It was found that these organelles occur in all stages of androgenesis. Their structure was simple and was frequently manifested on the cross section only by the presence of the envelope and matrix of different degree of density. Single thylakoids, nucleoid-like regions and starch grains were, however, also noted. The structure of plastids in embryoids formed from microspores of bar...

  2. Reação de cultivares de cevada a Drechslera teres, e variabilidade patogênica de isolados do Sul do Brasil Reaction of barley cultivars to Drechslera teres and pathogenic variability of isolates from the South of Brazil

    Directory of Open Access Journals (Sweden)

    João Américo Wordell Filho

    2002-06-01

    Full Text Available Objetivou-se avaliar a reação de 58 cultivares de cevada a Drechslera teres, agente causal da mancha-em-rede, bem como a variabilidade patogênica e freqüência de sintomas do patógeno. A reação das cultivares foi estimada com auxílio de uma escala de notas de 0 a 4, em que zero (0 representa a ausência de sintomas, e 4 representa os sintomas típicos da mancha-em-rede. O mesmo método foi utilizado para avaliar a variabilidade patogênica de 25 isolados oriundos do Sul do Brasil. Seis isolados de boa capacidade de esporulação foram utilizados para comparar o número de lesões e a severidade da doença. As cultivares diferiram quanto à reação a D. teres, e identificaram-se as três cultivares, BR 2, EMBRAPA 43 e PFC 8590, como fontes de resistência moderada à doença. Em testes de 25 isolados de D. teres, inoculados na concentração de 1,7x10(4 conídios/mL, detectaram-se diferenças significativas entre os isolados, evidenciando diferenças na sua virulência. Pelo sistema de nomenclatura de Limpert & Müller, foi possível diferenciar padrões de virulência de isolados oriundos de diferentes regiões do Sul do Brasil. O número de lesões e a severidade foram intimamente relacionadas com o local de origem do isolado.This research aimed to evaluate 58 barley cultivars for resistance to net blotch caused by Drechslera teres and to determine the variability of isolates of the pathogen and frequency of symptoms of the disease. The cultivar reaction was estimated with aid of a 0 to 4 scale, in which zero represented the absence of symptom and 4 the typical symptoms of disease susceptibility. The same method was used to determine de pathogenic variability of isolates originated from the Southern Brazil. Six isolates of good sporulation capacity were used for comparison of number of lesions and disease severity. The cultivars showed differences in reaction to net blotch, and the cultivars BR 2, EMBRAPA 43 and PFC 8590 were

  3. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.

    1986-01-01

    Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...

  4. Antioxidant potential of barley extract in rats subjected to a high-fat diet Potencial antioxidante de extrato de cevada em ratos submetidos à dieta hiperlipídica

    Directory of Open Access Journals (Sweden)

    Alice Mesquita Zimmermann

    2013-03-01

    Full Text Available Antioxidants have the ability to neutralize free radicals produced in the body during lipid oxidation. The objective in this article was to study the effect of the barley extract on lipid oxidation in rats subjected to a high-fat diet. The experiment lasted 67 days. The animals were separated into three experimental groups: standard (P, high-fat diet group (L, and group with high-fat diet supplemented with barley extract (C. The feed intake of L and C groups was the lowest (p Os antioxidantes têm a capacidade de neutralizar os radicais livres gerados no organismo durante a oxidação lipídica. O objetivo deste artigo foi estudar o efeito do extrato de cevada na oxidação lipídica em ratos submetidos a uma dieta rica em gordura. O experimento durou 67 dias. Os animais foram separados em três grupos experimentais: grupo padrão (P, grupo de dieta rica em gordura (L e grupo com dieta rica em gordura suplementada com extrato de cevada (C. O consumo de ração dos grupos L e C foi mais baixa (p < 0,05. Os tratamentos não influenciaram no ganho de peso, no peso dos órgãos e nos parâmetros sanguíneos avaliados. No entanto, os níveis de malondialdeído presentes no tecido hepático foram maiores no grupo L e menores nos grupos P e C. Portanto, os resultados indicaram um aumento do nível de peroxidação lipídica no fígado de ratos submetidos à dieta rica em gordura, a qual foi reduzida com o consumo de cevada.

  5. NAM-1gene polymorphism and grain protein content in Hordeum.

    Science.gov (United States)

    Jamar, Catherine; Loffet, Francois; Frettinger, Patrick; Ramsay, Luke; Fauconnier, Marie-Laure; du Jardin, Patrick

    2010-04-15

    Grain protein content (GPC) is a key quality factor for malting and brewing process. In wheat, a QTL explaining a large part of GPC variation was identified, which co-localizes with a gene encoding a NAC transcription factor (TtNAM-B1). NAC transcription factors influence GPC by their role in the regulation of senescence and in protein remobilization. An orthologous gene was discovered on barley chromosome 6H where a GPC QTL was mapped. In this study, we identify allelic variation of the NAM-1 gene for three species of Hordeum representing wild and cultivated barley and we investigate the possible link with GPC. Three haplotypes were identified, one corresponds to the sequences of 11 European varieties representing H. vulgare, one corresponds to the sequence found in H. spontaneum and one represents the sequence of H. bulbosum. Three SNPs were identified between H. spontaneum sequence and H. vulgare sequence. One of the H. bulbosum polymorphisms leads to the introduction of a stop codon and a non-functional protein. Differences in GPC between the 11 varieties were found but no polymorphism in the NAM-1 gene was observed, suggesting that differences in expression of the HvNAM-1 gene or other genes should play a role in GPC regulation. Nevertheless based on published values for GPC of H. bulbosum and H. spontaneum compared to GPC measured here in H. vulgare, the non-functional protein is associated with the lower GPC, suggesting that loss of functionality of the NAM-1 gene in Hordeum is related to lower GPC. Moreover H. spontaneum GPC seems to be higher than H. vulgare GPC, suggesting also that allelic variation of the functional NAM-1 gene could be associated with GPC variation within the genus Hordeum. Copyright 2009 Elsevier GmbH. All rights reserved.

  6. Submergence tolerance in Hordeum marinum

    DEFF Research Database (Denmark)

    Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.

    2010-01-01

    Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds......) movement, would all contribute to submergence tolerance in H. marinum. The present study demonstrates that dissolved CO(2) levels can determine submergence tolerance of terrestrial plants. So, submergence experiments should be conducted with defined CO(2) concentrations and enrichment might be needed...

  7. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    , (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...... were monitered during induction by collecting 1 ml samples every hr for 24 hrs. After 4 days, the supernatant were harvested and analyzed by SDS-PAGE, activity assay and Western blot. A significant amount of functional, heterologous protein was produced and the protein production was highest after 4...

  8. Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib

    1986-01-01

    The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...

  9. Giemsa C-banded karyotypes of Hordeum taxa from North America

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.

    1986-01-01

    submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....

  10. Fine structure of plastids during androgenesis in Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Fortunat Młodzianowski

    2014-01-01

    Full Text Available The fine structure of plastids was studied in the course of androgenesis in in the pollen of Hordeum vulgare L. It was found that these organelles occur in all stages of androgenesis. Their structure was simple and was frequently manifested on the cross section only by the presence of the envelope and matrix of different degree of density. Single thylakoids, nucleoid-like regions and starch grains were, however, also noted. The structure of plastids in embryoids formed from microspores of barley was compared with embryos developed from fertilized egg cell, and we did not found any fundamental differences between them. However, only plastid ribosomes were difficult to identify on ultrathin sections in embryoids and in the embryos.

  11. Pollen size in Hordeum L.: correlation between size, ploidy level, and breeding system

    DEFF Research Database (Denmark)

    Johansen, Bo; von Bothmer, Roland

    1994-01-01

    The size of pollen in the genus Hordeum (Poaceae) is correlated with ploidy level and breeding system. Generally, the pollen size increases with the ploidy level, and outbreeding species possess significant- ly larger pollen than inbreeders. In H. roshevitzii (2x), H. pusilplum (2x), H. murinum...... consequences of heteromorphic pollen are discussed, and a model for the evolution of breeding strategies in Hordeum is suggest- ed. Key...

  12. Rph22: mapping of a novel leaf rust resistance gene introgressed from the non-host Hordeum bulbosum L. into cultivated barley (Hordeum vulgare L.)

    NARCIS (Netherlands)

    Johnston, P.A.; Niks, R.E.; Meiyalaghan, V.; Blanchet, E.; Pickering, R.

    2013-01-01

    A resistance gene (Rph22) to barley leaf rust caused by Puccinia hordei was introgressed from the non-host species Hordeum bulbosum into cultivated barley. The H. bulbosum introgression in line ‘182Q20’ was located to chromosome 2HL using genomic in situ hybridisation (GISH). Using molecular markers

  13. Nitrate Uptake into Barley (Hordeum vulgare) Plants 1

    Science.gov (United States)

    Deane-Drummond, Celia E.; Glass, Anthony D. M.

    1982-01-01

    Evidence is presented that chlorate is an extremely good analog for nitrate during nitrate uptake by intact barley (Hordeum vulgare cv. Fergus) roots. The depletion of ClO3− or NO3− from uptake media over 2 to 6 hours by seedlings was found to be dependent on combined NO3− plus ClO3− concentrations, and total anion uptake was equivalent at different NO3−/ClO3− ratios. After loading barley seedlings with 36ClO3− for 6 hours, kinetic parameters were derived from the analysis of efflux of [36Cl] chlorate into unlabeled solution. On the basis of this analysis, the half times for exchange for the cytoplasmic and vacuolar phases were 17 minutes and 20 hours, respectively. Data pooled from a number of different experiments were used to calculate kinetic constants (Km and Vmax) for 36ClO3− influx into barley roots at different external ClO3−/NO3− ratios, using short (10 minutes) influx times. There appeared to be no discrimination by the root cells between ClO3− and NO3−. Lineweaver-Burk analysis of the interaction between nitrate and chlorate were characteristic of competitive inhibition at low nitrate concentrations (0-0.5 mm). At higher concentrations, in the range of >1 mm, similar interactions between these ions were evident. PMID:16662478

  14. Development and characterization of recombinant chromosome substitution lines (RCSLs) using Hordeum vulgare subsp. spontaneum as a source of donor alleles in a Hordeum vulgare subsp. vulgare background.

    Science.gov (United States)

    Matus, I; Corey, A; Filichkin, T; Hayes, P M; Vales, M I; Kling, J; Riera-Lizarazu, O; Sato, K; Powell, W; Waugh, R

    2003-12-01

    The ancestor of barley (Hordeum vulgare subsp. spontaneum) may be a source of novel alleles for crop improvement. We developed a set of recombinant chromosome substitution lines (RCSLs) using an accession of H. vulgare subsp. spontaneum (Caesarea 26-24, from Israel) as the donor and Hordeum vulgare subsp. vulgare 'Harrington' (the North American malting quality standard) as the recurrent parent via two backcrosses to the recurrent parent, followed by six generations of selfing. Here we report (i) the genomic architecture of the RCSLs, as inferred by simple sequence repeat (SSR) markers, and (ii) the effects of H. vulgare subsp. spontaneum genome segment introgressions in terms of three classes of phenotypes: inflorescence yield components, malting quality traits, and domestication traits. Significant differences among the RCSLs were detected for all phenotypes measured. The phenotypic effects of the introgressions were assessed using association analysis, and these were referenced to quantitative trait loci (QTL) reported in the literature. Hordeum vulgare subsp. spontaneum, despite its overall inferior phenotype, contributed some favorable alleles for agronomic and malting quality traits. In most cases, the introgression of the ancestral genome resulted in a loss of desirable phenotypes in the cultivated parent. Although disappointing from a plant breeding perspective, this finding may prove to be a useful tool for gene discovery.

  15. Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...

    African Journals Online (AJOL)

    Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown under low ... Thousand-kernel malting weight loss (TKMWL) was 11 to 13% and is in the ... and refined wheat flour starch as a substrate (1:29) showed a reduction in peak ...

  16. Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

    2001-01-01

    In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the prese

  17. Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis

    DEFF Research Database (Denmark)

    Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1984-01-01

    The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...... of hybrid and haploid tillers were investigated....

  18. Quantitative trait locus analysis of nitrogen use efficiency in barley (Hordeum vulgare L.)

    NARCIS (Netherlands)

    Kindu, G.A.; Tang, J.; Yin, X.; Struik, P.C.

    2014-01-01

    Quantitative trait locus (QTL) analysis of nitrogen use efficiency (NUE) of barley (Hordeum vulgare L.) was conducted on data generated from two pot experiments carried out in 2005 (using four nitrogen rates) and 2008 (with three rates) with AFLP markers and 94 recombinant inbred lines (RILs) of the

  19. Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum

    NARCIS (Netherlands)

    Lange, W.

    1969-01-01

    Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties a

  20. Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

    DEFF Research Database (Denmark)

    Doll, Hans; Brown, A. H. D.

    1979-01-01

    The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

  1. Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke

    1986-01-01

    The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

  2. The genetics and mechanism of avoidance of rust infection in Hordeum chilense

    NARCIS (Netherlands)

    Vaz Patto, M.C.

    2001-01-01

    Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae tribe.H. chilense is one of the five wild barley species in which a

  3. Genetic dissection of grain beta-glucan and amylose content in barley (Hordeum vulgare L.)

    Science.gov (United States)

    High beta glucan (BG) barleys (Hordeum vulgare L.) have major potential as food ingredients due to the well know health benefits. Quantitative trait loci (QTLs) associated with BG have been reported in hulled barley, however no QTL studies have been reported in hulless barley. In this study, QTL an...

  4. cDNA Cloning of a Vacuolar H+-Pyrophosphatase and Its Expression in Hordeum brevisubulatum (Trin.) Link in Response to Salt Stress

    Institute of Scientific and Technical Information of China (English)

    L(U) Shi-you; JING Yu-xiang; PANG Xiao-bin; ZHAO Hua-yan; MA Lan-qing; LI Yan-fang

    2005-01-01

    A cDNA clone encoding a vacuolar H+-pyrophosphatase (V-H+-PPase) was isolated from Hordeum brevisubulatum (Trin.) Link by using RACE method. Sequence analysis revealed that HbVP1 contained 2 319 nucleotides of open reading frame (ORF) and 420 nucleotides of 3'-untranslated region. Its encoding protein consisted of 773 amino acid residues,which includes 14 transmembrane helices. The predicated molecular mass is 80.4 kDa with pI of 4.90. The V-H+-PPases in higher plants shared low identity (40-55%) with those of protozoa, marine alga and archaebacteria. HbVP1 transcripts accumulated abundantly in roots, shoots and seeds, and it was also strongly induced by salt treatment.

  5. Simulação do caminhamento da água da chuva e herbicidas em palhadas utilizadas em sistemas de plantio direto Simulation of rain wetting dynamics and herbicide movement in different straws used under no-tillage system

    Directory of Open Access Journals (Sweden)

    C.D.G. Maciel

    2005-09-01

    Full Text Available Um experimento foi conduzido no NuPAM/FCA/UNESP, Botucatu-SP, objetivando avaliar a dinâmica de retenção de água e o caminhamento de um traçante (simulando um herbicida em diferentes coberturas mortas. Os tratamentos foram constituídos pelo monitoramento do traçante FD&C-1 pulverizado sobre coberturas mortas de cevada, trigo, aveia-preta colhida, aveia-preta rolada, azevém, milheto e capim-braquiária, nas quantidades de 3.000, 6.000 e 9.000 kg ha-1, antes e após simulação de chuvas. As repetições constituíram-se de oito conjuntos de PVC + funil + béquer com palha, onde, através da chuva lixiviada pelas palhadas e do peso dos suportes de PVC, foram estimadas a retenção e transposição da água, assim como quantificado o traçante extraído, através de procedimentos espectrofotométricos. Os diferentes tipos de resíduos culturais mostraram-se similares quanto à retenção da água da chuva, ocorrendo uniformização entre os primeiros 7,5 e 15 mm de precipitação. A formação de "pontos secos" associados a "canais preferenciais de escorrimento" induziu menor capacidade de embebição e retenção da água das chuvas pelas palhadas. As máximas capacidades médias de retenção da chuva pelas coberturas foram de 1,22, 1,99 e 2,59 mm para 3.000, 6.000 e 9.000 kg de matéria seca ha-1, respectivamente. As precipitações iniciais entre 10 e 20 mm foram fundamentais para o molhamento uniforme das palhadas e carregamento do traçante até o solo, independentemente do tipo e da quantidade de palha. Esse comportamento indica ser viável a utilização de programas similares de controle de plantas daninhas para diferentes tipos e quantidades de palha em sistemas de plantio direto.An experiment was conducted at NuPAM/FCA/UNESP, Botucatu-SP, Brazil, to evaluate the dynamics of water retention and the path of a tracer (simulating a herbicide in different crop residues. The treatments were constituted by monitoring of the tracer FD

  6. Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L)

    OpenAIRE

    Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

    2015-01-01

    Background In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. Results In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong doubl...

  7. Uzu mutation in barley (Hordeum vulgare L.) reduces the leaf unrolling response to brassinolide.

    Science.gov (United States)

    Honda, Ichiro; Zeniya, Haruko; Yoneyama, Koichi; Chono, Makiko; Kaneko, Shigenobu; Watanabe, Yoshiaki

    2003-05-01

    A sensitive method to examine the brassinolide (BL) response of barley (Hordeum vulgare L.) using dark-grown leaf segments was established based on the known method for wheat. BL responses of 53 dwarf isogenic lines of barley were examined, and two lines were found having a uzu gene that doesn't respond significantly. These results indicate that uzu dwarfism may be caused by the non-responding character to BL.

  8. Complex Interspecific Hybridization in Barley (Hordeum vulgare L.) and the Possible Occurrence of Apomixis

    DEFF Research Database (Denmark)

    Bothmer, R. von; Bengtsson, M.; Flink, J.

    1988-01-01

    Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were ...... is that an unreduced gamete from the amphiploid was fertilized by a normal gamete from the backcross parent, and during early embryo development, some chromosomes were eliminated....

  9. Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

    Directory of Open Access Journals (Sweden)

    Dongfa Sun

    Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

  10. Purification and characterization of three chitinases and one beta-1,3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Kragh, K.M.; Jacobsen, S.; Dalgaard Mikkelsen, J.

    1991-01-01

    Three basic chitinases and one basic beta-1,3-glucanase were secreted into the medium when embryogenic cell suspensions of barley (Hordeum vulgare L.) cv. 'Igri' were cultured as undifferentiated aggregates in the presence of 2,4-D. The enzymes were purified by affinity and ion exchange...... chromatography. Two of the chitinases were identified as the previously described endochitinases T and C from barley grain. The third and novel chitinase, designated K, was the major basic chitinase in the medium constituting 4% of the soluble protein. Chitinase K was found to be a 33-kDa endochitinase with p...... chitinases from barley aleurone and barley, bean and potato leaves. The purified beta-1,3-glucanase with a molecular weight (MW) of 32 kDa and pI greater-than-or-equal-to 9.8 constituted 1% of the soluble protein in the medium. Based on similar MW, pI and amino acid composition as well as identical N...

  11. Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)

    DEFF Research Database (Denmark)

    Podzimska, Dagmara Agata

    the senescence process has been extensively studied in the model plant Arabidopsis, knowledge about the molecular mechanism driving senescence in crop plants is still limited. Extending our knowledge about the genes that control senescence in cereals is very important for future improvement of agronomic traits......, such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...

  12. NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence

    DEFF Research Database (Denmark)

    Wagner, Michael

    yielding cereal crops are generated. In cereals, the process of leaf senescence is of utmost relevance when discussing yield. It is during the senescence process that all nutrients are transported from the withering leaf to the developing grains. Furthermore, the timing of senescence determines...... parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...

  13. Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

    Directory of Open Access Journals (Sweden)

    Quanwen Dou

    2016-10-01

    Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

  14. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib

    1984-01-01

    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  15. Zinc Blotting Assay for Detection of Zinc-Binding Prolamin in Barley (Hordeum vulgare) Grain

    DEFF Research Database (Denmark)

    Uddin, Mohammad Nasir; Langkilde, Ane; Vincze, Éva

    2014-01-01

    In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc...

  16. QTL mapping provides evidence for lack of association of the avoidance of leaf rust in Hordeum chilense with stomata density

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.

    2003-01-01

    In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of s

  17. Quantitative trait loci affecting growth-related traits in wild barley (Hordeum spontaneum) grown under different levels of nutrient supply

    NARCIS (Netherlands)

    Elberse, I.A.M.; Vanhala, T.K.; Turin, J.H.B.; Stam, P.; Van Damme, J.M.M.; van Tienderen, P.H.

    2004-01-01

    The genetic basis of phenotypic plasticity of relative growth rate (RGR), its components and associated morphological traits was studied in relation to nutrient limitation. In all, 140 F3 lines from a cross, made between two Hordeum spontaneum (wild barley) accessions sampled in Israel, were subject

  18. The Mystery of Spot Blotch Disease Caused by the Fungal Pathogen Bipolaris sorokiniana on Barley (Hordeum vulgare L)

    DEFF Research Database (Denmark)

    Gjendal, Nele

    The fungal pathogen Bipolaris sorokiniana causes a wide spectrum of diseases including spot blotch disease. To achieve a better understanding of the biology of the fungus, the interaction of B. sorokiniana with the host barley (Hordeum vulgare L) and the resulting disease spot blotch was investig...

  19. The Mystery of Spot Blotch Disease Caused by the Fungal Pathogen Bipolaris sorokiniana on Barley (Hordeum vulgare L)

    DEFF Research Database (Denmark)

    Gjendal, Nele

    The fungal pathogen Bipolaris sorokiniana causes a wide spectrum of diseases including spot blotch disease. To achieve a better understanding of the biology of the fungus, the interaction of B. sorokiniana with the host barley (Hordeum vulgare L) and the resulting disease spot blotch was investig...

  20. Proteomic response of Hordeum vulgare cv. Tadmor and Hordeum marinum to salinity stress: Similarities and differences between a glycophyte and a halophyte

    Directory of Open Access Journals (Sweden)

    Lucie Maršálová

    2016-08-01

    Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H

  1. Molecular size and net charge of pathogenesis-related enzymes from barley (Hordeum vulgare L., v. Karat) infected with Drechslera teres f. teres (Sacch.) Shoem.

    Science.gov (United States)

    Rothe, G M; Welschbillig, N; Reiss, E

    1998-05-01

    Molecular size and net charge of isoforms of pathogenesis-related (PR) chitinase, beta-1,3-glucanase and peroxidase were studied in uninfected barley (Hordeum vulgare L., v. Karat) leaves and in barley leaves infected with the pathogenic fungus Drechslera teres f. teres (Sacch.) Shoem. Molecular characteristics were determined by time-dependent polyacrylamide gradient gel electrophoresis under native conditions and by applying an extended version of the computer program MOL-MASS (Rothe, G. M., Weidmann, H., Electrophoresis 1991, 12, 703-709). Uninfected barley leaves contained predominantly one peroxidase isozyme but also three very weak peroxidases. Activities of all of these three peroxidases increased considerably after infection with Drechslera teres. The molecular masses of peroxidases 1 and 3 were estimated to be 38 +/- 5 and 42 +/- 7 kDa and their apparent valences at pH 8.4 were Z = 3.13 and 3.20, respectively. Amongst the chitinase isoforms, chitinase 1 and chitinase 2 appeared after infection, while chitinase 3 was also observed in uninfected leaves of barley. The molecular mass of chitinase 3 (31 +/- 6 kDa; f/fo = 1.20) was larger than that of chitinase 1 (20 +/- 2 kDa; f/fo = 1.04) and chitinase 2 (23 +/- 3 kDa; f/fo = 1.06). The valence of constitutive chitinase 3 (Z = 1.44 +/- 0.81) at pH 8.4 was lower than that of adaptive chitinase 1 (Z = 3.27 +/- 1.02) and chitinase 2 (Z = 2.96 +/- 1.38). Infection of barley leaves with Drechslera teres also induced the hydrolytic enzyme beta-1,3-glucanase 1; beta-1,3-glucanase 2 appeared in uninfected and in infected leaves. Constitutive beta-1,3-glucanase 2 was smaller (molecular mass 19 +/- kDa; f/fo = 1.05) than adaptive beta-1,3-glucanase 1 (molecular mass 26 +/- 4 kDa; f/fo = 1.07). The valence of adaptive beta-1,3-glucanase 1 (Z = 9.58 +/- 4.17) was approximately threefold that of beta-1,3-glucanase 2 (Z = 2.80 +/- 0.93).

  2. Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

    Directory of Open Access Journals (Sweden)

    Z Amini

    2013-08-01

    Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

  3. Abscisic acid effects on activity and expression of barley (Hordeum vulgare) plastidial glucose-6-phosphate dehydrogenase.

    Science.gov (United States)

    Cardi, Manuela; Chibani, Kamel; Cafasso, Donata; Rouhier, Nicolas; Jacquot, Jean-Pierre; Esposito, Sergio

    2011-07-01

    Total glucose-6-phosphate dehydrogenase (G6PDH) activity, protein abundance, and transcript levels of G6PDH isoforms were measured in response to exogenous abscisic acid (ABA) supply to barley (Hordeum vulgare cv Nure) hydroponic culture. Total G6PDH activity increased by 50% in roots treated for 12 h with exogenous 0.1 mM ABA. In roots, a considerable increase (35%) in plastidial P2-G6PDH transcript levels was observed during the first 3 h of ABA treatment. Similar protein variations were observed in immunoblotting analyses. In leaves, a 2-fold increase in total G6PDH activity was observed after ABA treatment, probably related to an increase in the mRNA level (increased by 50%) and amount of protein (increased by 85%) of P2-G6PDH. Together these results suggest that the plastidial P2-isoform plays an important role in ABA-treated barley plants.

  4. Five new secondary metabolites from Monascus purpureus-fermented Hordeum vulgare and Sorghum bicolor.

    Science.gov (United States)

    Ansari, Md Pravej; Puri, Alka; Ali, M; Panda, Bibhu Prasad

    2013-10-01

    Long grains of Hordeum vulgare and Sorghum bicolor were individually fermented with Monascus purpureus MTCC 369 under solid state fermentation. The aqueous extract of Monascus which fermented H. vulgare and S. bicolor was found to contain five different new metabolites. Silica gel column chromatography of the aqueous extract with a linear gradient of ethyl acetate, acetonitrile and carbon tetrachloride (v/v) yielded five new metabolites named benzopranyl capriate (9H-1-isoprenyl-benzopyran-5-isopropanoic acid-6-ol-6-n-decanoate), shorghumoic acid (n-octadec-8,11-dien-7α-ol-1-oic acid) and sorghumflavin A (2-n-butyloxo-6-β-hydroxy-7-β-isoprenyl ankaflavin) from Monascus-fermented S. bicolor, while hordeumflavin B (2-n-undecanyloxo-7-β-isoprenyl ankaflavin) and vulgaredilone (2-dodecanyl-7-β isopranyl monoscodilone) from Monascus-fermented H. vulgare.

  5. Influência da inoculação de Azospirillum sp. em trigo, cevada e aveia / Influence of Azospirillum sp. inoculation in wheat, barley and oats

    Directory of Open Access Journals (Sweden)

    Osmar Roberto Dalla Santa

    2008-05-01

    Full Text Available The aim of this study has been to evaluate the infl uence of inoculation with Azospirillum sp. RAM-7 in wheat, barley and oats on yields, density and N total of grains. The experiments were conducted under fi eld conditions. The treatments involved bacterial inoculation with or without different levels of nitrogen fertilization and absolute control. The inoculation was carried out by the seed coating method with bacterial suspension containing 1010 CFU.mL-1. Statistically signifi cant effects on grain yield in wheat were obtained at the inoculated treatment without any nitrogen fertilizer, increasing the yield by 23.9% over de control (p<0.05. In the inoculated treatment associated with 48 kg of N.ha-1, the yield was similar to that obtained at 60 kg of N.ha-1 with or without inoculation. In barley, the grain yields of the inoculated treatment associated with 32 kg of N.ha-1 was statistically equivalent to that obtained with 40 kg de N.ha-1 with or without inoculation (p<0,05. In oats, there was no signifi cant difference between treatments and their respective controls for yields, density and N total of grains. The results of the present investigations showed the possibility of the partial substitution of the inorganic nitrogen fertilizer with the Azospirillum sp. RAM-7 inoculation in wheat, barley and oats.

  6. Parâmetros nutricionais e estabilidade aeróbia de silagens de cereais de inverno submetidas a diferentes regimes de corte no estádio vegetativo

    Directory of Open Access Journals (Sweden)

    G.F.M. Leão

    Full Text Available RESUMO O uso de regimes de corte em estádio vegetativo para os cereais de inverno é interessante quando se busca intensificar a produção de alimento volumoso para ruminantes. No entanto, é necessário se averiguar o impacto desse manejo sobre as características das silagens resultantes. Dessa forma, o objetivo do experimento foi avaliar o valor nutricional e a estabilidade aeróbia de silagens de cereais de inverno, submetidas a regimes de corte no estádio vegetativo, prévio ao corte para ensilagem. Os cereais utilizados foram trigo (Triticum aestivum cv. BRS Gralha Azul, cevada (Hordeum vulgare cv. BRS Brau, aveia-branca (Avena sativa cv. URS Guará, aveia- preta (Avena strigosa cv. Embrapa 139 e triticale (X Triticosecale cv. IPR 11, associados a três regimes de corte: sem cortes prévios (silagem exclusiva; um corte; e com dois cortes em estádio vegetativo e subsequente produção de silagem. Na avaliação nutricional, a cevada apresentou valores baixos de FDA (311,7 e 375,3g kg de MS-1 e altos de NDT (569,2 e 533,4g kg de MS-1 para os sistemas com um e dois cortes, respectivamente. Na avaliação da estabilidade aeróbia, os materiais foram bastante estáveis após a abertura dos silos, com exceção da aveia-branca e da aveia-preta, no regime sem cortes. As silagens de triticale e de cevada apresentaram as maiores estabilidades nutricionais com o aumento no número de cortes.

  7. Soil fertility status and nutrients provided to spring barley (Hordeum distichon L. by pig slurry

    Directory of Open Access Journals (Sweden)

    Melisa Gómez-Garrido

    2014-03-01

    Full Text Available Nutrient recycling using pig slurry is a common agricultural practice to manage the ever-increasing amounts of wastes from the pig industry. This study was conducted in the southeast of Spain to quantify the enrichments in major (N, P, K, Mg and minor (Zn, Fe, Cu, and Mn nutrients in soils amended with D1-170 kg N ha-1 (European Union legislated dose or D2-340 kg N ha-1, and understand the influence of pig slurry on yield and nutrient uptake in two crop seasons of spring barley (Hordeum distichon L. Compared to control, D2 increased NO3--N by 11.4X to 109 mg kg-1, Olsen-P by 6.9X to 423 mg kg-1, exchange K (2.5X to 1.6 cmol+ kg-1, Mg (1.7X to 1.8 cmol+ kg-1, diethylene-triamine pentaacetic acid (DTPA-Zn (94X to 18.2 mg kg-1, and Fe (2X to 11.3 mg kg-1. Available NO3--N, Olsen-P, and DTPA-Zn have the best correlations with crop yield and nutrient uptake. These results indicate that the assessment of soil fertility status at 1-mo after pig slurry addition provides a good indicator for potential yield and uptake of barley. However, it is suggested that leachates should be monitored to effectively manage potential releases of nitrate and phosphate into the environment.

  8. Non-reciprocal interactions between K+ and Na+ ions in barley (Hordeum vulgare L.)

    Science.gov (United States)

    Kronzucker, Herbert J.; Szczerba, Mark W.; Schulze, Lasse M.; Britto, Dev T.

    2008-01-01

    The interaction of sodium and potassium ions in the context of the primary entry of Na+ into plant cells, and the subsequent development of sodium toxicity, has been the subject of much recent attention. In the present study, the technique of compartmental analysis with the radiotracers 42K+ and 24Na+ was applied in intact seedlings of barley (Hordeum vulgare L.) to test the hypothesis that elevated levels of K+ in the growth medium will reduce both rapid, futile Na+ cycling at the plasma membrane, and Na+ build-up in the cytosol of root cells, under saline conditions (100 mM NaCl). We reject this hypothesis, showing that, over a wide (400-fold) range of K+ supply, K+ neither reduces the primary fluxes of Na+ at the root plasma membrane nor suppresses Na+ accumulation in the cytosol. By contrast, 100 mM NaCl suppressed the cytosolic K+ pool by 47–73%, and also substantially decreased low-affinity K+ transport across the plasma membrane. We confirm that the cytosolic [K+]:[Na+] ratio is a poor predictor of growth performance under saline conditions, while a good correlation is seen between growth and the tissue ratios of the two ions. The data provide insight into the mechanisms that mediate the toxic influx of sodium across the root plasma membrane under salinity stress, demonstrating that, in the glycophyte barley, K+ and Na+ are unlikely to share a common low-affinity pathway for entry into the plant cell. PMID:18562445

  9. Biosynthesis of stable iron oxide nanoparticles in aqueous extracts of Hordeum vulgare and Rumex acetosa plants.

    Science.gov (United States)

    Makarov, Valentin V; Makarova, Svetlana S; Love, Andrew J; Sinitsyna, Olga V; Dudnik, Anna O; Yaminsky, Igor V; Taliansky, Michael E; Kalinina, Natalia O

    2014-05-27

    We report the synthesis and characterization of amorphous iron oxide nanoparticles from iron salts in aqueous extracts of monocotyledonous (Hordeum vulgare) and dicotyledonous (Rumex acetosa) plants. The nanoparticles were characterized by TEM, absorbance spectroscopy, SAED, EELS, XPS, and DLS methods and were shown to contain mainly iron oxide and iron oxohydroxide. H. vulgare extracts produced amorphous iron oxide nanoparticles with diameters of up to 30 nm. These iron nanoparticles are intrinsically unstable and prone to aggregation; however, we rendered them stable in the long term by addition of 40 mM citrate buffer pH 3.0. In contrast, amorphous iron oxide nanoparticles (diameters of 10-40 nm) produced using R. acetosa extracts are highly stable. The total protein content and antioxidant capacity are similar for both extracts, but pH values differ (H. vulgare pH 5.8 vs R. acetosa pH 3.7). We suggest that the presence of organic acids (such oxalic or citric acids) plays an important role in the stabilization of iron nanoparticles, and that plants containing such constituents may be more efficacious for the green synthesis of iron nanoparticles.

  10. Monosomic and double monosomic substitutions of Hordeum bulbosum L. chromosomes into H. vulgare L.

    Science.gov (United States)

    Pickering, R A

    1992-07-01

    One of the aims of the interspecific crossing programme between Hordeum vulgare L. and H. bulbosum L. has been to introgress desirable genes into barley from the wild species. However, despite their close taxonomic relationship there have been few reports of achieving this objective using amphidiploid hybrids. In order to broaden the range of available hybrids, partially fertile triploids between H. vulgare (2n = 2x = 14) and H. bulbosum (2n = 4x = 28) were developed and crossed with H. vulgare as female parent. From 580 progeny which were screened, eight putative single monosomic chromosome substitution lines and one double monosomic substitution were identified by cytological analysis. These involved the substitution of H. vulgare chromosome 1 (two lines), 6 (four lines), 6L (one line), 7 (one line) and 1 + 4 (one line) by their respective H. bulbosum homoeologues. The H. bulbosum chromosome was frequently eliminated during plant development, but it was observed regularly in pollen mother cells of two lines. However, pairing between the H. bulbosum chromosome and its H. vulgare homoeologue was low. Several of the lines were more resistant than their H. vulgare parents to powdery mildew (Erysiphe graminis DC. f.sp. hordei Em. Marchai), net blotch (Drechslera teres Sacc.) and scald (Rhynchosporium secalis (Oudem.) Davis). Apart from their use in studying genome relationships, their value to plant breeders will depend on the ease of inducing translocations between the parental chromosomes.

  11. Evaluation of Toxic Effects and Bioaccumulation of Cadmium and Copper in Spring Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Jūratė Žaltauskaitė

    2013-07-01

    Full Text Available This paper deals with the analysis of toxic effects of cadmium and copper on the growth of spring barley (Hordeum vulgare L. cultivated in hydroponics. The seedlings of barley were treated with four different concentrations of cadmium and copper, ranging from 0.1 to 10 mg L-1. The aim of the study was to assess toxic effects of cadmium (Cd and copper (Cu on the growth of spring barley, and to determine metal accumulation in above-ground and underground parts of the plant. The impact of Cu and Cd on photosynthetic pigments (chlorophyll a, b, the content of malondialdehyde (MDA, and the essential micronutrients (Mn, Fe were examined. Metal treatment reduced the growth of roots (by 60%, shoots (Cd – 48 %, Cu – 57% and dry weight (Cd – 47 %, Cu – 52% of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. Regression analysis revealed that there was significant negative relationship between MDA content and biomass of barley treated with Cu (r=-0.99, p=0.01. The examined heavy metals were accumulated mainly in the roots and bioconcentration of Cu there was higher than that of Cd, indicating that roots tended to accumulate higher amounts of Cu than Cd. Though translocation of Cd from roots to above-ground tissues was higher, higher levels of Cd were observed in leaves.DOI: http://dx.doi.org/10.5755/j01.erem.64.2.1951

  12. The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Pavlova Violetta Aleksandrovna

    2014-04-01

    Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

  13. Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L).

    Science.gov (United States)

    Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

    2015-06-11

    In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.

  14. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-05-01

    Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  15. Identification and Expression Analysis of the Barley (Hordeum vulgare L. Aquaporin Gene Family.

    Directory of Open Access Journals (Sweden)

    Runyararo M Hove

    Full Text Available Aquaporins (AQPs are major intrinsic proteins (MIPs that mediate bidirectional flux of water and other substrates across cell membranes, and play critical roles in plant-water relations, dehydration stress responses and crop productivity. However, limited data are available as yet on the contributions of these proteins to the physiology of the major crop barley (Hordeum vulgare. The present work reports the identification and expression analysis of the barley MIP family. A comprehensive search of publicly available leaf mRNA-seq data, draft barley genome data, GenBank transcripts and sixteen new annotations together revealed that the barley MIP family is comprised of at least forty AQPs. Alternative splicing events were likely in two plasma membrane intrinsic protein (PIP AQPs. Analyses of the AQP signature sequences and specificity determining positions indicated a potential of several putative AQP isoforms to transport non-aqua substrates including physiological important substrates, and respond to abiotic stresses. Analysis of our publicly available leaf mRNA-seq data identified notable differential expression of HvPIP1;2 and HvTIP4;1 under salt stress. Analyses of other gene expression resources also confirmed isoform-specific responses in different tissues and/or in response to salinity, as well as some potentially inter-cultivar differences. The work reports systematic and comprehensive analysis of most, if not all, barley AQP genes, their sequences, expression patterns in different tissues, potential transport and stress response functions, and a strong framework for selection and/or development of stress tolerant barley varieties. In addition, the barley data would be highly valuable for genetic studies of the evolutionarily closely related wheat (Triticum aestivum L..

  16. Tissue-specific epigenetic modifications in root apical meristem cells of Hordeum vulgare.

    Directory of Open Access Journals (Sweden)

    Agnieszka J Braszewska-Zalewska

    Full Text Available Epigenetic modifications of chromatin structure are essential for many biological processes, including growth and reproduction. Patterns of DNA and histone modifications have recently been widely studied in many plant species, although there is virtually no data on the spatial and temporal distribution of epigenetic markers during plant development. Accordingly, we have used immunostaining techniques to investigate epigenetic modifications in the root apical meristem of Hordeum vulgare. Histone H4 acetylation (H4K5ac, histone H3 dimethylation (H3K4me2, H3K9me2 and DNA methylation (5mC patterns were established for various root meristem tissues. Distinct levels of those modifications were visualised in the root cap, epidermis, cortex and vascular tissues. The lateral root cap cells seem to display the highest level of H3K9me2 and 5mC. In the epidermis, the highest level of 5mC and H3K9me2 was detected in the nuclei from the boundary of the proximal meristem and the elongation zone, while the vascular tissues were characterized by the highest level of H4K5ac. Some of the modified histones were also detectable in the cytoplasm in a highly tissue-specific manner. Immunolocalisation of epigenetic modifications of chromatin carried out in this way, on longitudinal or transverse sections, provides a unique topographic context within the organ, and will provide some answers to the significant biological question of tissue differentiation processes during root development in a monocotyledon plant species.

  17. Prospects for exploitation of disease resistance from Hordeum chilense in cultivated cereals.

    Science.gov (United States)

    Rubiales, D; Niks, R E; Carver, T L; Ballesteros, J; Martín, A

    2001-01-01

    Hordeum chilense is a South American wild barley with high potential for cereal breeding given its high crossability with other members of the Triticeae. In the present paper we consider the resistance of H. chilense to several fungal diseases and the prospects for its transference to cultivated cereals. All H. chilense accessions studied are resistant to the barley, wheat and rye brown rusts, the powdery mildews of wheat, barley, rye and oat, to Septoria leaf blotch, common bunt and to loose smuts, which suggests that H. chilense is a non-host of these diseases. There are also lines resistant to wheat and barley yellow rust, stem rust and to Agropyron leaf rust, as well as lines giving moderate levels of resistance to Septoria glume blotch, tan spot and Fusarium head blight. Some H. chilense lines display pre-appressorial avoidance to brown rust. Lines differ in the degree of haustorium formation by rust and mildew fungi they permit, and in the degree to which a hypersensitive response occurs after haustoria are formed. Unfortunately, resistance of H. chilense to rust fungi is not expressed in tritordeum hybrids, nor in chromosome addition lines in wheat. In tritordeum, H. chilense contributes quantitative resistance to wheat powdery mildew, tan spot and loose smut. The resistance to mildew, expressed as a reduced disease severity, is not associated with macroscopically visible necrosis. Hexaploid tritordeums are immune to Septoria leaf blotch and to common bunt although resistance to both is slightly diluted in octoploid tritordeums. Studies with addition lines in wheat indicate that the resistance of H. chilense to powdery mildew, Septoria leaf blotch and common bunt is of broad genetic basis, conferred by genes present on various chromosomes.

  18. Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

    Directory of Open Access Journals (Sweden)

    Weiwei Deng

    Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

  19. Tissue-Specific Epigenetic Modifications in Root Apical Meristem Cells of Hordeum vulgare

    Science.gov (United States)

    Braszewska-Zalewska, Agnieszka J.; Wolny, Elzbieta A.; Smialek, Lukasz; Hasterok, Robert

    2013-01-01

    Epigenetic modifications of chromatin structure are essential for many biological processes, including growth and reproduction. Patterns of DNA and histone modifications have recently been widely studied in many plant species, although there is virtually no data on the spatial and temporal distribution of epigenetic markers during plant development. Accordingly, we have used immunostaining techniques to investigate epigenetic modifications in the root apical meristem of Hordeum vulgare. Histone H4 acetylation (H4K5ac), histone H3 dimethylation (H3K4me2, H3K9me2) and DNA methylation (5mC) patterns were established for various root meristem tissues. Distinct levels of those modifications were visualised in the root cap, epidermis, cortex and vascular tissues. The lateral root cap cells seem to display the highest level of H3K9me2 and 5mC. In the epidermis, the highest level of 5mC and H3K9me2 was detected in the nuclei from the boundary of the proximal meristem and the elongation zone, while the vascular tissues were characterized by the highest level of H4K5ac. Some of the modified histones were also detectable in the cytoplasm in a highly tissue-specific manner. Immunolocalisation of epigenetic modifications of chromatin carried out in this way, on longitudinal or transverse sections, provides a unique topographic context within the organ, and will provide some answers to the significant biological question of tissue differentiation processes during root development in a monocotyledon plant species. PMID:23935955

  20. Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.)

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach;

    2011-01-01

    Barley (Hordeum vulgare L.) and wheat (Triticum aestivum L.) possess a significant phytase activity in the mature grains. Maize (Zea mays L.) and rice (Oryza sativa L.) possess little or virtually no pre-formed phytase activity in the mature grain and depend fully on de novo synthesis during...

  1. Physiological and biochemical reactions of Hordeum vulgare seedlings to the action of silver nanoparticles

    Directory of Open Access Journals (Sweden)

    N. O. Khromykh

    2015-07-01

    Full Text Available Morphometrical indexes, and spectrophotometrically measured protein and glutathione (GSH, GSSG contents and activity of peroxidase (POD, EC 1.11.1.7, glutathione-reductase (GR, EC 1.6.4.2 and glutathione S-transferase (GST, EС 2.5.1.18 were examined in Hordeum vulgare L. seedlings after 0.01 and 0.1 mg/l AgNPs treatment during 24 h. We tested the hypothesis that the action of nanoparticles has a stressful effect on the physiological and biochemical processes of seedlings. Growth of roots was inhibited and fresh weight decreased by 29% and 21% under low and high concentrations respectively. Conversely, leaf growth was intensified, and leaf length (16% and 18% and fresh weight (35% and 44% increased at low and high concentrations respectively. POD activity in roots increased by 26% and 7%, and decreased in leaves to 57% and 81% of control at low and high concentrations respectively. GSH content changed insignificantly, but GSSG content increased in roots (2 and 2.5-fold and in leaves (13% and 30% at both AgNPs concentrations. GSH/GSSG-ratio decreased in roots (1.9 and 2.6-fold and in leaves (1.1 and 1.3-fold at low and high concentrations respectively. GR activity decreased at a concentration of 0.01 mg/l (7% in roots and 17% in leaves respectively and increased at 0.1 mg/l (52% in roots and 6% in leaves. GST activity increased in leaves (52% and 78% at low and high concentrations but decreased by 17% in roots under high concentration of nanosilver. Thus, the action of AgNPs on barley seedlings had a dose-dependent and organ-specific character. The various directions of changes in growth, metabolic processes and activity of antioxidant defense systems appear to be a stress response of barley seedlings to the impact of AgNPs, which underlines the necessity of detailed study of plant intracellular processes exposed to the action of nanomaterial.

  2. Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

    Directory of Open Access Journals (Sweden)

    Miriama Kopernická

    2016-01-01

    Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

  3. DAÑOS EN GERMOPLASMA DE CEBADA (Hordeum vulgare Lin. PRODUCIDOS POR Rhyzoperta dominica FABRICIUS

    Directory of Open Access Journals (Sweden)

    Regla M. Cárdenas

    2009-01-01

    Full Text Available Los daños cuantitativos producidos por plagas de almacén revisten vital importancia cuando se trata de semillas con destino a la investigación, pues generalmente las cantidades son muy pequeñas. El estudio se desarrolló con el objetivo de conocer las pérdidas de este tipo, producidas por Rhyzoperta dominica F. en semillas de 96 líneas de cebada procedentes de Siria y conservadas a la temperatura de 15 ± 2°C durante seis meses; para ello, se tuvo en cuenta la reducción producida en el peso (g, se determinó el peso de mil granos (PMG, se estimó el número de insectos adultos en mil granos (NAMG y se calculó, además, el índice de ataque (IA. Los resultados mostraron que 12 líneas presentaron daños producidos por R. dominica, con una pérdida promedio de 18 % en el peso en gramos; las líneas en estudio mostraron un bajo PMG (32.38 g, mientras el NAMG estimado fue de 31.25 y el IA de 3.17 %.

  4. Reduction in amounts of mitochondrial DNA in the sperm cells as a mechanism for maternal inheritance in Hordeum vulgare.

    Science.gov (United States)

    Sodmergen; Zhang, Quan; Zhang, Yingtao; Sakamoto, Wataru; Kuroiwa, Tsuneyoshi

    2002-12-01

    It is known that extranuclear organelle DNA is inherited maternally in the majority of angiosperms. The mechanisms for maternal inheritance have been well studied in plastids but not in mitochondria. In the present study we examined the mitochondrial DNA in the male reproductive cells of Hordeum vulgare L. by immunoelectron microscopy. Our results show that the number of anti-DNA gold particles on sections of sperm cell mitochondria decreased by 97% during pollen development. The reduction occurred rapidly in the generative cells and subsequently in the sperm cells, concomitant with a remarkable reduction in mitochondrial volume. It seems that the copy numbers of mitochondrial DNA were reduced in the male reproductive cells, which may be a possible mechanism by which paternal transmission is inhibited. Unlike mitochondria, plastids are excluded from the generative cells during the first pollen mitosis. These data suggest a mechanism for maternal inheritance of mitochondria in angiosperms and for independent control of inheritance of mitochondria and plastids in H. vulgare.

  5. Purification and characterization of soluble (cytosolic) and bound (cell wall) isoforms of invertases in barley (Hordeum vulgare) elongating stem tissue

    Science.gov (United States)

    Karuppiah, N.; Vadlamudi, B.; Kaufman, P. B.

    1989-01-01

    Three different isoforms of invertases have been detected in the developing internodes of barley (Hordeum vulgare). Based on substrate specificities, the isoforms have been identified to be invertases (beta-fructosidases EC 3.2.1.26). The soluble (cytosolic) invertase isoform can be purified to apparent homogeneity by diethylaminoethyl cellulose, Concanavalin-A Sepharose, organo-mercurial Sepharose, and Sephacryl S-300 chromatography. A bound (cell wall) invertase isoform can be released by 1 molar salt and purified further by the same procedures as above except omitting the organo-mercurial Sepharose affinity chromatography step. A third isoform of invertase, which is apparently tightly associated with the cell wall, cannot be isolated yet. The soluble and bound invertase isoforms were purified by factors of 60- and 7-fold, respectively. The native enzymes have an apparent molecular weight of 120 kilodaltons as estimated by gel filtration. They have been identified to be dimers under denaturing and nondenaturing conditions. The soluble enzyme has a pH optimum of 5.5, Km of 12 millimolar, and a Vmax of 80 micromole per minute per milligram of protein compared with cell wall isozyme which has a pH optimum of 4.5, Km of millimolar, and a Vmax of 9 micromole per minute per milligram of protein.

  6. Spatial relationships between seed bank and seedling populations of Hordeum spontaneum and Cardaria draba in saffron (Crocus sativus L. fields

    Directory of Open Access Journals (Sweden)

    hasan makariyan

    2009-06-01

    Full Text Available Geostatistical techniques were used to characterize the spatial relationship between Hordeum spontaneum and Cardaria draba seedling and seed bank over the course of one growing season (2004-2005 in three saffron fields, located in Southern Khorasan, Iran. The density and spatial distribution of weeds varied widely with fields. The emergence percentage was higher for Cardaria draba than for H. spontaneum in all fields. Semivariograms showed spatial autocorrelation in seed bank and seedling populations of H. spontaneum and C. draba in all fields. Cross-semivariograms showed moderate to strong (63.3 to 94.7% and strong spatial continuity (78.4 to 95.4 %. between seed bank and seedling population densities of H. spontaneum and C. draba, respectively. Grey-scale field maps of C. draba seed banks corresponded visually to maps of seedling populations and could have been used to target control efforts, but visual correspondence between H. spontaneum seed bank and seedling maps was poor. Seed bank and seedling mapping may be useful for site-specific management, but additional information is needed to understand variation in the relationships between these two populations over time and space.

  7. Overexpression, purification and enzymatic characterization of a recombinant plastidial glucose-6-phosphate dehydrogenase from barley (Hordeum vulgare cv. Nure) roots.

    Science.gov (United States)

    Cardi, Manuela; Chibani, Kamel; Castiglia, Daniela; Cafasso, Donata; Pizzo, Elio; Rouhier, Nicolas; Jacquot, Jean-Pierre; Esposito, Sergio

    2013-12-01

    In plant cells, the plastidial glucose 6-phosphate dehydrogenase (P2-G6PDH, EC 1.1.1.49) represents one of the most important sources of NADPH. However, previous studies revealed that both native and recombinant purified P2-G6PDHs show a great instability and a rapid loss of catalytic activity. Therefore it has been difficult to describe accurately the catalytic and physico-chemical properties of these isoforms. The plastidial G6PDH encoding sequence from barley roots (Hordeum vulgare cv. Nure), devoid of a long plastidial transit peptide, was expressed as recombinant protein in Escherichia coli, either untagged or with an N-terminal his-tag. After purification from both the soluble fraction and inclusion bodies, we have explored its kinetic parameters, as well as its sensitivity to reduction. The obtained results are consistent with values determined for other P2-G6PDHs previously purified from barley roots and from other land plants. Overall, these data shed light on the catalytic mechanism of plant P2-G6PDH, summarized in a proposed model in which the sequential mechanism is very similar to the mammalian cytosolic G6PDH. This study provides a rational basis to consider the recombinant barley root P2-G6PDH as a good model for further kinetic and structural studies.

  8. Reconstitution of cyanogenesis in barley (Hordeum vulgare L.) and its implications for resistance against the barley powdery mildew fungus.

    Science.gov (United States)

    Nielsen, Kirsten A; Hrmova, Maria; Nielsen, Janni Nyvang; Forslund, Karin; Ebert, Stefan; Olsen, Carl E; Fincher, Geoffrey B; Møller, Birger Lindberg

    2006-04-01

    Barley (Hordeum vulgare L.) produces a leucine-derived cyanogenic beta-D-glucoside, epiheterodendrin that accumulates specifically in leaf epidermis. Barley leaves are not cyanogenic, i.e. they do not possess the ability to release hydrogen cyanide, because they lack a cyanide releasing beta-D-glucosidase. Cyanogenesis was reconstituted in barley leaf epidermal cells through single cell expression of a cDNA encoding dhurrinase-2, a cyanogenic beta-D-glucosidase from sorghum. This resulted in a 35-60% reduction in colonization rate by an obligate parasite Blumeria graminis f. sp. hordei, the causal agent of barley powdery mildew. A database search for barley homologues of dhurrinase-2 identified a (1,4)-beta-D-glucan exohydrolase isozyme betaII that is located in the starchy endosperm of barley grain. The purified barley (1,4)-beta-D-glucan exohydrolase isozyme betaII was found to hydrolyze the cyanogenic beta-D-glucosides, epiheterodendrin and dhurrin. Molecular modelling of its active site based on the crystal structure of linamarase from white clover, demonstrated that the disposition of the catalytic active amino acid residues was structurally conserved. Epiheterodendrin stimulated appressoria and appressorial hook formation of B. graminis in vitro, suggesting that loss of cyanogenesis in barley leaves has enabled the fungus to utilize the presence of epiheterodendrin to facilitate host recognition and to establish infection.

  9. Characterization of barley (Hordeum vulgare L. NAC transcription factors suggests conserved functions compared to both monocots and dicots

    Directory of Open Access Journals (Sweden)

    Gregersen Per L

    2011-08-01

    Full Text Available Abstract Background The NAC transcription factor family is involved in the regulation of traits in both monocots and dicots of high agronomic importance. Understanding the precise functions of the NAC genes can be of utmost importance for the improvement of cereal crop plants through plant breeding. For the cereal crop plant barley (Hordeum vulgare L. only a few NAC genes have so far been investigated. Results Through searches in publicly available barley sequence databases we have obtained a list of 48 barley NAC genes (HvNACs with 43 of them representing full-length coding sequences. Phylogenetic comparisons to Brachypodium, rice, and Arabidopsis NAC proteins indicate that the barley NAC family includes members from all of the eight NAC subfamilies, although by comparison to these species a number of HvNACs still remains to be identified. Using qRT-PCR we investigated the expression profiles of 46 HvNACs across eight barley tissues (young flag leaf, senescing flag leaf, young ear, old ear, milk grain, late dough grain, roots, and developing stem and two hormone treatments (abscisic acid and methyl jasmonate. Conclusions Comparisons of expression profiles of selected barley NAC genes with the published functions of closely related NAC genes from other plant species, including both monocots and dicots, suggest conserved functions in the areas of secondary cell wall biosynthesis, leaf senescence, root development, seed development, and hormone regulated stress responses.

  10. Barley (Hordeum vulgare L.) low phytic acid 1-1: an endosperm-specific, filial determinant of seed total phosphorus.

    Science.gov (United States)

    Raboy, Victor; Cichy, Karen; Peterson, Kevin; Reichman, Sarah; Sompong, Utumporn; Srinives, Peerasak; Saneoka, Hirofumi

    2014-01-01

    Inositol hexaphosphate (Ins P6 or "phytic acid") typically accounts for 75 (± 10%) of seed total phosphorus (P). In some cases, genetic blocks in seed Ins P6 accumulation can also alter the distribution or total amount of seed P. In nonmutant barley (Hordeum vulgare L.) caryopses, ~80% of Ins P6 and total P accumulate in the aleurone layer, the outer layer of the endosperm, with the remainder in the germ. In barley low phytic acid 1-1 (Hvlpa1-1) seed, both endosperm Ins P6 and total P are reduced (~45% and ~25%, respectively), but germs are phenotypically wild type. This translates into a net reduction in whole-seed total P of ~15%. Nutrient culture studies demonstrate that the reduction in endosperm total P is not due to a reduction in the uptake of P into the maternal plant. Genetic tests (analyses of testcross and F2 seed) reveal that the Hvlpa1-1 genotype of the filial seed conditions the seed total P reduction; sibling seed in the same head of barley that differ in their Hvlpa1-1 genotype (heterozygous vs. homozygous recessive) differ in their total P (normal vs. reduced, respectively). Therefore, Hvlpa1 functions as a seed-specific or filial determinant of barley endosperm total P.

  11. Limitation of Cell Elongation in Barley (Hordeum vulgare L.) Leaves Through Mechanical and Tissue-Hydraulic Properties.

    Science.gov (United States)

    Touati, Mostefa; Knipfer, Thorsten; Visnovitz, Tamás; Kameli, Abdelkrim; Fricke, Wieland

    2015-07-01

    The aim of the present study was to assess the mechanical and hydraulic limitation of growth in leaf epidermal cells of barley (Hordeum vulgare L.) in response to agents which affect cellular water (mercuric chloride, HgCl(2)) and potassium (cesium chloride, CsCl; tetraethylammonium, TEA) transport, pump activity of plasma membrane H(+)-ATPase and wall acidification (fusicoccin, FC). Cell turgor (P) was measured with the cell pressure probe, and cell osmotic pressure (π) was analyzed through picoliter osmometry of single-cell extracts. A wall extensibility coefficient (M) and tissue hydraulic conductance coefficient (L) were derived using the Lockhart equation. There was a significant positive linear relationship between relative elemental growth rate and P, which fit all treatments, with an overall apparent yield threshold of 0.368 MPa. Differences in growth between treatments could be explained through differences in P. A comparison of L and M showed that growth in all except the FC treatment was co-limited through hydraulic and mechanical properties, though to various extents. This was accompanied by significant (0.17-0.24 MPa) differences in water potential (ΔΨ) between xylem and epidermal cells in the leaf elongation zone. In contrast, FC-treated leaves showed ΔΨ close to zero and a 10-fold increase in L. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  12. Novel Bread Wheat Lines Enriched in Carotenoids Carrying Hordeum chilense Chromosome Arms in the ph1b Background

    Science.gov (United States)

    Rey, María-Dolores; Calderón, María-Carmen; Rodrigo, María Jesús; Zacarías, Lorenzo; Alós, Enriqueta; Prieto, Pilar

    2015-01-01

    The use of crop wild relative species to improve major crops performance is well established. Hordeum chilense has a high potential as a genetic donor to increase the carotenoid content of wheat. Crosses between the 7Hch H. chilense substitution lines in wheat and the wheat pairing homoeologous1b (ph1b) mutant allowed the development of wheat-H. chilense translocation lines for both 7Hchα and 7Hchβ chromosome arms in the wheat background. These translocation lines were characterized by in situ hybridization and using molecular markers. In addition, reverse phase chromatography (HPLC) analysis was carried out to evaluate the carotenoid content and both 7Hchα∙7AL and 7AS∙7Hchβ disomic translocation lines. The carotenoid content in 7Hchα∙7AL and 7AS∙7Hchβ disomic translocation lines was higher than the wheat-7Hch addition line and double amount of carotenoids than the wheat itself. A proteomic analysis confirmed that the presence of chromosome 7Hch introgressions in wheat scarcely altered the proteomic profile of the wheat flour. The Psy1 (Phytoene Synthase1) gene, which is the first committed step in the carotenoid biosynthetic pathway, was also cytogenetically mapped on the 7Hchα chromosome arm. These new wheat-H. chilense translocation lines can be used as a powerful tool in wheat breeding programs to enrich the diet in bioactive compounds. PMID:26241856

  13. Novel Bread Wheat Lines Enriched in Carotenoids Carrying Hordeum chilense Chromosome Arms in the ph1b Background.

    Directory of Open Access Journals (Sweden)

    María-Dolores Rey

    Full Text Available The use of crop wild relative species to improve major crops performance is well established. Hordeum chilense has a high potential as a genetic donor to increase the carotenoid content of wheat. Crosses between the 7Hch H. chilense substitution lines in wheat and the wheat pairing homoeologous1b (ph1b mutant allowed the development of wheat-H. chilense translocation lines for both 7Hchα and 7Hchβ chromosome arms in the wheat background. These translocation lines were characterized by in situ hybridization and using molecular markers. In addition, reverse phase chromatography (HPLC analysis was carried out to evaluate the carotenoid content and both 7Hchα∙7AL and 7AS∙7Hchβ disomic translocation lines. The carotenoid content in 7Hchα∙7AL and 7AS∙7Hchβ disomic translocation lines was higher than the wheat-7Hch addition line and double amount of carotenoids than the wheat itself. A proteomic analysis confirmed that the presence of chromosome 7Hch introgressions in wheat scarcely altered the proteomic profile of the wheat flour. The Psy1 (Phytoene Synthase1 gene, which is the first committed step in the carotenoid biosynthetic pathway, was also cytogenetically mapped on the 7Hchα chromosome arm. These new wheat-H. chilense translocation lines can be used as a powerful tool in wheat breeding programs to enrich the diet in bioactive compounds.

  14. Direct measurement of recombination frequency in interspecific hybrids between Hordeum vulgare and H. bulbosum using genomic in situ hybridization.

    Science.gov (United States)

    Zhang, L; Pickering, R; Murray, B

    1999-09-01

    Two different genotypes of diploid Hordeum vulgare x H. bulbosum hybrids, which differ in their pattern of meiotic metaphase pairing behaviour, were investigated at MI and AI by genomic in situ hybridization (GISH). One hybrid, 102C2, showed a high frequency of bivalents at metaphase I whereas the other, 103K5, showed a high frequency of univalents. The GISH analysis of both hybrids established that pairing occurred only between chromosomes of different parental genomes and revealed that pairing frequency greatly exceeded recombination. Hybrid 102C2 had a significantly higher recombination frequency than 103K5, but in both hybrids recombination involved only distal chromosome regions. However, an interesting finding is that the ratio of recombination to pairing frequency in 103K5 (1:8.9) is twice as high compared with 102C2 (1:17). The hybrids also differed in chromosome stability; little chromosome elimination occurred in 102C2 but 103K5 showed extensive chromosome loss. It appears that the high frequency of bound arms at MI favours retention of H. bulbosum chromosomes and maintains stability of chromosome numbers in PMCs. Various ideas are put forward to explain the discrepancy between meiotic pairing frequency and recombination in these hybrids.

  15. Further molecular evidence for the Hordeum vulgare ssp. spontaneum in Tibet as ultimate progenitor of Chinese cultivated barley

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    106 accessions of Tibetan wild barley, including 50 accessions of the two-rowed wild barley Hordeum vulgare ssp. spontaneum(HS), 27 accessions of the six-rowed bottle-shaped wild barley H. lagunculiforme(HL) and 29 accessions of the six-rowed wild barley H. agriocrithon(HA) that separately represent different agrigeographical regions of Tibet, were used to study the genetic diversity and genetic differentiation using SSR markers selected from seven barley linkage groups. 229 allelic variants were identified with an average of 7.6 alleles/locus. The average of total number of alleles per locus in HA(6.4) is much higher than that in HS(3.9) and HL(3.4). The genetic diversity and its standard deviation among the three subspecies were in the order of HS>HL>HA. Very significant genetic differentiation was observed among the three subspecies of wild barley. Comparisons of the results from this and previous studies showed a strong Oriental-Occidental differentiation of barley, and that Shannan region of Tibet might be the center of origin of the Tibetan two-rowed wild barley, thus supporting not only the hypothesis of a mono-phyletic origin of cultivated barley but also the proposition that the Tibetan two-rowed wild barley as ultimate progenitor of Chinese cultivated barley.

  16. Genetic analysis and ecological association of Hina genes based on single nucleotide polymorphisms (SNPs) in wild barley, Hordeum spontaneum.

    Science.gov (United States)

    Li, Wei-Tao; Huang, Xia; Wang, Ji-Rui; Chen, Guo-Yue; Nevo, Eviatar; Zheng, You-Liang; Wei, Yu-Ming

    2010-02-01

    Specific primers were designed to amplify the sequences of Hina genes from 121 wild barley (Hordeum spontaneum) accessions belonging to 18 populations from Iran, Israel and Turkey. Forty-nine single nucleotide polymorphisms (SNPs), nine indels, and 26 haplotypes were determined by sequence analysis. The genetic polymorphism (P), genetic diversity (He), and Shannon's information index (I) in the 18 populations were 0.486, 0.181 and 0.269, respectively. Approximately 2/3 genetic variations of Hina genes were presented within populations, while approximately 1/3 genetic variations were observed between populations. Broad gene flow (Nm= 3.31) and low genetic variation (Gst= 0.0702) were detected. However, the genetic differentiation between populations was independent of geographical distances according to the Mantel test (p = 0.478). The result of Spearman rank correlations (r(s)) showed that the genetic indices (P, He and I) of Hina were not significantly correlated with ecological factors. Only eight SNP positions correlated significantly with ecological factors. Of the eight SNP positions that positively correlated with ecological factors, only one SNP (769, T-C) was located in the coding region; however, it was not responsible for the amino acid change.

  17. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

    Science.gov (United States)

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

    2015-01-01

    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

  18. Agronomic Characters of Elymus dahuricus, Hordeum brevisubulatum and Their BC1F3%披碱草和野大麦及其杂种回交后代的农艺特性研究

    Institute of Scientific and Technical Information of China (English)

    李微微; 李造哲; 王磊

    2009-01-01

    [Objective] This study was to explore the inheritance of BC1F3 to excellent characteristics of parents(Elymus dahuricus, Hordeum brevisubulatum), heterosis and fertility restoration. [Method] The agronomic characters such as growth period, growth rate, pollen fertility, fecundity, reproducibility and fresh grass output of Elymus dahuricus, Hordeum brevisubulatum and BC1F3 were comparatively studied. [Result] The growth dynamic of the BC1F3 lined tended to like that of its parent Hordeum brevisubulatum; although growing periods of various lines were different, they were close to that of Hordeum brevisubulatum. There were differences in pollen fertility and seed setting, the pollen fertility rate of YF3-93 was higher than recurrent parent Hordeum brevisubulatum, its seed setting rate in open pollination was also higher. Some lines had low pollen fertility rate and seed setting rate, such as the pollen fertility rate of PF3-52. There were significant differences in the output among BC1F3 lines, e.g. the heterosis (HP) of YF3-64, YF3-74 and YF3-83 were 75.53%, 75.12% and 66.16%, respectively; however, the yields of PF3-52, PF3-15 and PF3-42 were lower than their parents. [Conclusion] This study provided reference for breeding new varieties of forage which is suitable to drought and saline environment.

  19. O PROCESSO DE FABRICAÇÃO DA CERVEJA E SEUS EFEITOS NA PRESENÇA DE POLIFENÓIS

    Directory of Open Access Journals (Sweden)

    PRISCILA BECKER SIQUEIRA

    2009-06-01

    Full Text Available

    Cerveja é a bebida obtida através da fermentação alcoólica de mosto de cereal maltado, geralmente malte de cevada, sendo facultativa a adição de outra matéria-prima fonte de carboidratos, como milho, arroz ou trigo, e possui em geral teor alcoólico entre 3% e 8%. A cerveja pode ser considerada uma boa fonte de polifenóis, que podem ser provenientes tanto do malte quanto do lúpulo. Devido à sua capacidade antioxidante e teor alcoólico baixo, é capaz de melhorar a atividade antioxidante do plasma, reduzindo o risco de doenças coronarianas, sem apresentar os aspectos negativos produzido por doses excessivas de etanol. Em relação ao aspecto nutritivo da cerveja, pode-se dizer que há disponibilidade de uma quantidade significativa de vitaminas do complexo B, além deste produto ser fonte de ácido fólico e selênio. A cerveja é um produto instável, que passa por diversas transformações químicas, físicas e sensoriais durante sua vida de prateleira. A perda de qualidade pelo surgimento de sabores e aromas indesejáveis e alterações nas propriedades físicas da cerveja é um problema que a indústria cervejeira procura solucionar.

  20. Effect of Quantity and Distribution of Rainfalls on Hordeum murinum L. Growth and Development Efecto de la Cantidad y Distribución de las Precipitaciones en el Crecimiento y Desarrollo de Hordeum murinum L.

    Directory of Open Access Journals (Sweden)

    Myrna Johnston B

    2009-06-01

    Full Text Available The growth and development of Hordeum murinum L. seeds growing with extreme pluviometric regimes in cool greenhouse conditions were evaluated. Seven treatments according to quantity and distribution of real rainfalls of the semiarid zone of the Metropolitan Region, Chile were applied: rainy-late, normal-late, dry-early, rainy-normal, normal-early and dry-late, plus a reference without water stress, at 2/3 field capacity. The experimental design was randomized complete blocks with five replicate pots. Seeds produced in the last year were sown in pots with disinfected soil leaving the more uniform plants after emergence. Evaluations were made of phytomass production, spearing shoots of roots, the quantity of floral stems and seeds, their total weight and the proportion of seed annex structures, and the viability and germination capacity of seeds. The life cycle of dry years was shortest and with the least dry shoot matter production, the rainy-normal and normal-late years had similar dry root matter production, therefore the most important factor was rainfall distribution. All the reproductive growth values were lower than the reference. There was no seed production in both distributions of dry years and in the normal-early. There were only differences in late distributions, there were no differences among treatments in seed quality. Thus, H. murinum uses its resources principally for seed production and late distributions determined seed production.Se evaluó el desarrollo de plantas de Hordeum murinum sometidas a regímenes pluviométricos simulados en invernadero frío. En un diseño de bloques completos al azar con cinco repeticiones, se establecieron tratamientos según cantidad y distribución de las precipitaciones reales del secano de la Región Metropolitana, Chile: lluvioso-tardío, normal-tardío, seco-temprano, lluvioso-normal, normal-temprano, seco-tardío y uno de referencia sin restricción hídrica. Se sembraron semillas del a

  1. Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

    Science.gov (United States)

    Brassac, Jonathan; Blattner, Frank R

    2015-09-01

    Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  2. Estimativa da difusividade térmica de grãos de soja pelo método da compactação Thermal diffusivity of soy bean grains by the compacting method

    Directory of Open Access Journals (Sweden)

    Pedro A. P. Borges

    2009-10-01

    Full Text Available A medição da difusividade térmica de grãos, como trigo, arroz e cevada torna-se impraticável com métodos que dependam da introdução de sensores no interior do grão. Propôs-se, neste trabalho, um método para a determinação da difusividade do grão com base nas variações da difusividade da massa de grãos submetida a diferentes níveis de compactação e em curvas de temperatura por tempo, medidas em pontos internos e na fronteira de cilindros da massa de grãos. O problema de transferência de calor (problema direto foi resolvido numericamente pelo método das diferenças finitas. A difusividade da massa de grãos foi estimada resolvendo o problema inverso. Com os valores da difusividade se sugeriu uma função de ajuste relacionando-se a difusividade e a densidade da massa de grãos. Esta função foi usada para projetar o valor da difusividade do grão com base na medida da sua densidade, cujo resultado obtido é compatível com os dados da literatura. A precisão do método depende bastante da qualidade dos dados experimentais e da posição da densidade do grão, no intervalo de dados pesquisados da densidade da massa de grãos.The measurement of thermal diffusivity of grains such as wheat, rice and barley becomes impracticable with methods that depend on the introduction of sensors inside the grain. In this study a method was proposed to determine the thermal diffusivity of grain considering the variations of the mass diffusivity of grains submitted to different compacting levels. Temperature was measured in internal points and in the border of cylinders of grain mass, for three compacting levels. The thermal diffusivity of grain mass was estimated solving the inverse problem. The heat transfer problem (direct problem was solved numerically by the finite differences method. With the values of the thermal diffusivity for the three compacting levels, a function was fitted relating the grain mass diffusivity and density. This

  3. Effects of Seed Priming on Root Characteristics of Two Barley (Hordeum vulgare L.) Cultivars in Different Levels of Salinity Stress by using Gel Chamber Technique

    OpenAIRE

    H. R Khazaei; A Nezami; B Saadatian; O Armand Pishe

    2015-01-01

    The study was conducted to evaluate the effect of seed priming on root growth of two barley cultivars (Hordeum vulgare L.) under salinity stress was performed in phytogel. The treatments included two cultivars of barely (Yusuf and Maquie), levels of seed priming (control, hydro-priming and priming with 4.35 g l-1 of urea) and four levels of NaCl salinity stress (0, 0.2, 0.3 M). The experiment was conducted in Factorial experiment based on a completely randomized design (CRD) with three replic...

  4. Genetic Transformation of Common Bean (Phaseolus vulgaris L. with the Gus Color Marker, the Bar Herbicide Resistance, and the Barley (Hordeum vulgare HVA1 Drought Tolerance Genes

    Directory of Open Access Journals (Sweden)

    Kingdom Kwapata

    2012-01-01

    Full Text Available Five common bean (Phaseolus vulgaris L. varieties including “Condor,” “Matterhorn,” “Sedona,” “Olathe,” and “Montcalm” were genetically transformed via the Biolistic bombardment of the apical shoot meristem primordium. Transgenes included gus color marker which visually confirmed transgenic events, the bar herbicide resistance selectable marker used for in vitro selection of transgenic cultures and which confirmed Liberty herbicide resistant plants, and the barley (Hordeum vulgare late embryogenesis abundant protein (HVA1 which conferred drought tolerance with a corresponding increase in root length of transgenic plants. Research presented here might assist in production of better P. vulgaris germplasm.

  5. The activity of some oxidoreductases in Hordeum vulgare L. plants treated with ethylmethanesulfonate and Rosmarinus officinalis L. hydro-alcoholic extracts

    Directory of Open Access Journals (Sweden)

    Gogu Gheorghita

    2011-02-01

    Full Text Available This paper focuses on the activity of some oxidoreductases (catalase, peroxidase, superoxide- dismutase in barley seedlings (Hordeum vulgare L. after 6 hours of seeds treatment with different concentrations (0,01 – 0,50% of ethyl-methane-sulfonate and 12 hours with hydro-alcoholic 0,5% rosemary (Rosmarinus officinalis L. extract (EHR. The EMS treatments led to an obvious increase of the superoxide dismutase, catalase and peroxidase activity in plants, while the application of the hydro-alcoholic rosemary extract, after the EMS treatment, led to a significant decrease of the activities of these enzymes, since the rosemary extract has an obvious antioxidant effect.

  6. Calcium transport in protoplasts isolated from ml-o barley isolines resistant and susceptible to powdery mildew. [Hordeum vulgare L

    Energy Technology Data Exchange (ETDEWEB)

    Wrona, A.F.; Spanswick, R.M.; Aist, J.R. (Cornell Univ., Ithaca, NY (USA))

    1988-12-01

    Free cytoplasmic calcium has been postulated to play a role in preventing powdery mildew in a series of homozygous ml-o mutants of barley, Hordeum vulgare L. Protoplasts isolated from 7-day-old plants of the ml-o resistant-susceptible (R-S) barley isolines, Riso 5678/3* {times} Carlsberg II R and S, were used to test for differences in fluxes of Ca{sup 2+} across the plasmalemma. Greater influx or lesser efflux might account for a higher free cytosolic Ca{sup 2+} postulated to exist in ml-o R mutants. Uniform patterns of uptake were maintained for 3 hours from solutions of 0.2 and 2 millimolar Ca{sup 2+}. Washout curves of {sup 45}Ca{sup 2+} from R and S protoplasts revealed three compartments - presumed to represent release from the vacuole, organelles, and the cytoplasm (which included bound as well as free Ca{sup 2+}). Uptake and washout did not differ between isolines. On the basis of recent determinations of submicromolar levels of free cytoplasmic Ca{sup 2+} and their initial rates of {sup 45}ca-labeled Ca{sup 2+} uptake, they show that measurement of the unidirectional influx of Ca{sup 2+} across the plasmalemma is not feasible because the specific activity of the pool of free cytoplasmic calcium increases almost instantaneously to a level that would result in a significant, but unknown, efflux of label. Similarly, measurement of the efflux of Ca{sup 2+} across the plasmalemma is not possible since the activity of the pool of free cytoplasmic calcium is a factor of 350 smaller than the most rapid component of the washout experiment. This pool of cytoplasmic free Ca{sup 2+} will wash out too rapidly and be too small to detect under the conditions of these experiments.

  7. Allelic variation, alternative splicing and expression analysis of Psy1 gene in Hordeum chilense Roem. et Schult.

    Directory of Open Access Journals (Sweden)

    Cristina Rodríguez-Suárez

    Full Text Available BACKGROUND: The wild barley Hordeum chilense Roem. et Schult. is a valuable source of genes for increasing carotenoid content in wheat. Tritordeums, the amphiploids derived from durum or common wheat and H. chilense, systematically show higher values of yellow pigment colour and carotenoid content than durum wheat. Phytoene synthase 1 gene (Psy1 is considered a key step limiting the carotenoid biosynthesis, and the correlation of Psy1 transcripts accumulation and endosperm carotenoid content has been demonstrated in the main grass species. METHODOLOGY/PRINCIPAL FINDINGS: We analyze the variability of Psy1 alleles in three lines of H. chilense (H1, H7 and H16 representing the three ecotypes described in this species. Moreover, we analyze Psy1 expression in leaves and in two seed developing stages of H1 and H7, showing mRNA accumulation patterns similar to those of wheat. Finally, we identify thirty-six different transcripts forms originated by alternative splicing of the 5' UTR and/or exons 1 to 5 of Psy1 gene. Transcripts function is tested in a heterologous complementation assay, revealing that from the sixteen different predicted proteins only four types (those of 432, 370, 364 and 271 amino acids, are functional in the bacterial system. CONCLUSIONS/SIGNIFICANCE: The large number of transcripts originated by alternative splicing of Psy1, and the coexistence of functional and non functional forms, suggest a fine regulation of PSY activity in H. chilense. This work is the first analysis of H. chilense Psy1 gene and the results reported here are the bases for its potential use in carotenoid enhancement in durum wheat.

  8. Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

    Directory of Open Access Journals (Sweden)

    Filip Pošćić

    2016-06-01

    Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

  9. Estimation of Barley (Hordeum Vulgare L. Crop Water Requirements Using Cropwat Software in Ksar-Chellala Region, Algeria

    Directory of Open Access Journals (Sweden)

    M. B. Laouisset

    2016-09-01

    Full Text Available This paper estimates the reference Evapotranspiration (ET0 and Water requirements of barley (Hordeum vulgare L. in Ksar-Chellala region, Algeria, for one dry year by using CROPWAT software. Determination of Evapotranspiration ( ET is important in application such as irrigation design, irrigation scheduling, water resource management, hydrology and cropping systems modeling. Estimation of crop water requirements of barley ( CWR b respected the methodology adopted by the service of development and management service of FAO, based on the use of software CROPWAT 8.0. The total water requirements for barley depend on a variety of target yields and crops management. The period of climatic data used is 23 years (1990-2012, the average rain in this period is 254 mm. The total rain of the dry year is 190 mm. The results of this study show, during the vegetative cycle of barley which is 6 months, the calculation of ET 0 is 453 mm, the potential water which was used by the crop barley is estimated at 281.4 mm, the efficiency of rainfall is 69 mm and a total water requirements of barley ( CWR b equals to 211 mm, this amount distributed on three months coincided with important stages of development in barley. The supplementary irrigation in these conditions with optimal contents equals water requirements estimated by CROPWAT software that increases significantly grain yield of barely. Consequently, the gross irrigation water requirements ( GIWR of 1250000 ha which project to grow barley in the Algerian steppes regions are estimated at 3.77 billion and this for a dry year and a irrigation efficiency of 70%.

  10. BAC library resources for map-based cloning and physical map construction in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Wu Cheng-Cang

    2011-05-01

    Full Text Available Background Although second generation sequencing (2GS technologies allow re-sequencing of previously gold-standard-sequenced genomes, whole genome shotgun sequencing and de novo assembly of large and complex eukaryotic genomes is still difficult. Availability of a genome-wide physical map is therefore still a prerequisite for whole genome sequencing for genomes like barley. To start such an endeavor, large insert genomic libraries, i.e. Bacterial Artificial Chromosome (BAC libraries, which are unbiased and representing deep haploid genome coverage, need to be ready in place. Result Five new BAC libraries were constructed for barley (Hordeum vulgare L. cultivar Morex. These libraries were constructed in different cloning sites (HindIII, EcoRI, MboI and BstXI of the respective vectors. In order to enhance unbiased genome representation and to minimize the number of gaps between BAC contigs, which are often due to uneven distribution of restriction sites, a mechanically sheared library was also generated. The new BAC libraries were fully characterized in depth by scrutinizing the major quality parameters such as average insert size, degree of contamination (plate wide, neighboring, and chloroplast, empty wells and off-scale clones (clones with 250 fragments. Additionally a set of gene-based probes were hybridized to high density BAC filters and showed that genome coverage of each library is between 2.4 and 6.6 X. Conclusion BAC libraries representing >20 haploid genomes are available as a new resource to the barley research community. Systematic utilization of these libraries in high-throughput BAC fingerprinting should allow developing a genome-wide physical map for the barley genome, which will be instrumental for map-based gene isolation and genome sequencing.

  11. Problemas da sociologia da arte

    OpenAIRE

    Bastide, Roger

    2006-01-01

    A partir de um balanço das realizações consideradas pelo autor como as mais relevantes no campo da sociologia da arte até o final dos anos de 1940, o texto propõe novos rumos para a disciplina, considerando o modo como a arte é socialmente produzida como linguagem e valor.

  12. Bioacumulación de arsénico en las etapas de desarrollo de la cebada maltera (Hordeum distichon L. Arsenic bioaccumulation in the stages of development of malt barley (Hordeum distichon L.

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    Full Text Available La contaminación por arsénico en aguas y suelos de Zimapán, Hidalgo, México; origina que la cebada maltera (Hordeum distichon L. acumule este elemento. El objetivo fue determinar los niveles de bioacumulación de arsénico en órganos y tejidos de cebada bajo condiciones controladas, en diferentes etapas de desarrollo de la planta. Se cultivó la cebada en 25 macetas, cinco por cada uno de cinco ensayos diferenciados, incluyendo controles negativos (suelo y agua no contaminados y positivos. Se utilizaron cinco semillas por macetas y se evaluó la acumulación de arsénico en cada uno de los órganos: raíz, tallo, hoja, espiga y grano, en cada una de las cinco etapas de desarrollo consideradas: formación del coleoptilo o aparición de la primera hoja; amacollamiento u hojas verdaderas a partir de la axila foliar; etapa de "encañado" o primer nudo separado del suelo donde aparecerán las primeras espigas, espigamiento y llenado de granos. Se utilizó un diseño experimental de bloques al azar con tres tratamientos: con arsénico, control positivo y control negativo. Se realizaron cinco réplicas por tratamiento. El cultivo presentó una elevada acumulación de arsénico en sus diferentes etapas de desarrollo, directamente proporcional al tiempo de exposición. La raíz presentó la más alta concentración de arsénico acumulada (100 y 300 mg kg-1, seguida por las hojas (80 a 180 mg kg-1 y el tallo (70 a 110 mg kg-1. El nivel de acumulación de arsénico en granos resultó entre 40-90 mg kg-1, que de acuerdo a normas argentinas, pueden considerarse como altamente contaminados. En índice de bioacumulación (IBA, las hojas presentaron los valores más altos, clasificando como niveles medios (0.1-1 para plantas verdes. Este índice se utilizó como indicativo para estimar niveles de contaminación por arsénico en suelos. En el tallo se presentaron los mayores valores de IBA; por lo tanto, este órgano sirvió como indicador específico del

  13. Population-genetic analysis of HvABCG31 promoter sequence in wild barley (Hordeum vulgare ssp. spontaneum

    Directory of Open Access Journals (Sweden)

    Ma Xiaoying

    2012-09-01

    Full Text Available Abstract Background The cuticle is an important adaptive structure whose origin played a crucial role in the transition of plants from aqueous to terrestrial conditions. HvABCG31/Eibi1 is an ABCG transporter gene, involved in cuticle formation that was recently identified in wild barley (Hordeum vulgare ssp. spontaneum. To study the genetic variation of HvABCG31 in different habitats, its 2 kb promoter region was sequenced from 112 wild barley accessions collected from five natural populations from southern and northern Israel. The sites included three mesic and two xeric habitats, and differed in annual rainfall, soil type, and soil water capacity. Results Phylogenetic analysis of the aligned HvABCG31 promoter sequences clustered the majority of accessions (69 out of 71 from the three northern mesic populations into one cluster, while all 21 accessions from the Dead Sea area, a xeric southern population, and two isolated accessions (one from a xeric population at Mitzpe Ramon and one from the xeric ‘African Slope’ of “Evolution Canyon” formed the second cluster. The southern arid populations included six haplotypes, but they differed from the consensus sequence at a large number of positions, while the northern mesic populations included 15 haplotypes that were, on average, more similar to the consensus sequence. Most of the haplotypes (20 of 22 were unique to a population. Interestingly, higher genetic variation occurred within populations (54.2% than among populations (45.8%. Analysis of the promoter region detected a large number of transcription factor binding sites: 121–128 and 121–134 sites in the two southern arid populations, and 123–128,125–128, and 123–125 sites in the three northern mesic populations. Three types of TFBSs were significantly enriched: those related to GA (gibberellin, Dof (DNA binding with one finger, and light. Conclusions Drought stress and adaptive natural selection may have been important

  14. Evaluation of phytotoxicity effect of olive mill wastewater treated by different technologies on seed germination of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad

    2015-06-01

    Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if

  15. Development of T. aestivum L.-H. californicum alien chromosome lines and assignment of homoeologous groups of Hordeum californicum chromosomes.

    Science.gov (United States)

    Fang, Yuhui; Yuan, Jingya; Wang, Zhangjun; Wang, Haiyan; Xiao, Jin; Yang, Zhixi; Zhang, Ruiqi; Qi, Zengjun; Xu, Weigang; Hu, Lin; Wang, Xiu-E

    2014-08-20

    Hordeum californicum (2n = 2x = 14, HH) is resistant to several wheat diseases and tolerant to lower nitrogen. In this study, a molecular karyotype of H. californicum chromosomes in the Triticum aestivum L. cv. Chinese Spring (CS)-H. californicum amphidiploid (2n = 6x = 56, AABBDDHH) was established. By genomic in situ hybridization (GISH) and multicolor fluorescent in situ hybridization (FISH) using repetitive DNA clones (pTa71, pTa794 and pSc119.2) as probes, the H. californicum chromosomes could be differentiated from each other and from the wheat chromosomes unequivocally. Based on molecular karyotype and marker analyses, 12 wheat-alien chromosome lines, including four disomic addition lines (DAH1, DAH3, DAH5 and DAH6), five telosomic addition lines (MtH7L, MtH1S, MtH1L, DtH6S and DtH6L), one multiple addition line involving H. californicum chromosome H2, one disomic substitution line (DSH4) and one translocation line (TH7S/1BL), were identified from the progenies derived from the crosses of CS-H. californicum amphidiploid with common wheat varieties. A total of 482 EST (expressed sequence tag) or SSR (simple sequence repeat) markers specific for individual H. californicum chromosomes were identified, and 47, 50, 45, 49, 21, 51 and 40 markers were assigned to chromosomes H1, H2, H3, H4, H5, H6 and H7, respectively. According to the chromosome allocation of these markers, chromosomes H2, H3, H4, H5, and H7 of H. californicum have relationship with wheat homoeologous groups 5, 2, 6, 3, and 1, and hence could be designated as 5H(c), 2H(c), 6H(c), 3H(c) and 1H(c), respectively. The chromosomes H1 and H6 were designated as 7H(c) and 4H(c), respectively, by referring to SSR markers located on rye chromosomes.

  16. Cell-type-specific H+-ATPase activity in root tissues enables K+ retention and mediates acclimation of barley (Hordeum vulgare) to salinity stress

    DEFF Research Database (Denmark)

    Shabala, Lana; Zhang, Jingyi; Pottosin, Igor

    2016-01-01

    While the importance of cell type specificity in plant adaptive responses is widely accepted, only a limited number of studies have addressed this issue at the functional level. We have combined electrophysiological, imaging, and biochemical techniques to reveal the physiological mechanisms...... compared with the mature zone, mature root cells accumulated more cytosolic and vacuolar Na(+), suggesting that the higher sensitivity of apical cells to salt is not related to either enhanced Na(+) exclusion or sequestration inside the root. Rather, the above differential sensitivity between the two zones...... conferring higher sensitivity of apical root cells to salinity in barley (Hordeum vulgare). We show that salinity application to the root apex arrests root growth in a highly tissue- and treatment-specific manner. Although salinity-induced transient net Na(+) uptake was about 4-fold higher in the root apex...

  17. Use of Co speciation and soil properties to explain variation in Co toxicity to root growth of barley (Hordeum vulgare L.) in different soils.

    Science.gov (United States)

    Micó, C; Li, H F; Zhao, F J; McGrath, S P

    2008-12-01

    The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl2. Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC50) ranged from 45 to 863 mg kg(-1), representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co2+ activity in soil solution. The EC50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC50 values based on soil added Co.

  18. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H spontaneum cross in a Mediterranean environment

    DEFF Research Database (Denmark)

    Grando, S.; Baum, M.; Ceccarelli, S.;

    2005-01-01

    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore......, difficult to improve with empirical breeding. The objective of this study was to identify molecular markers to facilitate the improvement of straw quality in barley. For this purpose, we have used the genetic linkage map that was already developed for recombinant inbred lines (RILs) of the cross between...... a Hordeum vulgare cultivar (`Arta') and a H. spontaneum line (H. spontaneum 41-1), covering a total of 890 cM. Straw parameters from RILs grown at Tel Hadya and Breda (ICARDA's research stations) in 2 years (1996/1997 and 1997/1998) were analyzed by NIRS for predicted nutritional characteristics including...

  19. Sazonalidade e potencial energético da biomassa residual agrícola na região dos Campos Gerais do Paraná

    Directory of Open Access Journals (Sweden)

    Letícia de Pierri

    2016-04-01

    Full Text Available RESUMO Teve-se por objetivo, neste trabalho, avaliar as disponibilidades sazonal e espacial da biomassa residual da colheita das principais culturas de grãos, na região dos Campos Gerais, PR, estimar o potencial teórico de produção de energia elétrica a partir desses resíduos, bem como identificar os municípios da região com maior potencial para instalação de termelétricas movidas a biomassa. Dados de produtividade de milho, soja, trigo, cevada, aveia branca e aveia preta foram obtidos, na Secretaria de Agricultura do Paraná, para as safras 2008/2009 e 2009/2010 e, a partir do índice e do calendário de colheitas, estimou-se a produção e sazonalidade da biomassa residual das culturas analisadas. Foram coletadas amostras de biomassa destas espécies e determinou-se o poder calorífico superior (PCS e o potencial teórico de produção de energia elétrica a partir dos resíduos quantificados. Os Campos Gerais do Paraná produziram 3.862.130 (2008/2009 e 4.107.932 Mg ha−1 (2009/2010 de biomassa residual total com o cultivo das seis culturas. A disponibilidade de biomassa concentra-se em março e abril (aproximadamente 60%, sendo inexpressiva em dezembro, janeiro e entre junho e agosto. A biomassa residual da colheita de grãos apresentou PCS comparável ao de espécies florestais e potencial total de produção de energia de 3.932 (2008/2009 e 4.185 GWh ano−1 (2009/2010. Dos municípios analisados, Tibagi e Castro são os mais promissores para a instalação de termelétricas movidas a biomassa, por apresentarem maior produção e melhor distribuição sazonal dos resíduos.

  20. A laser ablation ICP-MS based method for multiplexed immunoblot analysis: applications to manganese-dependent protein dynamics of photosystem II in barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager

    2015-01-01

    developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...

  1. Effect of gamma radiation on the inactivation of aflatoxin B1 in food and feed crops Efeito da radiação gama na inativação de aflatoxina B1 em alimentos e ração

    Directory of Open Access Journals (Sweden)

    I. Ghanem

    2008-12-01

    Full Text Available Samples of food crops (peanut, peeled pistachio, unpeeled pistachio, rice, and corn and feed (barley, bran, corn were autoclave-sterilized, and inoculated with 10(6 of spore suspension of an isolate of Aspergillus flavus fungus known to produce aflatoxin B1 (AFB1 . Following a 10-day period of incubation at 27 C to allow for fungal growth, food and feed samples were irradiated with gamma radiation at the doses 4, 6, and 10 kGy. Results indicated that degradation of AFB1 was positively correlated with the increase in the applied dose of gamma ray for each tested sample. At a dose of 10 kGy percentages of AFB1 degradation reached highest values at 58.6, 68.8, 84.6, 81.1 and 87.8% for peanuts, peeled pistachios, unpeeled pistachios, corn and rice samples, respectively. In feed samples percentages of AFB1 degradation were 45, 66, and 90% in barley, 47, 75, and 86% in bran, and 31, 72, and 84% in corn for the doses of 4, 6, and 10 kGy, respectively. AFB1 degradation in food samples correlated negatively with oil content in irradiated samples. Thus, in peanuts, which contained the highest oil content, percentage of AFB1 degradation at 10 kGy was not more than 56.6%, whereas, the corresponding value in corn, which contained the lowest oil content, reached as high as 80%. The above results indicate the possibility of using gamma radiation as a means of degradation of AFB1 in food and feed crops to levels lower than the maximum allowed levels.Amostras de alimentos (amendoim, pistache descascada, pistache com casca, arroz e milho e de ração (cevada, farelo de trigo e milho foram esterilizadas por autoclavação e inoculadas com uma suspensão de esporos (10(6 de um isolado de Aspergillus flavus produtor de aflatoxina B1 (AFB1. Após incubação por 10 dias a 27ºC para multiplicação do fungo, as amostras foram irradiadas com radiação gama nas doses de 4, 6 e 10 kGy. Os resultados indicaram que a degradação da AFB1 correlacionou-se positivamente

  2. Low-resolution structure of the full-length barley (Hordeum vulgare SGT1 protein in solution, obtained using small-angle X-ray scattering.

    Directory of Open Access Journals (Sweden)

    Michał Taube

    Full Text Available SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR, the CHORD- and SGT1-containing domain (CS, and the SGT1-specific domain (SGS, and two less conserved variable regions (VR1 and VR2. In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed.

  3. Interactive effects of salinity and phosphorus availability on growth, water relations, nutritional status and photosynthetic activity of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Talbi Zribi, O; Abdelly, C; Debez, A

    2011-11-01

    The interactive effects of salinity and phosphorus availability on growth, water relations, nutritional status and photosynthetic activity were investigated in barley (Hordeum vulgare L. cv. Manel). Seedlings were grown hydroponically under low or sufficient phosphorus (P) supply (5 or 180 μmol KH(2) PO(4) plant(-1) week(-1) , respectively), with or without 100 mm NaCl. Phosphorus deficiency or salinity significantly decreased whole plant growth, leaf water content, leaf osmotic potential and gas exchange parameters, with a more marked impact of P stress. The effect of both stresses was not additive since the response of plants to combined salinity and P deficiency was similar to that of plants grown under P deficiency alone. In addition, salt-treated plants exposed to P deficiency showed higher salt tolerance compared to plants grown with sufficient P supply. This was related to plant ability to significantly increase root:shoot DW ratio, root length, K(+)/Na(+) ratio, leaf proline and soluble sugar concentrations and total non-enzymatic antioxidant capacity, together with restricting Na(+) accumulation in the upper leaves. As a whole, our results indicate that under concomitant exposure to both salt and P deficiency, the impact of the latter constraint is pre-dominant.

  4. Identifying inflorescence phytoliths from selected species of wheat (Triticum monococcum, T. dicoccon, T. dicoccoides, and T. aestivum) and barley (Hordeum vulgare and H. spontaneum) (Gramineae).

    Science.gov (United States)

    Ball, T B; Gardner, J S; Anderson, N

    1999-11-01

    Analysis of microfossil silica phytoliths is becoming an increasingly important research tool for taxonomists, archaeobotanists, and paleoecologists. Expanded use of phytolith analysis by researchers is dependent upon development of phytolith systematics. In this study phytoliths produced by the inflorescence bracts from four species of wheat, Triticum monoccocum, T. dicoccon, T. dicoccoides, and T. aestivum, and two species of barley, Hordeum vulgare, and H. spontaneum, were analyzed using computer-assisted image and statistical analysis with the intent to develop taxonomic tools to distinguish among the taxa. A classification key based on significant differences among the mean morphometries of the inflorescence phytoliths produced by each species was created and tested. Discriminant analysis of the morphometries of several morphotypes of phytoliths was also conducted to determine whether this computer-assisted statistical procedure could be used as another method to classify the taxa and to determine which morphotypes have measurements that can best be used in discriminant functions. Test results indicated that, at the genus level, both the classification key and discriminant analysis of certain morphotypes of phytoliths were relatively reliable tools for distinguishing among phytoliths produced in the inflorescence bracts of the taxa considered. For distinguishing among the taxa at the species level, the classification key was most reliable. Of the discriminant analyses tested, that based on all the phytolith morphotypes combined was more reliable than those based on only one morphotype.

  5. [Cold induced cDNA library construction of highland barley (Hordeum vulgare L. var. nudum Hk. f.) using suppression subtractive hybridization technology].

    Science.gov (United States)

    He, Tao; Jia, Jing Fen

    2008-12-01

    Cold-induced genes of highland barley (Hordeum vulgare L. var. nudum Hk. f.) were studied using suppression subtractive hybridization (SSH) technique. The cDNA from the materials treated with 4 degrees C was used as "tester", and that from the materials growing in green house (20+/-2 degrees C) as "driver". A subtractive library of highland barley including 640 cDNA clones was constructed in this study. Enzyme digestion of 32 clones chosen randomly from the library indicated that 87.5% of them contained inserts. The cDNA inserts of 16 clones were sequenced. Blast search analyses showed that these cDNAs were homologies to genes encoding the following proteins: metallothionein, protein kinase, ethylene signal transcription factor, bZIP transcription factor, zing finger transcription factor, ribulose-1,5-bisphosphate carboxylase, ribosomal protein, sodium: hydrogen antiporter, catalase, NADPH-cytochrome reductase, ascorbate peroxidase, DNA binding protein, and sugar transporter-like protein. These results indicated that the cDNA clones in the library were related to cold-induced genes, and suggested that the cold-tolerant mechanism of highland barley might be a complicated, interactive system involving multiple approaches and genes. Construction of subtractive cDNA library provided an advantage for further studies to isolate and clone cold-induced genes in highland barley.

  6. The Effect of Homoeologous Meiotic Pairing in Tetraploid Hordeum bulbosum L. × H. vulgare L. Hybrids on Alien Introgressions in Offspring.

    Science.gov (United States)

    Scholz, Margret; Pendinen, Galina

    2016-01-01

    The pairing behaviour of the individual chromosome arms of Hordeum vulgare (Hv) with their homoeologous arms of H. bulbosum (Hb) at metaphase I of meiosis in tetraploid Hb × Hv hybrids and the frequencies of recombined Hv chromosome arms in selfed offspring were studied on differentially visualized chromosomes after fluorescent in situ hybridisation. The frequencies of paired Hv-Hb arms in the F2 and F3 hybrids were correlated with the frequencies of recombined Hv chromosomes in progenies. Self-generation of hybrids, the number of Hv and Hb chromosomes, and the number of recombined Hv chromosomes of the hybrids strongly influenced the Hv-Hb pairing frequency in meiosis. Within the offspring of F2 and F3 hybrids both Hv plants and hybrids were detected. In contrast, all progenies of the F4 hybrid were hybrids which exhibited centromere misdivisions. The highest frequencies of homoeologous pairing in hybrids and most recombinants were obtained for the barley chromosome 1HL. Recombinants for 4HL, 5HS, 6HS, and 7HS were rarely found. Meiotic pairing and recombinants involving chromosome 1HS were never observed. The results of this study demonstrate that fertile tetraploid interspecific hybrids with a high intergenomic pairing at meiosis are valuable basic material for introgression breeding in barley.

  7. Effects of the Application of Different Concentrations of NaN3 for Different Times on the Morphological and Cytogenetic Characteristics of Barley (Hordeum vulgare L.) Seedlings

    Institute of Scientific and Technical Information of China (English)

    Ali Irfan ILBAS; Yasemin EROGLU; Halil Erhan EROGLU

    2005-01-01

    Sodium azide (NaN3) has been used in many biological studies as a mutagen. In the present study, the morphological and cytogenetic effects of NaN3 on barley (Hordeum vulgare L.) seedlings were investigated. Seeds of barley were treated with different concentrations of NaN3 (0.5, 1.0, 1.5, 2.0, 2.5, and3.0 mmol/L) and applied for different periods of time (3 and 4 h). Parameters investigated, except for the mitotic index, were determined on Days 7 and 14. Increasing concentrations of NaN3 affected germination rates on Days 7 and 14 following application for 3 and 4 h. Although the length of the roots and leaves was affected by treatment with NaN3 on Day 14 of the germination period, coleoptile length was affected by NaN3 treatment on Day 7. Increasing concentrations of NaN3 and increased treatment period decreased the mitotic index compared with the untreated control. The inhibitory effects of NaN3 on the mitotic index indicate that NaN3 can have genotoxic and mutagenic effects on barley seedlings.

  8. Growth parameters and resistance against Drechslera teres of spring barley (Hordeum vulgare L. cv. Scarlett) grown at elevated ozone and carbon dioxide concentrations.

    Science.gov (United States)

    Plessl, M; Heller, W; Payer, H-D; Elstner, E F; Habermeyer, J; Heiser, I

    2005-11-01

    Spring barley ( Hordeum vulgare L. cv. Scarlett) was grown at two CO2 levels (400 vs. 700 ppm) combined with two ozone regimes (ambient vs. double ambient) in climate chambers for four weeks, beginning at seedling emergence. Elevated CO2 concentration significantly increased aboveground biomass, root biomass, and tiller number, whereas double ambient ozone significantly decreased these parameters. These ozone-induced reductions in growth parameters were strongly overridden by 700 ppm CO2. The elevated CO2 level increased C : N ratio of the leaf tissue and leaf starch content but decreased leaf protein levels. Exposure to double ambient ozone did not affect protein content and C : N ratio but dramatically increased leaf starch levels at 700 ppm CO2. Resistance against Drechslera teres (Sacc.) Shoemaker was increased in leaves grown at double ambient ozone but was less obvious at 700 ppm than at 400 ppm CO2. Constitutive activities of beta-1,3-glucanase and chitinase were significantly higher in leaves grown at double ambient ozone compared to ambient ozone levels. The sum of methanol-soluble and alkali-released cell wall-bound aromatic metabolites (i.e., C-glycosylflavones and several structurally unidentified metabolites) and lignin contents did not show any treatment-dependent differences.

  9. Chemometrics applied to the analysis of induced phytochelatins in Hordeum vulgare plants stressed with various toxic non-essential metals and metalloids.

    Science.gov (United States)

    Dago, Àngela; González, Inmaculada; Ariño, Cristina; Díaz-Cruz, José Manuel; Esteban, Miquel

    2014-01-01

    Hordeum vulgare plants were stressed with Hg, Cd and As and their phytotoxicity was evaluated in terms of growth inhibition and total metal uptake by the plant. The synthesised phytochelatins ((γ-Glu-Cys)n-Gly, n=2-5; PCs) were determined by HPLC with amperometric detection at a glassy carbon electrode. The results indicate that H. vulgare is a good phytostabilisation plant due to its capacity to accumulate heavy metals in roots. Cd and Hg are the most uptake toxic elements, being Cd the most potent inducer of PCs. The data obtained on the different PCs and related peptides induced by each heavy metal were used to perform a Principal Component Analysis (PCA) of the results as a function of the contaminating toxic element or its concentration level. The nature of the stressor element could be predicted from the pattern of PCs and related peptides identified by PCA. PCs were the most strongly induced peptides under Cd and Hg stress, whereas As only tended to synthesise small thiols such as glutathione and γ-glutamylcysteine, both precursors of PCs synthesis. This finding indicates that PCs are induced at different rates depending on the metal stressor used.

  10. Some characteristics of segregation in hybrids of Hordeum spontaneum C. Koch emend. Bacht. × H. vulgare (L.) emend. Vav. et Bacht.

    Science.gov (United States)

    Bakhteyev, F K

    1969-01-01

    The analysis of hybrid generations, that had arisen from crosses of various forms of H. spontaneum, as well as comparison of the results of crossing representatives of H. spontaneum with two and six-row forms of H. vulgare warrant the following statements: 1. When various morphological races of H. spontaneum were intercrossed, no morphologically new types arose among the progeny of hybrid generations as a result of these crosses. Various morphological hybrid groups, eight up to F 3, remained strictly within the variability of the system of the species Hordeum spontaneum C. Koch emend. Bacht. 2. When various morphological races of H. spontaneum were hybridized with two- and six-row forms of H. vulgare, marked dominance of characters of the wild parent were observed, nevertheless even in F 3 occasional hybrid individuals with a nonbrittle ear have been obtained. This fact is an evidence that cultivated barley may take part in the formation of such hybrids. In the fourth generation of the above interspecific crosses besides individuals which had inherited the characters of one or the other of the parents new morphological types arise. The latter are characterized by new combinations, inherited from both parents. In studies reported previously such casual hybrid individuals were provisionally named by us "sessiliproskowetzii". At first glance, the latter seemed not to differ from H. spontaneum v. proskowetzii, but more thorough observation showed that such hybrids differ from genuine individuals of v. proskowetzii: their sterile lateral spikelets are sessile, i.e. deprived of pedicels.

  11. Effect of different doses of post-emergence-applied iodosulfuron on weed control and grain yield of malt barley (Hordeum distichum L., under Mediterranean conditions

    Directory of Open Access Journals (Sweden)

    Barros José Calado

    2016-01-01

    Full Text Available A study was carried out over a two year period (2009/2010 and 2012/2013 on an experimental farm in the Alentejo region (Beja, in southern Portugal where rainfed malt barley (Hordeum distichum L. is sown at the end of autumn or beginning of winter (November- December. The aim of this experiment was to study the efficiency of the herbicide iodosulfuron-methyl-sodium to control post-emergence broadleaved weeds in this cereal crop. The malt barley crop was established using no-till farming. This technology provides the necessary machine bearing capacity of the soil to assure the post-emergence application of herbicides at two different weed development stages. The herbicide iodosulfuron-methyl-sodium was applied at three doses (5.0, 7.5, and 10.0 g a. i. · ha-1 and at two different broadleaved weed development stages (3 to 4 and 6 to 7 pairs of leaves, that also corresponded to two different crop development stages (beginning of tillering and complete tillering. The results indicated that early herbicide application timing provided a significantly higher efficiency for all the applied herbicide doses, but this better weed control was not reflected in a higher crop grain yield. The lack of a higher crop grain yield was probably due to a crop phytotoxicity of the herbicide, when used at an early application timing.

  12. 大麦(Hordeum vulgare)昼夜节律钟基因CCA1的克隆及表达分析%Cloning and Expression Analysis of Circadian Clock Gene CCA1 in Barley (Hordeum vulgare)

    Institute of Scientific and Technical Information of China (English)

    邢国芳; 宋萌; 姚涵; 韩渊怀

    2012-01-01

    CCA 1 gene plays an important role in circadian clock sensitivity in rice (Oryza sativa L. ) and Arabidopsis thaliana. In this study, CCAl gene in barley was cloned by RT-PCR using homological primers based on the highly conserved region of the multiple alignments of the rice and Arabidopsis. The similarities of this sequence were up to 72% and 69%, respectively, to corresponding mRNA sequences of rice and maize in BLASTx of GenBank database. Using ORF Finder software, a 2157 bp open reading frame was found to code 718 amino acids. Using Compute pI/Mw tool, the amino acid sequence was analyzed, and it revealed that the molecular weight of this protein was about 77 769. 4 Da, and isoelectric point was about 6. 55. We established fluorescence quantitative RT-PCR system with barley inbred lines HUADAMAI 1 and HUADAMAI 2, and studied the expression of CCAl in leaf under 16h/8h (light/ dark) conditions. Expression analysis showed that the gene expression peaked at dawn (ZTO) then gradually declined from ZTO to ZT15, bottomed at ZT15, then increased and returned to the initial level at ZT24. This study will provide information of barley CCAl gene for further studying the function in regulating photoperiod sensitivity in barley, and provide scientific basis for clarifying the mechanism of the circadian synchronization in barley.%昼夜节律钟基因CCA1在调解水稻和拟南芥的光周期反应中起着重要作用.利用BLAST手段以玉米中的CCA1基因序列作为靶序列,调取Genbank数据库信息,并结合RT-PCR方法获得了大麦的cDNA同源序列.BLASTx分析发现其与水稻和玉米的序列相似性分别达到72%和69%.通过ORF Finder软件分析发现,该序列包含一个2157 bp的开放阅读框,编码一个由718个氨基酸残基组成的蛋白序列,其分子量为77769.4 Da,等电点为6.55.采用实时荧光定量PCR分析发现,随光照时间的变化,该基因在大麦叶片中的表达量呈现出白天不断降低而夜晚逐渐

  13. Valor nutritivo da forragem de genótipos de cereais de inverno de duplo propósito Nutritive value of forage of genotypes of double purpose winter cereals

    Directory of Open Access Journals (Sweden)

    Gilmar Roberto Meinerz

    2011-06-01

    Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar o valor nutritivo da forragem de 12 genótipos de seis espécies de cereais de inverno de duplo propósito (forragem e grãos, submetidos ao corte, na região da Depressão Central do Rio Grande do Sul. As espécies e genótipos testados foram: trigo (BRS 277, BRS Guatambu, BRS Tarumã, BRS Umbu; aveia-preta (Agro Zebu, UPFA 21 - Moreninha e Comum; aveia-branca (UPF 18; centeio (BR 1 e BRS Serrano; Cevada (BRS Marciana e triticale (BRS 148.Os genótipos foram distribuídos em 36 parcelas experimentais, num delineamento experimental inteiramente casualizado, com 12 tratamentos e três repetições. As análises de valor nutritivo e composição mineral foram feitas pelo método da reflectância do infravermelho proximal (NIRS, em amostras do estrato superior a 10 cm de altura da forragem. Os genótipos de aveia e o trigo BRS Umbu apresentaram os melhores resultados de valor nutritivo. A composição mineral apresentou pequena variabilidade entre os genótipos testados. Os resultados demonstram que os cereais de inverno produzem forragem de elevado valor nutritivo.The objective of this research was to evaluate the nutritive value of the forage of 12 genotypes of six double purpose (forage and grains winter cereal species submitted to harvest in the region of Depressão Central in Rio Grande do Sul state. The species and genotypes tested were: wheat (BRS 277, BRS Guatambu, BRS Tarumã and BRS Umbu; black oat (Agro Zebu, UPFA 21 - Moreninha and Commom black-oat; white-oat (UPF 18; rye (BR 1 and BRS Serrano; barley (BRS Marciana; and triticale (BRS 148. The genotypes were distributed in 36 experimental plots in completely randomized experimental design, with 12 treatments and three replications. Analysis of nutritive value and mineral composition were performed by the near infrared spectroscopy (NIRS in samples of stratum greater than 10 cm height of forage. Oat genotypes and BRS Umbu wheat

  14. Zinc absorption from low phytic acid genotypes of maize (Zea mays L.), Barley (Hordeum vulgare L.), and Rice (Oryza sativa L.) assessed in a suckling rat pup model.

    Science.gov (United States)

    Lönnerdal, Bo; Mendoza, Concepcion; Brown, Kenneth H; Rutger, J Neil; Raboy, Victor

    2011-05-11

    Dietary phytic acid is a major causative factor for low Zn bioavailability in many cereal- and legume-based diets. The bioavailability of Zn in seed of low phytic acid (lpa) variants of maize ( Zea mays L.), rice ( Oryza sativa L.), and barley ( Hordeum vulgare L.) was evaluated using a suckling rat pup model. Suckling rat pups (14 days old, n = 6-8/treatment) were fasted for 6 h and intubated with (65)Zn-radiolabeled suspensions prepared using seed produced by either wild-type (normal phytic acid) or lpa genotypes of each cereal. Test solutions were radiolabeled overnight (all genotypes) or immediately prior to intubation (barley genotypes). Pups were killed 6 h postintubation and tissues removed and counted in a gamma counter. Zn absorption was low from wild-type genotypes of maize (21, 33%) and rice (26%), and phytic acid reduction resulted in significantly higher Zn absorption, 47-52 and 35-52%, respectively. Zn absorption from wild-type barley incubated overnight was high (86-91%), and phytate reduction did not improve Zn absorption (84-90%), which is likely due to endogenous phytase activity. When the wild-type barley solutions were prepared immediately before intubation, Zn absorption was significantly lower (63, 78%) than from the lpa cultivars (92, 96%). Variation in seed or flour phenolic acid levels did not affect Zn absorption. Differences in seed Zn levels did not substantially affect Zn absorption. Thus, when phytic acid is abundant in a diet, it has a larger effect on Zn absorption than the level of Zn. Therefore, reducing the phytic acid content of staple cereal grains may contribute to enhancing Zn nutrition of populations consuming these staple foods.

  15. An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

    Science.gov (United States)

    Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

    2013-03-01

    Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

  16. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

    Energy Technology Data Exchange (ETDEWEB)

    Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

    2008-02-01

    WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

  17. Evidence of phytotoxicity and genotoxicity in Hordeum vulgare L. exposed to CeO2 and TiO2 nanoparticles

    Directory of Open Access Journals (Sweden)

    Alessandro eMattiello

    2015-11-01

    Full Text Available Engineered nanoscale materials (ENMs are considered emerging contaminants since they are perceived as a potential threat to the environment and the human health. The reactions of living organisms when exposed to metal nanoparticles (NPs or NPs of different size are not well known. Very few studies on NPs-plant interactions have been published, so far. For this reason there is also great concern regarding the potential NPs impact to food safety. Early genotoxic and phytotoxic effects of cerium oxide nanoparticles (nCeO2 and titanium dioxide nanoparticles (nTiO2 were investigated in seedlings of Hordeum vulgare L.Caryopses were exposed to an aqueous dispersion of nCeO2 and nTiO2 at respectively 0, 500, 1000 and 2000 mg l-1 for 7 days. Genotoxicity was studied by Randomly Amplified Polymorphism DNA (RAPDs and mitotic index on root tip cells. Differences between treated and control plants were observed in RAPD banding patterns as well as at the chromosomal level with a reduction of cell divisions. At cellular level we monitored the oxidative stress of treated plants in terms of reactive oxygen species (ROS generation and ATP content. Again nCeO2 influenced clearly these two physiological parameters, while nTiO2 were ineffective. In particular, the dose 500 mg l-1 showed the highest increase regarding both ROS generation and ATP content; the phenomenon were detectable, at different extent, both at root and shoot level. Total Ce and Ti concentration in seedlings was detected by ICP-OES. TEM EDSX microanalysis demonstrated the presence of aggregates of nCeO2 and nTiO2 within root cells of barley. nCeO2 induced modifications in the chromatin aggregation mode in the nuclei of both root and shoot cells.

  18. Variabilidad espacial de la materia orgánica en un suelo dedicado al cultivo de cebada maltera (Hordeum distichum L.

    Directory of Open Access Journals (Sweden)

    Judith Prieto Méndez

    2014-01-01

    Full Text Available El contenido de materia orgánica (MO en suelos es una de las propiedades de mayor interés debido a su papel en la estructura y a su reconocida influencia en la dinámica de solutos. Su caracterización es por tanto, un aspecto de gran interés. Los contenidos de MO en suelos dedicados al cultivo de cebada maltera ( Hordeum distichum L. son relativamente bajos, por lo que la incertidumbre y posibles errores del método analítico pueden condicionar estudios de variabilidad espacial. En este trabajo se elaboró y validó un método de análisis de la MO de acuerdo con los criterios de la Norma ISO-17025 y se diseñó un control de calidad, incluyendo un estudio de la variabilidad que la metodología introduce en los resultados. Con la metodología desarrollada se ha llevado a cabo un muestreo previo y un muestreo final de 39 y 248 muestras representativas de una parcela dedicada al cultivo de cebada maltera del municipio de Apan, al sur del estado de Hidalgo, México, cuyo fin fue evaluar el número de muestras necesarias que han de tomarse para caracterizar este suelo y esta propiedad (MO. El trabajo se completó con un estudio geoestadístico de los valores de MO, con lo que pueden extraerse conclusiones para planes de muestreo futuros, desarrollo de modelos de simulación a escala de campo y aplicación práctica de problemas de fertilización.

  19. Effect of salinity stress on chlorophyll content, proline, water soluble carbohydrate, germination, growth and dry weight of three seedling barley (Hordeum vulgare L. cultivars

    Directory of Open Access Journals (Sweden)

    Movafegh S.

    2012-11-01

    Full Text Available Salinity is a serious environmental constraint to crop production in many parts of the world and the development of crops with improved salt tolerance is proposed as part of solution to this problem. This research was performed out in order to study the effects of different salinity levels on germination, growth, dry weight, proline, water soluble carbohydrate and chlorophyll content of three barley (Hordeum vulgare L. cultivars named Jonoob (INC-54, Reyhan (INC-45 & Nosrat (INC -47.The experiment was carried out using factorial based on completely randomized design with three replications.Seven old seedlings after germination were transferred to Hoagland nutrient solution under the effect of salinity levels (0, 50, 150 and 250 mM NaClin during seven days. Data variance analysis showed that seed germination of three barley cultivars was significantly (PReyhan>Nosrat. The results showed that, increasing in salinity decreased all growth parameters. Salinity stress decreased shoot and root length, root dry weight and chlorophyll contents in every three cultivars. But decreasing of chlorophyll was less in Nosrat compared to two other items. Proline content and soluble carbohydrate were increased in all of the three cultivars with enhance of NaCl concentration. By increasing of salinity stress accumulation of proline and soluble sugar content in leaves of Nosrat cultivar was more than other cultivars.As saltiness increases resistance natural responses in this plant gets better considering less decrease in chlorophyll amount and strategy of more production about praline and sugar solution compared to two other items.

  20. Transgenic barley (Hordeum vulgare L.) expressing the wheat aluminium resistance gene (TaALMT1) shows enhanced phosphorus nutrition and grain production when grown on an acid soil.

    Science.gov (United States)

    Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E

    2009-06-01

    Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.

  1. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H. spontaneum cross in a Mediterranean environment.

    Science.gov (United States)

    Grando, S; Baum, M; Ceccarelli, S; Goodchild, A; El-Haramein, F Jaby; Jahoor, A; Backes, G

    2005-02-01

    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore, difficult to improve with empirical breeding. The objective of this study was to identify molecular markers to facilitate the improvement of straw quality in barley. For this purpose, we have used the genetic linkage map that was already developed for recombinant inbred lines (RILs) of the cross between a Hordeum vulgare cultivar ('Arta') and a H. spontaneum line (H. spontaneum 41-1), covering a total of 890 cM. Straw parameters from RILs grown at Tel Hadya and Breda (ICARDA's research stations) in 2 years (1996/1997 and 1997/1998) were analyzed by NIRS for predicted nutritional characteristics including neutral detergent fiber, acid detergent fiber, lignin, digestible organic matter in dry matter, voluntary intake, crude protein, and straw morphology (the percentage of blades, sheaths, and stems). Localization of QTLs was performed using Windows QTL Cartographer, version 2.0. Seventy-three QTLs were identified, the majority of which (17) in the driest of the four environments. Only six QTLs were identified in two environments; in five cases, one of the two was the wettest environment. This is discussed in relation to the possibility of improving straw quality in favorable environments where yields are higher, rather than in dry environments where straw quality is already relatively good.

  2. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare WRKY transcription factor family reveals putatively retained functions between monocots and dicots

    Directory of Open Access Journals (Sweden)

    Jansson Christer

    2008-04-01

    Full Text Available Abstract Background WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare, three different WRKY proteins have been characterized so far as regulators in sucrose signaling, pathogen defense, and in response to cold and drought. However, their phylogenetic relationship remained unresolved. Results In this study, we used available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY genes. According to their structural features, the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. Conclusion HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in monocot and dicot species.

  3. Comparative effect of salinity on ion accumulation, grain yield and stability salt tolerance degree of barley (Hordeum vulgare L. in different growth stage

    Directory of Open Access Journals (Sweden)

    Abdennaceur Ben Khaled

    2016-12-01

    Full Text Available In arid and semi-arid regions of the world, excess salts in agricultural land can limit crop production. Barley (Hordeum vulgare L. is one of the most salt tolerant crop species. This study was conducted to determine the effects of salinity on seed germination, mineral content and yield production of 14 barley accessions from two regions in the Southern Tunisia. First experiment was conducted in laboratory to test the effect of nine levels of NaCl concentrations in different germination parameter. Second experiments were conducted in a greenhouse. The accessions were grown in soil and exposed to three salinity levels. Salinity decreased significantly the germination rate and the germination rate index for all accessions. Na+ content, total dry matter and grain yield vary significantly with increasing salinity levels. The degree of tolerance varies between accessions in the different growth stage. A significant correlation were observed between ranking using grain yield and multivariate parameter. The tolerance degree based in germination rate and Na+ content don’t present significant correlation with yield ranking. Therefore, ranking using multivariate parameter can be the appropriate method to analysis the tolerance degree of barley under saline conditions. The differences response between accessions of local population of barley “Ardhaoui” reflected an important internal genetic variability against the salinity. This variability could be more explored and used for the barley breeding program. The accessions Ettalah, Chneni Tatouine and Elhezma showed more salt tolerance at 13 dS/m as indicated by the multivariate ranking using germination rate, Na+ content and grain yield.

  4. Quantitative trait loci for water-use efficiency in barley (Hordeum vulgare L.) measured by carbon isotope discrimination under rain-fed conditions on the Canadian Prairies.

    Science.gov (United States)

    Chen, Jing; Chang, Scott X; Anyia, Anthony O

    2012-06-01

    Barley (Hordeum vulgare L.) yield is commonly limited by low rainfall and high temperature during the growing season on the Canadian Prairies. Empirical knowledge suggests that carbon isotope discrimination (Δ(13)C), through its negative relationship with water-use efficiency (WUE), is a good index for selecting stable yielding crops in some rain-fed environments. Identification of quantitative trait loci (QTL) and linked markers for Δ(13)C will enhance its use efficiency in breeding programs. In the present study, two barley populations (W89001002003 × I60049 or W × I, six-row type, and Merit × H93174006 or M × H, two-row type), containing 200 and 127 recombinant inbred lines (RILs), were phenotyped for leaf Δ(13)C and agronomic traits under rain-fed environments in Alberta, Canada. A transgressive segregation pattern for leaf Δ(13)C was observed among RILs. The broad-sense heritability (H (2)) of leaf Δ(13)C was 0.8, and there was no significant interaction between genotype and environment for leaf Δ(13)C in the W × I RILs. A total of 12 QTL for leaf Δ(13)C were detected in the W × I RILs and 5 QTL in the M × H RILs. For the W × I RILs, a major QTL located on chromosome 3H near marker Bmag606 (9.3, 9.4 and 10.7 cM interval) was identified. This major QTL overlapped with several agronomic traits, with W89001002003 alleles favoring lower leaf Δ(13)C, increased plant height, and reduced leaf area index, grain yield, harvest index and days to maturity at this locus or loci. This major QTL and its associated marker, when validated, maybe useful in breeding programs aimed at improving WUE and yield stability of barley on the Canadian Prairies.

  5. The enzymology of alanine aminotransferase (AlaAT) isoforms from Hordeum vulgare and other organisms, and the HvAlaAT crystal structure.

    Science.gov (United States)

    Duff, Stephen M G; Rydel, Timothy J; McClerren, Amanda L; Zhang, Wenlan; Li, Jimmy Y; Sturman, Eric J; Halls, Coralie; Chen, Songyang; Zeng, Jiamin; Peng, Jiexin; Kretzler, Crystal N; Evdokimov, Artem

    2012-12-01

    In this paper we describe the expression, purification, kinetics and biophysical characterization of alanine aminotransferase (AlaAT) from the barley plant (Hordeum vulgare). This dimeric PLP-dependent enzyme is a pivotal element of several key metabolic pathways from nitrogen assimilation to carbon metabolism, and its introduction into transgenic plants results in increased yield. The enzyme exhibits a bi-bi ping-pong reaction mechanism with a K(m) for alanine, 2-oxoglutarate, glutamate and pyruvate of 3.8, 0.3, 0.8 and 0.2 mM, respectively. Barley AlaAT catalyzes the forward (alanine-forming) reaction with a k(cat) of 25.6 s(-1), the reverse (glutamate-forming) reaction with k(cat) of 12.1 s(-1) and an equilibrium constant of ~0.5. The enzyme is also able to utilize aspartate and oxaloacetate with ~10% efficiency as compared to the native substrates, which makes it much more specific than related bacterial/archaeal enzymes (that also have lower K(m) values). We have crystallized barley AlaAT in complex with PLP and l-cycloserine and solved the structure of this complex at 2.7 Å resolution. This is the first example of a plant AlaAT structure, and it reveals a canonical aminotransferase fold similar to structures of the Thermotoga maritima, Pyrococcus furiosus, and human enzymes. This structure bridges our structural understanding of AlaAT mechanism between three kingdoms of life and allows us to shed some light on the specifics of the catalysis performed by these proteins.

  6. Transformation of isolated barley (Hordeum vulgare L.) microspores: I. the influence of pretreatments and osmotic treatment on the time of DNA synthesis.

    Science.gov (United States)

    Shim, Youn-Seb; Pauls, K Peter; Kasha, Ken J

    2009-02-01

    The objective of this study was to determine when DNA synthesis occurred during pretreatments of cultured barley (Hordeum vulgare L.) microspores and during their preparation for particle bombardment. Based on this information, an investigation of the influence of cell cycle stage on the ability to obtain homozygous transgenic plants by particle bombardment will be presented in paper II of this series. It was hypothesized that the introduction of foreign genes at the G1 cell cycle stage in cultured uninucleate microspores would produce homozygous transgenic plants. Experiments were conducted with two different commonly used pretreatments to induce microspore embryogenesis: cold (4 degrees C) for 21days and cold plus 0.3 mol/L mannitol for 4 days. After pretreatment, the microspores were placed in a higher osmotic medium for 4 h prior to and for 18 h following bombardment. It was confirmed that during the cold plus mannitol pretreatment, there was no apparent change in the cell cycle stage, with the majority of the microspores remaining at the G1 stage. While in the cold for 21 days, the microspores progressed slowly through to G2, with a few progressing further into the mitosis and binucleate stages. Hourly DNA density measurements that were taken during the 4 h osmotic adjustment period following the cold plus mannitol pretreatment indicated that DNA synthesis began during this period at 25 degrees C, while at 4 degrees C, there was no apparent change in cell cycle stage or in DNA density. Thus, one might expect to find a higher frequency of homozygous doubled haploids by maintaining the temperature low during the 4 h osmotic adjustment period following the cold plus mannitol pretreatment than following the 21 day cold pretreatment. However, it is also not known what effect the temperatures during the whole high-osmotic treatments will have on the rate and time of incorporation of the transgene.

  7. Comparative kinetics and reciprocal inhibition of nitrate and nitrite uptake in roots of uninduced and induced barley (Hordeum vulgare L.) seedlings

    Science.gov (United States)

    Aslam, M.; Travis, R. L.; Huffaker, R. C.

    1992-01-01

    Nitrate and NO2- transport by roots of 8-day-old uninduced and induced intact barley (Hordeum vulgare L. var CM 72) seedlings were compared to kinetic patterns, reciprocal inhibition of the transport systems, and the effect of the inhibitor, p-hydroxymercuribenzoate. Net uptake of NO3- and NO2- was measured by following the depletion of the ions from the uptake solutions. The roots of uninduced seedlings possessed a low concentration, saturable, low Km, possibly a constitutive uptake system, and a linear system for both NO3- and NO2-. The low Km system followed Michaelis-Menten kinetics and approached saturation between 40 and 100 micromolar, whereas the linear system was detected between 100 and 500 micromolar. In roots of induced seedlings, rates for both NO3- and NO2- uptake followed Michaelis-Menten kinetics and approached saturation at about 200 micromolar. In induced roots, two kinetically identifiable transport systems were resolved for each anion. At the lower substrate concentrations, less than 10 micromolar, the apparent low Kms of NO3- and NO2- uptake were 7 and 9 micromolar, respectively, and were similar to those of the low Km system in uninduced roots. At substrate concentrations between 10 and 200 micromolar, the apparent high Km values of NO3- uptake ranged from 34 to 36 micromolar and of NO2- uptake ranged from 41 to 49 micromolar. A linear system was also found in induced seedlings at concentrations above 500 micromolar. Double reciprocal plots indicated that NO3- and NO2- inhibited the uptake of each other competitively in both uninduced and induced seedlings; however, Ki values showed that NO3- was a more effective inhibitor than NO2-. Nitrate and NO2- transport by both the low and high Km systems were greatly inhibited by p-hydroxymercuribenzoate, whereas the linear system was only slightly inhibited.

  8. An evaluation of the impact of the endophyte fungus Piriformospora indica on some traits of barley (Hordeum vulgare L. in drought stress

    Directory of Open Access Journals (Sweden)

    M. Ghabouli

    2016-05-01

    Full Text Available Microbial endophytes, which make one of the most important classes of soil microorganisms, induce genetic, physiological and ecological alterations in their host plant and thus increase its yield and enable its cultivation in saline or dry soils or in climates facing biotic and abiotic stresses. The endophyte fungus Piriformospora indica exhibits a high effect in plant growth and increased resistance against environmental tensions like drought and salinity, as well as against phytopathogens. This work was intended to study the potential of P. indica in enhancing growth and elevating drought resistance in barley (Hordeum vulgare L. during 2010. A greenhouse trial of completely randomized design with two fungal treatments (inoculated vs. non-inoculated and three drought levels (F.C., 50% F.C. and 25% F.C. with four repeats was conducted in greenhouse of Agricultural Biotechnology Research Institute (Isfahan. The results indicate that the fungus P. indica has accompanied biomass increments of both shoot and root parts in the inoculated plant compared to the control, as in inoculated plant, total shoot dry weight and root dry weight were increased by 39 and 46 percent, respectively. Also, in stress conditions RWC in inoculated plant was greater. In addition to the growth increasing activity, the effective role of the fungus in enhancing barley growth and yield under drought conditions (especially at the 25% F.C. level is evident. According to the results, and to the fact that the fungus can be cultured on artificial (host-plant-free growth medium, this fungus can be contemplated as making a growth stimulating agent and in producing biological fertilizer for use in crops; and it might take a significant role toward a sustainable agriculture. The application of this fungus can also be beneficial in increasing growth and production of crops such as barley and wheat under the dry conditions widely encountered in Iran.

  9. Chromosomal characterization of the three subgenomes in the polyploids of Hordeum murinum L.: new insight into the evolution of this complex.

    Directory of Open Access Journals (Sweden)

    Ángeles Cuadrado

    Full Text Available Hordeum murinum L. is a species complex composed of related taxa, including the subspecies glaucum, murinum and leporinum. However, the phylogenetic relationships between the different taxa and their cytotypes, and the origin of the polyploid forms, remain points of controversy. The present work reports a comparative karyotype analysis of seven accessions of the H. murinum complex representing all subspecies and cytotypes. The karyotypes were determined by examining the distribution of the repetitive Triticeae DNA sequences pTa71, pTa794, pSc119.2, pAs1 and pHch950, the simple sequence repeats (SSRs (AG10, (AAC5, (AAG5, (ACT5, (ATC5, and (CCCTAAA3 via in situ hybridization. The chromosomes of the three subgenomes involved in the polyploids were identified. All tetraploids of all subspecies shared the same two subgenomes (thus suggesting them to in fact belong to the same taxon, the result of hybridization between two diploid ancestors. One of the subgenomes present in all tetraploids of all subspecies was found to be very similar (though not identical to the chromosome complement of the diploid glaucum. The hexaploid form of leporinum came about through a cross between a tetraploid and a third diploid form. Exclusively bivalent associations among homologous chromosomes were observed when analyzing pollen mother cells of tetraploid taxa. In conclusion, the present results identify all the individual chromosomes within the H. murinum complex, reveal its genome structure and phylogeny, and explain the appearance of the different cytotypes. Three cryptic species are proposed according to ploidy level that may deserve full taxonomic recognition.

  10. APROVEITAMENTO, COMPOSIÇÃO NUTRICIONAL E ANTINUTRICIONAL DA FARINHA DE QUINOA (CHENOPODIUM QUINOA

    Directory of Open Access Journals (Sweden)

    Cristiane de Oliveira LOPES

    2010-06-01

    Full Text Available

    A quinoa é um pseudocereal originário dos Andes, cultivado há milênios e amplamente distribuído ao mundo. No Brasil, foi introduzido na década de 90 e, através de modifi cações genéticas, desenvolveu-se a variedade BRS Piabiru, adaptada para cultivos em solos brasileiros. Nutricionalmente, destaca-se em relação a muitos cereais, como o trigo, o milho e a cevada, por apresentar qualidade protéica comparável à caseína do leite e pela ausência de proteínas formadoras de glúten. Além disso, possui elevado teor de lisina, vitaminas (como tiamina, ribofl avina, niacina e piridoxina e minerais (como magnésio, zinco, cobre, ferro manganês e potássio. É essencial a realização de estudos dos nutrientes e antinutrientes da quinoa, de utilizá-la no preparo e desenvolvimento de receitas isentas de glúten. Diante disso, o presente estudo objetivou elaborar uma farinha de quinoa (FQ, caracterizar a sua composição nutricional e antinutricional, além de aproveitá-la na formulação de bolinhos fritos e avaliar sua aceitabilidade. Para a obtenção da farinha, os grãos de quinoa foram secos em estufa com circulação de ar forçada a 60-65oC, triturados e peneirados. A FQ foi submetida às avaliações da composição centesimal, de alguns minerais (potássio, cálcio, ferro e zinco e antinutricional (nitrato, ácido oxálico e inibidor de tripsina, sendo ainda formuladas e avaliadas a aceitabilidade de três preparações de bolinhos fritos com diferentes adições de FQ em escala hedônica de 5 pontos. Observou-se que a FQ destacou-se em proteínas, fi bras, cinzas, potássio, ferro, cálcio e zinco. Os valores (mg/100g dos antinutrientes encontrados na FQ foram de 63,26 para o nitrato, 380 para o ácido oxálico e 2,11UTI/mg para inibidor de tripsina, sendo considerados teores menores aos de outros alimentos vegetais comumente utilizados na alimentação humana. O bolinho de formulação com 12,61% de FQ

  11. Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants.

    Science.gov (United States)

    Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald

    2015-05-01

    Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on

  12. A Sintaxe da Janela

    Directory of Open Access Journals (Sweden)

    Luís Antônio Jorge

    1993-12-01

    Full Text Available A preocupação fundamenta! do trabalho é de caráter ontológico: esboçar o problema das significações apriorísticas e autônomas dos elementos que compõem a sintaxe arquitetônica. O trabalho elege um desses elementos: a janela. Este artigo parte da aproximação histórica entre a janela e a secção da pirâmide visual, construção imaginária da teoria da perspectiva renascentista. A consideração da janela na linguagem arquitetônica implica reconhecer uma ambigüidade essencial: a janela deve inserir-se ordenadamente no plano da parede - raciocínio típico da modenatura - mas também relacionar-se com a imagem vista através dela, que extrapola o plano, ressaltando a tridimensionalidade - herança da perspectiva renascentista, fundamentada no espaço euclidiano. Ver janela ou ver através da janela são alternativas que se colocam tanto ao observador interno ao edifício, quanto ao externo. Texto de duplaface, a sintaxe da janela versa sobre o relacionamento desses dois lados

  13. Influence of Straw Pulp Film Mulching on Water Conservation Effect of Hordeum vulgare Farmland in Tibet%西藏青稞农田草浆地膜覆盖的保水效果研究

    Institute of Scientific and Technical Information of China (English)

    关法春

    2012-01-01

    采用对比方法研究了草浆地膜覆盖对青稞(Hordeum vulgare)农田土壤的保水作用,以期明确草浆地膜的农田保水理论依据和保水效果.结果表明:草浆地膜覆盖下的土壤表面相对湿度、土壤紧实度和土壤含水量等指标均低于塑料地膜覆盖处理,其中土壤含水量指标显著低于后者(n=3,P<0.05);与对照相比,草浆地膜覆盖下0~5 cm土层内土壤紧实度显著降低,但土壤温度与对照相比相差不大,同时土壤表层水分散失明显减少,土壤含水量增加7.59%,达到显著差异水平(n=3,P<0.05).草浆地膜覆盖保水效果十分明显.%In order to offer theoretical basis and clarify practical effect, straw pulp film and plastic film were compared to investigate the effect of film mulches for water conservation of soil in Hordeum vulgare farmland. Plastic film, straw pulp film and CK treatment were administrated; the effect was compared by measuring relative humidity of soil surface, soil temperature, soil compaction and water content. The results showed that all four factors monitored were lower in the treatment of straw pulp film than the plastic film, among which water content of the former was significantly reduced than the latter(n=3, P<0.05). In the treatment of straw pulp film comparing to CK, soil compaction was significantly reduced(n=3, P<0.05), while no significant difference in soil temperature was shown between the two. The evaporation of soil moisture reduced dramatically in the treatment of straw pulp film, resulting in a 7.59% statistically significant increase in the water content of soil (n=3, P<0.05). In conclusion, the straw pulp film mulch has significantly improved the water conservation of the soil in Hordeum vulgare farmland.

  14. Genealogias da alegria

    Directory of Open Access Journals (Sweden)

    Bruno Vasconcelos de Almeid

    2009-08-01

    Full Text Available Genealogias da Alegria tem por objetivo rastrear conceitos e construir planos sobre os quais podemos pensar a alegria como campo problemático. Trata-se de traçar linhas e acoplar fragmentos históricos e literários com a finalidade de subsidiar a discussão contemporânea em torno da alegria. O procedimento genealógico vale-se de trechos das obras de Calímaco e Luciano de Samósata, da elegia erótica romana e da alegria cristã. O passo seguinte consiste em rastrear o pensamento da alegria na obra de Gilles Deleuze, especialmente em três momentos: uma passagem de Diferença e Repetição, um trecho dos Diálogos extraído de Da Superioridade da Literatura Anglo-americana e a comunicação Pensamento Nômade no Colóquio de Cerisy. A alegria não se define como sentimento ou emoção; ao contrário, está ligada à premissa de afirmação da vida e ao caráter trágico da existência.

  15. A sabedoria da democracia

    Directory of Open Access Journals (Sweden)

    Gilson Matilde Diana

    2010-01-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2010v9n1p131Durante a maior parte da história, a democracia foi desprezada como uma forma política inferior – a regra do povo, ou “dos muitos”, era logo identificada como a regra da ralé, da escória. Herdando do povo a volubilidade e a instabilidade, a democracia estava sempre perigosamente próxima do arbítrio e da anarquia, com toda a violência que se costuma associar a isso.

  16. Caracterización morfológica de almidones de los géneros Triticum y Hordeum en la Península Ibérica

    Directory of Open Access Journals (Sweden)

    López Sáez, José Antonio

    2012-12-01

    Full Text Available Starch grains are increasingly used in archaeobotanical studies as markers of diet, plant domestication, tool use and site organization in archaeological research, because their morphology and features provide a means to identify the plant that produced them. In this paper we characterize morphometrically the starch grains of five species of the genus Triticum and three varieties of Hordeum vulgare. In addition there is an assessment of the studies of starch grains made in the Prehistory of the Iberian Peninsula, indicating the achievements, the weaknesses and future directions to promote this type of bioarchaeological analysis; especially, there is a need to rely on wide reference collections, as well as apply statistical analyses and carry out experimental studies to control the processes of alteration of the starch grains.Los granos de almidón son cada vez más utilizados en los estudios arqueobotánicos como marcadores de la dieta, la domesticación de plantas, el uso de herramientas y la organización microespacial de los yacimientos arqueológicos, debido a que su morfología y características permiten identificar las plantas que los produjeron. En el presente trabajo se caracterizan morfométricamente los granos de almidón de cinco especies del género Triticum y tres variedades de Hordeum vulgare. Además se hace un balance de los estudios de almidones realizados en la Prehistoria de la Península Ibérica, señalando los logros, las debilidades y futuras directrices para potenciar este tipo de análisis bioarqueológico; especialmente la necesidad de contar con amplias colecciones de referencia, la aplicación de análisis estadísticos paralelos, y la realización de estudios experimentales para controlar los procesos de alteración de los almidones.

  17. Characterization of T. aestivum-H, californicum chromosome addition lines DA2H and MA5H

    Institute of Scientific and Technical Information of China (English)

    Fang Kong; Haiyan Wang; Aizhong Cao; Bi Qin; Jianhui Ji; Suling Wang; Xiu-E Wang

    2008-01-01

    In order to transfer useful genes of Hordeum californicum into common wheat (Triticum aestivum L.), the T. aestivum c.v. Chinese Spring (CS)-H. californicum amphiploid was crossed to CS, and its backcrossing and self-fertilized progenies were analyzed by morpho-logical observation, cytological, biochemical and molecular marker techniques. Alien addition lines with two H. californicum chromo-somes were identified and their genetic constitution was characterized. STS-PCR analysis using chromosome 2B specific markers indi-cated that chromosome H3 of 1t. califomicum belongs to homoeologous group 2, and was thus designated 2H. SDS-PAGE showed that chromosome H2 of H. californicum belongs to homoeologous group 5, and was designated 5H. The CS-H. californicum amphiploid and the chromosome addition lines (DA2H and MA5H) identified were evaluated for powdery mildew (Erysiphe graminis f. sp. triticii) resis-tance in field. The preliminary results indicated that the amphiploid showed higher powdery mildew resistance than CS. However, chro-mosome addition lines DA2H and MA5H were highly susceptible to powdery mildew, indicating that major powdery mildew resistant genes of H. californicum should be located on chromosomes other than 2H and 5H.

  18. Corporeidade da voz : estudo da vocalidade poetica

    OpenAIRE

    Fernando Manoel Aleixo

    2004-01-01

    Resumo: Este material é o resultado da investigação prática da voz realizada a partir do desenvolvimento do princípio da sabedoria sensível do corpo. O texto expõe as etapas percorridas no levantamento de experiências e reflexões pedagógicas sobre a voz do ator, no estabelecimento de referências sobre o corpo e o aprendizado sensível e, também, no processo de composição poética do espetáculo teatral Voz Mercê Abstract: This material springs from a practical investigative work on voice base...

  19. Modelagem da laringe: da biologia ao computador

    Directory of Open Access Journals (Sweden)

    Marcelo de Oliveira Rosa

    2016-01-01

    Full Text Available Neste trabalho apresentamos uma descrição daanatomia e fisiologia da laringe, enfatizando os aspectos relevantes à fonação. A partir destes aspectos, a modelagem da laringe é apresentada. O principal objetivo de modelara laringe é representar de uma maneira simples esse órgãoatravés de equações matemáticos intimamente relacionadoscom características fisiológicas. Equações aerodinâmicase viscoelásticas são simplificadas de acordo com as pesquisas,sempre buscando simplicidade e aplicabilidade computacional. Assim, pesquisadores podem compreender melhor a laringe e a fala humana em termos dos efeitos linguísticos, cirúrgicos e computacionais produzidos pelamovimentação desse órgão. Palavras-chave: Laringe, modelagem, sinal glotal,produção da fala.

  20. A ciclovia da morte

    OpenAIRE

    Gois, Ancelmo

    2016-01-01

    De acordo com levantamento da FGV/DAPP, houve mais de 36 mil menções ao desabamento no Twi er, até o fim da tarde de ontem, com palavras como "vergonha", "incompetência" e "culpa" em destaque, além de muitas criticas ao prefeito Eduardo Paes.

  1. Cartografia da paisagem alterada

    Directory of Open Access Journals (Sweden)

    Simone Cortezão

    2011-04-01

    Full Text Available O presente trabalho de pesquisa surge da investigação de paisagens alteradas, áreas pós-industriais e da geografia urbana que é conformada pela indústria. A preocupação principal é revê-las como espaço de investigação crítica sob o ponto de vista particular, integradas às noções da peculiar natureza industrial com suas consequentes transformações na paisagem, além das relações do indivíduo com esse novo meio produzido. “Cartografia da paisagem alterada” é uma pesquisa que indicia a paisagem alterada em pelo menos dois estratos: um que é o da construção da geografia da cidade pela indústria, e o outro que é a paisagem alterada subjetivamente, o que configura uma crítica e uma reação à conformação sócio geográfica em outros parâmetros - da proximidade, da experiência vivida e da construção de um vocabulário próprio.  A pesquisa teórica sobre áreas pós-industriais, associada a referências nas artes e arquitetura, constitui o primeiro estrato. Teorias e procedimentos artísticos de Robert Smithson, Joseph Beuys e Rem Koolhaas fornecem material para o segundo, mediante a pesquisa do cotidiano no lugar, a região do Vale do Aço, que se configura em um guia - glossário

  2. GERONTOLOGIA: ESTADO DA ARTE

    Directory of Open Access Journals (Sweden)

    Vera M.A.Tordino Brandão

    2010-02-01

    Full Text Available O Programa de Gerontologia da PUC desenvolve pesquisas focando o ser na perspectiva do envelhecimento. As atividades são interdisciplinares e reúnem docentes, alunos e ex-alunos. Nesta mesa redonda apresentamos um panorama sobre estes estudos. Na área da educação e comunicação o foco está centrado na longevidade e na preparação e representação social da velhice. São ressaltadas como temáticas: a formação continuada de profissionais e pesquisadores; o significado da religiosidade/espiritualidade ao longo da trajetória, e sua repercussão na qualidade de vida do idoso; os programas sócio-educacionais para idosos e concepções sobre educação; o monitoramento da mídia na cobertura da crescente longevidade e seus impactos. Em identidade e modos de morar reflete-se sobre soluções planejadas e sua adequação para a inclusão do envelhecimento populacional como questão fundamental, que implica a elaboração de novas políticas, investigações e, especialmente, apresenta-se como questão a ser analisada, refletida e vivenciada pela sociedade em geral. Quanto à saúde, o Programa desenvolve várias pesquisas numa abordagem interdisciplinar tendo como objetos de estudo: a terapia assistida com animais direcionada a idosos com diagnóstico de Alzheimer; o acompanhamento terapêutico e o atendimento psicoterapêutico em grupo, a aplicação da técnica de Calatonia em idosos moradores de ILPI, além da investigação sobre impasses clínicos no idoso frágil. Palavras-chave: gerontologia, longevidade, envelhecimento

  3. CONDICIONANTES DA COMPETITIVIDADE EMPRESARIAL

    Directory of Open Access Journals (Sweden)

    José Luiz Contador

    2010-03-01

    Full Text Available Este trabalho examina teoricamente os fatores determinantes da competitividade do produto e do negócio, imprescindíveis à elaboração de estratégias competitivas que visam à obtenção e sustentação de vantagens competitivas. Esse tema é objeto tanto da área de marketing estratégico quanto da de estratégia empresarial. Nas duas áreas, há um ponto de consenso que afirma que a empresa deve diferenciar sua oferta para conquistar e manter vantagem competitiva. Mas, os estudos conduzidos por meio do modelo de Campos e Armas da Competição revelaram que a empresa pode diferenciar seu produto e/ou serviço de modo mais amplo, levando em consideração, na formulação da sua estratégia competitiva, também o campo da competição, quer do produto, quer dela própria. Assim, o objetivo deste artigo é evidenciar que, para a empresa ser competitiva, além de diferenciar seu produto e/ou seu serviço no sentido tradicional, ela precisa: 1 diferenciar seu produto incluindo a definição em quais campos vai competir em cada segmento; e 2 escolher as armas da competição que irá utilizar e definir a intensidade de cada arma. Para atingir tal objetivo, foram necessários vários conceitos do modelo de Campos e Armas da Competição: campo da competição, arma da competição, tese do modelo, configuração dos campos da competição, campo coadjuvante, produto coadjuvante e par produto-mercado. Como uma proposta inovadora sempre desperta dúvida, é mostrado o processo de validação do modelo de Campos e Armas da Competição e são discutidas sua universalidade, consistência e completude.

  4. Purification and characterization of three chitinases and one beta-1,3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Kragh, K.M.; Jacobsen, S.; Dalgaard Mikkelsen, J.;

    1991-01-01

    chromatography. Two of the chitinases were identified as the previously described endochitinases T and C from barley grain. The third and novel chitinase, designated K, was the major basic chitinase in the medium constituting 4% of the soluble protein. Chitinase K was found to be a 33-kDa endochitinase with p...... chitinases from barley aleurone and barley, bean and potato leaves. The purified beta-1,3-glucanase with a molecular weight (MW) of 32 kDa and pI greater-than-or-equal-to 9.8 constituted 1% of the soluble protein in the medium. Based on similar MW, pI and amino acid composition as well as identical N...

  5. Het Italiaanse voorzetsel da

    NARCIS (Netherlands)

    Boer, M.G. de

    2010-01-01

    SAMENVATTING In een voorzetselstudie in het kader van Jackendoffs semantische theorie wordt het sterk polyseme Italiaanse voorzetsel da geanalyseerd als een verzameling deelbetekenissen waarbij de meeste door een of meer semantische regels afgeleid kunnen worden van de basisbetekenis ruimtelijke

  6. Het Italiaanse voorzetsel da

    NARCIS (Netherlands)

    Boer, M.G. de

    2010-01-01

    SAMENVATTING In een voorzetselstudie in het kader van Jackendoffs semantische theorie wordt het sterk polyseme Italiaanse voorzetsel da geanalyseerd als een verzameling deelbetekenissen waarbij de meeste door een of meer semantische regels afgeleid kunnen worden van de basisbetekenis ruimtelijke He

  7. ESPECTROS INFRAVERMELHOS DA CREATINA

    Directory of Open Access Journals (Sweden)

    Kumiko K. Sakane

    2011-08-01

    Full Text Available São apresentados espectros infravermelhos da creatina, na faixa de 4000 a 400 cm−1. Os resultados são comparados com espectros observados e calculados, publicados na literatura.

  8. Impacto ambiental da apicultura

    OpenAIRE

    1999-01-01

    A cultura da abelha doméstica Apis. mellifera L. ou apicultura é conhecida desde a antiguidade, sendo o mel uni alimento natural corrente entre os povos primitivos. Pinturas rupestres mostram que desde o neolítico o homem era atraído pelo mel, pois tentava recolher ninhos de abelhas selvagens e instalava-os em cavidades naturais das rochas, muito perto da sua habitação.

  9. Matéria seca de plantas de cobertura, produção de cebola e atributos químicos do solo em sistema plantio direto agroecológico Dry matter of cover crops, onion yield and soil chemical attributes in agroecological no-tillage system

    Directory of Open Access Journals (Sweden)

    Monique Souza

    2013-01-01

    Full Text Available O cultivo e a deposição de resíduos de plantas de cobertura em sistema plantio direto podem afetar os atributos químicos do solo e a produção de cebola. O trabalho objetivou avaliar a interferência do cultivo de plantas de cobertura sobre a produção de cebola e sobre os atributos químicos do solo em sistema plantio direto (SPD agroecológico. O experimento foi conduzido na EPAGRI, em Ituporanga (SC, em um Cambissolo Húmico, nas safras de 2010 e 2011. Em abril, foram implantados os tratamentos: testemunha com vegetação espontânea (T1; cevada (2010/aveia-preta (2011 (T2; centeio (T3; nabo-forrageiro (T4; centeio + nabo-forrageiro (T5; e cevada (2010/aveia-preta (2011 + nabo-forrageiro (T6. Aos 60, 80 e 95 dias após a semeadura (DAS das espécies de inverno, coletou-se a parte aérea das plantas e determinou-se a produção de matéria seca por hectare. Em julho, foram transplantadas mudas de cebola e, em novembro, avaliou-se a produção. Após o acamamento das plantas de cobertura de inverno e a colheita da cebola, foi coletado solo na camada de 0-10 cm e submetido à análise de atributos químicos. O cultivo e a deposição dos resíduos de matéria seca das espécies de plantas de cobertura em SPD contribuíram para o aumento e a manutenção da produção total de cebola ao longo dos anos. Os atributos químicos do solo, com exceção do K trocável, P disponível e valores de saturação da CTCpH7,0 por bases não foram afetados pelo cultivo de plantas de cobertura.The cultivation and deposition of waste from cover crops in no-tillage can affect soil chemical attributes and onion yield. The aim of this study was to evaluate the dry matter yield of plant species from winter cover crops, onion yield and chemical attributes of soil in agroecological no-tillage system. The experiment was carried out at EPAGRI Experimental Station in Ituporanga (SC under Humic Haplumbrept in the agricultural years of 2010 and 2011. The following

  10. Em defesa da semiodiversidade

    Directory of Open Access Journals (Sweden)

    Antônio Risério

    2008-11-01

    Full Text Available Semiodiversidade é um conceito que denomina a esfera da vida que se refere particularmente ao reino dos signos. Embora tenha sido criado no contexto das discussões sobre a biodiversidade, ele compreende um amplo campo que é quase desconhecido. Contrariamente à biodiversidade, não é um termo da moda, ainda que abarque um amploconjunto de problemas. As mais diferentes linguagens, signos e códigos culturais encontram lugar no domí­nio da semiodiversidade. Neste artigo a defesa da semiodiversidade é uma forma de preservar a vida humana neste momento da aventura do homem no planeta.Abstract: Semiodiversity is a concept to denominate the sphere of life that refers, particularly, to the realm of signs. Although it has been created in the context of biodiversity, it assigns a wider territory, which is almost unknown. Contrary to biodiversity, it is not a trendy' term, even though embeding a much wider scope. The most different languages, signs and cultural codes can be found in the domain of semiodiversity. In this article, the defense of semiodiversity is a way to preserve human life at this moment of humanadventure on Earth.

  11. da etiologia ao tratamento

    OpenAIRE

    Soares, Tânia Alexandra Maia

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária A luxação da articulação temporomandibular (ATM) ocorre quando o côndilo mandibular se desloca para fora da fossa mandibular e não é capaz de retornar. As manifestações clinicas mais frequentes desta patologia são: dificuldade de fechar a boca, depressão pré-auricular, sialorréia, tensão dos músculos da mastigação e dor severa na reg...

  12. Fundamentos da psicologia social

    OpenAIRE

    Kruger, Helmuth Ricardo

    1984-01-01

    O tema central deste estudo é o dos fundamentos da Psicologia Social. Neste sentido, foram examinados pressupostos ontológicos, epistemológicos, lógicos e axiológicos mas, também, as bases conceituais, teóricas e metodológicas deste setor da Psicologia contemporânea. A justificar este empreendimento, encontram-se duas suposições: a de que qualquer ciência é inexoravelmente construída sobre postulados metafísicos e lógicos, e a de que a falta de clareza em relação a estes impede a instalação d...

  13. DA LITERATURA AO PENSAMENTO

    Directory of Open Access Journals (Sweden)

    Gustavo Bernardo

    2012-07-01

    Full Text Available Apresento uma concepção pessoal do ensino de literatura, condensando a discussão das principais questões que o afetam: a singularidade da disciplina entre as demais disciplinas escolares; a crítica do realismo como valor dominante; a importância do exemplo; os efeitos da desvalorização salarial e moral do professor; a praga das adaptações literárias para jovens. A partir dessas questões, apresento cinco modos de leitura e ensino do texto literário, a saber: ler como resposta; ler como pergunta; a leitura ingênua; a leitura crítica; a leitura teórica. Concluo pela necessidade de proteção radical à dúvida, fundadora da literatura e do próprio pensamento.

  14. Medidas de rentabilidade da empresa

    OpenAIRE

    Mota, Haroldo Moura Vale

    2010-01-01

    Faz uma avaliação da medida de retorno contábil da corporação (return on investment - ROI) à luz da verdadeira medida de retorno econômico (taxa interna de retorno - TIR). Apresenta modelo para cálculo da taxa interna de retorno da empresa, o qual é submetido à testes para aferir o seu valor informativo. Utilizando o conceito de taxa interna de retorno da corporação, é criado um modelo denominado de Modelo de Avaliação Econômica Base Caixa, aplicável a uma empresa b...

  15. Da Vinci Linjen

    DEFF Research Database (Denmark)

    Nissen, Poul

    Afsluttende evalueringsrapport fra følgeforskningen gennem tre år i forbindelse med dety pædagogiske arbejde på Blåbjerggårdskolens Da Vinci Linje for skolemotiverede og underpræsterende elever på 7. til 9. klassetrin.......Afsluttende evalueringsrapport fra følgeforskningen gennem tre år i forbindelse med dety pædagogiske arbejde på Blåbjerggårdskolens Da Vinci Linje for skolemotiverede og underpræsterende elever på 7. til 9. klassetrin....

  16. GESTAO DA AGRICULTURA URBANA

    OpenAIRE

    2014-01-01

    Este artigo apresenta o conceito de agricultura urbana e sua contribuição para a integração da atividade agrícola com o ambiente urbano, incentivando o desenvolvimento de cidades sustentáveis. Analisa o grau de complexidade encontrado pelas autoridades ao criar e aplicar politicas pública onde os sistemas urbanos de suprimento de alimentos não são acessíveis a toda a população. Traz luz a algumas das questões diretamente relacionadas à implantação da agricultura em grandes centros urbanos, ta...

  17. Profilaxia da peste

    Directory of Open Access Journals (Sweden)

    Renato dos Santos Araújo

    1967-12-01

    Full Text Available O autor parte da premissa de que a profilaxia da doença infecciosa decorre do encadeamento epidemiológico: fonte de infecção-veículo transmissor - receptivel, para explicar a da peste, baseada no mesmo princípio. Depois de citar os 4 principais complexos epidemiológicos da peste e afirmar que tôda a profilaxia da doença consiste em atingir os dois primeiros elos dessas cadeias e proteger o último, passa a classificar os vários métodos profiláticos empregados em 2 grandes grupos: o das medidas destrutivas ou provisórias e o das medidas supressivas ou definitivas. Entre as primeiras arrola a desratização e a despulização, às quais acrescenta o tratamento e isolamento do doente e do portaãor, e entre as segundas inclui a anti-ratização e a imunização. A seguir, passa a explicar em que consistem essas várias medidas profiláticas e quais os agentes de que se tem lançado mão para executá-las, expendendo ao curso dessa exposição o conceito que formula a respeito de cada uma delas, à guisa de apreciação do seu valor relativo. Enaltece sobretudo as medidas supressivas ou definitivas, às quais empresta a maior significação na luta antipestosa, chamando a atenção, em especial, para a necessidade de estudos imunológicos para aperfeiçoamento do poder imunitário das vacinas de germes vivos avirulentos, que considera um grande recurso para a profilaxia da doença, sobretudo para a proteção do rurícola, cujo labor e modo de vida o expõem inevitavelmente a se infectar, por ocasião da ocorrência de epizootias de origem silvestre. Concluída essa primeira parte, passa a fazer o histórico de como se desenvolveu a campanha contra a peste, no Brasil, desde a época da sua invasão em 1899 pelo pôrto de Santos até os nossos dias. Nesse histórico, detem-se um pouco para expôr a atuação do extinto Serviço Nacional de Peste, o qual, criado em 1941, após a reorganização do Departamento Nacional de Saúde, passou

  18. O livro da alma

    Directory of Open Access Journals (Sweden)

    Oliver Tolle

    2016-12-01

    Full Text Available Trata-se de compreender os pressupostos da filosofia concreta pretendida por Johann Gottfried Herder (1744-1803 em uma série de textos redigidos durante as décadas de 1760-70. Se, por um lado, Herder demonstra afinidade com a mesma harmonia preestabelecida que está na base de leibnizianos como Gottsched e Baumgarten, por outro, ele aprofunda a discussão sobre a origem do conhecimento humano ao reduzir a importância de juízos de valor universal e acentuar a necessidade de uma aproximação constante das sensações que se agitam obscuramente no fundo da alma. Disso resulta uma concepção inusitada de sabedoria, a qual depende de uma renúncia à posse confortável de conhecimentos abstratos e da aceitação da natureza cambiante e apenas parcialmente perscrutável daquilo que nos move. Se com isso perde-se a certeza, abre-se em contrapartida uma dimensão essencialmente ativa e sensível de realização no mundo.

  19. O esvaziamento da cultura

    Directory of Open Access Journals (Sweden)

    Andressa Paula de Andrade

    2015-01-01

    Full Text Available Trata-se da resenha da obra "A civilização do espetáculo: uma radiografia do nosso tempo e da nossa cultura" de autoria de Mario Vargas Llosa, ganhador do Nobel de Literatura em 2010. O trabalho busca compreender este tempo em que a diversão assume maior relevância em detrimento da cultura profunda e reflexiva. Destarte, a todo momento se olha para o passado com vistas a examinar este fenômeno que se tornou um verdadeiro "esvaziamento cultural". Outrossim, busca-se elucidar que embora ocorra um progresso científico, acesso a educação e a tecnologia de forma vertiginosa, isso não significa que a as artes avançaram na mesma velocidade, pelo contrário, acabou estagnando e já não visa mais a modificação de estruturas, mas apenas entreter.

  20. O labirinto da contemporaneidade

    Directory of Open Access Journals (Sweden)

    Lang, Charles Elias

    2011-01-01

    Full Text Available O presente trabalho discute a modernidade e a produção da subjetividade contemporânea. Toma-se como modelo o labirinto de Eco (1985. Existem três tipos de labirintos: o labirinto clássico, o maneirístico, e a rede. O clássico é unicursal. Assim que se entra, a única coisa que se pode fazer é chegar ao centro e, do centro, só o que se pode fazer é encontrar uma saída. O maneirístico propõe escolhas alternativas. Todos os percursos levam a um ponto morto, com exceção de um que leva à saída. Na rede, cada ponto pode ter conexão com qualquer outro ponto. Se os labirintos anteriores têm um interior e um exterior, a rede, extensível ao infinito, não tem nem um dentro nem um fora. A partir deste modelo discute-se a produção de individualidades e subjetividades, do corpo como meio de comunicação e a produção de imagens do corpo através da mídia

  1. Dj Da Hai

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Miko Da Hai is DJ at a Xi’an disco bar. At work, in his cool attire, the pulsing disco beat punctuated by his distinctive vocal commentary, he makes a striking impression. The job having come his way by chance, Miko is now a skilled and experienced DJ of eight years’ standing. This may be

  2. Transitoriedade ou o desterro da certeza

    Directory of Open Access Journals (Sweden)

    Paulo José Carvalho da Silva

    2012-12-01

    Full Text Available O tema da transitoriedade era lugar-comum da medicina da alma da primeira modernidade. Este artigo analisa algumas dessas fontes para mostrar como a dor do tempo e os males da alma atinentes eram relacionados a um modo de encarar a fugacidade do tempo e a fragilidade da vida. Dá-se destaque, sobretudo, às construções em torno da condição humana enquanto desterro da certeza.

  3. Germination and microwave processing of barley (Hordeum vulgare L) changes the structural and physicochemical properties of β-d-glucan & enhances its antioxidant potential.

    Science.gov (United States)

    Ahmad, Mudasir; Gani, Adil; Shah, Asima; Gani, Asir; Masoodi, F A

    2016-11-20

    The nutraceutical potential of β-d-glucan is largely dependent on its structure, size and viscosity. The present study analyzed the effect of germination and microwave processing of barley on the structural, size, antioxidant and thermal characteristics of β-d-glucan. The molecular weight and viscosity of β-d-glucan obtained from germinated barley (GGB) were the lowest (144kDa and 37.33cp) as compared to β-d-glucan from microwave processed barley (GMB) and unprocessed barley (GUB). The GGB exhibited higher antioxidant potential than GMB and GUB. The Structural elucidation by ATR-FTIR revealed scission in polymeric chain and β glycosydic linkage of β-d-glucan obtained from processed barley. The highest peak intensity at glycosydic linkage in GGB confirms more scission in the molecule. The DSC curve of GGB showed the highest transition temperature. It was concluded that germination of barley can be a good approach for enhancing the antioxidant potential of β-d-glucan.

  4. O Tema da Cidadania

    Directory of Open Access Journals (Sweden)

    Adriano Moreira

    2009-11-01

    Full Text Available Neste artigo tentaremos evidenciar a natureza pelo menos tripartida da cidadania que responde ao incontroladoglobalismo: uma que se confunde com os direitos humanos, exigentes querem seja o Estado o seu interlocutor,quer não exista tal interlocutor; outra que se insere na fenomenologia dos grandes espaços em formação, de que aUnião Europeia é exemplo, e a que o projecto da Constituição Europeia, agora em recolhimento de meditação, jáoferece o apoio de uma definição específica de direitos; e finalmente, a cidadania que diz respeito à relação com oEstado soberano em crise de redefinição, sobretudo, pelo que nos interessa, no espaço europeu.

  5. Fisiopatologia da asma grave

    OpenAIRE

    Todo-Bom, Ana; Mota-Pinto, Anabela

    2006-01-01

    Não tem resumo. Transcreve-se o primeiro parágrafo: A história natural da asma e os condicionalismos de uma evolução para formas moderadas ou graves não está completamente estabelecida. Contudo, quer os factores genéticos quer os factores ambientais, serão determinantes na fisiopatologia e no prognóstico da doença. A asma é, por definição, uma doença inflamatória crónica das vias aéreas caracterizada por uma obstrução brônquica generalizada mas variável que é, pelo menos parcialmente, reve...

  6. [da Vinci surgical system].

    Science.gov (United States)

    Watanabe, Gou; Ishikawa, Norihiro

    2014-07-01

    The da Vinci surgical system was developed by Intuitive Surgical Inc. in the United States as an endoscopic surgical device to assist remote control surgeries. In 1998, the Da Vinci system was first used for cardiothoracic procedures. Currently a combination of robot-assisted internal thoracic artery harvest together with coronary artery bypass grafting (CABG) through a mini-incision (ThoraCAB) or totally endoscopic procedures including anastomoses under robotic assistance (TECAB) are being conducted for the treatment of coronary artery diseases. With the recent advances in catheter interventions, hybrid procedures combining catheter intervention with ThoraCAB or TECAB are anticipated in the future.On the other hand, with the decrease in number of coronary artery bypass surgeries, the share of valvular surgeries is expected to increase in the future. Among them, mitral valvuloplasty for mitral regurgitation is anticipated to be conducted mainly by low-invasive procedures, represented by minimally invasive cardiac surgery( MICS) and robot-assisted surgery. Apart from the intrinsic good surgical view, robotic-assisted systems offer additional advantages of the availability of an amplified view and the easy to observe the mitral valve in the physiological position. Thus, robotic surgical surgeries that make complicated procedures easier are expected to accomplish further developments in the future. Furthermore, while the number of surgeries for atrial septal defects has decreased dramatically following the widespread use of Amplatzer septal occluder, robotic surgery may become a good indication for cases in which the Amplatzer device is not indicated. In Japan, clinical trial of the da Vinci robotic system for heart surgeries has been completed. Statutory approval of the da Vinci system for mitral regurgitation and atrial septal defects is anticipated in the next few years.

  7. Effects of Neotyphodium Endophyte on Germination of Hordeum brevisubulatum under Temperature and Water Stress Conditions%温度和水分胁迫下内生真菌对野大麦种子发芽的影响

    Institute of Scientific and Technical Information of China (English)

    宋梅玲; 李春杰; 彭清青; 梁莹; 南志标

    2010-01-01

    本文通过比较携带(E+)和未携带(E-)内生真菌(Neotyphodium)的野大麦种子(Hordeum brevisubulatum)在温度胁迫和模拟干旱胁迫条件下种子的发芽速度、发芽率、根苗长以及幼苗含水量等方面的差异,探讨了内生真菌在对宿主植物抗逆境胁迫条件下的增益作用.结果表明:在10℃,15℃低温胁迫和30℃高温胁迫时,E+种子的发芽率、发芽指数显著大于E-种子(P<0.05);而在模拟干旱胁迫条件下,-0.6 ~-1.2 MPa时,E+的发芽率和发芽指数显著高于E-(P<0.05).表明内生真菌可以提高禾草在温度和干旱胁迫下的发芽率和发芽速度.另外,在10℃,15℃低温和30℃高温,及渗透势为-0.3 ~-1.2 MPa胁迫条件下,E+的胚根长、胚芽长和幼苗含水量也显著大于E-(P<0.05),表明内生真菌可以促进宿主植物在温度和干旱胁迫环境中发芽后幼苗的生长,并增强植株自主吸收水分的能力.

  8. Gramíneas hospedeiras de Xanthomonas sp., agente causal da falsa estria vermelha da cana-de-açúcar Host range of Xanthomonas sp., causal agent of the false red stripe of sugarcane, among grasses

    Directory of Open Access Journals (Sweden)

    Elaine Spindola Mantovani

    2006-06-01

    Full Text Available Falsa estria vermelha (FEV, uma nova doença causada por Xanthomonas sp., é diferente diferente de todas as outras doenças já descritas em cana-de-açúcar. Ela está distribuída por toda as principais regiões canavieiras do centro-sul do Brasil, mas ainda não foi detectada no norte e nordeste do Brasil nem em qualquer outro país. O presente estudo determinou a gama de culturas e plantas daninhas hospedeiras da bactéria dentre espécies pertencentes às gramíneas, através de inoculação por injeção e pulverização de suspensão bacteriana. Além da cana-de-açúcar, entre as 31 diferentes espécies estudadas, apenas sorgo, milho e aveia apresentaram sintomas, 15 dias após a inoculação. Em sorgo, no ponto de inoculação, apareceram estrias avermelhadas coalescentes. As folhas apresentaram típicas estrias vermelhas finas (1 mm, longas e paralelas às nervuras, com presença de exsudato bacteriano. Até mesmo as inflorescências apresentaram pontuações avermelhadas. Plantas de milho inoculadas com seringa apresentaram sintomas de anasarca e descoloração de tecidos ao redor do ponto de inoculação e estrias cloróticas (2-3 mm no limbo foliar; porém, sem exsudato de bactéria. Apenas folhas de cevada apresentaram sintomas quando inoculadas por pulverização. As lesões iniciais eram estrias e manchas de cor palha, evoluindo para uma necrose total das folhas, causando a morte das plantas. A partir de folhas sintomáticas de cana-de-açúcar, sorgo, milho e aveia, realizaram-se re-isolamentos, obtendo-se culturas puras de Xanthomonas sp. cuja identidade foi comprovada através de testes sorológicos e por Rep-PCR. Diante desses resultados, surge a necessidade de realização de inspeções e campos de cultivo de sorgo, milho e aveia para verificar a presença da bactéria da FEV e determinar se o patógeno pode infectar essas culturas naturalmente.False Red Stripe (FRS, a new disease caused by Xanthomonas sp., is different

  9. O paradoxo da legitimidade a partir da legalidade segundo Habermas

    Directory of Open Access Journals (Sweden)

    Aylton Barbieri Durão

    2010-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2008v7n2p233A autonomia jurídica surge da conexão co-originária entre a autnomia privada dos indivíduos e a autonomia pública dos cidadãos, a qual, contudo, ficou velada ao longo da história da filosofia política e jurídica por causa da herança metafísica do direito natural racional e da filosofia da consciência que gerou uma relação de competição entre os direitos humanos e a vontade soberana do povo. Por causa desta conexão entre a autonomia privada e pública, o processo democrática de produção de normas jurídicas apresenta um aparente paradoxo porque os cidadãos tanto podem aprovar as normas motivados pela busca do êxito da racionalidade estratégica como orientados pelo reconhecimento de sua validade através da racionalidade comunicativa, o qual se dissolve, contudo, quando se considera a democracia como um processo aberto para a solidariedade dos cidadãos no mundo da vida.

  10. O Cognitivismo e o problema da Cientificidade da Psicologia

    OpenAIRE

    Arja Castañon, Gustavo

    2010-01-01

    Este artigo trata do problema do estatuto científico da psicologia. Seu objetivo é avaliar em que medida o cognitivismo solucionou objeções históricas levantadas contra a possibilidade de uma psicologia científica. Com base em avaliação de textos clássicos da “revolução cognitiva”, se conclui que esta abordagem apresentou um projeto filosófico de ciência psicológica que resolveu a maior parte dos problemas ontológicos e epistemológicos endêmicos da disciplina, como o da natureza inquantificáv...

  11. A Utopia da Paz Universal

    Directory of Open Access Journals (Sweden)

    Daniel Serrão

    2009-11-01

    Full Text Available Como o Homem atingiu a fase da cultura exterior simbólica em que se encontra actualmente. Apresentaçãosucinta da teoria dos patamares evolutivos de Merlin Donald. O paradigma "popperiano" da investigaçãocientífica moderna: verificar ou falsificar hipóteses. O caso típico da teoria darwiniana da evolução das espéciesvivas. A Bioética como diálogo de saberes em ordem à criação de uma nova sabedoria (wisdom. Apresentação doconceito de Van Rensselaer Potter. O "credo" de Potter e a utopia da paz universal.

  12. Custos da qualidade

    Directory of Open Access Journals (Sweden)

    Gilberto Caetano

    2009-01-01

    Full Text Available Este artigo pretende demonstrar através de uma síntese histórico-conceitual , a evolução da importância do sistema de qualidade, bem como a sua mensuração no processo de tomada de decisão das organizações frente à competitividade estabelecida no contexto da globalização. Assim, procura dar ênfase à ação planejada no sentido de reduzir ou eliminar falhas e defeitos nos vários processos, com vistas a agregar valor ao cliente e ao mesmo tempo reduzir os custos da não-conformidade. Palavras-chave: Custo, qualidade, satisfação, inspeção, controle, requisito, conformidade, não-conformidade, mensuração, processo, prevenção, problema e avaliação. Abstract This article intends to demonstrate through a historical-conceptual synthesis, the evolution of the importance of the quality system, as well as your measurement the process of decision making of the organizations front to the established competitiveness in the context of the globalization. Like this, it tries to give emphasis to the action drifted in the sense of to reduce or to eliminate flaws and defects in the several processes, with views to join value to the customer and at the same time to reduce the costs of the no-conformity. Key-words: Cost, quality, satisfaction, inspection, control, requirement, conformity, no-conformity, measurement, process, prevention, problem and evaluation.

  13. Pioneirismo da associacao brasileira de enfermagem no desenvolvimento da pesquisa: da revista ao centro de pesquisa

    Directory of Open Access Journals (Sweden)

    Lais de Araujo Pereira

    2013-09-01

    Full Text Available O presente estudo tem como objetivo analisar as primeiras iniciativas da Associação Brasileira de Enfermagem para o desenvolvimento da pesquisa em enfermagem. Com um recorte temporal que engloba o período de 1932 a 1971, ano de criação da Revista Brasileira de Enfermagem à criação do Centro de Estudos e Pesquisas, da Associação Brasileira de Enfermagem. As fontes utilizadas foram documentos escritos localizados no Centro de Documentação da Escola de Enfermagem Anna Nery da Universidade Federal do Rio de Janeiro e no Centro de Memória da Associação Brasileira de Enfermagem, além de edições da revista localizadas na Biblioteca Setorial da Pós-Graduação da Escola de Enfermagem Anna Nery. Percebe-se, nesta análise, que os empreendimentos realizados por essa entidade representaram um verdadeiro espaço de investigação e de formação de enfermeiros pesquisadores no Brasil.

  14. Pensamento da America

    OpenAIRE

    2013-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Filosofia e Ciências Humanas, Programa de Pós-Graduação em História, Florianópolis, 2013. Esta dissertação objetivou investigar a atividade editorial de Rui Ribeiro Couto e Renato Costa Almeida enquanto estes intelectuais estiveram à frente do Pensamento da America, uma publicação mensal vinculada ao A Manhã, jornal porta voz do Estado Novo. Este suplemento panamericano veio a público entre 1941 e 1949, no entanto a...

  15. Propriedades antioxidantes da melatonina

    OpenAIRE

    Teixeira,Adriana

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Biológicas. Programa de Pós-Graduação em Neurociências. Foram investigadas as ações da melatonina (MEL) contra a lipoperoxidação (LPO) induzida por hidroxil (OH), ascorbil (Asc) e peroxinitrito (ONOO-) em diversos modelos de membranas como lipossomas de fosfatidilcolina (LipPC) e asolecitina (LipASO), microssomas de cérebro (MicC) e fígado (MicF) e homogeneizado de cérebro (HC); e seu efeito contra enzimas ...

  16. A moral da infidelidade

    Directory of Open Access Journals (Sweden)

    Bundt, Roger

    2007-01-01

    Full Text Available Através das representações da infidelidade conjugal encontradas em três filmes do diretor Adrian Lyne realizados nas décadas de 1980, 1990 e 2000 (Atração Fatal, Proposta Indecente e Infidelidade, busca- se entender as idéias trabalhadas em cada obra, as maneiras de representar a mulher, a família, a relação amorosa e a monogamia, a partir das noções de dever e moral trabalhadas por Gilles Lipovetsky

  17. A moralidade da nanotecnologia

    OpenAIRE

    2012-01-01

    A nanotecnologia é um conjunto formado por saberes, técnicas e práticas que estudam e exploram as novas propriedades dos materiais, quando manipulados em níveis atômicos e moleculares. A possibilidade técnica de organizar e controlar a matéria, desde suas menores dimensões e unidades, pode implicar profundas transformações no processo industrial de produção e ter consequências, moralmente significativas, sobre as inter-relações humanas, a organização da conjuntura social vigente e o próprio f...

  18. Aspectos moleculares da anemia falciforme

    Directory of Open Access Journals (Sweden)

    Galiza Neto Gentil Claudino de

    2003-01-01

    Full Text Available No presente artigo abordaram-se vários aspectos relacionados à natureza molecular da anemia falciforme, desordem hematológica de caráter hereditário que acomete expressivo número de indivíduos em várias regiões do mundo. As pesquisas realizadas em torno desta patologia da hemácia, ao longo de quase um século, a partir de 1910, cooperaram para a criação de um novo e importante segmento da ciência, denominado biologia molecular. A descoberta dos polimorfismos da mutação (GAT->GTG no gene que codifica a cadeia beta da hemoglobina, originando diferentes haplótipos da doença, permitiu um melhor e mais amplo conhecimento em torno da heterogeneidade clínica nos pacientes falcêmicos. Analisando a hemoglobina na sua estrutura normal e mutante, sua produção e evolução, pode-se ter um entendimento mais completo da fisiopatologia desta doença e da sua complexidade clínica.

  19. Fractais : da geometria à videoarte

    OpenAIRE

    2013-01-01

    A descoberta da geometria fractal é datada de meados do séc. XX. É conhecida como a geometria da natureza já que permite descrever muitos fenómenos naturais que apresentam irregularidades que são impossíveis de descrever através dos princípios da geometria tradicional. O aparecimento de novas tecnologias digitais veio alterar o modo como a arte é encarada. Este trabalho pretende demonstrar possibilidades de integração da geometria fractal e a Teoria do Caos na criação de videoarte, b...

  20. Fisiopatogênese da dor

    Directory of Open Access Journals (Sweden)

    Miguel R. Covian

    1965-09-01

    Full Text Available O estudo da dor é um capítulo do estudo das bases neurofisiológicas da sensação, pois a dor nada mais é que uma sensação de conteúdo desagradável originada por estímulos nocivos. Enquanto a função das outras modalidades sensoriais é informativa ou gnósica, a dor é de proteção. O estudo da fisiología da dor compreende o estudo dos receptores, dos estímulos, das vias, das estruturas do sistema nervoso central que partici- pam da fisiología da dor, da percepção dolorosa e das reações motoras e neurovegetativas. São analisados os receptores e as vias e discutidas sua especificidade, assim como a transmissão da dor rápida e lenta por vias nervosas diferentes até o córtex cerebral. É comentada a influência da atenção na intensidade da percepção dolorosa e, com base em estudos experimentais, é considerado que o circuito retículo-córtico-reticular seja indispensável para a percepção da dor. No tocante à patologia da dor é examinada a insensibilidade congênita à dor, sendo admitida a hipótese de que em algumas sinapses é modificado o esquema de impulsos que darão lugar à sensação dolorosa. É destacado o papel do lobo frontal como parte de um mecanismo pòtenciador que condiciona o sofrimento geral do paciente. A dor referida é explicada pela teoria da "convergência-projeção" de fibras viscerais com fibras cutâneas dolorosas sôbre o mesmo neurônio em algun ponto da via sensitiva. O resultado da hipofisectomia trazendo uma diminuição ou anulação da dor no câncer do seio abre debates em tôrno do papel dos hormônios na percepção dolorosa.

  1. Tumores cartilaginosos da laringe

    Directory of Open Access Journals (Sweden)

    Thomé Robert

    2001-01-01

    Full Text Available Introdução: Os tumores cartilaginosos da laringe são raros, sendo a cartilagem cricóide a mais acometida. A raridade desses tumores tem como conseqüência experiência limitada e, portanto, o conhecimento a respeito destas neoplasias apresenta pontos obscuros. Objetivo: Apresentar os resultados cirúrgicos bem como o seguimento a longo prazo de 6 pacientes com tumores cartilaginosos da laringe, 4 condrossarcomas de baixa malignidade e 2 condromas. Forma de estudo: Retrospectivo não randomizado. Material e método: Cinco dos tumores acometiam a cartilagem cricóide e 1 a tireóide. Os pacientes foram submetidos a laringectomia parcial (4 e total (2, com seguimento de 6 a 30 anos (média-19,5 anos. Resultados: Nenhum dos pacientes apresentou metástase ou morte relacionada ao tumor. A sobrevida alcançada por 5 anos foi de 100% e a por 20 anos, 67%, sendo a comorbidade responsável por tal decréscimo. Conclusões: Nossos resultados reforçam o conceito de que a laringectomia conservadora seja a modalidade ideal de tratamento, reservando a ressecção total para tumores extensos ou casos de recorrência. Há indícios de que 5 anos pode não ser tempo suficiente para observar recorrência no condrossarcoma de baixo grau de malignidade.

  2. Dos Males da Medida

    Directory of Open Access Journals (Sweden)

    Schwarcz Lilia Moritz

    1997-01-01

    Full Text Available Esse artigo tem como objeto a difícil percepção da "diferença". Tema polêmico, o debate sobre as variedades culturais foi transformado, em meados do século XIX, em uma questão racial e, nesse sentido, vinculado às regularidades da biologia. Tecendo comparações entre os teóricos raciais brasileiros e os impasses mais contemporâneos, sobre a aferição de inteligência e capacidade, esse ensaio pretende provocar. Em pauta estarão as contradições que têm se destacado, mais recentemente, quando se opõem de um lado as etnicidades locais, de outro a tão propalada globalização. Tal qual dois lados de uma mesma moeda, a afirmação de identidades tem se mostrado tão evidente como o próprio estreitamento das relações internacionais. Mudam os termos do debate - de raça, para etnia -, mas, de alguma maneira, continuamos presos a uma lógica positiva de estabelecimento de hierarquias ontológicas.

  3. Os usos da diversidade

    Directory of Open Access Journals (Sweden)

    Clifford Geertz

    1999-05-01

    Full Text Available Resumo Ao discorrer sobre o “Futuro do Etnocentrismo”, este artigo parte da premissa de que a globalização, apesar de ter – em muitos casos – diminuído as diferenças entre povos, não tem amenizado os preconceitos e as formas de discriminação que ocorrem em nome dessas diferenças. Ele resgata a importância do antropólogo neste cenário lembrando que a diversidade cultural faz parte da sociedade complexa, remetendo-se não apenas a grupos étnicos ou nacionais bem delimitados, mas também a diferenças de geração, gênero, sexo e classe, entre outros. Neste contexto, a tolerância passiva de modos distantes de vida assim como a aceitação pragmática de nosso próprio paroquialismo são atitudes não somente intelectualmente desonestas mas também moralmente repreensíveis. É no encontro incômodo de subjetividades variantes na sua própria sociedade que o antropólogo define seu lugar.

  4. A morte da bailarina

    Directory of Open Access Journals (Sweden)

    Nancy Mangabeira Unger

    2010-04-01

    Full Text Available A história do Ocidente pode ser lida de acordo com o sentido da palavra grega hybris: transgressão, presunção, desmesura. Hoje, vivemos o ápice de um percurso marcado pela desejo de tudo dominar. Por sua extrema gravidade, a crise contemporânea nos coloca diante da responsabilidade de questionar a própria dimensão na qual pensamos, e a maneira em que compreendemos nossa identidade enquanto humanos e nosso lugar na totalidade do real.Palavras-chave: civilização ocidental; crise; hybris; questionamento. AbstractThe history of the West can be read according to the meaning of the greek word hybris: transgression, arrogance, loss of measure. We presently live the pinnacle of a course marked by the desire to dominate all beings.  The extreme gravity of  contemporary crisis confronts us with the responsibility of questioning the very dimension in which we think, as well as the manner in which we understand our identity as human beings and our place in the totality of being.Key words: western civilization; crisis; hybris; questioning. 

  5. [Effect of rye Secale cereale L. chromosomes 1R and 3R on polyembryony expression in hybrid combinations between (Hordeum vulgare L.)-Triticum aestivum L. alloplasmic recombinant lines and wheat T. aestivum L.-rye S. cereale L. substitution lines].

    Science.gov (United States)

    Pershina, L A; Rakovtseva, T S; Belova, L I; Deviatkina, E P; Silkova, O G; Kravtsova, L A; Shchapova, A I

    2007-07-01

    The effect of rye chromosomes on polyembryony was studied for reciprocal hybrid combinations between (Hordeum vulgare L.)-Triticum aestivum L. alloplasmic recombinant lines and five wheat T. aestivum L. (cultivar Saratovskaya 29)-rye Secale cereale L. (cultivar Onokhoiskaya) substitution lines: IR(1D), 2R(2D), 3R(3B), 5R(5A), and 6R(6A), and for direct hybrid combinations between the [H. marinum ssp. gussoneanum (H. geniculatum All.)]-T. aestivum alloplasmic recombinant line and the wheat-rye substitution lines 1R (1A), 1R (1D), and 3R(3B). Chromosomes 1R and 3R of rye cultivar Onokhoiskaya proved to affect the expression of polyembryony in the hybrid combinations that involved the alloplasmic recombinant lines of common wheat as maternal genotypes. Based on this finding, polyembryony was regarded as a phenotypic expression of nuclear-cytoplasmic interactions where an important role is played by rye chromosomes 1R and 3R and the H. vulgare cytoplasm. Consideration is given to the association between the effect of rye chromosomes 1R and 3R on polyembryony in the [(Hordeum)-T. aestivum x wheat-rye substitution lines] hybrid combinations and their stimulating effect on the development on angrogenic embryoids in isolated anther cultures of the wheat-rye substitution lines.

  6. Fisiologia da caquexia

    OpenAIRE

    Gonçalves, Catarina Vicente

    2014-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A caquexia é uma síndrome de desnutrição multifatorial que se caracteriza por uma perda de peso e perda de massa muscular. Esta síndrome parte de uma doença subjacente e pode estar presente em várias doenças crónicas como por exemplo HIV, doença renal crónica, DPOC, doença hepática crónica, insuficiência cardíaca congénita e cancro. Com este trabalho, pretendeu-se entender a definição de ca...

  7. Em favor da talassografia

    Directory of Open Access Journals (Sweden)

    Jean-Louis Boudou

    2001-01-01

    Full Text Available A Talassografia (“descrição do mar” interessa-sepelos impactos físicos, biológicos, ecológicos... culturais da violenta antropização dos ambientes costeiros (oceânicos e continentais, caracterizados pelaexigüidade, vulnerabilidade, fragilidade e plasticidade. Como o Brasil é um “país marítimo”, os geó-grafos (os talassógrafos brasileiros são convidadosa intensificar suas pesquisas nas áreas costeiras e acriar novas estruturas para divulgá-las: Revista, Encontros, Associação, Pós-Graduação... tudo em prolda talassografia.

  8. Fisiologia da caquexia

    OpenAIRE

    Gonçalves, Catarina Vicente

    2014-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A caquexia é uma síndrome de desnutrição multifatorial que se caracteriza por uma perda de peso e perda de massa muscular. Esta síndrome parte de uma doença subjacente e pode estar presente em várias doenças crónicas como por exemplo HIV, doença renal crónica, DPOC, doença hepática crónica, insuficiência cardíaca congénita e cancro. Com este trabalho, pretendeu-se entender a definição de ca...

  9. Berengario da Carpi.

    Science.gov (United States)

    De Santo, N G; Bisaccia, C; De Santo, L S; De Santo, R M; Di Leo, V A; Papalia, T; Cirillo, M; Touwaide, A

    1999-01-01

    Berengario da Carpi was magister of anatomy and surgery at the University of Bologna from 1502 to 1527. Eustachio and Falloppia defined him as 'the restaurator of anatomy'. He was a great surgeon, anatomist and physician of illustrious patients including Lorenzo II dei Medici, Giovanni dalle Bande Nere, Galeazzo Pallavicini, Cardinal Colonna, and Alessandro Soderini. He had strong links to the intellectuals of his time (Forni, Bonamici, Manuzio, Pomponazzi) as well as with the Medici family. He was respected by the Popes Julius II, Leo X and Clement VII. His main contributions are the Isogogae Breves, De Fractura calvae sive cranei, and the illustrated Commentaria on the Anatomy of Mondino de Liucci, a textbook utilized for more than 200 years, which Berengario aimed to restore to its initial text. The Commentaria constitutes the material for the last part of this paper which concludes with a personal translation of some passages on 'The kidney', where the author gives poignant examples of experimental ingenuity.

  10. Genetic Diversity of SSR Markers in Cultivated Hordeum vulgare L. in Qinghai Province%青海省栽培青稞SSR标记遗传多样性研究

    Institute of Scientific and Technical Information of China (English)

    田海宁; 杨菁; 何桂芳

    2011-01-01

    [ Objective] The aim was to analyze genetic diversity of SSR markers in Hordeum vulgare L. in Qinghai Province and lay a foundation for screening and protecting some excellent H. vulgare cultivars. [ Method] SSR markers were used to evaluate the genetic diversity of 42 cultivated H. vulgare from Qinghai Province. [ Result ] 42 H. vulgare showed polymorphism in 7 SSR markers locus. A total of 24 alleles were identified, and the number of alleles per locus ranged from 1 to 6, with an average of 3.0. According to SSR markers polymorphism, 42 H. vulgare could be divided into 4 groups, namely Ⅰ, Ⅱ, Ⅲ and IV. [ Result] The study indicated that cultivated H. vulgare from Qinghai Province is rich in genetic diversity, which will provide reference for selecting parent of H. vulgare breeding.%[目的]分析我国青海省青稞SSR标记遗传多样性,为具有某些优异特性的青稞品种或资源筛选及青稞资源的保护奠定基础.[方法]利用SSR标记评估42份青海省栽培青稞的遗传多样性.[结果]42份青稞材料在7个SSR标记位点处表现出多态性,各位点扩增的等位基因数为1~6个,共鉴定出24个等位基因,每位点平均3.0个;根据SSR标记多态性可将42份青稞材料分为4组,即Ⅰ、Ⅱ、Ⅲ和Ⅳ.[结论]该研究表明青海省栽培青稞具有丰富的遗传多样性,可为青稞育种亲本选择提供参考.

  11. A influência da Internet no processo ensino-aprendizagem da leitura e da escrita

    Directory of Open Access Journals (Sweden)

    Evanice Ramos Lima Barreto

    2010-03-01

    Full Text Available

    A Internet constitui um dos grandes avanços da comunicação humana. Através dela, é possível o contato com uma infinidade de informações, veiculadas pelos mais diversos gêneros de texto. Por isso, sendo um dos meios de comunicação que mais se expandiu no mundo, a Internet se apresenta como uma ferramenta indispensável no ensino-aprendizagem da leitura e da escrita. Partindo desse pressuposto, o presente trabalho pretende apresentar os resultados de um estudo que tem por objetivo investigar, à luz dos pressupostos empreendidos por Soares (1998 e Dionísio (2005, qual o “lugar” da Internet no processo de ensino-aprendizagem da leitura e da escrita, bem como até que ponto ela interfere de forma positiva e/ou negativa nesse processo. Para tanto, foram aplicados questionários a professores e alunos do Ensino Médio. A partir da análise dos dados, pretende-se verificar como a sobrecarga de informações, bem como o uso inadequado da Internet podem trazer implicações para o desenvolvimento dessas atividades.

  12. Dimensão da maturidade à luz da logoterapia

    Directory of Open Access Journals (Sweden)

    Libardi, Tadeu Antonio

    2008-01-01

    Full Text Available O artigo aborda o tema da maturidade humana à luz da logoterapia, fundada por Viktor Emil Frankl. Nos dias de hoje, existe a frustração existencial, não mais a sexual, como analisada por Freud. Cada ser humano, como pessoa livre e responsável e tendo como meta a busca da maturidade, vai percorrendo seu próprio caminho, que o leva à ceitação de si, de seus limites e potencialidades e ao relacionamento social e religioso, capacitando-o ao confronto com o sofrimento humano

  13. Mito da guerra nos Estados Unidos

    OpenAIRE

    Spini, Ana Paula; UFU

    2011-01-01

    Este artigo tem como objetivo compreender aspectos do mito da guerra nos Estados Unidos, em uma abordagem que prioriza as dissensões internas acerca da legitimidade de uma guerra e os dispositivos midiáticos de criação do consenso nacional. Procura-se, assim, demonstrar que o mito da guerra é constantemente reformulado à luz da conjuntura internacional, da prática da guerra, da propaganda e da resistência interna às intervenções militares. Palavras-Chave: Guerra; Estados Unidos; Mídia....

  14. Controle da ferrugem e da broca-dos-ramos da figueira com diferentes fungicidas e inseticidas

    Directory of Open Access Journals (Sweden)

    Éder Júnior Mezzalira

    2015-02-01

    Full Text Available Temperaturas e precipitações elevadas favorecem a incidência da ferrugem (Cerotelium fici(Cast. e da broca-dos-ramos (Azochis gripusalis (Walker, 1859 (Lepidoptera: Pyralidae, limitando a produção comercial de figos. O objetivo deste trabalho foi comparar a eficiência de fungicidas e inseticidas alternativos em relação à de produtos convencionais registrados para a cultura. Foram realizados dois experimentos, no delineamento de blocos inteiramente casualizados, com quatro repetições, no setor de fruticultura da Universidade Tecnológica Federal do Paraná, Campus Dois Vizinhos. Para controle da ferrugem, foram utilizados, em 100 L de água, azoxistrobin (10 g, calda bordalesa (1.500 g de cal virgem + 1.500 g de sulfato de cobre e testemunha (água. No controle da broca-dos-ramos utilizaram-se, em 100 L de água, azadiractina (1.000 mL P.C., alho (Allium sativumL. (100 mL P.C., cinza (20.000 g, extrato de fumo (nicotina (10.000 mL do preparado, deltametrina (50 mL P.C., Bacillus thuringiensisBerliner (100 g P.C., rotenona (1.000 mL P.C., sabão de coco (1.000 g e testemunha (água. A calda bordalesa foi o tratamento mais efetivo no controle da ferrugem, promovendo aumento da produtividade e da qualidade dos frutos. A deltametrina promoveu o melhor controle da broca-dos-ramos da figueira. Entre os produtos alternativos testados, o alho foi o mais efetivo no controle dessa praga.

  15. Nitrogênio da biomassa microbiana em solo de Cerrado com aplicação de fertilizante nitrogenado Microbial biomass nitrogen in cerrado soil with nitrogen fertilizer application

    Directory of Open Access Journals (Sweden)

    Thais Rodrigues Coser

    2007-03-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da adubação nitrogenada no nitrogênio da biomassa microbiana do solo (N BMS, em diferentes profundidades, em um Latossolo Vermelho-Amarelo cultivado com cevada. O experimento foi instalado em junho de 2004, em área experimental de primeiro ano de plantio direto, anteriormente cultivada com milheto por três anos e posteriormente com soja por duas safras. Foram utilizados os seguintes tratamentos: quatro doses de nitrogênio (30, 60, 90 e 120 kg ha-1 e o controle sem adubação nitrogenada. As amostras de solo foram coletadas em quatro profundidades: 0-5, 5-10, 10-20 e 20-30 cm, com três repetições e em três épocas: perfilhamento pleno, floração e logo após a colheita. O N BMS e a razão N BMS:Ntotal diminuíram com a profundidade. Doses mais elevadas de nitrogênio não aumentaram o N BMS. O Ntotal não foi alterado nas diferentes doses de nitrogênio, mas diminuiu com a profundidade. Houve correlação negativa entre o N BMS e o pH do solo em todas as doses de nitrogênio, com exceção na dose zero. Houve também, correlação positiva entre a razão N BMS:Ntotal e o N BMS, porém não entre a razão N BMS:Ntotal e o Ntotal.The objective of this work was to evaluate the effect of different nitrogen doses and soil depths on soil microbial biomass nitrogen (N SMB in a sandy textured Oxisol, cultivated with barley. The experiment was established in June, 2004, in an area which had been cultivated with millet for three years and subsequently with soya beans for two seasons. The treatments were four doses of nitrogen (30, 60, 90 e 120 kg ha-1 and a control without any dose. Soil samples were collected in four depths: 0-5, 5-10, 10-20 e 20-30 cm, comprising three replicates and three sampling periods: tillering, flowering and right after the harvest. The N SMB and N SMB:Ntotal decreased according to depth. Higher doses of nitrogen did not increase the N SMB. The Ntotal was not altered with

  16. Dificuldades da aprendizagem na leitura

    Directory of Open Access Journals (Sweden)

    Solange Oliveira Nascimento

    2011-07-01

    Full Text Available Este presente artigo propôs verificar os fatores que influenciam no desenvolvimento da aprendizagem na leitura dos alunos da 4º ano no Ensino Fundamental na Escola Municipal Armando Dias no município de Sinop/MT, cujo tema é dificuldade da aprendizagem na leitura. O objetivo do trabalho foi investigar as relações interpessoais em sala de aula e de que forma a professora introduz a leitura nos conteúdos dados aos alunos. Como fundamentação teórica, recorremos a vários autores, entre eles: Enrique Cártula Fita, Elisabete da Assunção Jóse, Jésus Alonso Tapia, Maria Tereza Coelho e Ruth Caribe da Rocha Drouet. A metodologia usada consistiu na pesquisa qualitativa, no estudo de caso e questionário com perguntas abertas e fechadas aplicadas à professora e três alunos que estão com dificuldades na leitura. Através dos relatos dos sujeitos realizamos um estudo analítico confrontando os dados da pesquisa com os autores principais que fundamentam a mesma. O presente trabalho pretende contribuir e mostrar ao professor em sala de aula a importância de incentivar os alunos a aprenderem a ler com prazer motivando-os a despertar o interesse e gosto pela leitura. Os resultados da investigação revelam que a professora pesquisada está ciente de seu papel e procura meios para enfrentar os problemas existentes em sala de aula, em especial às dificuldades da aprendizagem na leitura e os alunos percebem a importância da leitura e tem vontade em avançar nesse aprendizado.Palavras-chave: educação; dificuldades na aprendizagem. professor; aluno; sala de aula.

  17. JORNALISMO AUDIOVISUAL: DA TELA DA TV PARA OUTRAS TELAS

    Directory of Open Access Journals (Sweden)

    Mayra Ferreira

    2012-12-01

    Full Text Available O presente trabalho é fruto de uma pesquisa em desenvolvimento em parceria com a TV Unesp, emissora universitária vinculada à Universidade Estadual Paulista Júlio de Mesquita, campus de Bauru/SP e que tem por objetivo identificar os pontos convergentes e divergentes na produção de conteúdo audiovisual informativo para a TV aberta e demais plataformas digitais e móveis. O texto em questão é a conclusão da primeira etapa da pesquisa que se pautou por identificar os pressupostos básicos que deverão nortear os conteúdos que serão produzidos posteriormente e veiculados pela emissora no decorrer da pesquisa. Foram analisadas as características do jornalismo audiovisual online e o modelo de negócios da TV aberta em contraste com o modelo de negócios presente na Internet.

  18. Dificuldades da aprendizagem na leitura

    OpenAIRE

    Nascimento, Solange Oliveira; Trugillo, Edneuza Alves

    2011-01-01

    Este presente artigo propôs verificar os fatores que influenciam no desenvolvimento da aprendizagem na leitura dos alunos da 4º ano no Ensino Fundamental na Escola Municipal Armando Dias no município de Sinop/MT, cujo tema é dificuldade da aprendizagem na leitura. O objetivo do trabalho foi investigar as relações interpessoais em sala de aula e de que forma a professora introduz a leitura nos conteúdos dados aos alunos. Como fundamentação teórica, recorremos a vários autores, entre eles: Enri...

  19. Controlo da Qualidade em Hemoglobinopatias

    OpenAIRE

    Miranda, Armandina

    2015-01-01

    Experiência do Controlo da qualidade em Hemoglobinopatias, pelo Grupo de Trabalho de Hematologia do Programa Nacional de Avaliação Externa da Qualidade (PNAEQ), INSA. As Hemoglobinopatias são doenças monogénicas hereditárias de transmissão autossómica recessiva resultantes de mutações que afetam os genes responsáveis pela síntese das cadeias de globina da hemoglobina, ou as suas regiões regulatórias.

  20. ESTUDO DA PASTEURIZAÇÃO DA POLPA DE GRAVIOLA

    Directory of Open Access Journals (Sweden)

    C. K. B. TEIXEIRA

    2009-01-01

    Full Text Available

    Estudou-se a pasteurização da polpa de graviola (Annona muricata L., visando estabelecer condições simples e eficientes para sua conservação. Foram realizadas avaliações microbiológica, enzimática e de cor da polpa, para identificar parâmetros a serem utilizados no acompanhamento da pasteurização. O produto foi submetido a tratamento térmico, em copos de inox, em diferentes tempos (1 a 300 seg e temperaturas (70°C a 90°C, para identificar o efeito destas variáveis sobre parâmetros de qualidade do produto. Constatou-se que os tratamentos não provocaram variação na atividade da peroxidase, contagem de bactérias, bolores e leveduras e cor da polpa. Em seguida foram realizadas pasteurizações, em escala piloto, a 80°C e 90°C; sendo os produtos estocados a 25°C e avaliados durante 120 dias. A redução da atividade da peroxidase e da concentração de bactérias, bolores e leveduras, a níveis aceitáveis, e a manutenção da cor, demonstraram a eficiência dos processos térmicos. A manutenção destes parâmetros, nos níveis aceitáveis, durante a estocagem, confirmou a aplicabilidade dos processos, sem a necessidade da adição de conservante na polpa. A pasteurização da polpa de graviola a 80°C ou 90°C, mostrou ser um tratamento térmico adequado para a conservação do produto, proporcionando 120 dias de vidade- prateleira à temperatura ambiente ( 25°C.

  1. A INTERPRETAÇÃO DELEUZEANA DA GENEALOGIA DA MORAL

    Directory of Open Access Journals (Sweden)

    Péricles Pereira de Sousa

    2014-12-01

    Full Text Available O texto tem o objetivo de apresentar como o filósofo francês Gilles Deleuze, a partir da obra Nietzsche e a Filosofia, interpreta a Genealogia da Moral, obra escrita pelo filósofo alemão Friedrich Nietzsche, levando em consideração as formas mais gerais do niilismo: ressentimento, má consciência e ideal ascético.

  2. O sentido da espiritualidade na transitoriedade da vida

    Directory of Open Access Journals (Sweden)

    Isabel Cristina de Oliveira Arrieira

    Full Text Available Resumo Objetivo: Compreender o sentido da espiritualidade para a pessoa em cuidados paliativos. Métodos: Abordagem qualitativa, fundamentada na fenomenologia existencialista e referencial de Viktor Frankl. Os participantes foram nove pessoas em cuidados paliativos atendidas no domicílio. Informações coletadas por meio da observação e de entrevista realizadas no período de junho a outubro de 2014, gravadas, transcritas e transformadas em texto interpretado com a abordagem fenomenológica hermenêutica. Resultados: Surgiram as seguintes categorias: sentido de continuidade da vida; sentido de alívio do sofrimento; sentido de naturalidade da morte e sentido de valorização do viver. Conclusão: Para a integralidade da atenção faz-se necessário a inclusão da espiritualidade na prática do cuidado em saúde. A espiritualidade proporciona o encontro existencial entre a pessoa em cuidados paliativos e os profissionais que a cuidam em sua integralidade.

  3. O PROBLEMA DA ORIGEM DA TRAGÉDIA EM NIETZSCHE

    Directory of Open Access Journals (Sweden)

    Rafael Koehler; Rosana Jardim Candeloro

    2012-12-01

    Full Text Available O objetivo deste artigo consiste em analisar como Nietzsche, baseado na filosofia schopenhauriana, resolveu o problema do surgimento da tragédia grega através da elevação dos elementos Apolo e Dionísio a um estatuto ontológico, e como os gregos fizeram isso em seu tempo através da Música, além de revelar como, em Nietzsche, o pensamento de Sócrates surge como o “perverso algoz da arte”.O estudo foi realizado através de uma pesquisa bibliográfica com base nas seguintes obras do filósofo: A visão Dionisíaca de Mundo (uma compilação de duas conferências e um texto não publicado e O nascimento da tragédia no espírito da Música. Na segunda parte, sugere-se como Nietzsche faz esse resgate do trágico em sua época e qual a recepção no século XIX de seu trabalho.

  4. O uso da aromaterapia na melhora da autoestima

    Directory of Open Access Journals (Sweden)

    Juliana Rizzo Gnatta

    2011-10-01

    Full Text Available Os objetivos deste estudo foram verificar se a inalação dos óleos essenciais de rosa e de ylang-ylang alteram a percepção da autoestima e comparar a eficácia dos mesmos. O projeto foi aprovado pelo Comitê de Ética em Pesquisa do Hospital da Universidade de São Paulo. Participaram 43 funcionários dos setores de Higienização e da Central de Materiais e Esterilização durante os meses de maio a julho de 2009. Os sujeitos foram randomizados em três grupos: dois que receberem os óleos essenciais e outro que recebeu placebo (essência de rosa. A avaliação da autoestima foi feita através de uma escala já validada no Brasil, sendo aplicada antes do uso dos aromas, depois de 30 dias de uso e ao completar 60 dias. Dentre os resultados, verificou-se que a amostra era constituída por 88,6% de indivíduos com média e alta autoestima e que os óleos essenciais em questão não alteraram de forma significativa a percepção da autoestima.

  5. SOBRE OS FUNDAMENTOS DA ARQUITETURA DA INFORMAÇÃO

    Directory of Open Access Journals (Sweden)

    Alfram Roberto Rodrigues de Albuquerque

    2011-10-01

    Full Text Available Expõe-se o estado atual da disciplina Arquitetura da Informação quanto a problemática terminológica da definição do campo de estudo, apresentando-se argumentos para uma definição de Arquitetura da Informação de uma forma ampla na qual os usos correntes dessa expressão sejam vistos como especializações. Defende-se uma definição com a utilização de um conjunto de propriedades mínimas cujas interações levam a uma terminologia formal e cuja abstração leva a uma definição formal do conceito que emprega a linguagem de morfismos da Teoria das Categorias. Trata-se de um recorte de alguns dos resultados obtidos na tese de doutoramento de um dos autores, defendida em setembro de 2010. O contexto da pesquisa é exposto e alguns dos resultados obtidos são delineados.

  6. A utilização da teoria da aprendizagem significativa no ensino da Enfermagem

    Directory of Open Access Journals (Sweden)

    Alana Tamar Oliveira de Sousa

    2015-08-01

    Full Text Available RESUMOObjetivo:sintetizar a produção científica acerca da Teoria da Aprendizagem Significativa no processo de ensino-aprendizagem em Enfermagem.Método:revisão integrativa realizada nas bases de dados MEDLINE, LILACS, SciELO, BDENF e CINAHL, com artigos que abordaram a temática ou aspectos da teoria da aprendizagem significativa de David Ausubel. Fizeram parte da amostra dez artigos, sendo seis escritos no idioma português e quatro no inglês, publicados de 1998 a 2013.Resultados:cinco artigos fizeram alusão à Teoria da Aprendizagem Significativa, quatro citaram Ausubel como autor dessa teoria e apenas dois seguiram a estrutura para a aplicação da teoria completamente. Há escassez de estudos sobre o tema e os que o abordam não o correlacionam com a teoria de Ausubel.Conclusão:faz-se necessário romper com a dicotomia entre teoria e prática e promover a articulação dos conteúdos com a ação, introduzindo o aluno como autor de seu próprio conhecimento.

  7. DESENVOLVIMENTO DA PERSONALIDADE DA CRIANÇA: O PAPEL DA EDUCAÇÃO INFANTIL

    Directory of Open Access Journals (Sweden)

    Michelle de Freitas Bissoli

    2014-12-01

    Full Text Available Este trabalho, de cunho teórico-bibliográfico, tem por objetivo trazer à discussão a relação que se estabelece entre a prática pedagógica desenvolvida na Educação Infantil e a formação da personalidade da criança. Tem por fundamentos os pressupostos da Teoria Histórico-Cultural e busca responder, fundamentalmente, às seguintes questões: O que é a personalidade?; Quais são as forças motrizes do seu processo de desenvolvimento nos primeiros anos de vida da criança?; Quais as especificidades do trabalho dos professores da Educação Infantil e como a atividade pedagógica pode contribuir para o desenvolvimento da personalidade infantil? Para tanto, pretendemos refletir sobre alguns princípios essenciais de um trabalho docente capaz de impulsionar o processo formativo integral da criança na Educação Infantil. Consideramos que, com a consolidação de práticas pedagógicas que medeiem as relações entre as crianças e a cultura, é possível organizar atividades que focalizem as diferentes dimensões do desenvolvimento humano e a personalidade.

  8. Atlas nacional da Espanha, demografia

    Directory of Open Access Journals (Sweden)

    Hervé Théry

    2009-03-01

    Full Text Available Calvo Palacios J.L., Pueyo Campos Á. (2008, Atlas nacional de España, Demografía. Madrid: Centro Nacional de Información Geográfica, 386 p. ISBN: 978-8-4416-0685-2.O volume, que faz parte da série Monografias do Atlas Nacional de Espanha, inclui 420 mapas, 91 dos quais apresentam informações por município que dão uma visão global, concisa e muito completa da realidade da população espanhola e da sua evolução (em alguns casos analisada desde 1857. Seus diretores científicos são José Luis Cal...

  9. A subjetividade fora da mente

    Directory of Open Access Journals (Sweden)

    Alexandre Simões

    2011-08-01

    Full Text Available O artigo contextualiza uma tradição que se apresenta de maneira recorrente nas práticas clínicas da psicologia e da saúde mental: o Mentalismo. O Mentalismo pressupõe uma concepção interiorizada do sujeito em prol de modelos instrumentais de clínica. A partir da crítica ao Mentalismo, os autores examinam outras possibilidades de se lidar não mais com o sujeito essencializado, porém, com os complexos processos de subjetivação. Esta é uma perspectiva clínica que recorrendo a Deleuze, Guattari e à Filosofia da Diferença oferece estratégias mais condizentes com a complexidade do mundo contemporâneo, introduzindo debates éticos, políticos e estéticos na dimensão psíquica.

  10. A teoria da gastrea de Ernst Haeckel

    OpenAIRE

    Guilherme Francisco Santos

    2011-01-01

    O objetivo principal de nosso trabalho é descrever e analisar criticamente o núcleo da teoria da gastrea de Ernst Haeckel. Ele gira em torno de duas noções principais: forma gastrular e metazoário. A teoria da gastrea é um conjunto de formulações que visa estabelecer uma definição de metazoário a partir da noção de forma gastrular. O argumento central da teoria da gastrea articula essas duas noções para organizar a partir de estudos de embriologia comparativa uma visão geral da história evolu...

  11. Desafios da leitura e da escrita em meio digital

    Directory of Open Access Journals (Sweden)

    Adair de Aguiar Neitzel

    2015-04-01

    Full Text Available Este artigo trata das estratégias de ensino no campo da leitura literária que os licenciandos de Letras promoveram no decorrer do Programa Docência na Educação Básica/PIBID/UNIVALI. Foram analisadas as concepções que subjazem essas estratégias e como elas colaboram para a formação de leitores no ensino médio. Esta investigação, de caráter qualitativo, utilizou como instrumentos de coleta de dados os portfólios redigidos pelos licenciandos de Letras, bolsistas do PIBID, disponíveis no ambiente virtual da instituição, e entrevistas com os alunos do ensino médio que participaram da pesquisa. Os resultados apontam que, por meio da leitura e da produção de contos multimídias, os alunos foram capazes de fazer relações com outros textos; ampliar o diálogo sobre a obra lida; colocar a pesquisa no centro do processo; fazer uso da autonomia na escolha do material; participar de um processo criativo; trabalhar em equipe; aprender a importância da revisão na produção de textos; negociar saberes. Ao trabalhar-se com a literatura de forma a resguardar sua função estética, os estudantes mudaram sua visão sobre o texto literário, passando a compartilhá-lo com os pares e a reconhecer as literariedades do texto e as sutilezas das construções literárias.

  12. GRAU DA PRÁXIS DA GESTÃO DA RESPONSABILIDADE AMBIENTAL PRATICADA POR USINAS SUCROALCOOLEIRAS

    Directory of Open Access Journals (Sweden)

    Renata Longo

    2014-12-01

    gerencial (PCDA foi o Action que apresentou maior grau de aderência. Há uma concordância acentuada às características fundamentais do ciclo gerencial na Gestão da Responsabilidade Socioambiental.

  13. Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barley (¤Hordeum vulgare¤ ssp. ¤spontaneum¤) line

    DEFF Research Database (Denmark)

    Backes, G.; Madsen, L.H.; Jaiser, H.

    2003-01-01

    for the infection in this experiment. Moreover, powdery mildew disease severity was observed in the field at two different epidemic stages. In addition to other DNA markers, the map included 13 RGA (resistance gene analog) loci. The structure of the data demanded a non-parametric QTL-analysis. For each of the four......The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... the results for the different powdery mildew related traits and the relation between qualitative and quantitative resistance are discussed....

  14. FERTILIZING BREWING BARLEY (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    I. Kádár

    2000-12-01

    Full Text Available Four levels of N, P and K nutrition (poor, moderate, satisfactory and high and all their possible combinations with 64 treatments in two replications (128 plots were studied in a long term field trial on barley yield and malting quality. A standard East-European spring barley "Opal" (bred in Czechoslovakia was grown in 1986, 13th year of the agricultural experiment, involving various crops in previous years, on a calcareous loamy chernozem soil. The optimum fertility levels for yield enhancement resulted in the poorest malting quality: low modification and extract but long saccharification time and high protein. To solve this problem the brewing industry will have to apply the well-known technological methods available since growers are not likely to give up their fertilizers. Applying soil and plant analysis data, having knowledge about both soil and plant optimum values, the danger of the excessive use of fertilizers can be realized and decreased.

  15. O PRAZER DA APRENDIZAGEM ATRAVÉS DA POESIA

    Directory of Open Access Journals (Sweden)

    COLI, Katiane Cristie

    2012-10-01

    Full Text Available To present researches “The pleasure of the learning through of the poetry” has for objective to emphasize the importance of pleased poetries in classroom of the fundamental teaching, proposing to the students one moment ludic, tends in view the exercise of the imagination, of the fantasy and of the creativity, developing like this a form teaching more cheerful, more poetic and with larger freedom to build the knowledge. The research also has for purpose to call the teachers’ attention for the importance of the reading of poetries in the classroom and to develop in the students the taste for her. For the accomplishment of this research works of renowned national prominence were used, among other materials. It was also accomplished a field research, in way to still give larger credibility to the study. A presente pesquisa “O prazer da aprendizagem através da poesia” teve por objetivo ressaltar a importância de poesias prazerosas em sala de aula do ensino fundamental, propondo aos alunos um momento lúdico, tendo em vista o exercício da imaginação, da fantasia e da criatividade, desenvolvendo assim um ensino de forma mais alegre, mais poético e com maior liberdade para construir o conhecimento. A pesquisa também tem por propósito chamar a atenção dos professores para a importância da leitura de poesias na sala de aula e desenvolver nos alunos o gosto por ela. Para a realização desta pesquisa foram utilizadas obras de renomado destaque nacional, entre outros materiais. Foi realizada também uma pesquisa de campo, de forma a dar maior credibilidade ao estudo.

  16. Publicidade e ética: um estudo da construção da imagem da mulher

    Directory of Open Access Journals (Sweden)

    Elizabeth Moraes Gonçalves

    2010-02-01

    Full Text Available O texto propõe uma reflexão sobre a ética da responsabilidade na publicidade veiculada nas revistas Claudia e Nova. Trata-se de uma pesquisa descritiva, resultante da leitura dos anúncios selecionados, subsidiada por teóricos da Análise do Discurso da linha francesa, que busca averiguar como a mulher é representada. Constatou-se que no contexto da sociedade contemporânea o retrato da mulher como sedutora ainda está presente, mesmo que em vários momentos ela apareça como protagonista de sua própria vida.

  17. Efeitos da acupuntura no tratamento da ansiedade: revisao integrativa

    OpenAIRE

    Sueli Leiko Takamatsu Goyatá; Carolina Costa Valcanti Avelino; Sérgio Valverde Marques dos Santos; Deusdete Inácio de Souza Junior; Maria Dorise Simão Lopes Gurgel; Fábio de Souza Terra

    2016-01-01

    RESUMO Objetivo: avaliar as evidências científicas disponíveis na literatura sobre os efeitos da acupuntura no tratamento da ansiedade e a qualidade desses estudos. Método: revisão integrativa, realizada nas bases/bancos de dados CINAHL, LILACS, PUBMEDPICO, SciELO, The Cochrane Library, no período entre 2001 a 2014. Os descritores anxiety, acupuncture therapy, acupuncture e anxiety disorders foram combinados entre si para garantir a ampla busca de estudos primários. Resultados: dos 514 art...

  18. O apagamento da oralidade na historiografia da literatura brasileira

    OpenAIRE

    Schneider, Sabrina; Pontifícia Universidade Católica do Rio Grande do Sul (PUCRS)

    2009-01-01

    Este artigo tem, por objetivo, mostrar como a oralidade tem sido abordada – quando é abordada – pelos historiadores da literatura brasileira. Trabalha com a hipótese de que a historiografia, por meio de estratégias discursivas, tem marginalizado a oralidade, bem como a contribuição das tradições ágrafas africana e indígena. Para verificá-la, perfaz um trajeto que tem início em Ferdinand Denis, cujo "Resumo da história literária do Brasil" foi publicado em 1826, e termina em Alexei Bueno, que ...

  19. O PROJETO DA MODERNIDADE SEGUNDO HABERMAS

    Directory of Open Access Journals (Sweden)

    João Paulo Rodrigues

    2014-12-01

    Full Text Available O projeto acadêmico de Habermas busca contribuir para a realização das metas emancipatórias da modernidade, através da teoria da ação comunicativa. Portanto, será examinado aqui se o processo de racionalização da sociedade moderna, presente na teoria da ação comunicativa, realmente representa um potencial para a emancipação humana. Primeiramente, pretende-se abordar no respectivo trabalho os principais conceitos que Habermas utiliza em sua teoria da ação comunicativa. Em um segundo momento, serão explorados os elementos fundamentais da teoria da sociedade. Após isso, será analisada a teoria da modernidade e a sua relação com a teoria da sociedade. Tal caminho terá o objetivo de investigar a possibilidade de resgate do projeto da modernidade, ao explicar a possibilidade da teoria da ação comunicativa ser considerada o potenciador emancipatório da sociedade moderna, formando tanto o cidadão como um indivíduo autônomo, preservando a sua identidade pessoal, quanto o cidadão como participante de uma sociedade política, possuidor de uma identidade cultural, étnica, entre outras, que abrange variados grupos sociais.

  20. Carencia de dados e desafios metodologicos para o desenvolvimento dos estudos da industria da musica

    National Research Council Canada - National Science Library

    Herschmann, Micael

    2013-01-01

    Balanco das dificuldades metodologicas enfrentadas pelos pesquisadores que vem trabalhando com a industria da musica no contexto atual marcado pela crise e reestruturacao deste setor da producao cultural...

  1. ESTUDO DA EFICIÊNCIA DA PASTEURIZAÇÃO DA POLPA DE TAPEREBÁ (SPONDIAS MOMBIN

    Directory of Open Access Journals (Sweden)

    C. T. R. M. BASTOS

    2008-12-01

    Full Text Available

    O taperebá (Spondias mombim é uma pequena drupa elipsóide, de cor amarelo alaranjado, com casca fi na que pode ser facilmente rompida, tornando o fruto susceptível à contaminação por ação de agentes externos. Estudou-se a pasteurização da polpa de taperebá, visando estabelecer condições simples e efi cientes de conservação a temperatura ambiente. Parâmetros microbiológicos (enumeração de microrganismos mesófílos aeróbios e pesquisa de coliformes a 45°C, químicos (teor de vitamina C, enzimáticos (atividade da peroxidase – POD e colorimétricos (colorimetria tristimulus foram utilizados como variáveis de resposta. Em bancada, foram testados diferentes tempos (1 a 300 s e temperaturas (70ºC a 90ºC de tratamento térmico, não tendo sido observado efeito estatisticamente signifi cativo (p < 0,05 sobre as contagens de microrganismos mesófi los aeróbios, coliformes a 45°C e sobre a cor da polpa. Em escala piloto, realizou-se a pasteurização da polpa a 85°C por 3 minutos, sendo avaliados parâmetros de qualidade do produto durante 14 dias de manutenção a 40°C, sob iluminação artifi cial, e realizados testes sensoriais. A redução da contagem de microrganismos mesófi los aeróbios e coliformes a 45°C, para níveis aceitáveis pela legislação brasileira, a manutenção da cor e os índices de aceitação da polpa confi rmaram a efi ciência do tratamento térmico. Não se observou atividade da POD na polpa pasteurizada, devendo o controle de qualidade do produto ser feito com base nos parâmetros microbiológicos e de cor da polpa.

  2. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    Directory of Open Access Journals (Sweden)

    Diana Palaversich

    2013-12-01

    Full Text Available O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e se reflete em áreas da cultura como as artes plásticas e a literatura, produzindo um novo tipo de expressão artística ou narrativa, que tanto pode ser oportunista e contribuir para a banalização da violência do narcotráfico como ser crítica e narrar o impacto individual e coletivo do tráfico de drogas, narrar a desenfreada e violenta realidade mexicana sem cair no estilo da imprensa marrom, do folclore ou dos lugares comuns dos romances de ação.

  3. CILADAS DA DIFERENÇA

    Directory of Open Access Journals (Sweden)

    Antônio Flávio Pierucci

    1990-12-01

    Full Text Available Este artigo procura analisar os efeitos perversos da apropriação pela esquerda de um tema definidor das tradições de direita, a saber, a diferença. Com base no caso Sears (EUA e no caso Le Pen (França, o autor aponta para as armadilhas racistas e sexistas presentes nos discursos que focalizam e enfatizam a diferença, sobretudo num período histórico de reemergência dos conservadorismos que, por sua vez, se apropriam do argumento da diferença, dirigindo-o contra os próprios movimentos de esquerda.

  4. O mito fascista da romanidade

    OpenAIRE

    Giardina, Andrea

    2008-01-01

    Este ensaio procura analisar como o mito de Roma foi utilizado por Mussolini para criar uma "especificidade" fascista que coincidisse com uma "especificidade" da nação italiana. Práticas rituais, gestos, valores, símbolos foram retomados, de forma variamente arbitrária, para construir um mito que gerava novas ambigüidades, e que constituiu, à diferença do nazismo, um empecilho para a própria sobrevivência da "romanidade" após Mussolini.

  5. Cinco discursos da digitalidade audiovisual

    Directory of Open Access Journals (Sweden)

    Gerbase, Carlos

    2001-01-01

    Full Text Available Michel Foucault ensina que toda fala sistemática - inclusive aquela que se afirma “neutra” ou “uma desinteressada visão objetiva do que acontece” - é, na verdade, mecanismo de articulação do saber e, na seqüência, de formação de poder. O aparecimento de novas tecnologias, especialmente as digitais, no campo da produção audiovisual, provoca uma avalanche de declarações de cineastas, ensaios de acadêmicos e previsões de demiurgos da mídia

  6. Cinco discursos da digitalidade audiovisual

    Directory of Open Access Journals (Sweden)

    Gerbase, Carlos

    2001-01-01

    Full Text Available Michel Foucault ensina que toda fala sistemática - inclusive aquela que se afirma “neutra” ou “uma desinteressada visão objetiva do que acontece” - é, na verdade, mecanismo de articulação do saber e, na seqüência, de formação de poder. O aparecimento de novas tecnologias, especialmente as digitais, no campo da produção audiovisual, provoca uma avalanche de declarações de cineastas, ensaios de acadêmicos e previsões de demiurgos da mídia.

  7. Escola Vila : pedagogia da sustentabilidade

    OpenAIRE

    Rocha, Ilka Maria Zoza

    2007-01-01

    Esta pesquisa teve como objetivo conhecer de que forma a educação ambiental é colocada em prática na Escola VILA de Fortaleza, buscando compreender o seu significado como conteúdo transversal e as relações que as crianças e as demais pessoas da comunidade escolar estabelecem com o ambiente, por meio da observação de como atuam e se comportam no cotidiano. Inicia situando o leitor no contexto educacional: leis e exigências, seguido dos conceitos: relação homem x meio ambiente...

  8. da Vinci decoded: does da Vinci stereopsis rely on disparity?

    Science.gov (United States)

    Tsirlin, Inna; Wilcox, Laurie M; Allison, Robert S

    2012-11-01

    In conventional stereopsis, the depth between two objects is computed based on the retinal disparity in the position of matching points in the two eyes. When an object is occluded by another object in the scene, so that it is visible only in one eye, its retinal disparity cannot be computed. Nakayama and Shimojo (1990) found that a precept of quantitative depth between the two objects could still be established for such stimuli and proposed that this precept is based on the constraints imposed by occlusion geometry. They named this and other occlusion-based depth phenomena "da Vinci stereopsis." Subsequent research found quantitative depth based on occlusion geometry in several other classes of stimuli grouped under the term da Vinci stereopsis. However, Nakayama and Shimojo's findings were later brought into question by Gillam, Cook, and Blackburn (2003), who suggested that quantitative depth in their stimuli was perceived based on conventional disparity. In order to understand whether da Vinci stereopsis relies on one type of mechanism or whether its function is stimulus dependent we examine the nature and source of depth in the class of stimuli used by Nakayama and Shimojo (1990). We use three different psychophysical and computational methods to show that the most likely source for depth in these stimuli is occlusion geometry. Based on these experiments and previous data we discuss the potential mechanisms responsible for processing depth from monocular features in da Vinci stereopsis.

  9. Efeitos da acupuntura no tratamento da ansiedade: revisao integrativa

    Directory of Open Access Journals (Sweden)

    Sueli Leiko Takamatsu Goyatá

    2016-06-01

    Full Text Available RESUMO Objetivo: avaliar as evidências científicas disponíveis na literatura sobre os efeitos da acupuntura no tratamento da ansiedade e a qualidade desses estudos. Método: revisão integrativa, realizada nas bases/bancos de dados CINAHL, LILACS, PUBMEDPICO, SciELO, The Cochrane Library, no período entre 2001 a 2014. Os descritores anxiety, acupuncture therapy, acupuncture e anxiety disorders foram combinados entre si para garantir a ampla busca de estudos primários. Resultados: dos 514 artigos, 67 foram selecionados para leitura na íntegra e 19 incluídos. Desses, 11 apresentaram forte nível de evidência. Dos seis artigos de estudos clínicos randomizados, cinco apresentaram qualidade classificada como razoável. Dois estudos utilizaram acupunturistas enfermeiros para a aplicação da intervenção. Os resultados mostram efeitos positivos e estatisticamente significativos do uso da acupuntura para tratamento de indivíduos com ansiedade. Conclusão: a acupuntura parece ser um tratamento promissor para a ansiedade, no entanto, há necessidade de melhorar a qualidade metodológica das pesquisas nessa temática.

  10. Efeito da urina de vaca no estado nutricional da alface

    Directory of Open Access Journals (Sweden)

    Nelson Licínio C. de Oliveira

    2010-08-01

    Full Text Available Existem diversos relatos da utilização da urina de vaca em hortaliças, todavia sua eficácia carece de comprovação. Objetivou-se avaliar o efeito da urina de vaca no estado nutricional da alface. O experimento foi constituído de 12 tratamentos, esquema de parcelas subdivididas, em blocos ao acaso, com quatro repetições. Nas parcelas foram alocadas as vias de aplicação (solo ou foliar e nas subparcelas as concentrações das soluções (0,00; 0,25; 0,50; 0,75; 1,00 e 1,25% v/v. Aplicou-se 60 mL de solução/planta, divididos em cinco aplicações de 5; 5; 10; 20 e 20 mL/planta, aos 7, 14, 21, 28 e 35 após o transplante, respectivamente. Durante o ciclo avaliou-se o índice SPAD e na colheita a massa da matéria seca de cabeça (MSCA e os teores de N, P, K, Ca, Mg, S, Na, Zn, Fe, Mn, Cu e B na matéria seca das folhas (MSF, caule (MSC e raízes (MSR. Em ambas as vias de aplicação o índice SPAD apresentou incremento linear às concentrações e resposta quadrática ao longo do tempo. A MSCA teve comportamento linear às concentrações, com aumento de 25,9 e 35,4% nas aplicações via foliar e solo, respectivamente. Não houve efeito de concentrações sobre teores de nutrientes na MSF e MSC. Na MSR, via solo, os teores de P e K apresentaram pontos de máximo enquanto Fe e Mn de mínimo; o Na apresentou incremento linear às concentrações via foliar. Os efeitos da urina sobre o crescimento da alface provavelmente são devidos a fatores outros que não somente a quantidade de nutrientes veiculados nas soluções.

  11. Efeito agudo da suplementacao da cafeina no desempenho da forca muscular e alteracoes cardiovasculares durante o treino de forca

    National Research Council Canada - National Science Library

    Materko, W; Santos, E.L

    2011-01-01

    A proposta do presente estudo foi avaliar o efeito agudo da cafeina no desempenho da forca muscular, paralelamente a possiveis alteracoes hemodinamicas ao longo de uma sessao de treino de forca muscular...

  12. Laser de diodo no tratamento da retinopatia da prematuridade

    Directory of Open Access Journals (Sweden)

    Liarth Josilene de Carvalho Soares

    2001-01-01

    Full Text Available Objetivo: Determinar a eficácia do laser de diodo e suas complicações no tratamento da retinopatia da prematuridade, estágio 3 limiar. Métodos: De 348 crianças pré-termo examinadas na Clínica Oftalmológica do Hospital Getúlio Vargas e Instituto de Olhos do Piauí, em Teresina, Piauí, no período de julho/89 a março/99, 152 (43,7% apresentaram retinopatia da prematuridade. As crianças com retinopatia da prematuridade no estágio 3 limiar foram submetidas a laserablação retiniana com laser de diodo indireto, no centro cirúrgico, sob anestesia geral. Resultados: Vinte crianças (38 olhos foram submetidas a laserablação retiniana. Doze pacientes (80,0% tiveram regressão da retinopatia e três (20,0% evoluíram para o estágio 5. Cinco crianças não retornaram para controle, sendo excluídas do estudo quanto aos resultados do laser. Não foram observadas complicações oculares. Cinco crianças apresentaram apnéia relacionada à anestesia. Conclusões: Neste grupo de crianças, o laser de diodo foi eficaz em 80,0% dos pacientes tratados. As complicações encontradas (cinco casos de apnéia se relacionaram possivelmente à anestesia geral.

  13. A identidade à flor da pele: etnografia da prática da tatuagem na contemporaneidade

    Directory of Open Access Journals (Sweden)

    Andrea Lissett Pérez

    2006-04-01

    Full Text Available No presente artigo, realiza-se uma descrição etnográfica da prática da tatuagem na contemporaneidade, a partir de uma perspectiva que prioriza as noções da prática, das interações e das experiências vividas durante o processo de ser tatuado. A reflexão tenta reconstruir uma visão total da prática da tatuagem que abrange o mundo subjetivo e as dinâmicas sociais como partes constitutivas desse ato. Entre as idéias conclusivas estão, de um lado, o surgimento de uma nova normalidade estética e vivencial no seio da sociedade ocidental e, de outro, a configuração de uma nova subjetividade, a dos "tatuados", como um processo interativo, inovador, emotivo e reflexivo, em que o corpo se converte em uma forma de expressão e construção do sujeito.This article provides a descriptive account of contemporary tattooing, based on a perspective that prioritizes the notion of practice, as well as the interactions and experiences involved in the process of being tattooed. The analysis attempts to rebuild a holistic view of tattooing, combining subjective processes and social dynamics as equally constitutive parts of this activity. Among the conclusions reached are: (a the emergence of tattooing as a new aesthetic norm and a lived experience at the heart of the western society; and (b the configuration of a new subjectivity, the ‘tattooed,’ as an interactive, innovative, emotional and reflexive process in which the body is converted into a form of expressing and constructing the subject.

  14. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  15. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  16. Novas e velhas abordagens da teoria da escolha e da utilidade

    OpenAIRE

    Wagner, Sergio Artur Luz

    2009-01-01

    Até pouco tempo havia apenas um posicionamento frente o dilema da escolha envolvendo o risco, que era baseado no processo do indivíduo racional. Atualmente, com novas técnicas de compreensão do risco e principalmente do complexo instituto da incerteza, já é possível de se delimitar o que leva as pessoas a decidirem e a se equivocarem em alguns processos de decisão. Neste trabalho apresentaremos um pequeno resumo histórico dos processos, visando certa linha de pensamento, no que tange aos meca...

  17. Mulheres da Norô

    Directory of Open Access Journals (Sweden)

    Flavia Liberman

    Full Text Available O projeto Cartografias femininas: ações territoriais junto às mulheres da região noroeste de Santos realiza diferentes ações em uma região que apresenta vulnerabilidade social e ambiental na cidade de Santos. Envolvendo docentes e estudantes de diferentes cursos de graduação da área da saúde da Universidade Federal de São Paulo, campus Baixada Santista, teve como resultado uma Exposição Fotográfica itinerante cujas imagens explicitam um processo de construção de vínculos com as participantes. A fotógrafa Nice Gonçalvez, do Instituto Arte no Dique, acompanhou e fotografou momentos desta experiência, oferecendo-nos um material delicado que retrata seus rostos, corpos, detalhes e expressividades. Esta exposição ofereceu, às mulheres, uma oportunidade de reconhecerem-se como protagonistas ativas e fortes em todo o processo, tornando-as visíveis para além das fronteiras de suas casas, de seu bairro ou, mesmo, de sua região.

  18. Tratamento da dor em queimados

    Directory of Open Access Journals (Sweden)

    Rodrigo José Alencar de Castro

    2013-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Apesar dos avanços, ainda é observado manejo analgésico inadequado dos pacientes com queimaduras. O objetivo desta revisão foi coletar dados sobre tratamento da dor em queimados. CONTEÚDO: Foi feita revisão sobre os mecanismos de dor, avaliação do paciente com queimadura e o tratamento farmacológico e não farmacológico. CONCLUSÕES: O manejo da dor em pacientes vítimas de queimaduras ainda é um desafio por parte da equipe multiprofissional. A avaliação frequente e contínua da resposta apresentada pelo paciente é muito importante, tendo em vista os vários momentos por que passa o paciente internado em decorrência de uma queimadura, além de uma terapêutica combinada com medicações analgésicas e medidas não farmacológicas. Entender a complexidade de alterações fisiopatológicas, psicológicas e bioquímicas apresentadas por um paciente em tratamento de queimadura é o primeiro passo para alcançar o sucesso no seu manejo analgésico.

  19. Leonardo da Vinci and the Downburst.

    Science.gov (United States)

    Gedzelman, Stanley David

    1990-05-01

    Evidence from the drawings, experiments, and writings of Leonardo da Vinci are presented to demonstrate that da Vinci recognized and, possibly, discovered the downburst and understood its associated airflow. Other early references to vortex flows resembling downbursts are mentioned.

  20. A LINGUAGEM TÉCNICA DA ECONOMIA

    Directory of Open Access Journals (Sweden)

    Tânia Pitombo de Oliveira

    2011-07-01

    Full Text Available Monografia de linguística que trata da linguagem de jornal dentro da área econômica. Focaliza essencialmente o léxico da linguagem técnica desta área de interesse, de um artigo de jornal. Elaborada para a disciplina de Linguística V, Departamento de Letras, Centro de Ciências Humanas, Letras e Artes da Universidade Estadual de Maringá, em 1985.

  1. BASES DE UMA TEORIA DO DELITO A PARTIR DA FILOSOFIA DA LINGUAGEM

    OpenAIRE

    Busato, Paulo César; Universidade Federal do Paraná, Curitiba/PR

    2012-01-01

    O presente artigo trata das bases que conduzem à estruturação de uma teoria do delito a partir da filosofia da linguagem. Apresenta-se a estrutura formada pela ação significativa, a liberdade de ação e a teoria da norma, bem como uma composição breve da teoria do delito.

  2. Historicidade da filosofia em Hegel e Heidegger

    Directory of Open Access Journals (Sweden)

    Christian Iber

    2017-02-01

    Full Text Available Gostaria de discutir, em forma de teses, a temática da historicidade da filosofia em contraste e na sua divergência em Hegel e Heidegger. Diferente do historicismo, que não soluciona o problema da historicidade da filosofia, porque ele dissolve tendencialmente a filosofia na história da filosofia e não coloca em especial a questão da verdade, Hegel e Heidegger desenvolvem uma teoria genuinamente filosófica da história da filosofia do interesse filosófico pela verdade. Esse interesse genuinamente filosófico pela verdade segue do seu conceito respectivo de filosofia, que inclui em ambos uma posição crítica à Modernidade. Ambos os pensadores não são apenas pensadores modernos, mas também pensadores críticos da Modernidade, de uma Modernidade que entrou no estado de uma autorreflexão. Em Hegel e Heidegger, a filosofia da história da filosofia é ao mesmo tempo a chave para uma filosofia crítica de Modernidade da história.

  3. Fases da história da fotografia e a questão da aura, segundo Walter Benjamin

    Directory of Open Access Journals (Sweden)

    Orlando José Ribeiro de Oliveira

    2014-07-01

    Full Text Available Este artigo aborda as fases da história da fotografia propostas por Walter Benjamin, no ensaio Pequena História da Fotografia, e discute as transformações que atingiram a obra de arte na modernidade, à luz do conceito de aura. A periodização estabelecida por Benjamin - apogeu, declínio, revitalização - é ilustrada com trabalhos dos fotógrafos referidos pelo autor no texto em que visa à “compreensão real da essência da arte fotográfica”.

  4. Prevenção da anemia ferropriva em lactentes da Zona da Mata Meridional de Pernambuco

    OpenAIRE

    de Lourdes Perez Diaz Teixeira, Maria

    2007-01-01

    Esta tese é apresentada sob a forma de um artigo de revisão da literatura e dois artigos originais. A revisão da literatura discorre sobre a importância da deficiência de ferro e a anemia dela decorrente para os lactentes, bem como das estratégias preventivas que têm sido preconizadas. O primeiro artigo original aborda o papel da alimentação, mais especificamente do aleitamento materno exclusivo, na prevenção da anemia no lactente. Aborda ainda a relação entre a anemia materna ...

  5. Clarice Lispector - A hora da estrela: o discurso no panfleto da exposição

    Directory of Open Access Journals (Sweden)

    Lucília Maria Sousa Romão

    Full Text Available Este trabalho intenta discutir, à luz da Análise do Discurso francesa, como o conceito de memória e heterogeneidade nos atos de linguagem pode contribuir para uma reflexão sobre os estudos da informação e da documentação. Partindo de recortes do panfleto da exposição sobre Clarice Lispector a hora da estrela, realizada no segundo semestre de 2007 pelo Museu da Língua Portuguesa (Estação da Luz, São Paulo, interpretamos as várias vozes que circulam e sustentam o sujeito e o sentido.

  6. História da fisioterapia em Portugal: da origem a 1966

    OpenAIRE

    Fonseca, João Pedro da

    2012-01-01

    Mestrado em Fisioterapia. Em 1851, Gleich usa pela primeira vez o termo de Fisioterapia. Surge num momento em que a arte de curar o campo médico, procurava corresponder à necessidade que a sociedade tinha de cuidados de saúde mais eficazes. A área médica procurou a exclusividade da ginástica, da aplicação da mecanoterapia, da electroterapia, da massagem e da hidroterapia. O termo Fisioterapeuta surge em Portugal em 1918 e Serviço de Fisioterapia em 1917 num Instituto da Casa Pia de Lisboa ...

  7. EFFECTS OF NITROGEN ON PHENOLIC ACID AND PROTEIN CONTENT IN BARLEY (Hordeum vulgare L. ) GRAIN%氮素对大麦籽粒中酚酸和蛋白质含量的影响

    Institute of Scientific and Technical Information of China (English)

    王祥军; 齐军仓; 贾力群; 王倩; 王琴; 马建峰; 王仙; 曹连莆

    2011-01-01

    Nitrogen is one of the necessary nutrient elements for crop growth. The primary and secondary metabolisms of plant are regulated by nitrogen nutrient levels. As important secondary metabolites, phenolic acids play significant roles in plant resistances, and potentially contribute to barley qualities. However, little is known concerning effects of nitrogen on barley (Hordeum vulgare L. ) phenolic acids. In the present study, two barley cultivars were used, and seven nitrogen concentration treatments (0,412.5, 825.0, 1237.5, 1650, 3300, and 4950mg/L, respectively) under in vitro spike culture were conducted to investigate the effects of nitrogen on phenolic acid and protein contents in barley grain. Results showed that the development of barley grain was inhibited under high nitrogen levels (3300 ~ 4950mg/L), and grain weight decreasing significantly was as the response. Total hydroxybenzoic acid content (THBA), total hydroxycinnamic acid content (THCA), total phenolic acid content (TPA) and THBA/THCA ratio were all significantly affected by nitrogen concentration, cultivar and the interaction between nitrogen concentration and cultivar. Four indexes above were all significantly positively correlated with nitrogen concentration. Except for hordein content ( HC ), the protein indexes of crude protein content (CPC), salt-soluble protein content (SSPC), and glutelin content (GC) were all significantly affected by nitrogen concentration, moreover, SSPC and GC were significantly affected by cultivar and the interaction between nitrogen concentration and cultivar. Excluding HC and GC in the four indexes, CPC and SSPC were significantly positive-correlated with nitrogen concentration. The results also indicated that phenolic acid contents (including THBA, THCA, and TPA) in barley grain increased cooperated with CPC and SSPC when the nitrogen nutrient level went up.%采用穗培养技术在7个氮素(NH4NO3为氮源)浓度水平(N1:0mg/L;N2:412.5 mg/L;N3:825.0mg/L;N4

  8. Da ordem. Da cidade. Da literatura: personagens à beira do "ruim do mundo"

    Directory of Open Access Journals (Sweden)

    Eliana Kuster

    2007-12-01

    Full Text Available As grandes cidades estão doentes. Seus sintomas: a quebra da sociabilidade e a irrupção rotineira da violência. Diante disso, ecoa na sociedade um clamor por ordem. No mesmo momento em que a polícia põe a tropa na rua, os literatos criam personagens que dão voz à sensação crescente de que a cidade está deixando de ser uma referência à constituição das identidades urbanas. É a partir da literatura, em especial da obra do escritor Rubem Fonseca, que iremos perscrutar as possibilidades apresentadas pela cidade para o convívio humano.The great cities are sick. Its indications: the sociability in addition and the routine irruption of the violence. Ahead of this, a outcry for order echoes in the society. At the same moment where the policy goes to the street, the writers create personages who give voice to the increasing sensation of that the city is leaving of being a reference to the constitution of the urban identities. It is from literature, in special of the writer Rubem Fonseca, that we will go to investigate the possibilities presented for the city for the human conviviality.

  9. O Património Cultural da Freguesia da Cumieira

    OpenAIRE

    Silva, José Emílio Esteves da

    2010-01-01

    Dissertação de Mestrado em Ciências da Cultura O património cultural, material e imaterial, caracteriza e identifica uma comunidade através dos tempos. A freguesia da Cumieira, concelho de Santa Marta de Penaguião, possui, na sua área, um vasto património constituído por achados arqueológicos e edificações e por um conjunto de saberes ancestrais, ainda utilizados no seu quotidiano, que faz a história do seu povo. Exemplos dessa riqueza são os indícios de povoamento romano e mouro, a igreja...

  10. O papel da geografia em face da crise ambiental

    Directory of Open Access Journals (Sweden)

    RAQUEL DEZIDÉRIO SOUTO

    Full Text Available resumo Diante da crise ambiental atual, diversas disciplinas científicas têm se voltado para sua análise, a fim de apontar soluções para dirimir ou minimizar os danos ambientais e sociais causados pelas atividades econômicas e por outros tipos de fatores de pressão ambiental. Este artigo propõe-se inicialmente a mostrar sucintamente como mudou a visão geográfica predominante no mundo ocidental a respeito da relação entre as populações humanas e o ambiente. Uma mudança de visão que foi reflexo das mudanças que estavam em curso na geografia como um todo, resguardadas as diferenças entre os países. Discute-se ainda que a crise ambiental é uma crise do conhecimento, como afirmam cada vez mais autores. Este texto culmina com as virtudes e limitações da geografia na busca desse entendimento, no intuito de colaborar para seu avançar.

  11. A arte da fuga: Os mecanismos da liquidez

    Directory of Open Access Journals (Sweden)

    José Maria Castro Caldas

    2012-10-01

    Full Text Available A ideia de “liquidez” enquanto característica da fase actual da modernidade, presente na obra mais recente de Zygmunt Bauman, convida a uma leitura cruzada entre este autor e Keynes. Quer em Bauman, quer em Keynes, a liquidez aplica-se a relações que podem ser facilmente revertidas, ou revertidas a baixo custo, e a sistemas que, sendo caracterizados pela precariedade dos laços que unem os seus elementos constituintes, tendem a ser, eles próprios, instáveis e precários. Em ambos os autores, a liquidez e a especulação surgem como respostas racionais à incerteza e, ao mesmo tempo, como estratégias individuais que contribuem para o aumento do risco sistémico. As duas abordagens são complementares e coerentes. A leitura cruzada sugere a existência de mecanismos da liquidez transversais a diferentes domínios institucionais cuja identificação é aqui ensaiada.

  12. Dye tracer and morphophysical properties to observe water flow in a Gleyic Luvisol Fluxo de água em um Gleyic Luvisol usando traçador e sua relação com as propriedades físicas e morfológicas do solo

    Directory of Open Access Journals (Sweden)

    Monica Martins Silva Salvador

    2011-04-01

    Rostock (nordeste da Alemanha num solo onde cultiva-se milho (Zea mays L. e cevada (Hordeum spp.. Um dia após a infiltração do traçador, perfis de solo foram escavados no local do TI e do DI para observar o fluxo da água deixado pelo do traçador no solo. O objetivo era verificar se os mosqueados vermelhos e partes esbranquiçadas cor-padrão do subsolo do Gleyic Luvisol, resultante da água estagnada temporariamente, poderia estar relacionada ao fluxo da água visualizados pelo traçador e se a cor do solo poderia estar relacionada a outras propriedades físicas do solo. A estrutura biogênica do solo foi a principal rota de transporte conduzindo água e solutos em profundidade e em menor tempo. Esses caminhos tiveram menor densidade do solo e menor resistência do que as áreas vermelhas e esbranquiçadas adjacentes do subsolo do Gleyic Luvisol. Áreas vermelhas foram relacionadas com o transporte devido apresentarem maior conteúdo de água após o teste de infiltração. Entretanto, não houve diferenças entre as propriedades físicas do solo das áreas brancas e vermelhas. Assumiu-se que as áreas vermelhas participaram do transporte de água porque absorveram água do fluxo adjacente, ou seja, dos bioporos.

  13. Estudo fitoquímico e avaliação da atividade anticolinesterásica de extratos da casca da raiz da Mimosa tenuiflora (Willd.) Poiret

    OpenAIRE

    Neves, Maiane dos Santos

    2015-01-01

    Mimosa tenuiflora (Willd.) Poiret (jurema preta) é uma espécie da família Fabaceae nativa da Caatinga, encontrada largamente em todo nordeste brasileiro. Na medicina popular, as cascas do caule e da raiz da jurema preta são utilizadas no tratamento de diversas enfermidades, como queimaduras e inflamações, além de ser empregada tradicionalmente como bebida em rituais indígenas. Com relação à casca da raiz, há poucos estudos descritos na literatura sobre seu perfil químico e propriedades biológ...

  14. Teoria da adequação econômica da conduta: significado econômico da conduta em face da tutela penal antitruste

    OpenAIRE

    Luiz da Silva, Ivan

    2009-01-01

    Essa tese tem por objetivo o desenvolvimento da teoria da adequação econômica da conduta no direito penal econômico. Vale-se de uma abordagem interdisciplinar abrangendo a Economia, o direito econômico e o direito penal. Para alcançar o desiderato a investigação analisou a intervenção do direito penal em face da atividade econômica e, em especial, os fundamentos da tutela penal antitruste, para fins de estabelecer os contornos teóricos necessários à aplicação das premissas fund...

  15. Los daños morales

    OpenAIRE

    Gallo Segoviano, Gerardo

    2017-01-01

    El daño moral es un daño cuya veracidad es muy difícil de demostrar en el mundo material; hay numerosas teoría sobre cuándo determinar la existencia del daño moral, quiénes son los sujetos susceptibles de sufrir este daño y de qué forma podemos entrar a valorar pecuniariamente este daño. Abordadas las cuestiones generales del daño, el trabajo se orienta hacia la concreción del daño moral que resulta de la lesión de los derechos al honor, a la intimidad personal y familiar y a la propia imagen...

  16. Aspectos incomuns da paracoccidioidomicose infantil

    Directory of Open Access Journals (Sweden)

    Achiléa Lisboa Bittencourt

    1987-12-01

    Full Text Available São relatados dois casos de paracoccidioidomicose (PCM infantil. Em um deles, a principal manifestação da doença foi tumoração abdominal, simulando linfoma maligno não Hodgkin. O outro apresentou acentuado envolvimento articular, com ruptura da cápsula. Representam o segundo e terceiro casos de PCM infantil observados na Bahia, ambos procedentes de áreas urbanas.The authors present two cases of infantil para-coccidioidomycosis. In one case the main presentation was an abdominal mass that mimicked non- Hodgkin lymphoma. In the other case the child had a joint swelling with rupture of the capsule and the clinical diagnosis was piogenic arthritis. They represent the second and third cases of infantile paracoccidioidomycosis observed in the state of Bahia, all coming from urban areas.

  17. ASPECTOS PSICOSSOCIAIS DA VELHICE LGBT

    Directory of Open Access Journals (Sweden)

    Ludgleydson Fernandes de Araújo

    2016-09-01

    Full Text Available A população idosa composta por lésbicas, gays, bissexuais e transgêneros (LGBT vem aumentando nas últimas décadas não somente pela redução da mortalidade na infância e vida adulta, mas pelo melhor acesso aos serviços de saúde (Kimmel, 2015. Apesar dos avanços das leis que garantem iguais direitos as pesssoas de diferentes orientações sexuais, as pessoas idosas LGBT ainda é uma categoria pouco visível entre os pesquisadores da Geriatria e da Gerontologia. Deste modo, a presente resenha apresentará o livro “The lives of LGBT older adults: understanding challenges and resilience” que foi organizando pelas pesquisadoras americanas Nancy A. Orel (Bowling Green State University, Bowling Green, OH e a Christine A. Fruhauf (Department of Human Development & Family Studies, Colorado State University, trata-se de uma publicação pioneira e alvissareira que busca preencher a escassez de publicações versando sobre a velhice e o processo de envelhecimento das pessoas LGBT.

  18. Os mundos sociais da empresa

    Directory of Open Access Journals (Sweden)

    Florence Osty

    2008-11-01

    Full Text Available Ao contrário do modo comum que a sociologia trata as empresas, tratamos a empresa, neste artigo, como um universo social que, além de constituir um universo de relações de força, também é um espaço de socialização irredutível à sua dimensão propriamente agonística. Destarte, tratando a empresa como um universo de relações sociais - o que chamamos de "mundo social" -, apresentamos uma tipologia geral que pretende descrever os modos gerais de funcionamento das empresas. Para construir essa tipologia, mobilizamos grande parte das pesquisas e dos dados coletados ao longo de mais de 10 anos de pesquisas em nosso centro. Assim, construímos cada tipo analisando a lógica interna das empresas analisadas, e as diferenciamos. A partir de então, comparamos os vários tipos e ressaltamos suas especificidades. Apresentamos também uma análise das transformações específicas que passam alguns modelos de empresa, e buscamos ressaltar suas causas conjunturais e internas. Concluímos apresentando considerações acerca da possibilidade da aplicação prática da tipologia aqui proposta para a gestão efetiva das empresas.

  19. Doença celíaca: avaliação da obediência à dieta isenta de glúten e do conhecimento da doença pelos pacientes cadastrados na Associação dos Celíacos do Brasil (ACELBRA Celiac disease: evaluation of compliance to a gluten-free diet and knowledge of the disease in celiac patients registered at the Brazilian Celiac Association (BCA

    Directory of Open Access Journals (Sweden)

    Vera Lucia SDEPANIAN

    2001-10-01

    Full Text Available Racional — A obediência à dieta isenta de glúten previne a ocorrência de complicações malignas e não-malignas. Objetivo - Avaliar a obediência à dieta isenta de glúten e o conhecimento teórico acerca da doença celíaca e seu tratamento pelos pacientes cadastrados na Associação dos Celíacos do Brasil (ACELBRA. Métodos - Foi enviado por correio um questionário a respeito da obediência à dieta isenta de glúten e do conhecimento teórico da doença celíaca e seu tratamento a 584 membros cadastrados na ACELBRA. Resultados - Dos 534 (91,4% questionários recebidos, foram analisados 529 (90,6%. Quanto à obediência à dieta, 69,4% dos pacientes responderam que nunca ingerem glúten e 29,5% que não obedecem à dieta. A proporção de pacientes que ingerem glúten freqüentemente ou sem restrição alguma é maior entre aqueles com idade igual ou maior a 21 anos (17,7% do que os com idade menor (9,9%. A freqüência de obediência à dieta foi maior quando o intervalo de tempo em que foi estabelecido o diagnóstico da doença foi inferior a 5 anos. O intestino delgado foi assinalado como o principal órgão afetado na doença celíaca por 82% dos pacientes. Os principais sintomas assinalados foram diarréia (96,6%, emagrecimento (93,4%, barriga inchada (90,4%, anemia (68,1% e vômitos (59,6%. Apenas 59,0% concordaram com a existência de predisposição genética. Segundo 90,4% das respostas, a doença é permanente e 96,2% assinalaram que a dieta deve ser totalmente isenta de glúten; 67,1% responderam que o glúten é uma proteína que está presente, segundo 92,1% dos inquéritos, no trigo, centeio, cevada e aveia. Observou-se maior proporção de obediência à dieta quando há conhecimento da doença e dieta. A biopsia de intestino delgado foi considerada necessária por apenas 67,5% dos pacientes, observando-se maior freqüência de obediência à dieta nos pacientes que realizaram pelo menos uma biopsia de intestino delgado

  20. EXPANSÃO DA SOJA NO TERRITÓRIO NACIONAL: O PAPEL DA DEMANDA INTERNACIONAL E DA DEMANDA INTERNA

    Directory of Open Access Journals (Sweden)

    Margarida de Cássia Campos

    2010-01-01

    Full Text Available Produto das discussões do segundo capítulo da tese de doutorado intitulada A Embrapa/Soja em Londrina (PR. Pesquisa agrícola dum país moderno que analisou a criação da Embrapa/Soja em Londrina, como parte integrante do projeto nacional desenvolvimentista, idealizado a partir da década de 1930. Discutem-se os fatores da expansão da soja no Brasil, a fim de entender quais agentes externos e internos foram responsáveis pelo incentivo à expansão do plantio de soja no território brasileiro, no decorrer das últimas décadas, tendo em vista a importância dessa Commodity como geradora de divisas e importante produto para o mercado interno em franca expansão. Defende-se que a expansão da soja no território nacional a partir da década de 1960 teve influência direta da demanda internacional por essa oleaginosa, além de atender à demanda interna, proveniente da crescente urbanização e mudança nos hábitos de alimentação da população brasileira.

  1. Formas obstrutivas da neurocisticercose ventricular

    Directory of Open Access Journals (Sweden)

    Sylvio de Vergueiro Forjaz

    1961-03-01

    Full Text Available A incidência da cisticercose cerebral entre os consulentes orientados para o Ambulatório de Neurologia da Faculdade de Medicina de Ribeirão Prêto é muito alta. Trata-se de moléstia que, pela gravidade de seus sintomas, pela facilidade de infestação e pela precariedade dos recursos terapêuticos, representa um probiema individual e social grave nesta região. Muitos aspectos da moléstia já foram esclarecidos, sendo grande a contribuição de autores brasileiros. Certas feições da moléstia, porém, ainda comportam maiores estudos. É nosso objetivo oferecer uma contribuição ao estudo das formas intraventriculares de neurocisticercose. Relatamos as observações de 4 pacientes com queixas de hipertensão intracraniana periódica e com achados liquóricos e radiológicos compatíveis com a suspeita de cisticercose cerebral. Exames subsidiários (pneumencefalografia ou ventriculografia mostraram que em dois dêstes pacientes havia bloqueio do aqueduto de Sylvius (casos 3 e 4 e que, nos outros dois, havia exclusão de um ventrículo lateral por bloqueio do buraco de Monro (caso 1 e da confluência dos cornos temporal e occipital (caso 2. Nos dois casos em que havia bloqueio na parte alta do aqueduto de Sylvius os pacientes acusavam dificuldade no olhar vertical (síndrome de Parinaud. O tratamento cirúrgico permitiu desfazer o bloqueio em 3 casos (casos 2, 3 e 4; no caso 1 as punções feitas após a intervenção cirúrgica parecem ter agido benèficamente no sentido de restabelecer o trânsito do liqüido cefalorraquidiano. Excluindo um paciente (caso 2 que faleceu em caquexia 3 meses após a operação e no qual o exame necroscópico mostrou lesões pregressas imputáveis apenas à hipertensão aguda sem lesões cisticercóticas, os outros casos evoluíram para a cura.

  2. Da onda da gestão da qualidade a uma filosofia da qualidade da gestão: Balanced Scorecard promovendo mudanças

    Directory of Open Access Journals (Sweden)

    Andréa Cavalcanti Correia Lima

    2004-06-01

    Full Text Available No final da década de 80 a Gestão da Qualidade Total (GQT era apresentada como capaz de resolver todos os problemas e atender a todas as necessidades da gestão das organizações. Buscando solucionar problemas de gestão não equacionados pela GQT, muitas organizações começam a adotar o Balanced Scorecard (BSC. Uma questão ainda não discutida com profundidade no mundo acadêmico é a viabilidade de integração desses dois modelos. O presente artigo discute a possibilidade de integração dessas duas ferramentas, verificando as melhorias que podem alcançar, principalmente no gerenciamento da estratégia da organização. Assim sendo, realizou-se estudo de caso no Caesar Park Hotel Fortaleza (CPHF, empresa que vêm adotando com sucesso os dois modelos. A pesquisa revela que é possível integrar os princípios da GQT com os do BSC, à medida que os fundamentos de ambos se complementam, sendo assim a utilização conjunta das ferramentas propicia melhor gerenciamento da estratégia da organização.In recent years, many organizations have been managed according to the principles of Total Quality Management (TQM, which became known around the globe in the 1980's, when looking for explanations for the so-called "Japanese miracle". TQM was presented as being capable of solving all problems and attending to all company management needs, a stage that seems outdated now. In the search for a model that would allow them to analyze and follow up the implementation of organizational strategies, without remaining limited to Quality indicators, many companies started to adopt the Balanced Scorecard (BSC. Companies using TQM question whether it is viable together with the BSC. In order to contribute to a solution to this question, this article discusses the possibility of aligning these two tools. Therefore, a case study was carried out at the Caesar Park Hotel Fortaleza, a company that implanted TQM in 1997 and started to adopt the BSC in 2000. The

  3. Contribuições da epistemologia bachelardiana no estudo da história da Óptica

    OpenAIRE

    Melo,Ana Carolina Staub de; Luiz O.Q. Peduzzi

    2007-01-01

    O presente artigo explora um diálogo entre a história e a filosofia da ciência. Nesta perspectiva, apresenta uma articulação entre a história da óptica e as principais características da filosofia histórica de Gaston Bachelard, dando ênfase: aos períodos de rupturas e descontinuidades presentes no constante confronto entre o modelo corpuscular e ondulatório da luz; à permanente retificação do erro - e ao novo conceito de verdade presente na construção da concepção sobre a natureza da luz -; à...

  4. Fractura da cortical alveolar resultante da exodontia de dentes anquilosados

    OpenAIRE

    2010-01-01

    Monografia apresentada à Universidade Fernando Pessoa para obtenção do grau Licenciado em Medicina Dentária A anquilose dento-alveolar constitui uma condição patológica que consiste na fusão anatómica entre o cemento radicular e o osso alveolar propriamente dito, podendo ocorrer durante qualquer etapa do processo eruptivo. Os factores etiológicos da anquilose dento-alveolar ainda não estão totalmente esclarecidos, existindo diversas teorias que pretendem explicar o fenómeno. O objectivo...

  5. Contra o abuso da ética e da moral

    OpenAIRE

    Romano Roberto

    2001-01-01

    O autor, que ensina ética e filosofia política, deseja com este artigo indicar o perigo da inflação de palavras como "ética" e "moral" no vocabulário de nossos dias. Ele considera que o desgaste de tais termos, o seu uso indiscreto e indiscriminado, apenas auxilia o niilismo dos valores que domina a sociedade moderna. Como exercício para uma retomada dos conceitos na sua ordem própria, apresenta uma tradução do verbete, apresentado na Enciclopédia de Diderot e D´Alembert, sobre a ciência mora...

  6. Natureza da educação e filosofia da educação

    OpenAIRE

    Lins, Maria Judith; Universidade Federal do Rio de Janeiro -UFRJ

    2013-01-01

    Este artigo focaliza o problema da natureza da educação e sua relação com a filosofiada educação. É apresentada uma discussão sobre a natureza da educação e enfatizada a necessidade de se entender o conceito de educação para se prosseguir através da filosofia da educação. O propósito deste artigo não é trazer uma filosofia da educação específica co...

  7. Controlo operacional da qualidade da água: caso Águas do Algarve

    OpenAIRE

    Santos, Helena Maria Gonçalves Lucas dos

    2014-01-01

    O presente relatório pretende contribuir para a demonstração de que a adoção de um esquema de certificação da água para consumo humano associado à implementação de um plano de segurança da água, permite implementar um programa de controlo operacional da qualidade da água, quer no tratamento da água para consumo humano, quer no sistema de abastecimento de água, tendo em vista detetar e corrigir, em tempo útil, as alterações que eventualmente ocorram na qualidade da água. ...

  8. Cereais de inverno submetidos ao corte no sistema de duplo propósito Winter cereals submitted to cuts in double purpose system

    Directory of Open Access Journals (Sweden)

    Patrícia Cambrussi Bortolini

    2004-02-01

    Full Text Available A utilização de cereais de inverno no sistema de duplo propósito permite fornecer aos animais forragem verde no período crítico de carência alimentar, além de aumentar a estabilidade da receita da produção pela melhoria na qualidade e produtividade dos grãos dos cereais de inverno. O experimento foi conduzido no período de abril de 1994 a setembro de 1996 em Guarapuava, Paraná, a fim de avaliar o potencial de utilização para forragem e grãos de aveia branca (Avena sativa L., trigo (Triticum aestivum, triticale (X. Triticosecale Witt., aveia preta (Avena strigosa Schreb, centeio (Secale cereale L. e cevada (Hordeum vulgare L., visando sua utilização em condições de duplo propósito. Utilizou-se o delineamento experimental de blocos ao acaso, com tratamentos distribuídos em parcelas subdivididas, em três repetições. Nas parcelas foram estudados os sistemas de produção (sem corte, um e dois cortes e nas subparcelas, os genótipos. O sistema de dois cortes foi superior aos demais quanto ao rendimento de matéria seca, principalmente para a aveia. Para o rendimento de grãos, os sistemas sem corte e um corte foram superiores, apesar da maior produção dos genótipos de aveia sob dois cortes. Em todos os genótipos, houve melhoria do peso do hectolitro e redução da massa de mil sementes, quando se realizaram cortes. Sob condições de manejo adequadas, pode-se alcançar considerável produção de forragem, sem afetar a posterior produção de grãos para cereais de inverno.The winter cereals utilization in double purpose system allows to provide forage in critical food conditions periods and also to increase the income of production stablility by improving quality and produtivity of winter cereal grains. The experiment was conducted from April 1994 to September 1996, in Guarapuava, Paraná, to evaluate the potential for forage and grains of white oat (Avena sativa L., wheat (Triticum aestivum, triticale (X. Triticosecale

  9. EFEITOS DA LARGURA DA FAIXA DE CAPINA NA CULTURA DA MAMONA

    Directory of Open Access Journals (Sweden)

    EDISON MARTINS PAULO

    1997-01-01

    Full Text Available Estudou-se a influência de diferentes larguras de faixas de controle de plantas daninhas sobre a altura, o número de racemos e a produção de grãos da mamoneira (Ricinus communis L. var. IAC-80, objetivando-se determinar a área vegetada entre as linhas de plantio. Os experimentos foram desenvolvidos em Adamantina, na Estação Experimental de Agronomia da Alta Paulista do Instituto Agronômico (IAC, nos anos agrícolas 1989/90, 1990/91 e 1991/92. O delineamento estatístico adotado foi o de blocos ao acaso com quatro repetições e oito tratamentos. Os tratamentos consistiram em faixas com 0,0; 0,5; 1,0; 1,5; 2,0; 2,5 e 3,0 m de largura capinadas ao longo da linha de plantio e mantidas sempre livres de plantas daninhas; além dessas, mateve-se uma faixa de 1,0 m de largura e mesmo procedimento, na qual a comunidade infestante das entrelinhas era roçada manual- mente sempre que a altura média de 0,3 m era atingida. Concluiu-se que faixas de capina menores do que 1,0 m aplicadas sobre a linha de plantio da cultura diminuíram a produção de grãos, o número de racemos e a altura da mamoneira.Three experiments were carried out in Adamantina at the Experimental Station of Agronomy of Alta Paulista, Instituto Agronômico (IAC, State of São Paulo, Brazil, on a Dark Red Latosol during 1989-1992, in order to study the effects of different row widths covered by weeds on the yield, height and number of racemes of IAC-80 castor bean cultivar. Hoed rows of 0.0, 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 m wide were studied. An extra treatment had the entire plot covered with weeds mantained at 0.3 m height. The row space used was 3.0 x 1.0 m and the plots were 9.0 x 5.0 m. The experiment was set in a randomized complete block design with four replications. Hoeing row width of 1.0 m or less reduced raceme emission, plant height and seed yields.

  10. Nurse effect in seedling establishment: facilitation and tolerance to damage in the Andes of central Chile Efecto nodriza en el establecimiento de plántulas: facilitación y tolerancia al daño en los Andes de Chile central

    Directory of Open Access Journals (Sweden)

    IAN S ACUÑA-RODRÍGUEZ

    2006-09-01

    ás relevante en ambientes estresantes. Este efecto sería particularmente importante durante el periodo de establecimiento de las plántulas debido a su alta vulnerabilidad a factores bióticos y abióticos como herbivoría y desecación. La tolerancia a la herbivoría evidencia la capacidad de las plantas de recrecer y reproducirse después del daño, pero esta capacidad es recurso-dependiente. En los Andes de Chile central, la planta en cojín Laretia acaulis (Apiaceae atenúa el efecto del estrés ambiental, aumentando la supervivencia de diversas especies de plantas asociadas. Proponemos que las plántulas que se encuentren creciendo dentro de los cojines de L. acaulis deberían evidenciar niveles mayores de tolerancia en relación a aquellas plántulas creciendo fuera de los cojines. Para probar esta hipótesis se llevó a cabo un experimento de campo con dos especies nativas perennes: Hordeum comosum (Poaceae y Haplopappus anthylloides (Asteraceae. Plántulas de ambas especies fueron sembradas dentro y fuera de los cojines de L. acaulis, y la mitad de ellas recibieron daño manual (50 % tejido foliar removido. En general, las plántulas que se encontraron creciendo dentro del cojín evidenciaron una mayor supervivencia independientemente del tratamiento de daño. A pesar de que la ubicación de las plántulas no afectó la respuesta en tolerancia por parte de H. anthylloides, sí afectó significativamente la tolerancia de H. comosum. Por lo tanto, encontramos valores similares para la supervivencia de plántulas de H. comosum dentro de los cojines, pero la supervivencia de plántulas dañadas fuera de los cojines fue significativamente menor que la de plántulas control. Se pudo evidenciar la ocurrencia de efecto nodriza por parte de L. acaulis sobre el establecimiento de ambas especies y conjuntamente un aumento en la tolerancia al daño para H. comosum en este hábitat estresante

  11. Biblioterapia: estado da questão

    OpenAIRE

    Abreu, Ana Cristina; Zulueta, Maria Ángeles; Henriqes, Anabela

    2013-01-01

    A partir de uma revisão da literatura apresenta-se uma panorâmica concetual da biblioterapia para um melhor conhecimento da área, para compreender as suas raízes e perspetivar o seu devir.Após uma contextualização histórica, problematizam-se questões relativas à leitura e ao método como chave do sucesso biblioterapêutico, aos três tipos de biblioterapia, bem como os seus benefícios.São temas merecedores de debate a relação da biblioterapia no campo da biblioteconomia, da formação dos bibliote...

  12. Etiologia da cárie

    OpenAIRE

    2002-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Saúde Pública. Este trabalho de pesquisa tratou da construção do Estilo de Pensamento Odontológico acerca da etiologia da cárie. Abordou a historicidade dos conceitos de causalidade, no âmbito da doença específica e sua relação com a causalidade das doenças de maneira geral. Apontou como foco central da análise as transformações do estilo nas últimas duas décadas, em s...

  13. À Procura da Unidade Primordial

    Directory of Open Access Journals (Sweden)

    Debora Pazetto Ferreira

    2009-06-01

    Full Text Available O presente artigo tem como objetivo uma abordagem crítica de um dos primeiros ensaios de Hölderlin, escrito por volta de 1794-5, intitulado Juízo e Ser. Nesse período, fundamentar o sistema kantiano através de um primeiro princípio tornou-se um dos principais incentivos dos desenvolvimentos teóricos do idealismo alemão. A filosofia de Fichte e Schelling, bem como a de Hölderlin, podem ser compreendidas por esse viés. Entretanto, o último chega a soluções bastante diferentes dos demais, culminando com a negação da possibilidade de um princípio unificador para qualquer sistema filosófico. Assim, contra os incessantes esforços dos idealistas alemães para apreender a totalidade do real em termos conceituais, através de um primeiro princípio, normalmente caracterizado como o Eu, o Sujeito, o Eu absoluto, Hölderlin defende a incognoscibilidade de qualquer conceito unificante do real. A realidade enquanto unidade primordial não pode ser apanhada pelo discurso teórico, nem conhecida, nem aprisionada em conceitos, revelando-se apenas através de uma intuição intelectual de cunho estético. Esse conceito eminentemente anti-kantiano constitui a peça chave para o entendimento do pensamento hölderliniano. Ele justifica, em última instância, o privilégio da poesia e da linguagem poética em detrimento do discurso conceitual e mostra, com isso, que há uma coerência interna entre os ensaios teóricos de Hölderlin e suas obras literárias.

  14. Perspectivas da hotelaria no Brasil

    OpenAIRE

    Mello, Gustavo Afonso Taboas de; Goldenstein, Marcelo

    2011-01-01

    Rio + 20 em 2012, Copa do Mundo em 2014 e Jogos Olímpicos em 2016. Atento a esse cenário, o governo brasileiro atua em várias frentes, da infraestrutura de transportes à esportiva, para que o país possa atender satisfatoriamente às variadas demandas dessa agenda. O próprio segmento hoteleiro já iniciou uma série de movimentos no intuito de ampliar a oferta e modernizar o parque instalado para receber os turistas, com particular atenção à Copa do Mundo de 2014. E o BNDES, como partícipe dessa ...

  15. O duplo cego da antropologia

    Directory of Open Access Journals (Sweden)

    Jean Segata

    2012-10-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2012v2n30p83   O objetivo desse trabalho é o de explorar as discussões que se iniciam no Círculo de Viena, no que se chamou de “virada linguística”, em favor do trabalho antropológico. Para tanto, ela se abre em dois níveis de questionamento sobre o lugar da tradução, que podem ser resumidos em duas questões: como descrever o outro a partir das categorias que dispomos na antropologia? Em outros termos, os outros têm linguagem, mas para que possamos dizer algo sobre eles, precisamos da nossa linguagem, ou seja, o próprio processo de descrição já é por si mesmo um processo de tradução. O segundo nível é o de como dialogar entre antropólogos a partir de contextos etnográficos diferentes - ou seja, como traduzir entre antropologias aquilo que já é fruto, num primeiro nível, de uma tradução para a antropologia? Dito de outra maneira, seguindo uma ideia geral presente na obra de Nelson Goodman - a de que o mundo é criado na descrição e que cada descrição nova cria uma nova versão de mundo - qual é o estatuto da descrição antropológica? - é ela um modo de criar versões de mundo? Igualmente, se as pessoas que os antropólogos estudamos criam suas versões de mundo ao descreve-los para nós, como se dá a tradução entre as versões dos outros para as nossas versões? Seguindo Marilyn Strathern, o que os outros podem fazer é o que cabe no limite de uma certa linguagem, a deles - o que podemos fazer é o que cabe no limite de uma certa linguagem - a nossa, entre elas, seguindo W. O. Quine, apenas a indeterminação da tradução. Palavras-Chave: Descrição; Antropologia; Nominalismo.

  16. Fisiopatologia da enxaqueca Migraine pathophysiology

    Directory of Open Access Journals (Sweden)

    MAURICE B. VINCENT

    1998-12-01

    Full Text Available A fisiopatologia da enxaqueca ainda não foi completamente elucidada. As principais estruturas envolvidas parecem ser o sistema nervoso central (córtex e tronco cerebral, o sistema trigeminovascular e os vasos correspondentes, outras fibras autonômicas que inervam estes vasos, e os vários agentes vasoativos locais, como a SP, CGRP, NO, VIP, NPY, ACh, NA, NKA, entre outros. A depressão alastrante é o fenômeno neurológico que provavelmente justifica achados experimenais e clínicos na enxaqueca. Ela tem velocidade de propagação semelhante à aura, ativa o núcleo espinhal do trigêmeo e está relacionada à liberação de CGRP e NO. Alterações circulatórias detectadas por métodos complementares reforçam o papel da depressão alastrante. A identificação de anormalidades em pelo menos três loci (cromossomas 19 e 1 na enxaqueca hemiplégica familiar ocorreu recentemente. Elas estão relacionadas a anormalidades nos canais de cálcio voltagem dependentes tipo P/Q, específicos do sistema nervoso central, que regulam a liberação de vários neurotransmissores, incluindo possivelmente a serotonina. A exemplo de outras anormalidades neurológicas paroxísticas que resultam da hiperexcitabilidade da membrana plasmática, é possível que a enxaqueca ocorra devido a uma desordem de canais iônicos.The pathophysiology of migraine is not yet fully understood. The most important structures involved seem to be the central nervous system (cortex and brain stem, the trigeminovascular system and related cranial arteries, other autonomic fibres innervating such vessels, and various local vasoactive agents, including SP, CGRP, NO, VIP, NPY, ACh, NA, NKA, among others. The spreading depression phenomenon may explain clinical as well experimental findings in migraine. Its propagation velocity mirrors what is found in clinical aura, it may activate the spinal trigeminal nucleus and may induce CGRP and NO release. Circulatory changes detected with

  17. Geografia social da AIDS no Brasil

    Directory of Open Access Journals (Sweden)

    Bastos Francisco Inácio

    1995-01-01

    Full Text Available São divulgados os primeiros resultados da avaliação da dinâmica da epidemia da AIDS no Brasil através de técnicas de análise da distribuição espacial. São revisadas questões metodológicas, apontando as dificuldades de estabelecer regiões geográficas homogêneas no Brasil. Descrevem-se tendências recentes da dinâmica da epidemia da AIDS no Brasil - pauperização, interiorização e alteração na participação proporcional das categorias de exposição. Avalia-se a distribuição de casos de AIDS por Unidades da Federação (UFs, confeccionando-se mapas relativos à disseminação da epidemia no período 1987-1993 nas diversas UFs, estabelecendo-se os Centros Gravimétricos (CGs relativos a esses anos. A análise do posicionamento e deslocamento pluri-anual desses CGs indica a força atrativa do Estado de São Paulo como pólo de difusão da epidemia e uma expansão simultânea da epidemia em direção às fronteiras de ocupação. Essas tendências colocam dificuldades adicionais às atividades de prevenção ao acrescentarem novos segmentos populacionais e regiões geográficas ao quadro observado inicialmente nas principais regiões metropolitanas e segmentos mais afetados.

  18. A procura do belo e da verdade

    OpenAIRE

    Tavares, Cristina Azevedo, 1956-

    2012-01-01

    Contém: 1:Paidéia. 2:Da teoria da arte à representação do corpo. 3: O mundo medieval, as ideias estéticas e a medicina. 4: Os tratados, programa e método. Berengário da Capri e a beleza humanista: o corpo de Apolo como esplendor do conhecimento. Vesalius: a fronteira do natural e do ideal

  19. A caminho da estética

    Directory of Open Access Journals (Sweden)

    Amaral Filho, Fausto dos Santos

    2007-01-01

    Full Text Available O presente estudo tenta compreender, ainda que de maneira sumária, quais os caminhos que a Estética tomou; desde Hegel e a dedução filosófica dos conceitos, até a corrente, influenciada por Wittgenstein, da análise da liguagem comum, acabando por apontar, diante das dificuldades dos referidos caminhos, para a Estética da circularidade; tanto a de Heidegger quanto a de George Dickie

  20. Vigotski e o estudo da psicologia da arte: contribuições para o desenvolvimento humano

    OpenAIRE

    Sonia Mari Shima Barroco; Tatiane Superti

    2014-01-01

    O presente texto resulta de investigação bibliográfica e de um exercício teórico-metodológico sobre a obra Psicologia da Arte, de L. S. Vigotski (1999), visando aprofundar uma reflexão sobre o objeto e método da própria psicologia da arte. Objetiva-se, assim, discutir as possíveis contribuições da arte para o desenvolvimento humano com base na teoria histórico-cultural. Propõe-se que o objeto da psicologia da arte é o estudo da estrutura da obra, que deve provocar uma resposta estética e impa...

  1. O PAPEL DA ÁFRICA NA NOVA ROTA DA SEDA MARÍTIMA

    Directory of Open Access Journals (Sweden)

    Diego Pautasso

    2017-01-01

    Full Text Available O objetivo do presente artigo é analisar o lugar da África na construção da Nova Rota da Seda Marítima. Este é justamente um dos vetores do ambicioso projeto chinês de integração da Ásia, Europa e África, lançada em 2013 sob título de Iniciativa OBOR (One Belt, One Road. Na medida que os desafios da reconstrução nacional são superados, a China torna-se mais assertiva e dá forma à sua estratégia de inserção mundial. Nesse sentido, a Nova Rota da Seda agrega os objetivos centrais da diplomacia da China para o século XXI, reservando à África a condição de trampolim para que o projeto se torne global.

  2. Quem tem medo da angústia?

    Directory of Open Access Journals (Sweden)

    Vera Lopes Besset

    Full Text Available Este texto insere-se na discussão atual no Grupo de Trabalho “Psicopatologia e Psicanálise”, da Anpepp, sobre o tema da angústia. Nesse sentido, traz a questão da evitação da angústia no contemporâneo, sobretudo a que se observa entre os próprios psicanalistas, às vezes muito ávidos das soluções oferecidas por uma psiquiatria atual ancorada nos novos e eficazes medicamentos.

  3. Diretrizes brasileiras para o tratamento da narcolepsia

    OpenAIRE

    Alóe, Flávio; ALVES, Rosana Cardoso; Araújo, John F.; Azevedo, Alexandre; Bacelar, Andrea; Bezerra,Márcio; Bittencourt, Lia Rita Azeredo; BUSTAMANTE, Guilherme; CARDOSO, Tania Aparecida Marchiori de Oliveira; ECKELI, Alan L.; Fernandes, Regina Maria França; Goulart, Leonardo; Pradella-Hallinan,Márcia; Hasan,Rosa; Sander, Heidi Haueisen

    2010-01-01

    Este artigo relata as conclusões da reunião de consenso da Associação Brasileira de Sono com médicos especialistas brasileiros sobre o tratamento da narcolepsia, baseado na revisão dos artigos sobre narcolepsia publicados entre 1980 e 2010. Os objetivos do consenso são valorizar o uso de agentes avaliados em estudos randomizados placebo-controlados, emitir recomendações de consenso para o uso de outras medicações e informar pontos importantes a respeito da segurança e efeitos adversos das med...

  4. Entrevista com Alberto da Costa e Silva

    OpenAIRE

    Soares, Eliane Veras; Mutzenberg,Remo

    2014-01-01

    Alberto da Costa e Silva é membro da Academia Brasileira de Letras, escritor, historiador e diplomata, Doutor Honoris Causa em Letras pela Universidade Obafemi Awolowo (ex-Universidade de Ifé), da Nigéria, em 1986, e em História pela Universidade Federal Fluminense em 2009. Como diplomata, entre outras atividades, representou o Brasil em numerosas reuniões internacionais, tendo sido delegado do Brasil na reunião da Comissão Econômica das Nações Unidas para a África, em Adis Abeba, em 1961. Fo...

  5. Por uma arte no mundo da vida

    Directory of Open Access Journals (Sweden)

    Rachel Costa

    2016-12-01

    Full Text Available O artigo visa debater a análise colocada por Jacinto Lageira no texto “As razões do agir, contribuição a uma poética da ação”. O debate se estabelece no que concerne ao problema da autonomia da arte e suas consequências, tendo em vista a necessidade de pensar possibilidades contemporâneas para a experiência estética que pressuponham o mundo material. Isso é realizado a partir da teoria dos gestos do filósofo Vilém Flusser.

  6. Os robots na aprendizagem da trignometria

    OpenAIRE

    Caires, Noel Belerofonte da Fonte de

    2013-01-01

    Este trabalho foi elaborado no âmbito do Mestrado de Ensino de Matemática do 3º Ciclo do Ensino Básico e Secundário da Universidade da Madeira, no ano letivo de 2012/2013. Os grandes objetivos deste estudo são os de analisar qualitativamente uma atividade, para compreender como é que os alunos aprendem trigonometria, utilizando os robots NXT da Lego. De igual modo, se procede também, de forma sucinta, à apresentação do trabalho desenvolvido pelo grupo de estágio, ao longo da Prática de Ensino...

  7. A divisão da cristandade: da reforma protestante à era do iluminismo - Resenha

    OpenAIRE

    Claudia Danielle Andrade Ritz

    2016-01-01

    Livro:DAWSON, Christopher. A divisão da cristandade: Da reforma protestante à era do iluminismo. São Paulo: É Realizações Editora, 2014.  BookDAWSON, Christopher. A divisão da cristandade: da reforma protestante à era do iluminismo. São Paulo: É Realizações Editora, 2014. 368p. ISBN 978-85-8033-167-7

  8. Actinomicose da Mama em Gestante

    Directory of Open Access Journals (Sweden)

    Mottola Jr Juvenal

    2001-01-01

    Full Text Available A actinomicose mamária é doença inflamatória rara, com poucos casos descritos na literatura. Pode ser primária da mama quando resultante de traumas na pele e papila mamária, e, secundária, quando de origem toracopleural. Sua apresentação clínica é variável, devendo ser diferenciada das doenças mais comuns, dentre elas as mastites e também as neoplasias, como o carcinoma inflamatório. Seu diagnóstico é realizado pela cultura da secreção, com a identificação das colônias de Actinomyces sp. Seu tratamento é a drenagem, quando indicada, a antibioticoterapia endovenosa e manutenção oral por tempo prolongado. Os autores relatam caso de abscesso retromamário por Actinomyces sp. em gestante de 12 semanas que apresentava tumoração mamária expansiva na mama esquerda.

  9. Oficinas da cidade em Fortaleza

    Directory of Open Access Journals (Sweden)

    Cordeiro Andréa Carla de Filgueiras

    2002-01-01

    Full Text Available Este artigo trata do relato de uma experiência de intervenção focal com crianças na cidade de Fortaleza, na qual se procurou, através de discussões em grupo, possibilitar a construção e a re-construção das experiências destes sujeitos na cidade. Partiu-se da premissa que viver hoje na cidade contemporânea requer do sujeito orientação crítica para que ele se situe frente às demandas do viver coletivo. Três momentos de discussão foram focalizados: a reflexão sobre a experiência vivida na cidade; a imaginação sobre as possibilidades deste viver; e a discussão sobre o vivido e o desejado, visando a uma re-construção possível da cidade. As crianças mostraram capacidade de analisar criticamente sua experiência na cidade, apontando os aspectos que, do seu ponto de vista, tornam o viver na cidade particularmente difícil para elas. Mostraram, também, capacidade de indicar caminhos coletivos que suavizariam a tarefa de viver na cidade grande, principalmente quando não se é adulto, e sim criança.

  10. ESTUDO DA PASTEURIZAÇÃO DA POLPA DE MURUCI

    Directory of Open Access Journals (Sweden)

    A. C. A. PELAIS

    2008-12-01

    Full Text Available

    Estudou-se o processo de pasteurização da polpa de muruci (Byrsonima crassifolia e avaliou-se a vida-de-prateleira do produto. Não foi detectada atividade para as enzimas peroxidase e polifenoloxidase na polpa in natura. Primeiramente, foram realizados testes, em escala de bancada, em três temperaturas (70, 80 e 90°C e três tempos (1, 60 e 300 segundos. A variação da cor (colorimetria tristimulus, as contagens de bactérias mesófilas totais e de fungos (bolores e leveduras foram as variáveis de resposta. Todos os tratamentos destruíram os fungos e reduziram a carga bacteriana. A temperatura de pasteurização provocou variação signifi cativa nos parâmetros de cor b* e L*, porém em pequena escala (menor que 1%. Em um segundo momento, a polpa foi submetida à pasteurização, em escala piloto, utilizando processo hot fi ll. Foram testadas duas temperaturas (80 e 90°C, sem e com adição de conservante. Amostras do produto, após pasteurização, foram armazenadas a 25°C, por 120 dias. Os tratamentos foram efi cientes em relação às variáveis avaliadas, em todas as condições aplicadas; estando os produtos aptos para consumo, de acordo com a legislação brasileira. As coordenadas de cor L*, a* e b* sofreram variação signifi cativa (p < 0,05 durante o armazenamento, com diminuição média de 10% de b* e L*. A pasteurização da polpa de muruci, sem adição de conservante, mostrou-se apropriada para produção em pequena escala.

  11. A cirurgia da endomiocardiofibrose revisitada

    Directory of Open Access Journals (Sweden)

    Carlos R. MORAES

    1998-04-01

    Full Text Available Entre dezembro de 1977 e dezembro de 1997, 83 doentes com endomiocardiofibrose (EMF foram submetidos a decorticação endocárdica e substituição ou reparo das valvas atrioventriculares. Sessenta e seis (79,6% eram do sexo feminino e 17 (20,4% do masculino, variando as idades de 4 a 59 anos (média 31. Trinta e sete (44,5% pacientes tinham doença biventricular, 34 (41% apenas do ventrículo direito e 12 (14,5% apresentavam EMF limitada ao ventrículo esquerdo. Todos estavam na classe funcional III ou IV da classificação da New York Heart Association. Sessenta e oito (81,9% pacientes sobreviveram à operação e foram seguidos por período de tempo que variou de um mês a 17 anos. O tempo total de seguimento foi de 6.290 pacientes/meses (média: 92 meses. Houve 15 óbitos tardios, mas em 6 a causa não esteve relacionada à doença de base. Quatro (5,8% doentes apresentaram recidiva da fibrose e foram reoperados; em 6 (8,8% apareceu fibrose no outro ventrículo. Cinco (7,3% pacientes foram reoperados, seja para retroca de prótese valvular, seja para substituir a valva preservada na primeira operação. Somente 24 (45% dos atuais 53 sobreviventes estão em classe funcional I ou II. A curva de sobrevida actuarial, incluindo a mortalidade operatória, revelou que a probabilidade de sobrevida, 17 anos após a operação, é de 55%. Conclui-se que o tratamento cirúrgico da EMF deve ser considerado um procedimento paliativo porque a operação não impede a progressão da doença. Mesmo assim a operação é recomendada em pacientes com EMF e sintomas de insuficiência cardíaca, visto ser a única forma de tratamento.Eighty-three patients with endomyocardial fibrosis (EMF underwent endocardial decortication and atrioventricular valve replacement or repair between December, 1977, and December, 1997. There were 66 (79.6% female and 17 (20.4% male patients, ranging in age from 4 to 59 years (mean, 31. Thirty-seven (44.5% had biventricular disease

  12. Métodos de análise da severidade da patologia da marcha humana

    OpenAIRE

    Vieira, Alexandra Sofia Domingues

    2015-01-01

    A marcha humana é composta por um conjunto de movimentos complexos que dificultam a sua análise e o reconhecimento de padrões de marcha normais ou patológicos. O presente relatório descreve o projeto desenvolvido com o objetivo de apresentar dois métodos, capazes de avaliar a severidade da patologia de marcha e auxiliar a análise médica: análise cinética e análise cinemática. Na primeira fase do projeto foi escrita e submetida uma patente que descreve um sapato instrumentado, capaz de real...

  13. Eficácia da Eritropoietina na Prevenção da Anemia da Prematuridade

    OpenAIRE

    2014-01-01

    Objectivo: Avaliar o efeito nas necessidades transfusionais da administração de Eritropoietina Recombinante Humana (EPO-rH) ao recém-nascido (RN) de pré-termo de muito baixo peso.Material e Métodos: Estudo retrospectivo que incluiu 40 RN com peso inferior a 1500 gramas. Foram excluídos os RN com anomalias major do sistema nervoso central, anomalias cromossómicas, malformações cardiovasculares, hemorragia intraventricular de grau III ou com extensão ao parênquima e doença hemolítica ou hemorrá...

  14. O momento da saída do abrigo por causa da maioridade: a voz dos adolescentes

    Directory of Open Access Journals (Sweden)

    Ana Laura Moraes Martinez

    2008-12-01

    Full Text Available O que significa para um adolescente crescer num abrigo? E o que significa para ele ter que deixá-lo por causa da maioridade legal? Na tentativa de compreender essas questões, a presente pesquisa foi construída junto com dois adolescentes que vivenciavam a saída do abrigo, após terem permanecido na instituição por 12 anos. Partindo de uma perspectiva histórico-cultural, utilizou-se para a construção do corpus, observações participantes, entrevistas com os adolescentes e equipe técnica, além de produções narrativas de um dos adolescentes. O eixo norteador da análise foram os sentidos produzidos sobre a saída do abrigo. Entre os apontamentos finais, verificou-se a ausência de práticas sistemáticas de auxílio aos adolescentes no enfrentamento da saída e a existência de atuações individualizadas, permeadas pelos estereótipos construídos pela instituição. Enquanto um dos adolescentes (o adolescente ativo construiu arranjos próprios para sua saída, o outro (o adolescente problema foi intensamente tutelado pela instituição nesse processo de desligamento.

  15. Narrativas midiáticas e memória: o caso da Avenida da Legalidade e da Democracia

    Directory of Open Access Journals (Sweden)

    Camila Garcia Kieling

    2016-01-01

    Full Text Available Em outubro de 2014, a Câmara de Vereadores de Porto Alegre promulgou o projeto de lei que alterou o nome da Avenida Presidente Castelo Branco para Avenida da Legalidade e da Democracia. A mudança gerou amplo debate, trazendo ao âmbito midiático disputas nos campos da história e da memória. Interessa-nos compreender de que forma esta mudança de denominação foi apropriada midiaticamente, tanto na cobertura do processo em si como acontecimento jornalístico quanto as repercussões após sua efetivação.

  16. O uso da integral definida no cálculo da área alagada da barragem do Rio Bonito

    Directory of Open Access Journals (Sweden)

    Cristina Martins Paraol

    2015-12-01

    Full Text Available Este artigo apresenta uma aplicação de integral definida cujo objetivo é calcular a área alagada da barragem do rio Bonito. Os registros históricos mostram a importância desta barragem para a região, a mesma é responsável por conter as cheias no “Banhado do Sombrio”, e pela irrigação das lavouras de arroz. O formato da barragem está longe de ser uma região regular, cujo cálculo da área seria facilmente encontrado. Para tanto, fez-se o estudo detalhado sobre aproximação para integrais definidas e ajustes de curvas. Estes temas foram usados na aproximação da área alagada da barragem do rio Bonito. Para facilitar os cálculos, fez-se o uso dos softwares geogebra e graph.

  17. Tratamento cirúrgico da cisticircose da fossa craniana posterior

    Directory of Open Access Journals (Sweden)

    Pedro Garcia Lopes

    1971-03-01

    Full Text Available A cisticercose, um dos mais sérios problemas parasitológicos do sistema nervoso, apresenta, quando localizada na fossa posterior, um quadro clínico dramático, no qual predomina a hipertensão intracraniana. Foram estudados neste trabalho, 70 pacientes com cisticercose de fossa craniana posterior, atendidos no Serviço de Neurocirurgia do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo de 1945 a 1968. Considerando-se a grande diversidade existente em torno das técnicas de tratamento cirúrgico, foi objetivo deste trabalho o estudo dos resultados obtidos nestes pacientes, nos quais várias técnicas foram empregadas. As cirurgias paliativas que derivam o trânsito do líquido cefalorraqueano para regiões extracranianas, quando comparadas aos outros tipos de cirurgias utilizados, foram as que proporcionaram maior índice de recuperação, exigiram menos reoperações, além de terem sido acompanhadas de menor número de complicações, bem como de menor mortalidade pós-operatória. Por outro lado, a neurocisticercose geralmente é um processo difuso, encontrando-se parasitas em várias regiões do encéfalo e/ou aracnoidite, conforme comprovou-se, também, entre os casos ora reunidos e que vieram a falecer. Baseando-se nestes fatos, não se justificam as derivações intracranianas e, a não ser eventualmente, a abordagem direta do parasita. Os casos estudados permitem cone- tatar, portanto, que as derivações extracranianas, por sua simplicidade e eficácia, apresentam-se, atualmente, como a terapêutica cirúrgica mais propriada à cisticercose de fossa craniana posterior.

  18. Direito à palavra: interrogações acerca da proposta da justiça restaurativa

    Directory of Open Access Journals (Sweden)

    Edson Luiz André de Sousa

    Full Text Available Partindo da constatação da necessidade de alternativas ao sistema de Justiça atual, o presente artigo objetiva dar voz a uma das propostas que vem ganhando força no cenário jurídico mundial: a Justiça Restaurativa. Para tanto, este artigo explora essa proposta, promovendo uma análise crítica amparada em autores da psicanálise (freudo-lacaniana e da Filosofia (com F. Ost e J. Derrida. Através da Justiça Restaurativa, é possível questionar a potência da circulação da palavra, característica que promove o tensionamento entre psicanálise e Direito. Além disso, a questão da Lei e das leis, da performatividade dos atos da fala, da posição do Juiz, da experiência do encontro restaurativo e da função das utopias são os principais vieses que compõem esta análise. Mais voltado para a possibilidade de anunciar questionamentos sobre essa proposta tão nova no contexto brasileiro do que de encontrar respostas satisfatórias, este artigo mantém em suspenso várias conclusões, embora assuma a constatação da importante função utópica da Justiça Restaurativa.

  19. Brasil: o futuro da economia

    Directory of Open Access Journals (Sweden)

    Guilherme Leite da Silva Dias

    2006-04-01

    Full Text Available A PROPOSIÇÃO deste artigo é chamar a atenção para a falta de dinamismo da poupança doméstica já no início da década de 1970, quando o investimento era elevado. A razão desse baixo dinamismo está identificada na literatura que analisou o nosso capitalismo dependente. A forma como se deu a ruptura do modelo nacional-desenvolvimentista também é importante para entender as limitações do momento atual. O efeito esperado das reformas econômicas em curso sobre o crescimento econômico fica comprometido, e não será pela execução complementar da agenda que ele voltará a ocorrer. A dificuldade apontada está na natureza social e política do modelo de desenvolvimento; falta a dinâmica dos agentes econômicos básicos (capitalista nacional, multinacional, burocrata e consumidor como entidades reais detentoras de poder econômico e de representatividade política, temidas umas pelas outras e, portanto, respeitando a regra do jogo (desenvolvimento. O capitalismo nacional precisa de capacitação tecnológica e de inovação, assim como de um padrão de regulação adequado, para recuperar um papel relevante na governança das cadeias industriais. Esse é o elemento de confiança que, junto com as reformas, poderia recuperar um patamar superior de poupança doméstica.THE PURPOSE of this paper is to call attention to the lack of Brazilian domestic saving since the seventies, when investment was still going high. In the literature of dependent capitalism we find a source of explanation, as well as in the nature of the rupture in the nationalistic development process during the eighties. As a consequence, economic reforms alone will not bring back the dynamics of growth. What is missing is of a social and political nature, the dynamics between basic capitalist agents (national, multinational, burocrats and consumers real tenants of economic power and political representation, one fearing the other and by due consequence following the

  20. Abner Vicentini: um pioneiro da Biblioteconomia brasileira

    Directory of Open Access Journals (Sweden)

    Murilo Bastos Cunha

    2014-05-01

    Full Text Available Este ensaio biobibliográfico analisa a trajetória profissional do bibliotecário Abner Vicentini (23/08/1929 – 9/08/1976. Dentre vários cargos ocupados, Abner Vicentini foi presidente da Associação Paulista de Bibliotecários (1958-1961; professor de Biblioteconomia na Universidade de Brasília (1964-1971; conselheiro da Federação Internacional de Documentação; consultor da FAO para a implantação da Biblioteca Nacional da Agricultura e do Sistema Nacional de Informação e Documentação Agrícola (1975-1976. Como diretor na área de bibliotecas, Vicentini passou pela seguinte trajetória: Instituto Tecnológico de Aeronáutica (1952-1953, Centro Tecnológico da Aeronáutica (1954-1963, Universidade de Brasília (1964-1971, Ministério das Minas e Energia (1972-1975. Abner Vicentini foi ainda, um grande divulgador da Classificação Decimal Universal e editor da primeira edição brasileira do Anglo-American Cataloging Rules (AACR-1, lançada em 1969

  1. O ocaso da “rivalidade emergente”

    Directory of Open Access Journals (Sweden)

    MATIAS SPEKTOR

    2009-09-01

    Full Text Available O artigo examina o estado da arte da historiografia
    sobre o conceito de “Rivalidade Emergente”, que
    por muito tempo serviu para explicar as relações entre
    o Brasil e os Estados Unidos em parte do século XX.

  2. Arquitetura da paisagem da cidade e a importância da sistematização da análise do problema projetual

    Directory of Open Access Journals (Sweden)

    Rodrigo Gonçalves dos Santos

    2007-12-01

    Full Text Available Com este artigo pretende-se levantar os conceitos próprios da atividade da Arquitetura Paisagística encarando-a como disciplina projetual e associando-a ao Design Ambiental, necessitando, assim, de linhas metodológicas específicas para apresentação de soluções coerentes aos problemas paisagísticos. Sob esta ótica, reflexões sobre o uso da vegetação no projeto dos espaços exteriores são apresentadas apontando-se uma etapa de sistematização da análise do problema de projeto, dentro da abordagem da concepção de uma metodologia projetual em arquitetura paisagística. Também foram analisadas oito vias de circulação da área central de Florianópolis, Santa Catarina, Brasil, exemplificando uma etapa de sistematização da análise do problema de projeto.

  3. Imagens e contra imagens da favela

    Directory of Open Access Journals (Sweden)

    Mário Hélio Trindade de Lima

    2008-01-01

    Full Text Available O presente artigo aborda as representações sociais da pobreza urbana no Brasil. O objeto de estudo é, por um lado, o conjunto de discursos e imagens sobre a favela na imprensa e, por outro lado, as auto-representações visuais de favelas e periferias da cidade do Rio de Janeiro, na virada do século XXI. O objetivo é analisar o uso da categoria favela na formação do imaginário social da cidade e, ao mesmo tempo, investigar como se constrói o olhar periférico nas representações fotográficas dos moradores de favelas. O método empregado baseia-se nas contribuições de Pierre Bourdieu e de Roland Barthes para a análise do discurso e nas contribuições da antropologia visual e da história cultural para a análise da fotografia enquanto campo documental na etnografia. Os resultados revelam um movimento de constituição de novas subjetividades no cenário das grandes cidades dos anos 90, por meio da ação de ONG’s nas favelas, criando um espaço de reflexão sobre si e sobre o outro e de afirmação de novas identidades.

  4. Da impossível atopia ...

    OpenAIRE

    Cunha, Carlos Manuel F. da

    1994-01-01

    Este artigo procura demonstrar que a tópica literária e discursiva se impõem aoos escritores, que lutam para se libertar do "lugar comum". Mas é impossível uma total atopia, a fuga ao poder da tradição da memória literária.

  5. Consecuencias indirectas del daño

    Directory of Open Access Journals (Sweden)

    Philip James

    1987-12-01

    Full Text Available Se refiere a un problema fascinante, universal y fundamental, similar al problema de la causalidad, es decir a las consecuencias indirectas (remotenes del daño. Al considerar esto presumimos que el acusado ha causado un daño por su conducta ilegal y preguntamos por qué consecuencias del acto ilegal será considerado responsable.

  6. TRAÇANDO PERCURSOS DA FONOLOGIA

    Directory of Open Access Journals (Sweden)

    Gisela Collischonn*

    2010-12-01

    Full Text Available Partindo do olhar da fonologia, apresentamos uma retrospectiva da nossa área, focalizando o desenvolvimento de trabalhos sobre a língua portuguesa, nas variedades faladas no Brasil, enfocando tanto modelos teóricos que foram se sucedendo quanto os resultados a que chegamos nestes 25 anos e as perspectivas que se colocam daqui para frente.

  7. Flaskehalsen peger på DA

    DEFF Research Database (Denmark)

    Post, Bettina

    2015-01-01

    Nu har vi i årevis stillet krav til de arbejdsløse. Flaskehalsen peger nu på DA. Kom ind i kampen!......Nu har vi i årevis stillet krav til de arbejdsløse. Flaskehalsen peger nu på DA. Kom ind i kampen!...

  8. Da identidade açoriana ao consumo da marca Açores

    OpenAIRE

    Negalha, Raquel Raposo

    2015-01-01

    Dissertação de Mestrado, Sociologia, 24 de Setembro de 2015, Universidade dos Açores. O presente Projeto de Dissertação insere-se na área da sociologia do consumo intitulada Da Identidade Açoriana ao Consumo da Marca Açores. A pertinência da mesma prende-se com o facto de o Projeto “Marca Açores” desenvolvido pela Sociedade para o Desenvolvimento dos Açores (SDEA) ser uma novidade para as empresas que se encontram interessadas em incutir o selo da mesma nos seus produtos de modo a que este...

  9. A natureza comportamental da mente: behaviorismo radical e filosofia da mente

    OpenAIRE

    Alves, Diego Zilio [UNESP

    2009-01-01

    O presente trabalho pretende delinear uma possível interpretação do behaviorismo radical como teoria da mente, o que significa, em outros termos, contextualizá-lo no âmbito da filosofia da mente. Para tanto, primeiramente apresentaremos as principais teorias que figuram na filosofia da mente contemporânea, incluindo suas teses centrais e seus respectivos problemas. Em seguida, trataremos dos fundamentos do behaviorismo radical enquanto filosofia da ciência e enquanto teoria do comportamento. ...

  10. Da medicina biomedica a complementar : um estudo dos modelos da pratica medica

    OpenAIRE

    Nelson Felice de Barros

    2002-01-01

    Resumo: As questões examinadas nesta pesquisa pertencem ao campo da saúde e dizem respeito, acima de tudo, ao condicionamento social e filosófico da prática médica no ocidente. Foram usados como referência os conceitos sociológicos de campo e habitus, de Bourdieu, e os conceitos epistemológicos de Bachelard, Canguilhem, Foucault, Feyerabend, Kuhn e Santos para compreender os modelos da medicina biomédica, da medicina alternativa e da medicina complementar. Utilizou-se, também, o modelo que id...

  11. O peso social da obesidade

    Directory of Open Access Journals (Sweden)

    Felippe, Flávia

    2003-01-01

    Full Text Available Conhecer as representações sociais sobre o comer para indivíduos obesos, o significado atribuído à relação com o comer e com a manutenção de um peso saudável são os objetivos deste artigo. O peso social da obesidade revela que ela vem crescendo em proporções epidêmicas, favorecidas pela sociedade contemporânea, onde se percebem intenções ideológicas claras. Os mapas de diferentes segmentos foram construídos mostrando aspectos contraditórios no significado do comer para os obesos, como prazer e sofrimento relacionado ao comer (compulsão, descontrole; como aspectos que permeiam essa relação, aparecem os fatores sociais (discriminação, pressão, preconceito, culto ao corpo

  12. ARTIMANHAS DA HEGEMONIA: OBSTÁCULOS À RADICALIZAÇÃO DA DEMOCRACIA NO BRASIL

    Directory of Open Access Journals (Sweden)

    Frederico Alves Costa

    Full Text Available Resumo Este artigo apresenta como foco o debate sobre dificuldades na construção da luta política na contemporaneidade brasileira, mais especificamente nos últimos anos do governo do Presidente da República Luiz Inácio Lula da Silva. Objetiva-se, a partir do diálogo entre a Teoria Democrática Radical e Plural - desenvolvida por Ernesto Laclau e Chantal Mouffe - e posicionamentos de representantes de diferentes grupos de movimentos sociais brasileiros, discutir dois modos de resistência da hegemonia a alternativas de democratização da sociedade. Esses modos, concebidos como artimanhas da hegemonia, são denominados expansão hegemônica e expurgo à diferença. O debate contribui para a análise sobre estratégias políticas no campo da psicologia social.

  13. Hanna Krall e os caminhos tortos da memória e da identidade

    Directory of Open Access Journals (Sweden)

    Piotr Kilanowski

    2013-08-01

    Full Text Available Neste artigo apresentamos a escritora polonesa de origem judaica Hanna Krall por meio da análise literária do seu romance Sublokatorka (A sublocatária.  O romance, com elementos autobiográficos, apresenta a personalidade cindida de uma menina sobrevivente do Holocausto e discute o tema da identidade polonesa, judaica e judaico-polonesa. Através da observação da memória e do processo de criação da memória, a autora mostra a construção da identidade falsa e a repressão da verdadeira, o comportamento comum entre alguns dos sobreviventes.

  14. O reconhecimento visual da palavra no processo de aprendizagem inicial da leitura numa abordagem dinamicista

    Directory of Open Access Journals (Sweden)

    Márcia Cristina Bonfim Ramos Mangueira

    2015-08-01

    Full Text Available Este artigo tem por objetivo apresentar uma revisão da literatura sobre o processo inicial da aprendizagem de leitura, sob a perspectiva cognitiva, buscando uma aproximação do processo de reconhecimento visual da palavra à luz dos fundamentos da Teoria dos sistemas dinâmicos. Inicialmente, serão apresentadas as ideias gerais da Teoria dos Sistemas Dinâmicos. Posteriormente, será realizada uma revisão de literatura sobre a leitura, em especial, em seu processo inicial de aprendizagem.  Finalmente, será apresentado um ensaio analítico especulativo do processamento da leitura no sistema de reconhecimento visual à luz da Teoria dos Sistemas Dinâmicos.

  15. SOBRE AS ORIGENS DA FAVELA

    Directory of Open Access Journals (Sweden)

    Alfredo Pereira de Queiroz Filho

    2011-01-01

    Full Text Available This paper focuses upon the origins of the Brazilian shantytown (favela. It investigates the context of the appearance of the housing and of the name itself which came to characterize this form of precarious settlement in Rio de Janeiro at the end of the 19th century. Evidence suggests that the appearance of the shacks was related to the population explosion and the lack of housing in what was the Federal Capital at the time. The name ¿favela¿ is considered to have its origins in the place name 'Alto da Favela', a district on high ground located to the south of the town of Belo Monte, in the North-eastern state of Bahia, which was the site of the 'War of Canudos' uprising. 'Favela' is also the popular name for a plant, common to the outback of Bahia where the fi ghting took place. The species described by Euclides da Cunha, in his book 'Os Sertões', is probably the Cninodoscolus quercifolius. Of the many theories concerning the renaming of the hill district 'Providência' as 'Favela' by those who had been involved in the uprising, the most plausible is that it recalls strategic and topographic features. On the 'Favela' hill in Canudos, the Republican troops were ambushed, and the occupation was extremely important in the defeat of Antonio Conselheiro's followers. The topography is associated with a metaphor for the deprivation suffered by the troops during and after the fi ghting. The natural diffi culties of the battle, compounded by the physical characteristics of the outback, were related to the struggle the soldiers had in receiving their pay once the war had ended.

  16. Disturbios da olfacao: estudo retrospectivo

    Directory of Open Access Journals (Sweden)

    Luciano Lobato Gregorio

    2014-01-01

    Full Text Available Introdução: O olfato, fenômeno subjetivo de grande importância, é pouco compreendido e estudado no ser humano. Médicos com maior conhecimento sobre os distúrbios desse sentido tendem a considerar a doença mais importante e manejar melhor o diagnóstico e o tratamento. Objetivo: Descrever a amostra dos pacientes com queixa principal de distúrbios do olfato e mostrar a experiência do serviço no manejo e tratamento. Delineamento: Estudo retrospectivo de coorte histórica com corte transversal. Materiais e métodos: Descrição da amostra e avaliação de resposta ao tratamento de pacientes com queixa principal de hiposmia ou anosmia atendidos no ambulatório de Rinologia no período de janeiro de 2005 a outubro de 2011. Resultados: Dos 38 pacientes com distúrbio da olfação, 68,4% dos pacientes apresentaram queixa de hiposmia e 31,5% de anosmia, com duração média de 30,8 meses. Os diagnósticos etiológicos principais foram idiopática (31,5%, rinopatia alérgica (28,9% e RSC com pólipos (10,5%. As respostas ao tratamento com corticosteroide tópico e ácido alfa-lipoico foram variáveis, assim como na literatura. Conclusão: Maior importância deve ser dada aos distúrbios do olfato na prática do otorrinolaringologista, uma vez que o diagnóstico diferencial é amplo e pode trazer grande morbidade ao paciente, com impacto na sua qualidade de vida.

  17. Fenomenologia e crise da arquitetura

    Directory of Open Access Journals (Sweden)

    José Luiz Furtado

    2005-12-01

    Full Text Available Ao se fazer no espaço limítrofe entre a engenharia e a arte, a arquitetura enfrenta simultaneamente problemas estéticos e técnicos. Esta situação a torna tarefa sempre inacabada, ciência tecida no diálogo constante entre dois valores e fazeres tradicionalmente antagônicos. Diante desse quadro, busca-se comumente enraizar a arquitetura em fundamentos exteriores aos seus próprios conceitos, seja na improvisação criadora dos indivíduos, inerente à vida urbana, ou nos diversos saberes sobre o homem que equacionam as necessidades universais às quais ela deveria responder. Estas considerações preliminares conduzem ao cerne de uma questão propriamente filosófica acerca dos fundamentos pré-reflexivos do mundo da vida (Lebenswelt e, no caso da arquitetura, sobre a experiência do habitar que constitui o campo ontológico "regional" de onde parte a ciência/arte aqui investigada.Architecture faces technical and aesthetical problems since it exists in the space between Engineering and Art. This situation turns Architecture into an endless task, a science made in a ceaseless dialogue between two traditional antagonistic values. Art and Engeneering seek to base Architecture in foundations that are outside its own concepts, either when they try to base it in creative improvisation of individuals in their urban lives or when they try to put its roots in several different cognizances about humankind to which it should respond. This introductory essay intends to take us to the experience of inhabitation which constitutes the ontological "region" where this science/art departs from.

  18. No arco da luz obscura

    Directory of Open Access Journals (Sweden)

    Claude LeManchec

    2015-02-01

    Full Text Available ResumoEm Kafka, criação literária, escrita epistolar, anotações íntimas e escritos gnômicos estão dispostos sobre uma tela que comporta escritos como a Carta ao pai, orientada pela dupla compreensão da singularidade de seu percurso na sociedade e de sua vocação de escritor. A escrita nasce do vazio existencial e a ele reconduz. Este ensaio se propõe a refletir sobre os movimentos da escrita de Kafka em sua dimensão ética.Palavras-chave : criação literária ; escrita epistolar ; ética.Résumé Chez Kafka, création littéraire, écriture épistolaire, notations intimes et écrits gnomiques se positionnent sur une immense toile qui enserre des écrits comme la Lettre au  père orientée par la double compréhension de la singularité de son parcours dans la société et de sa vocation d’écrivain. L’écriture naît du vécu existentiel et elle y reconduit. Cet essai se propose à réfléchir sur les  mouvements de l’écriture de Kafka dans sa dimension éthique.Mots-clés: création littéraire; écriture épistolaire; éthique

  19. BANALIZAÇÃO DA FRAUDE ACADÊMICA: REFLEXÕES À LUZ DA TEORIA DA SEMICULTURA DE ADORNO

    Directory of Open Access Journals (Sweden)

    Carolina Machado Saraiva de Albuquerque Maranhão

    Full Text Available Resumo: A banalização da fraude no ambiente acadêmico impõe severos problemas à formação dos indivíduos. Este estudo fez uso da teoria crítica relacionada à educação. Adorno analisou o problema da semiformação na sociedade capitalista, em que a educação se tornou mais uma mercadoria a ser entregue a seus consumidores. O objetivo deste artigo foi propor a reflexão crítica sobre os reais sentidos da persistência da fraude nas universidades. Portanto, a fraude acadêmica destaca-se como uma evidência de que há algo errado com a educação fornecida pelas universidades. Somente uma mudança pedagógica pode transformar o caminho da educação inserida na sociedade capitalista. O resgate do potencial emancipatório da educação é fundamental para que a sociedade possa formar pessoas críticas e autônomas.

  20. BANALIZAÇÃO DA FRAUDE ACADÊMICA: REFLEXÕES À LUZ DA TEORIA DA SEMICULTURA DE ADORNO

    Directory of Open Access Journals (Sweden)

    Carolina Machado Saraiva de Albuquerque Maranhão

    Full Text Available Resumo: A banalização da fraude no ambiente acadêmico impõe severos problemas à formação dos indivíduos. Este estudo fez uso da teoria crítica relacionada à educação. Adorno analisou o problema da semiformação na sociedade capitalista, em que a educação se tornou mais uma mercadoria a ser entregue a seus consumidores. O objetivo deste artigo foi propor a reflexão crítica sobre os reais sentidos da persistência da fraude nas universidades. Portanto, a fraude acadêmica destaca-se como uma evidência de que há algo errado com a educação fornecida pelas universidades. Somente uma mudança pedagógica pode transformar o caminho da educação inserida na sociedade capitalista. O resgate do potencial emancipatório da educação é fundamental para que a sociedade possa formar pessoas críticas e autônomas.

  1. Retorno da educação no Brasil

    OpenAIRE

    Barbosa Filho,Fernando de Holanda; Pessoa, Samuel de Abreu

    2009-01-01

    Este artigo calcula a taxa de retorno da educação no Brasil. Diferentemente de outros trabalhos da literatura que calculam a taxa de retorno da educação através da equação de Mincer, este trabalho calcula a Taxa Interna de Retorno (TIR) da educação, atualizando os estudos de Langoni (1974) e Castro (1970). O artigo mostra que as taxas de retorno da educação continuam extremamente elevadas no Brasil. O artigo contribui ainda para a literatura com a aplicação da metodologia da TI...

  2. Main: 1GPT [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GPT 大麦 Barley Hordeum vulgare l. Gamma Hordothionin. Hordeum Vulgare Gamma-1-H Thi...r: A Structural Motif Common To Toxic Arthropod Proteins Biochemistry V. 32 715 1993 PIR; S13849; S13849.|PDB; 1GP... AA, Molecular weight: 5250 Da RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC barley_1GPT.jpg ...

  3. Da privação da dignidade social à privação da liberdade individual

    OpenAIRE

    Castro,Ana Luiza de Souza; Guareschi, Pedrinho

    2008-01-01

    O presente artigo discute o modo como os adolescentes significam suas práticas de vida e se subjetivam a partir dos contextos da família, da justiça e da medida sócio-educativa de internação, em decorrência de ato infracional cometido. Intenta, assim, questionar a forma como a sociedade e as instituições envolvidas têm tratado a questão. Para tanto, foram realizadas entrevistas com adolescentes considerados autores de atos infracionais que cumpriam a medida de internação na cidade de Porto Al...

  4. O sujeito da neurociência: da naturalização do homem ao re-encantamento da natureza

    OpenAIRE

    2002-01-01

    O objetivo deste trabalho é circunscrever a concepção de sujeito que emerge das teorias neurocientíficas sobre a mente. Para tanto, abordamos três autores-chave do campo da neurociência: Francisco Varela, Humberto Maturana e Gerald Edelman. A partir da análise de seus trabalhos, concluímos que uma determinada concepção de sujeito, calcada numa visão inteiramente materialista da mente, se apresenta como substituto vantajoso de uma concepção que poderíamos chamar de "psicológica", calcada princ...

  5. Verdade da Metafí­sica: Descartes na Rota da Descoberta dos Fundamentos da Ciência

    OpenAIRE

    2010-01-01

    Este artigo trata fundamentalmente de dois grandes aspectos da filosofia de Descartes: a metafísica como fundamento da Ciência e a própria concepçáo cartesiana de Ciência. Na abordagem da primeira questáo – formalmente a primeira parte deste artigo – procura-se evidenciar a metafísica como forjadora de uma concepçáo de verdade e como alicerce para o conhecimento certo e indubitável, ponto de partida para se fundar as ciências. Esta primeira parte apresenta, inicialmente, a concepçáo metafísic...

  6. Estudo da demanda ambulatorial da clínica de odontologia da Universidade do Estado do Amazonas

    OpenAIRE

    Sponchiado Júnior,Emílio Carlos; Souza,Torricelly Barreto de

    2011-01-01

    O objetivo deste trabalho foi avaliar a demanda ambulatorial da Clínica de Odontologia da Universidade do Estado do Amazonas (UEA). Foram entrevistados cem pacientes em tratamento na disciplina de semiologia; por meio de um questionário, foram coletados os dados demográficos e o perfil socioeconômico e por meio de exame clínico foram obtidos o perfil nosológico e o perfil da pressão arterial e das perdas dentais. Os resultados evidenciaram que 52% dos pacientes eram do sexo feminino, com idad...

  7. Estudo da prevalência e da gravidade da dermatite de contacto em 'frango do campo'

    OpenAIRE

    Lopes, Maria Clara Simões

    2014-01-01

    O sector avícola enfrenta atualmente dois desafios muito estimulantes. O primeiro decorre do aumento, que se prevê continuar a crescer, nos níveis de procura de carne de aves no mercado interno e internacional; o segundo decorre do facto da criação avícola ter adotado métodos de produção mais intensivos (kg peso vivo/m2/ano) e em maior escala, i.e. com maior concentração animal na mesma exploração. Este carácter vincadamente “industrial” tem merecido uma natural atenção das sociedades e das a...

  8. ESTATUTO PARADOXAL DA PELE E CULTURA CONTEMPORÂNEA: da porosidade à pele-teflon

    Directory of Open Access Journals (Sweden)

    Maria Cristina Franco Ferraz

    2014-06-01

    Full Text Available A exploração do estatuto paradoxal da pele - interface dentro/fora - permite ultrapassar a dicotomia metafísica superfície/profundidade, problematizando a tendência atual, também expressa na teoria, a um elogio das superfícies e a um horror por oposições dicotômicas. Possibilta avaliar as implicações do fechamento da porosidade da pele em formas de sociabilidade estimuladas na cultura da imagem, da exibição, do espetáculo, bem expressas pelo material inorgânico teflon. Sendo Poros, na visão grega, pai de Eros, a investigação acerca do estatuto paradoxal da pele convida a uma retomada do tema do erotismo. Partindo de perspectivas oferecidas por Agamben acerca da pornografia, ligada ao valor de exibição nas sociedades de espetáculo e de consumo, e relacionando-as a diversas reflexões de José Gil acerca do corpo e da pele, discute-se e convoca-se a abertura da porosidade da pele.

  9. Implicações da visibilidade da enfermagem no exercício profissional

    Directory of Open Access Journals (Sweden)

    Liziani Iturriet Avila

    Full Text Available A construção da imagem da Enfermagem é permeada por aspectos históricos, socioeconômicos e culturais. Ao explorar esta temática, objetivou-se conhecer a percepção dos enfermeiros acerca da visibilidade do cotidiano de trabalho da equipe de enfermagem. Pesquisa qualitativa do tipo exploratória, com 30 enfermeiros de um hospital universitário do sul do país. Os dados foram coletados, de julho a outubro de 2012, através de entrevista semi-estruturada e submetidos à análise textual discursiva. Os resultados apontam que a visibilidade da Enfermagem está relacionada à trajetória histórica da profissão, à falta de reconhecimento da cientificidade da Enfermagem, à veiculação errônea na mídia, aos comportamentos inadequados perante a equipe e, ainda, à sobrecarga de trabalho. Assim, a desmistificação da imagem da profissão inclui uma busca de maior visibilidade midiática, realização de marketing pessoal, comportamento adequado perante a equipe de saúde e demonstração de autonomia profissional, desafios estes que deverão ser superados pela Enfermagem.

  10. Proibicao de discriminacao de preco por genero nos contratos de seguro: analise economica da decisao do tribunal da Uniao Europeia

    National Research Council Canada - National Science Library

    Penido, Thiago; Bergamaschine Mata Diz, Jamile

    2012-01-01

    O trabalho tem por objetivo analisar a extensao da eficacia do principio da igualdade e a consequente proibicao de discriminacao no ambito das relacoes juridicas privadas, verificando, especificamente...

  11. Transformações da prática da enfermagem nos anos 30

    Directory of Open Access Journals (Sweden)

    Ieda de Alencar Barreira

    1999-03-01

    Full Text Available Este relatório se insere na linha de pesquisa "A prática profissional e a formação da identidade da enfermeira brasileira", desenvolvida por grupo cadastrado no CNPq e no Núcleo de Pesquisa de História da Enfermagem Brasileira (Nuphebras da EEscola de Enfermagem Anna Nery, Universidade Federal do Rio de Janeiro. Os objetivos do estudo são: relacionar as mudanças institucionais da enfermagem na sociedade brasileira da época à acentuada transição políticoeconômica do país; analisar os efeitos dessas mudanças institucionais no mercado de trabalho da enfermeira e nas características da prática da enfermagem; discutir as novas formas de articulação da enfermagem com outras práticas sociais no interior do campo da saúde. A enfermagem de saúde pública nacional, para acompanhar a ampliação do Estado burocrático, se expandiu e se modificou.. Ao mesmo tempo, em um contexto de uma política de proteção ao trabalhador, desenvolveuse uma política de incentivo à abertura de hospitais públicos e privados, embora os serviços de enfermagem dessas instituições não fossem organizados segundo os padrões que caracterizavam a enfermagem moderna. Assim, a prática da enfermagem na década de 30 caracteriza-se como o início da transição de um modelo de saúde pública urbana para um modelo de assistência hospitalar.

  12. Combatentes do gueto, guerreiros da periferia

    Directory of Open Access Journals (Sweden)

    Mônica Rebecca Ferrari Nunes

    2013-01-01

    Full Text Available Combatente do gueto, guerreiro da periferia, militante da causa (... Combatente do gueto é o nome de uma rua atrás do Palácio do Governo (...” conta Jairo, taxista, a propósito de sua inspiração poética, durante as filmagens de Povo lindo, povo inteligente – O Sarau da Cooperifa, documentário dirigido por Sérgio Gagliardi e Maurício Falcão, produzido, em 2008, pela DGT Filmes. O filme narra a história e os bastidores do sarau que acontece na zona sul da cidade de São Paulo, em Campo Limpo, no bar do Zé Batidão. “A periferia não tem museu, não tem teatro nem cinema, o único espaço público que tem é o bar”, explica Sérgio Vaz, um dos idealizadores do movimento que contempla na produção poética, da periferia para a periferia, a força da contestação social. A cultura como arena para a luta entre os signos monossêmicos e a pluralidade sígnica proposta pelo artista que faz da palavra ruído incômodo. O sarau da Cooperifa, o sarau do Binho também já foram objetos de estudos acadêmicos, como a tese As redes de escritura nas periferias de São Paulo, de Marco Antônio Bin, defendida no Programa de Ciências Sociais da PUCSP, em maio de 2009

  13. Aneurismas da aorta Aortic aneurysms

    Directory of Open Access Journals (Sweden)

    Januário M Souza

    1992-09-01

    Full Text Available Entre janeiro de 1979 e janeiro de 1992, foram realizadas 212 operações para correção de aneurismas e de dissecções da aorta. Neste trabalho serão analisados 104 procedimentos cirúrgicos (em 97 pacientes para correção de aneurismas. A idade dos pacientes variou de 14 a 79 anos (média 59,5 anos e o sexo predominante foi o masculino, com 75 pacientes. Os aneurismas localizavam-se na aorta ascendente em 46 pacientes, na croça em 8, na aorta descendente em 8, na aorta toráco-abdominal em 8, na aorta abdominal em 21, na aorta descendente e abdominal em 2, na aorta ascendente e tóraco-abdominal em 2, na aorta ascendente e descendente em 1, na aorta ascendente, croça e descendente em 1. Doenças cardiovasculares associadas estavam presentes em 39 pacientes, sendo valvopatia aórtica em 18 (excluídos os pacientes com ectasiaânulo-aórtíca, insuficiência coronária em 17, coarctação da aorta em 2, persistência do canal arterial em 1 e valvopatia mitral e aórtica em 1. A mortalidade imediata (hospitalar e/ou 30 dias foi de 14,4%, sendo de 27,7% (5/18 para pacientes com mais de 70 anos e de 11,3% (9/79 para pacientes com idade inferior a 70 anos. Os aneurismas localizados na aorta ascendente e croça foram operados como o auxílio de circulação extracorpórea. Parada circulatória e hipotermia profunda foram utilizadas em todos os pacientes com aneurisma da croça. O estudo tomográfico e angiográfico deve ser de toda a aorta, pela possibilidade de aneurismas de localizações múltiplas.Among 212 patients undergoing operation for aortic aneurysm and aortic dissection between January 1979 and January 1992, 97 were operated on for aneurysms. The aneurysms were localized in: ascending aorta in 46 patients, transverse aortic arch in 8, descending aorta in 8, thoracoabdominal aorta in 8, abdominal (infrarenal aorta in 21, descending and abdominal aorta in 2, ascending and thoracoabdominal aorta in 2, ascending and descending in 1

  14. Virtual observatory publishing with DaCHS

    Science.gov (United States)

    Demleitner, M.; Neves, M. C.; Rothmaier, F.; Wambsganss, J.

    2014-11-01

    The Data Center Helper Suite DaCHS is an integrated publication package for building VO and Web services, supporting the entire workflow from ingestion to data mapping to service definition. It implements all major data discovery, data access, and registry protocols defined by the VO. DaCHS in this sense works as glue between data produced by the data providers and the standard protocols and formats defined by the VO. This paper discusses central elements of the design of the package and gives two case studies of how VO protocols are implemented using DaCHS' concepts.

  15. Virtual Observatory Publishing with DaCHS

    CERN Document Server

    Demleitner, Markus; Rothmaier, Florian; Wambsganss, Joachim

    2014-01-01

    The Data Center Helper Suite DaCHS is an integrated publication package for building Virtual Observatory (VO) and Web services, supporting the entire workflow from ingestion to data mapping to service definition. It implements all major data discovery, data access, and registry protocols defined by the VO. DaCHS in this sense works as glue between data produced by the data providers and the standard protocols and formats defined by the VO. This paper discusses central elements of the design of the package and gives two case studies of how VO protocols are implemented using DaCHS' concepts.

  16. Sobre os fundamentos epistemologicos da psicologia

    OpenAIRE

    Marcio Aparecido Mariguela

    1994-01-01

    Resumo: A pesquisa em psicologia educacional tem se pautado em dois critérios metodológicos: quantitativo e qualitativo. O primeiro é identificado com o positivismo e o segundo procura justificar-se na fenomenologia. Procuramos escapar deste suposto conflito metodológico,introduzindo a discussão no campo dos fundamentos epistemol6gicos da psicologia. Definimos como objeto de estudo os projetos de fundamentação da psicologia que se apresentam como eixos norteadores da prática metodológica. Est...

  17. Anatomia da madeira de Mimosa eriocarpa Benth.

    Directory of Open Access Journals (Sweden)

    Celso Carnieletto

    2009-09-01

    Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 São descritos os caracteres anatômicos da madeira de Mimosa eriocarpa Benth. e fornecidos 31 dados quantitativos de sua estrutura xilemática. A descrição é ilustrada com fotomicrografias tomadas nos três planos anatômicos. A estrutura da madeira é comparada com referências da literatura para espécies afins, em uma análise de caráter taxonômico-filogenética.

  18. Capoeiras e a Revolta da Vacina

    Directory of Open Access Journals (Sweden)

    Fabio Samu da Cunha

    2015-03-01

    Full Text Available Os capoeiras eram um problema para a República, antes mesmo de ela ser consolidada. Rodrigues Alves, que governou o Brasil no período de 1902-1906, enfrentou uma grande greve no ano de 1903. No ano de 1904 eclodiu a revolta da vacina. Para combater a epidemia da varíola era necessário tornar obrigatório a vacina de Jenner. O texto faz uma análise sobre os reais motivos que levaram a revolta da vacina e a adesão, com grande destaque, dos capoeiras na revolta.

  19. Uso da terra como determinante da distribuição da raiva bovina em Minas Gerais, Brasil

    OpenAIRE

    J.A. Silva; Moreira,E.C.; J.P.A. Haddad; I.B.M. Sampaio; Modena,C.M.; M.A.S. Tubaldini

    2001-01-01

    Realizou-se um estudo observacional retrospectivo com o objetivo de avaliar variáveis do uso da terra como determinante da distribuição da raiva bovina em Minas Gerais. Foram analisadas 7.526 fichas de diagnóstico de raiva por imunofluorescência direta, de 1976 a 1997. Utilizaram-se os dados dos Censos Agropecuários de Minas Gerais- FIBGE, anos de 1970, 1985 e 1995-1996. Empregou-se o método da análise fatorial de componentes principais, com auxílio do programa Minitab versão 9.0. A raiva bov...

  20. MANEJO DA IRRIGAÇÃO DA CULTURA DA ALFACE (Lactuca sativa L. ATRAVÉS DO TANQUE CLASSE A

    Directory of Open Access Journals (Sweden)

    ANDRADE JÚNIOR A.S. de

    1997-01-01

    Full Text Available Com o objetivo de avaliar o efeito de diferentes níveis de irrigação, baseados em frações da evaporação do Tanque Classe A (ECA (0,25; 0,50; 0,75 e 1,00 sobre o comportamento produtivo da cultura da alface, variedade "Mesa 659" (tipo americana, cultivada em uma estufa plástica e irrigada por gotejamento, foi conduzido um experimento durante o período de julho a setembro de 1993. O comportamento produtivo foi avaliado através da determinação da matéria fresca (MFP, produtividade (PROD e eficiência do uso de água (EUA. Os resultados de MFP e PROD mostraram resposta quadrática, indicando acréscimo em ambos à medida que aumentaram as lâminas de irrigação aplicadas até o nível 0,75 da ECA, apresentando valores máximos de 818,72 g e 90,97 t.ha-1, respectivamente. Os dados relativos à EUA revelaram resposta linear decrescente, significando que à medida que os níveis de irrigação aumentam ocorre uma diminuição na EUA.

  1. Tipologia da consciência

    Directory of Open Access Journals (Sweden)

    João Queiroz

    2008-10-01

    Full Text Available Apesar do interesse crescente de muitas comunidades cientí­ficas pelo fenômeno da consciência, e apesar dos avanços obtidos recentemente por estas comunidades, multiplicam-se questões básicas sobre teorias, métodos, modelos e protocolos de investigação adequados; multiplicam-se as divergências sobre definições e demarcações conceituais e terminológicas. Parece, entretanto, haver uma questão consensual, embora não resolvida, que aproxima materialistas e dualistas, reducionistas e epifenomenalistas de muitas áreas: a consciência é um estado, processo ou entidade, que manifesta-seheterogeneamente. Como classificar a heterogeneidade de suas formas?Abstract: In spite of the increased interest of several scientific communities in the phenomenon of consciousness, and in spite of the recent results they have obtained, many basic questions about the most adequate theories, methods, models, and protocols for investigation concerning this topic remain, as well as disagreements about conceptual and terminological definitions. However, there does seem to be a consensus among dualists, materialists, reductionists and epiphenomenalists from many fields that consciousness is a state, process or entity, which express itself heterogeneously. This,therefore, leads to the question of how to classify the heterogeneity of its forms.

  2. Metilfenidato: medicamento gadget da contemporaneidade

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Brant

    2012-09-01

    Full Text Available O objetivo deste artigo consiste em apresentar os principais aspectos do uso não médico do metilfenidato. Em termos metodológicos, procedemos a uma pesquisa bibliográfica na busca por uma melhor compreensão interdisciplinar dessa utilização polêmica e multifacetada. Constatamos que o uso contemporâneo ultrapassa a tríade doença, saúde e cuidado. Compreende a busca incessante do homem em superar seus limites e viver bem em sociedade, o que torna esse medicamento um fetiche, aproximando o usuário de sua fragilidade. Percebe-se que, primeiramente, produziu-se o metilfenidato e, posteriormente, tentou-se configurar cientificamente o transtorno do déficit de atenção e hiperatividade (TDAH, ou seja, inventou-se, primeiro, o remédio e, depois, a doença. Concluímos ser o metilfenidato mais um gadget da contemporaneidade. Um objeto de consumo curto e rápido, parceiro conectável e desconectável ao alcance das mãos, tornando-se dispositivo de prazeres efêmeros, fabricado e comercializado como medicamento.

  3. Épocas de emergência de Brachiaria brizantha no desenvolvimento da cultura da soja

    Directory of Open Access Journals (Sweden)

    Silva Andréia Cristina

    2005-01-01

    Full Text Available A integração agricultura-pecuária beneficia simultaneamente a produção de grãos e a pecuária. Todavia, a forrageira tem sido a principal espécie daninha que compete com a cultura anual. Objetivou-se, neste trabalho, quantificar os efeitos de épocas de emergência de Brachiaria brizantha em relação à cultura da soja. O experimento foi realizado em casa de vegetação, avaliando-se sete épocas de emergência de B. brizantha em relação à cultura da soja (-21, -14, -7, 0, 7, 14 e 21 dias da emergência da soja e da soja em monocultivo. No estádio R2 da soja, foram determinados o número de colmos de B. brizantha, a área foliar e a partição de biomassa seca de ambas as espécies e o número de folhas trifolioladas e de nós de soja. No estádio R8 da soja, foram avaliados a biomassa seca total da parte aérea e o número de colmos da forrageira, assim como a produção de grãos por planta e o número de vagens por planta e de sementes por vagem da soja. A época de emergência da B. brizantha em relação à da soja foi determinante no crescimento de ambas as espécies. Foi observada redução da produção de grãos por planta de soja consorciada, comparada ao monocultivo, de aproximadamente 97, 96, 91, 80, 34, 27 e 15% quando B. brizantha emergiu aos -21, -14, -7, 0, 7, 14 e 21 dias da emergência da soja, respectivamente, sendo o acúmulo de biomassa seca da parte aérea da forrageira nos respectivos tratamentos de 275, 279, 267, 202, 79, 46 e 23 gramas por vaso. Em ordem decrescente, a suscetibilidade das características morfológicas da soja, avaliadas no estádio R2, devido à interferência imposta por B. brizantha ocorreu da seguinte maneira: número de folhas trifolioladas e área foliar > biomassa seca de folhas, haste, raízes e nódulos > número de nós. O número de vagens por planta da soja consorciada foi semelhante ao do monocultivo quando B. brizantha emergiu aos 21 dias da emergência da soja, e o de sementes

  4. Reversões da Metafísica Moral: Algumas Formas da Alteridade em A Convidada

    Directory of Open Access Journals (Sweden)

    Sílvio Rosa Filho

    2016-06-01

    Full Text Available RESUMO. O romance A convidada, de Simone de Beauvoir, não é ainda a manifestação sensível da moral da ambiguidade propriamente dita. É possível, no entanto, compreender a relação entre alguns conceitos fundamentais que povoam a forma romanesca e a concepção da metafísica moral, tal como Merleau-Ponty a concebe, tanto no ensaio que o filósofo consagrou ao romance, quanto em suas anotações, em O visível e o invisível. A partir dessa relação, destacaremos três momentos distintos e complementares: das imagens negativas à tomada de decisão; as formas abstratas da alteridade e a alteridade concreta; da sedimentação dos conteúdos em movimento à forma da reversibilidade.

  5. 青稞HbSnRK2.4的克隆及其序列特征与表达特性分析%Cloning and Characterization of HbSnRK2.4 in Tibetan Hulless Barley (Hordeum vulgare L. var. nudum HK.f.)

    Institute of Scientific and Technical Information of China (English)

    曾兴权; 王玉林; 徐齐君; 原红军; 韦泽秀; 尼玛扎西

    2015-01-01

    干旱胁迫是制约农作物生产的重要限制因素之一,研究并增强作物的抗旱性具有重要意义。SnRK2(Sucrose non-fermenting 1-related protein kinase 2)基因编码一类蔗糖非酵解型蛋白激酶,该酶在ABA信号转录途径和抗渗透胁迫中起着重要作用。以青稞(Hordeum vulgare subsp. vulgare)抗旱品种喜马拉雅10号为材料,利用RT-PCR技术克隆获得了SnRK2基因全长cDNA序列,命名为HbSnRK2.4(登录号:KJ699389)。生物信息学分析表明,该基因全长1310 bp,编码362个氨基酸序列,蛋白分子量为41.94 kD,等电点(pI)为5.96。Prosite Scan分析结果表明,HbSnRK2.4含有多个干旱胁迫响应蛋白的作用位点,如酪蛋白激酶Ⅱ磷酸化位点、酪氨酸激酶磷酸化位点、蛋白激酶C磷酸化位点及N-豆蔻酰化位点等。利用实时定量PCR方法研究了HbSnRK2.4在干旱胁迫条件下及复水后不同时间点的表达情况,发现HbSnRK2.4在土壤绝对含水量为33.4%时表达量最高,随着土壤绝对含水量的下降而下调表达;当达到作物正常生长所需的土壤绝对含水量时又开始上调表达;进行干旱胁迫后(<15.5%)基因表达量下降;复水后8h时恢复正常表达水平。%Drought stress has become one of the important factors that hamper the production of agriculture. Varieties with enhanced drought resistance can be an effective way to solve this problem. SnRK2 gene encoded a kind of Sucrose non-fermenting 1-related protein kinase,which have been thought to play an important role in the ABA signaling pathways and resistance to osmotic stress. However,the exact mechanism underlining is still to be elusive. We presented the isolation of a new SnRK2 gene from Hordeum vulgare subsp. vulgare, nominated as HbSnRK2.4(Accession No. Kj699389)by RT-PCR. The plants were proved to be highly drought tolerance. The gene was 1 310 base pair in length,encoding a peptide of 362 amino acids

  6. Sobre o tempo da loucura em Nise da Silveira Time in mental illness according to Nise da Silveira

    Directory of Open Access Journals (Sweden)

    Jacileide Guimarães

    2007-04-01

    Full Text Available Trata-se de um ensaio sobre a vivência do tempo no âmbito do hospital psiquiátrico. Após breve incursão acerca da escrita sobre o tempo e o tempo no hospital psiquiátrico, nos detemos no enfoque da psiquiatra e pesquisadora Nise da Silveira, cujo trabalho foi desenvolvido no Centro Psiquiátrico Nacional do Engenho de Dentro Rio de Janeiro (antigo Centro Psiquiátrico Pedro II e atualmente denominado Instituto Municipal Nise da Silveira, onde criou, em 1946, a Seção de Terapêutica Ocupacional e Reabilitação (STOR, chamada por um interno de "a sala da emoção de lidar". O tempo da loucura em Nise equaciona a síntese tempo versus afeto, sem reservas para com as susceptibilidades de um saber científico, mas em busca da real complexidade da condição humana. Reportando-se da vida ao sofrimento, Nise trouxe o afeto como condição sine que non para a compreensão da diferença e no limite para o questionamento do que o jargão psiquiátrico preconizava/esquadrinhava como "desorientado no tempo e no espaço". Com a tendência da reestruturação dos serviços psiquiátricos no Brasil, o tempo revisitado da loucura enclausurada traz a contribuição de Nise da Silveira como atitude digna de sobrevivência em tempos de atenção psicossocial.This research is about time at psychiatric hospitals. After a brief review of the literature on time and time at a psychiatric hospital, the author focused on psychiatry's approach and on studies by Nise da Silveira, a researcher who worked at the Centro Psiquiátrico Nacional do Engenho de Dentro, Rio de Janeiro (now named Centro Psiquiátrico Pedro II, where in 1946 she founded an Occupational Therapy and Rehabilitation Division, which a patient named "the emotions coping room". Time of mental illness according to Nise is equal to the synthesis of time versus affection, with no considerations towards the sensitivities of scientific knowledge, but instead is a search for the real complexities of the

  7. An extension of PPLS-DA for classification and comparison to ordinary PLS-DA.

    Directory of Open Access Journals (Sweden)

    Anna Telaar

    Full Text Available Classification studies are widely applied, e.g. in biomedical research to classify objects/patients into predefined groups. The goal is to find a classification function/rule which assigns each object/patient to a unique group with the greatest possible accuracy (classification error. Especially in gene expression experiments often a lot of variables (genes are measured for only few objects/patients. A suitable approach is the well-known method PLS-DA, which searches for a transformation to a lower dimensional space. Resulting new components are linear combinations of the original variables. An advancement of PLS-DA leads to PPLS-DA, introducing a so called 'power parameter', which is maximized towards the correlation between the components and the group-membership. We introduce an extension of PPLS-DA for optimizing this power parameter towards the final aim, namely towards a minimal classification error. We compare this new extension with the original PPLS-DA and also with the ordinary PLS-DA using simulated and experimental datasets. For the investigated data sets with weak linear dependency between features/variables, no improvement is shown for PPLS-DA and for the extensions compared to PLS-DA. A very weak linear dependency, a low proportion of differentially expressed genes for simulated data, does not lead to an improvement of PPLS-DA over PLS-DA, but our extension shows a lower prediction error. On the contrary, for the data set with strong between-feature collinearity and a low proportion of differentially expressed genes and a large total number of genes, the prediction error of PPLS-DA and the extensions is clearly lower than for PLS-DA. Moreover we compare these prediction results with results of support vector machines with linear kernel and linear discriminant analysis.

  8. A renovação fichteana da filosofia da imagem

    Directory of Open Access Journals (Sweden)

    Christoph Asmuth

    2014-12-01

    Full Text Available Este artigo pretende apresentar ao público brasileiro a leitura sobre a filosofia fichteana do Professor da Technische Universität Berlin, Christoph Asmuth, sobre um tema específico do pensamento de Fichte, a teoria da imagem. O texto foi originalmente apresentado como palestra no Departamento de Filosofia da UnB em 2014, como parte do projeto Douta Ignorância, coordenado pelo docente Herivelto Souza.

  9. História da cirurgia da tireoide = History of thyroid surgery

    Directory of Open Access Journals (Sweden)

    Toneto, Marcelo Garcia

    2015-01-01

    Full Text Available Objetivos: Revisar a história do conhecimento sobre as afecções da tireoide, com ênfase na evolução do tratamento cirúrgico das doenças dessa glândula, especialmente nos cirurgiões envolvidos no aperfeiçoamento de uma operação que inicialmente apresentava altas taxas de complicações e mortalidade. Métodos: Revisão da literatura utilizando as bases de dados PubMed e LILACS. Foram selecionados artigos relevantes sobre a história da cirurgia da glândula tireoide. Resultados: A evolução histórica da cirurgia da tireoide é semelhante à evolução da cirurgia em geral. Inicialmente cercada de superstições e resultados desastrosos, foi sendo aperfeiçoada pela contribuição de ícones da cirurgia como Billroth, Kocher e Halsted, até tornar-se um procedimento efetivo. Por se tratar de uma doença com alta prevalência, permitiu que centros de referência atingissem enorme experiência no procedimento, sendo inclusive o tipo de cirurgia que oportunizou o desenvolvimento das maiores clínicas de cirurgia nos Estados Unidos e na Europa. Conclusões: Apesar de reconhecida desde a antiguidade através das afecções que a acometem, o tratamento cirúrgico das doenças da tireoide somente se tornou seguro nos últimos 120 anos. O desprendimento e a coragem de cirurgiões pioneiros permitiram a compreensão da anatomia e da fisiologia da glândula tireoide, o que possibilita a realização de uma operação com altas taxas de segurança e efetividade nos dias atuais

  10. Apontamentos para uma sociologia da valentia

    Directory of Open Access Journals (Sweden)

    Eliézer Cardoso de Oliveira

    Full Text Available Resumo O artigo objetiva a construção de uma tipologia da valentia a partir da sociologia compreensiva de Weber, Simmel e Elias. A valentia é considerada como uma escolha valorativa de indivíduos inclinados a levarem uma vida de aventura e convictos da legitimidade de um estilo de vida baseado na proximidade com a violência, com a morte e com o risco. Mesmo com o advento da modernidade, quando emergiu o “processo civilizador”, responsável por refrear os instintos violentos, a valentia, restringida na vida cotidiana, mantém-se atuante como um valor social legítimo.

  11. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  12. Nova abordagem no tratamento da esquizofrenia

    Directory of Open Access Journals (Sweden)

    Walter Speltri

    1966-12-01

    Full Text Available Foram tratados 11 casos de esquizofrenia com a guanetidina, substância considerada, do ponto de vista farmacodinâmico, como simpaticoplégica. Na opinião do autor, os surpreendentes e significativos resultados obtidos autorizam uma nova abordagem nas pesquisas à procura da etiopatogenia da esquizofrenia e, a partir dos elementos colhidos, considera plausível uma "teoria psicossomática da esquizofrenia". Recusa-se, entretanto, a cair no atraente, mas inútil, terreno especulativo. Prefere aguardar que os farmacologistas e fisiologistas forneçam dados pais precisos sobre o mecanismo de ação da guanetidina e que novos estudos confirmem seus resultados para, depois, dar publicidade à sua teoria.

  13. Sociologias da literatura: Do reflexo à reflexividade

    Directory of Open Access Journals (Sweden)

    ANDRÉ BOTELHO

    Full Text Available Resumo A “sociologia da literatura” vem conhecendo maior pluralização de perspectivas que tornam a compreensão da literatura mais matizada em relação à ideia de “reflexo”, que marcou sua tradição de pesquisa, como indicam os balanços bibliográficos publicados nas últimas três décadas em periódicos de língua inglesa que analisamos neste artigo. Contudo, literatura e sociedade seguem sendo concebidos, em geral, como externos um ao outro, e não como reflexivamente relacionados. Mobilizando as perspectivas teóricas de Anthony Giddens e Niklas Luhmann para qualificar a ideia de reflexividade, argumentamos que elas podem constituir pontos de partida diferentes, mas igualmente consistentes para uma agenda renovada da sociologia da literatura.

  14. Wenceslau de Moraes, interprete da cultura japonesa

    National Research Council Canada - National Science Library

    Claudio Alexandre Barros Teixeira

    2015-01-01

    .... His complete works, in the form of essays, letters, diaries and travel reports, include 14 volumes dedicated to Japan and Japanese culture, with special attention to Relance da alma japonesa, published in 1925, a work that...

  15. Aleksi II kritikujet "Kod da Vintshi"

    Index Scriptorium Estoniae

    2006-01-01

    Dan Browni samanimelise romaani järgi valminud põnevusfilm "Da Vinci kood" : režissöör Ron Howard : Ameerika Ühendriigid 2006. Venemaa patriarh Aleksius II nimetas filmi linastamist lugupidamatuseks moraalinormide vastu

  16. A química da vida

    OpenAIRE

    2014-01-01

    A Bioquímica ou Química da Vida é uma ciência interdisciplinar que utiliza estratégias e métodos de todas as Ciências Exactas e Naturais. Nos últimos 10 anos, foram catorze os prémios Nobel da Química, Fisiologia e Medicina que foram atribuídos na área da Bioquímica o que reflecte a importância desta área de conhecimento nas Sociedades contemporâneas. A Química da Vida não se reduz apenas ao estudo dos compostos orgânicos, tais como os açúcares, lipidos ou proteínas mas tamb...

  17. O psicanalista no tratamento da dor

    Directory of Open Access Journals (Sweden)

    Sueli Pinto Minatti

    2012-12-01

    Full Text Available A dor se manifesta como mal-estar do corpo e no corpo, e tende a ser encaminhada para tratamento médico. O objetivo deste trabalho é analisar a queixa dolorosa do ponto de vista do tratamento psicanalítico, retomando algumas acepções relacionadas ao tratamento da dor, encontradas na obra de Freud. Partimos da experiência no trabalho em hospital pediátrico, utilizando a análise do atendimento de pacientes com queixas de dor para definir e situar a dor no campo da psicanálise, e distingui-la do campo da medicina. No texto, pode-se acompanhar a dor como signo de sofrimento e diversas formas de abordá-la tanto pelo sujeito que a porta quanto pelas instituições que propõem seu cuidado.

  18. O pêndulo da modernidade

    Directory of Open Access Journals (Sweden)

    ÁGNES HELLER

    1994-12-01

    Full Text Available O bicentenário da Revolução Francesa, em 1989, e as revoluções anti-totalitárias da Europa Oriental entre 1989 e 1991 levam os autores a interpretar a modernidade através da metáfora do pêndulo, utilizada para denotar a dinâmica do atual ordenamento social, pluralista e autônomo e que oscila, sem nunca parar, entre radicalismo e moderação. Para fazer uma diagnose do auto-conhecimento dos indivíduos modernos, o texto analisa questões referentes à modernidade e seus problemas: o totalitarismo lhe é inerente? Há como evitá-lo? As promessas de 1789 podem ser mantidas? E recorre à história para avaliar ceticamente a modernidade a partir de suas duas condições de existência: a dinâmica moderna (dialética, que opera através da auto-reflexividade da justiça dinâmica, e o ordenamento social moderno, estrutura constante de (re-distribuição simétrica ou assimétrica de liberdade e chances de vida. O artigo introduz as lógicas dinâmicas da modernidade (a divisão funcional do trabalho, a arte de governar e a tecnologia, mostrando que elas, operando conjuntamente ou em conflito, movimentam o pêndulo da modernidade geralmente entre os pólos do "individualismo" e do "comunitarianismo", entre a defesa do Estado do Bem-estar e a prática do mercado auto-regulador, de forma que não oscile entre oposições binárias ("capitalismo" e "socialismo", "direita" e "esquerda", "progresso" e "reação". Por fim, são enfatizados os efeitos advindos da percepção da existência do pêndulo da modernidade sobre a política, que se transforma em pós-moderna: acaba a vontade pela transcendência da modernidade; novas alianças, a "contextualidade" e algumas premissas universais na área política tornam-se importantes; o "modo de vida" prevalece sobre a "classe". No entanto, o texto atenta para os problemas destes ideais anti-holistas, que podem levar à intolerância e à impossibilidade de um meio coletivo de entendimento.

  19. Morfologia da laringe de cutia (Dasyprocta sp.

    Directory of Open Access Journals (Sweden)

    Andrezza B.S. Silva

    2014-06-01

    Full Text Available A cutia (Dasyprocta sp. é um roedor silvestre com distribuição mundial. Atualmente, além de importante papel ecológico que exerce, está sendo utilizada como modelo em experimento animal. Estudos sobre a morfologia destes animais são importantes porque podem ser uma alternativa para o estudo de diversos processos patológicos, além de contribuirem para a preservação da espécie. A laringe é um órgão localizado entre a faringe e a traqueia, no qual está envolvido nas funções de respiração, deglutição e fonação. O presente estudo propôs realizar uma descrição morfológica macroscópica e microscópica da laringe da cutia. Para tanto, foram utilizadas quinze cutias pertencentes ao Centro de Ciências Agrárias da Universidade Federal do Piauí e provenientes do Núcleo de Estudos e Preservação de Animais Silvestres com licença do IBAMA (Nº 02/08-618, CTF Nº 474064. Todos os animais foram identificados, promovida a sexagem e, posteriormente, a laringe acessada e dissecada sendo os fragmentos cartilagíneos encaminhados para rotina histológica e corados pelo método de hematoxilina-eosina. As lâminas obtidas foram visualizadas em microscopia óptica de luz e foto documentadas. A laringe da cutia apresenta cinco cartilagens, com ausência da cartilagem cuneiforme e presença da incisura caudal na cartilagem tireoide. O tecido epitelial da laringe varia de epitélio estratificado pavimentoso queratinizado à não queratinizado e ciliado com células caliciformes.

  20. Claro Enigma:o discurso da Obscuridade

    Directory of Open Access Journals (Sweden)

    Marilia Fiorillo

    2012-06-01

    Full Text Available Contrariando o molde clssico, o intenso poder comunicativo da primeira retrica crist repousa no paradoxo, no exagero e na ambivalncia. A retrica crist nasceu no da simplicidade dos lrios dos campos, mas de uma exortao ao assombro e ao enigma como pathos das boas-novas. Neste ensaio, analisamos em mincia esta caracterstica, numa passagem (perikope do mais antigo evangelho de que se tem conhecimento, o Evangelho de Tom.

  1. "Da Vinci kood" ja Eesti / Reet Rast

    Index Scriptorium Estoniae

    Rast, Reet, 1964-

    2010-01-01

    Möödunud kuu kunstisündmuseks oli "Da Vinci koodi avamine" Kadrioru Kunstimuuseumis ja Tallinna Ülikoolis. 5.-12. veebruarini eksponeeriti Kadrioru kunstimuuseumis Leonardo da Vinci arvatavat autoportreed. Lõuna-Itaalia erakogust leitud maali analüüsimisega tegelesid Tallinna Ülikooli maali ja maalitehnoloogia õppejõud Orest Kormašov, kes valmistas klassikalise portreeskulptuuri, arvutisimulatsiooni teostas Eesti Kunstiakadeemia graafilise disaini tudeng Helen Kokk

  2. Fundamentos bioquímicos da hereditariedade

    Directory of Open Access Journals (Sweden)

    Paulo A. Otto

    1970-04-01

    Full Text Available Os autores apresentam os resultados de levantamentos seccionais sobre a prevalência e a morbidade da esquistossomose mansônica no Estado de Alagoas. Os inquéritos foram feitos em oito localidades, urbanas e rurais. A prevalência da esquistossomose e de outras helmintoses intestinais foi muito elevada. As formas hepato-esplênicas variaram de 1 a 3%.

  3. Discursos e imagens da violência

    Directory of Open Access Journals (Sweden)

    Fernanda Cristina Marquetti

    2014-09-01

    Full Text Available Este artigo baseou-se na pesquisa de doutorado “Discursos e imagens da violência”, na qual abordamos as mortes violentas (homicídios na metrópole de São Paulo, privilegiando o estudo das elaborações subjetivas e culturais que ocorrem em torno desse fenômeno. O objetivo desta pesquisa foi abordar dois tipos de discursos sobre as mortes violentas: o discurso de uma população submetida ao evento das mortes violentas e o discurso da mídia televisiva sobre o fenômeno da violência. Há duas vertentes metodológicas neste estudo. A primeira é uma abordagem etnográfica de um bairro situado ou visto como “território violento” na cidade de São Paulo. A segunda são duas análises de discursos sobre as mortes violentas: o discurso da mídia televisiva e o discurso dos moradores do território. Nos resultados da etnografia do território violento encontramos, na trama da sociabilidade, angústia, medo, estratégias de sobrevivência e outros subterfúgios para viver num bairro violento. Nas narrativas dos moradores encontramos uma série de discursos verbais fragmentados, caóticos, desorganizados onde estava presente o terror da proximidade excessiva com a morte. Em contraponto, na análise do discurso da mídia televisiva, encontramos o excesso de imagens, verbalizações, teorizações e interpretações sobre a violência.

  4. Efeitos imediatos da MWM na dor, amplitude de movimento e funcionalidade, na osteoartrite da anca.

    OpenAIRE

    Beselga, Carlos

    2014-01-01

    Introdução: A mobilização com movimento (MWM), segundo o Conceito Mulligan tem apresentado bons resultados na melhoria da dor, amplitude de movimento e funcionalidade em diversas disfunções. No entanto, existem poucos estudos sobre a articulação da anca e, até este momento, não foi avaliada a sua efetividade em indivíduos com osteoartrite da anca. Objectivo(s): Avaliar os efeitos imediatos da técnica de MWM na dor, na amplitude de movimento e na função física em indivíduos com ...

  5. Adaptações da geometria da coluna vertebral e do dorso durante a corrida

    OpenAIRE

    2004-01-01

    Resumo: As adaptações das curvaturas da coluna vertebral e do dorso de corredores são analisadas em função da velocidade. A pesquisa é realizada com dez atletas voluntários, com faixa etária entre 18 e 26 anos, com experiência esportiva, correndo sobre uma esteira regulada em oito velocidades. A curva da coluna vertebral é representada por marcadores retrorefletores circulares aderidos à pele ao longo da linha definida pelos processos espinhosos vertebrais entre a região cervical e sacral. Sã...

  6. Estado da arte do Plano de Segurança da Água

    OpenAIRE

    Vieira, J. M. Pereira

    2015-01-01

    O reconhecimento do acesso a água segura e a saneamento como um direito humano, por parte da Assembleia Geral da ONU, em 2010, constituiu um acto político de elevado significado estratégico, contribuindo, decisivamente, para um novo impulso a nível mundial no sentido de garantir o acesso universal a estes serviços fundamentais que se têm revelado de vital importância para a protecção da saúde pública e para a promoção da qualidade de vida nas sociedades modernas. Face ao enorme crescimen...

  7. Procedimentos perceptuais na segmentação da cadeia da fala

    Directory of Open Access Journals (Sweden)

    Luiza de Arruda Nepomuceno

    2008-04-01

    Full Text Available 0 presente trabalho, dentro da psicolinguística experimental, insere-se na linha de pesquisa do Laboratório de Psicologia Experimental da Universidade de Bruxelas, cujo grupo chefiado pelo Prof. Jose Morales, procura investigar as capacidades metalinguísticas de segmentação da fala e o possível efeito reversivo da leitura sobre estratégias perceptuais. Esta pesquisa, utilizada como assunto central de Tese de Doutorado, na Disciplina Distúrbios da Comunicação Humana, Departamento de Oftalmo-Otorrinolaringologia da Escola Paulista de Medicina, tem por objetivo teórico discutir a realidade psicologiaca dos tragos fonéticos, dos fonemas e das sílabas, entre individuos letrados e iletrados. Preocupa-se, essencialmente, em avaliar as capacidades metalinguísticas de segmentação da cadeia da fala. Realmente, desde o surgimento e desenvolvimento da teoria dos traços fonéticos por R. Jakobson e M. Halle (1955i, ela tem se prestado a inúmeros debates.

  8. O método comparativo na origem da psicologia da arte

    OpenAIRE

    Arley Andriolo

    2006-01-01

    Este texto tem por objetivo apresentar o surgimento do método comparativo nas interpretações psicológicas das produções artísticas da Europa e do Brasil. Utilizam-se os discursos da Psiquiatria no início do século XX, notando como as interpretações básicas acerca da Psicologia da Arte foram permeadas pelo método comparativo. Este, por sua vez, carregou consigo um risco de análise, o de encontrar na arte uma manifestação de degeneração.

  9. Problemas da educação: o caso da psicopedagogia

    Directory of Open Access Journals (Sweden)

    Sass Odair

    2003-01-01

    Full Text Available Neste artigo é discutida a relevância dos problemas psicopedagógicos recorrentes das determinações internas e externas à educação escolar, a par do equívoco da pretensão de regulamentar a psicopedagogia como mais uma profissão da esfera educacional. Destaca a questão da regulamentação das profissões de nível superior no Brasil e as raízes variadas da psicopedagogia desde o período imediato após a Segunda Guerra Mundial.

  10. Os riscos da nanotecnologia e a responsabilidade socioambiental e ética da empresa

    OpenAIRE

    2014-01-01

    O tema desta pesquisa centra-se nos riscos da nanotecnologia e a responsabilidade socioambiental e ética da empresa à luz dos direitos humanos. Delimita-se na responsabilidade da empresa diante dos riscos oferecidos pela nanotecnologia à saúde e segurança humana. Em tal abordagem busca-se destacar que tais riscos não se limitam ao ambiente interno da empresa, onde potencialmente são produzidos, pois por suas peculiaridades podem afetar também o ambiente externo e consequentemente a sociedade ...

  11. Teoria da Agência e o Controle Social da Gestão Pública

    OpenAIRE

    Pinto, Daniely Wasilewski; Kozikowski, Heitor Pacheco; Pillati, Janinie Jurich; Chelski, Willian; Samaha, Michel Jorge

    2014-01-01

    RESUMO O presente artigo procura analisar a aplicabilidade da teoria da agência naquilo que, modernamente, se convencionou chamar de controle social da administração pública. Para atingir tal objetivo, foi utilizada uma pesquisa bibliográfica. Concluiu-se que, para a gestão pública, a sociedade seleciona um “agente” representante de seus interesses. E, assim procedendo, ela se caracteriza como agente “principal”. Essa interação é estudada pela Teoria da Agência que, por sua vez, evidencia tam...

  12. A História da enfermagem em Pernambuco: um olhar da ABEn (1968-1972

    Directory of Open Access Journals (Sweden)

    Fatima Maria da Silva Abrão

    2001-06-01

    Full Text Available Este artigo é uma tentativa de contribuir com a história da enfermagem ao levantar questões relevantes, marcos e influências que através da Associação Brasileira de Enfermagem foram vislumbrados na época. Através de depoimento oral e análise de documentos pudemos destacar ampla atuação da associação relacionadas à questões trabalhistas, normatização do exercício profissional, formação profissional, atividades sócio-culturais e educativas da enfermagem em Pernambuco.

  13. Cultura da marca: estratégia ou acaso?

    OpenAIRE

    Camargo, Shirlei Miranda; Machado Toaldo, Ana Maria; Mady, Elaine Batista; Sobrinho, Zaki Akel

    2014-01-01

    Este trabalho aborda o tema cultura como um dos componentes para a formação da identidade de marca. Seu objetivo é analisar a construção da marca CONDOR, uma grande rede supermercadista paranaense, sob o enfoque cultural. Primeiramente, desenvolveu-se breve referencial teórico sobre marca, posicionamento e identidade da marca e cultura da marca.

  14. Didáctica da física e didáctica da química : o computador no ensino da física e da química

    OpenAIRE

    Pereira, Duarte Costa

    1991-01-01

    Formação - Professores Programa apresentado pelo professor Duarte Costa Pereira, sobre a utilização do computador no ensino da Física e da Química. Disciplina “Didáctica da Física e da Química “, do Curso de Profissionalização em Exercício.

  15. NOTAS SOBRE A IRRACIONALIDADE DA GUERRA

    Directory of Open Access Journals (Sweden)

    Edilene Leal

    2014-08-01

    Full Text Available Nesse artigo, procedemos a uma análise sobre a irracionalidade da guerra em tempos cada vez mais caracterizados pela evolução da racionalidade técnica, ou seja, em tempos contemporâneos. Esse é o ponto a partir do qual traçamos, aqui, um percurso argumentativo dividido em duas partes. Na primeira, reconstituímos elementos da concepção de guerra de filósofos como Maquiavel, Clausewitz e Kant, destacando, nos dois primeiros pensadores, a prerrogativa de que a guerra é racional quando se configura meio para fins políticos. Na segunda parte, confrontamos essa racionalidade política da guerra com a dupla dimensão técnica que a guerra assumiu: de um lado, a guerra como um fim em si mesmo e não mais como meio da ação política; de outro, a dimensão racionalizante da guerra como resultado do progresso técnico e científico, atualizada como guerra do terror.

  16. Antropologia e esoterismo: dois contradiscursos da modernidade

    Directory of Open Access Journals (Sweden)

    José Jorge de Carvalho

    1998-06-01

    Full Text Available Resumo Este ensaio visa analisar as complexas relações entre duas visões de mundo que se desenvolveram no mundo ocidental a partir da segunda metade do século vinte: o esoterismo e a Antropologia entendida como disciplina acadêmica. Procuro mostrar que ambas correntes de pensamento são ao mesmo tempo herdeiras do projeto da modernidade e críticas do seu sistema de valores. De fato, tanto a Antropologia como as tradições esotéricas se opõem ao modelo weberiano de racionalidade, reeditado nos nossos dias por Habermas, que visa separar, como se fossem autônomas, as esferas da ciência, da arte e da moral. Três conceitos importantes do esoterismo são discutidos à luz da abordagem antropológica: tradição, iniciação e ciência sagrada, o que conduz a uma proposta de reintegração dos saberes humanos sobre a experiência religiosa em suas mais diversas manifestações etnográficas.

  17. Canopy Opener e assistência de ar no controle da ferrugem asiática e produtividade da cultura da soja

    OpenAIRE

    Prado, Evandro Pereira [UNESP

    2012-01-01

    Com a finalidade de comparar diferentes tecnologias de aplicação em pulverizações terrestre no controle da ferrugem asiática da soja (FAS), o trabalho objetivou construir um dispositivo abridor do dossel da soja e comparar diferentes tecnologias de aplicação de fungicida sobre os depósitos, controle da FAS e produtividade da soja. A confecção do dispositivo Canopy opener (CO) foi baseada no protótipo desenvolvido por pesquisadores do Departamento de Agricultura dos Estados Unidos da América (...

  18. Corrimentos vaginais em gestantes: comparacao da abordagem sindromica com exames da pratica clinica da enfermagem

    Directory of Open Access Journals (Sweden)

    Thais Marques Lima

    2013-12-01

    Full Text Available Estudo avaliativo de abordagem quantitativa, com amostra de 104 gestantes, com o objetivo de comparar os achados de infecções vaginais em gestantes obtidos por meio do fluxograma de corrimento vaginal com exames presentes na prática clínica da Enfermagem. Os dados foram coletados por meio de entrevista e exame ginecológico realizados de janeiro a julho de 2011. O fluxograma não se mostrou eficaz na identificação de candidíase e tricomoníase, apresentou baixa sensibilidade (0,0%; 50% e valor preditivo positivo (0,0%; 3,6% para as duas infecções e baixa especificidade para tricomoníase (46%. Mostrou-se satisfatório para vaginose bacteriana, com alta sensibilidade (100%, valor preditivo negativo (100% e acurácia (74%. Conclui-se que o emprego do fluxograma precisa ser reavaliado, visto que não foi eficaz em identificar infecções importantes em gestantes. Os esforços para o desenvolvimento de testes eficazes devem ser contínuos, com intuito de prevenir a disseminação de infecções e reduzir tratamentos desnecessários.

  19. Fase aguda da esquistossomose mansoni

    Directory of Open Access Journals (Sweden)

    Edward Tonelli

    1972-10-01

    Full Text Available O A. faz um estudo panorâmico sobre a fase aguda da esquistossomose mansoni, abordando o quadro clínico e seu diagnóstico, os exames subsidiários, o diagnóstico diferencial, a terapêutica e os aspectos evolutivos. As manifestações clinicas dos períodos de incubação, de estado e de supressão são abordados. O diagnóstico da fase aguda é baseado em dado epidemiológico, 110 exame fisico e em exames subsidiários. O dado epidemiológico. em geral, é positivo, com menção a banho infectante, comumente 30 a 40 dias antes do início do quadro clínico e ao exame físico, encontramos hipertermia (38 - 4G°C, prostração, micropoliadenia hepatomegalia dolorosa em 95%, dos casos e esplenomegalia em 70% dos casos. Os exames prioritários para o diagnóstico são o exame parasiiológico de fezes seriado, que é positivo para ovos viáveis de S. mansoni e o leucograma seriado, que, geralmente, acusa leucocitose com eosinofilia. Em caso de dúvida ou para complementação diagnostica, podemos recorrer à endoscovia retal, ao oograma e á biópsia hepática. A endoscopia acusa, comumente, mucosa hiperêmica, edemaciada, friável, granulosa, com pontos hemorrágicos e o exame colhido por punção biópsia revela, entre outros achados, granulomas na fase necrótica-exsudativa. O diagnóstico diferencial deve ser feito com as seguintes entidades clínicas: gastroenterites. febre tifóide, disenteria bacilar, amebíase aguda, salmonelose septicêrnica prolongada, devendo, ainda, figurar a tuberculose miliar, abdome agudo, a G.N.D.A., a mononucleose infecciosa, a leptospirose, a hepatite e as poaneurites. A terapeutica é baseada nos cuidados gerais, na córticoterapia e na terapêutica específica. Observamos regressão dramática do quadro toxinfeccioso. nas primeiras 24 a 48 horas com a córticoterapia (prednisona que tem duração aproximada de 7 a 10 dias. A terapêutica específica (derivado nitrotiazolico = ambilhar e derivado hidroximet

  20. Energy education; Pedagogia da energia

    Energy Technology Data Exchange (ETDEWEB)

    Muniz, Rafael Ninno, e-mail: rafaelninno@gmail.com

    2006-07-01

    'Pedagogia da Energia' (energy education) is a qualification course that has as intention to unite ambient education with renewable energies through the art-education and of the long-distance education. Collective made up of theoretical and practical activities through group dynamic and works, with intention to integrate and to enable the participants as a whole, aiming to form potentials to agreement and diffusion of energy concepts of the subjects environment - energy - residues. It possess the structure of an actual course with support of long-distance education with a platform of available web education in the Internet, where the participants have access the all content used in the course (texts, presentations and figures), virtual library, colloquy room, thematic list of quarrel and forum, beyond guardianship accompaniment. A structure constructed in classroom for the participants uses as pedagogical tool titled 'Mandala das Energias' where the concepts studied are worked in. The politics characteristics presented are, ambient and social of the use of the power plants and its implications in the daily one of the humanity. It understands the education as a reciprocal process, that understands the intention to teach and to learn in a set of exchanges of necessary information to the curious nature of the human beings. This article explains the structure and methodology of functioning of the course with a summary of the worked chapters. It also presents the pedagogical tool 'Mandala das Energias' and its respective flowchart of energies that originated it in annex at the end of the text. (author)

  1. Tratamento da giardiase com tinidazol

    Directory of Open Access Journals (Sweden)

    Miroslau Constante Baranski

    1975-02-01

    Full Text Available Estudou-se a eficácia terapêutica do tinidazol, um novo derivado nitroimidazólico, em trinta pacientes com giardiase. A posologia diária foi de 300 mg em 20 pacientes com idade superior a 10 anos, e de 150 mg em 10 crianças com idade inferior a 10 anos. O tratamento teve a duração de cinco dias. O diagnóstico e os controles de cura parasitológicos foram feitos pelos métodos de Hoffman, Pons & Janer e de Faust e cols. Foram realizados três controles, com intervalos de sete dias, iniciando-se na semana subsequente ao término do tratamento. Obtiveram cura parasitológica em 96,6% dos casos. Ressaltam a excelente tolerância da droga, mesmo em pacientes com grave doença fundamental ou em crianças, não se registrando efeitos colaterais. Concluem ser o tinidazol excelente droga giardicida.The Autors study the therapeutic efficacy of Tinidazole, a new nitrimidazole derivative, in the treatment of thirty patients with giardiasis. They employed the daily dosage of 300 mg for twenty patients and 150 mg for ten children, respectively with ten years of age or and less during five consecutive days. The diagnosis and the parasitological evaluation of the results of treatment were accomplished by stool examinations using zinc sulphate centrifugal-flotation technique of Faust et al. and sedimentatian-concentration technique of Hoffman, Pons and Janer. The control started one week after the treatment and consisted of three stool examinations, at one week intervals. The Authors achieved 96.6 per cent of parasitological cures. They stressed the excellent tolerance of the drug ,even by patients with serious fundamental diseases or by children. No side effects were registered. They conclude that Tinidazole is an excellent drug against Giardia lamblia infections.

  2. Estudo da Concentração de Mercado ao Longo da Cadeia Produtiva da Soja no Brasil

    Directory of Open Access Journals (Sweden)

    Nilson Luiz Costa

    2014-12-01

    Full Text Available O objetivo da presente pesquisa foi mensurar a concentração de mercado ao longo da cadeia produtiva da soja. A partir dessas informações tornou-se possível avaliar se as estratégias para manter e ampliar o poder de mercado e a governança ao longo da cadeia produtiva da soja resultam em sucesso, captação do excedente do produtor rural de soja e competitividade da agroindústria processadora do grão. Neste contexto, foram calculados o Market Share, a Relação de Concentração e do Índice de Herfindahl-Hirschmann. Confirmou-se a hipótese de que o mercado que fornece insumos para os produtores rurais de soja está altamente concentrado. A hipótese de elevada concentração no segmento de aquisição e processamento da soja também foi confirmada.  Concluiu-se que o produtor rural de soja encontra-se em situação de fragilidade econômica, pois: a adquire insumos em mercado oligopolizado e vende a produção em mercado oligopsonizado; b as empresas dominantes estão protegidas por barreiras à entrada. Diante deste cenário e das análises realizadas, cabe ao Estado brasileiro definir a forma de inserção dos agentes nacionais, em especial do produtor rural: se será caracterizado como um instrumento de acumulação do capital internacional ou se participará dos ganhos e se constituirá como agente de desenvolvimento regional. 

  3. A LEITURA DA GRAMÁTICA DA FORMA DO CONJUNTO HABITACIONAL CAMPINAS-F DA CDHU EM CAMPINAS

    Directory of Open Access Journals (Sweden)

    Marcelo de Morais

    2014-12-01

    Full Text Available A gramática da forma constitui uma importante ferramenta que pode dar suporte para futuros estudos e melhor qualidade em conjuntos habitacionais. A utilização de sistemas generativos de projeto pode aperfeiçoar uma série de rotinas de projeto, potencializando seu uso com outras ferramentas de informática. Este trabalho apresenta os resultados de estudo exploratório com um sistema generativo de projeto em processo de simulação e imersão, por meio do qual se pode avaliar o desenvolvimento e as alterações do projeto de implantação de conjunto habitacional social, ocasionadas pela variação das regras nos algoritmos criados. Inicialmente, se realizou a leitura Analítica da Gramática da Forma de um Conjunto Habitacional específico e, posteriormente, simulou-se em ferramenta computacional a Gramática da Forma Paramétrica, para futuros estudos de melhorias em conjuntos habitacionais similares. Tal ferramenta visa desenvolver soluções inovadoras em tecnologia da informação e comunicação aplicadas à construção e arquitetura. Os resultados demonstram a potencialidade do uso da Gramática da Forma, permitindo a inserção de novos parâmetros a cada momento, criando a perspectiva de flexibilidade na concepção e gerando diversas possibilidades que podem ser analisadas e comparadas durante o processo de tomada de decisão do projeto.

  4. 75 FR 52292 - Airworthiness Directives; Diamond Aircraft Industries GmbH Models DA 40 and DA 40F Airplanes

    Science.gov (United States)

    2010-08-25

    ... ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3... Industries GmbH Models DA 40 and DA 40F Airplanes AGENCY: Federal Aviation Administration (FAA), Department... new airworthiness directive (AD) for all Diamond Aircraft Industries GmbH Models DA 40 and DA...

  5. Determinantes sociais da saude e o Programa Saude da Familia no municipio de Sao Paulo

    Directory of Open Access Journals (Sweden)

    Tatiana Pluciennik Dowbor

    2013-08-01

    Full Text Available OBJETIVO Analisar a situação do trabalho com determinantes sociais da saúde no âmbito do Programa Saúde da Família. MÉTODOS Estudo de caso com métodos mistos de pesquisa, ancorados em estratégia sequencial explanatória, com 171 gerentes das unidades do Programa Saúde da Família em São Paulo, SP, em 2005/2006. Questionários autopreenchíveis foram aplicados. Entrevistas semiestruturadas e grupos focais foram realizados com amostra intencional de profissionais envolvidos no trabalho com determinantes sociais da saúde. Os dados quantitativos foram analisados por análise descritiva, análise de correspondência múltipla, análise de agrupamento e testes de correlação entre variáveis. Os dados qualitativos foram apurados por análise de conteúdo e a criação de categorias temáticas. RESULTADOS Apesar da concentração de atividades direcionadas ao cuidado com a doença, o Programa Saúde da Família realizou atividades relacionadas à determinação social da saúde, contemplando todas as formas de abordagem da promoção da saúde (biológico, comportamental, psicológico, social e estrutural e os principais determinantes sociais da saúde descritos na literatura. Houve diferença significativa quanto à abrangência dos determinantes trabalhados nas unidades em relação às diferentes regiões do município. Constatou-se fragilidade das iniciativas e a sua desconexão com a estrutura programática do Programa Saúde da Família. CONCLUSÕES A quantidade e variedade de atividades com determinantes sociais da saúde realizadas no Programa Saúde da Família mostram potencial para trabalhar a determinação social da saúde. Mas a fluidez de objetivo e o caráter extraordinário das atividades descritas questionam sua sustentabilidade como parte integral da atual estrutura organizacional do programa.

  6. Estudos organizacionais, (descolonialidade e estudos da dependência: as contribuições da Cepal

    Directory of Open Access Journals (Sweden)

    Sergio Wanderley

    Full Text Available O objetivo deste artigo é (revisitar o conceito de dependência como categoria de investigação da (e a partir da América Latina, por meio de uma perspectiva histórica crítica descolonial, a fim de ampliar o espaço de debates em estudos organizacionais e promover alternativas à ordem neoliberal. Este ensaio terá como foco os estudos da dependência realizados pela Comissão Econômica para a América Latina e o Caribe (Cepal durante a década de 1950 e o início dos anos 1960. A perspectiva descolonial é um constructo teórico de autores latino-americanos que se consideram herdeiros da longa tradição do pensamento social crítico da região, na qual a teoria da dependência está inserida. As propostas dos autores da dependência confrontaram as principais teorias ortodoxas do Norte produzidas à época. A partir do conceito de centro-periferia, da denúncia de assimetrias nas relações entre essas regiões, do reconhecimento da interdependência entre desenvolvimento e subdesenvolvimento, o conceito de dependência foi sendo (reelaborado nas décadas de 1950 e 1960 por diversos autores latino-americanos como uma categoria de investigação da realidade da (e a partir da região. Essas investigações tinham por objetivo não somente elaborar constructos teóricos, mas, também, transformar a realidade por meio da criação de diversas organizações e instituições que deveriam servir ao propósito de superar o subdesenvolvimento. A denúncia da historicidade da situação de subdesenvolvimento desnudou o caráter de neutralidade do economicismo das teorias produzidas no Norte e promoveu um encontro teórico entre economia e política que muito tem a contribuir com a área dos estudos organizacionais.

  7. A mediação do profissional da informação nas florestas da sociedade da informação

    Directory of Open Access Journals (Sweden)

    Silvia Maria do Espírito Santo

    Full Text Available Este artigo discute a identidade e a mediação do profissional da informação no âmbito dos questionamentos da Ciência da Informação e o tratamento dos objetos museológicos na linha de pesquisa da organização temática da informação. A conhecida imagem do conto "O Patinho Feio", do clássico infantil de autoria de Hans Christian Andersen, foi utilizada como metáfora do processo de auto-reconhecimento da identidade em transformação do profissional da informação. O patinho feio, personagem adotado para explicar a transformação profissional, busca novos caminhos, em fase de incertezas, diante da sociedade da informação. Os gansos, como simbologia das máquinas computacionais, são figurantes do contexto da sociedade contemporânea. Distinguindo as diferentes facetas da Ciência da Informação (arquivologia, biblioteconomia e museologia, esse profissional é o principal organizador e mediador entre usuário e informação. O texto aborda a aproximação com a organização da informação, questiona os limites encontrados frente à abrangência conceitual da Ciência da Informação, considera que é preciso refletir sobre e para o amadurecimento e realizá-lo diante de uma das dificuldades enfrentadas pela área: a função social da organização da temática no campo dos objetos museológicos.

  8. A ética na sociedade, na área da informacao e da atuac~a

    OpenAIRE

    Quiñones Torres, Aída Julieta; Pontificia Universidad Javeriana

    2009-01-01

    Reseña del Libro: Ferreira Gomes, H.; Martins Bottentuit, A.; Espinheiro de Oliveira y M. O. (organizadoras) A ética na sociedade, na área da informação e da atuação profissional: o olhar da Filosofia, da Sociologia, da Ciência da Informação e da Formação e do Exercício Profissional do Bibliotecário no Brasil Brasilia: Conselho Federal de Biblioteconomia- Comissão de Ética Profissional, 2009, 192 p. isbn: 978-85-62568-01-5

  9. Os problemas epistemológicos da realidade, da compreensibilidade e da causalidade na teoria quântica

    Directory of Open Access Journals (Sweden)

    Bastos Filho Jenner Barretto

    2003-01-01

    Full Text Available No presente trabalho apresentamos uma discussão epistemológica sobre os problemas da Realidade, da Compreensibilidade e da Causalidade no contexto de algumas das questões suscitadas pela teoria quântica, discussão essa que se reflete também num combate à concepção positivista de ciência. Argumentamos em prol de uma maior aproximação entre a epistemologia complexa de Bachelard, a filosofia popperiana do racionalismo crítico e a concepção lakatosiana de programas científicos de pesquisa. Argumentamos, outrossim, em prol de ambas: da necessidade de se levar mais a sério a complexidade do diálogo teoria/experimento e da cautela redobrada em relação à idéia de 'experimentos cruciais' notadamente quando esses são lidos tanto na ótica do positivismo quanto na do realismo ingênuo.

  10. DETERMINANTES DA DIVULGAÇÃO DOS INDICADORES DE DESEMPENHO DA GRI NAS EMPRESAS DO BRASIL E DA ESPANHA

    Directory of Open Access Journals (Sweden)

    Alan Diógenes Góis

    2015-01-01

    Full Text Available O estudo tem por objetivo investigar os fatores determinantes da divulgação dos indicadores de desempenho de sustentabilidade da GRI nas empresas listadas nas bolsas do Brasil e da Espanha. Para tanto, foram analisados os dados de 94 empresas de capital aberto dos dois países que publicaram relatórios anuais e/ou de sustentabilidade, referentes a 2011, no padrão GRI-G3. A pesquisa é descritiva, com abordagem quantitativa dos dados, utilizando-se a Regressão Linear Múltipla para quatro modelos de disclosure (econômico, ambiental, social e de sustentabilidade. Os resultados mostram que as empresas da Espanha apresentam um nível de disclosure de sustentabilidade mais elevado, e que o nível de evidenciação geral, considerando o conjunto das dimensões da sustentabilidade (econômica, social e ambiental, corresponde a 72,7%. Quanto ao resultado dos modelos de regressão, observa-se que as variáveis independentes (Tamanho, Rentabilidade, Endividamento, Auditoria, Setor de Impacto Ambiental e Idade não explicam o disclosure econômico; porém, quanto aos disclosures ambiental, social e de sustentabilidade, as variáveis Tamanho e Idade são fatores determinantes.

  11. ANÁLISE EXPERIMENTAL DA INFLUÊNCIA DA TECNOLOGIA HOMEPLUG NA QUALIDADE DA ENERGIA ELÉTRICA

    Directory of Open Access Journals (Sweden)

    Antonio Luiz Pereira de Siqueira Campos

    2008-03-01

    Full Text Available Trabalhos recentes têm estudado características do meio elétrico para a transmissão de dados, ruídos e técnicas empregadas na comunicação pela rede elétrica. A maioria dos trabalhos limita-se a fazer testes de desempenho do protocolo. Diversos pesquisadores têm se preocupado com a influência das transmissões de dados na rede elétrica sobre as comunicações sem fio, mas ninguém tem se preocupado com a influência dessas transmissões na qualidade da energia elétrica. Este trabalho apresenta resultados preliminares sobre o efeito produzido por redes de computadores que utilizam a tecnologia Homeplug 1.0 na qualidade da energia elétrica. Para isso, foram escolhidos parâmetros apropriados para análise da qualidade da energia elétrica, bem como, foram definidas as formas de se obter esses parâmetros. Foi montada uma rede de computadores, com modem’s PLC, no CEFET-RN e realizados testes iniciais para medição da qualidade de energia elétrica. Resultados numéricos são apresentados.

  12. Vigotski e o estudo da psicologia da arte: contribuições para o desenvolvimento humano

    Directory of Open Access Journals (Sweden)

    Sonia Mari Shima Barroco

    2014-04-01

    Full Text Available O presente texto resulta de investigação bibliográfica e de um exercício teórico-metodológico sobre a obra Psicologia da Arte, de L. S. Vigotski (1999, visando aprofundar uma reflexão sobre o objeto e método da própria psicologia da arte. Objetiva-se, assim, discutir as possíveis contribuições da arte para o desenvolvimento humano com base na teoria histórico-cultural. Propõe-se que o objeto da psicologia da arte é o estudo da estrutura da obra, que deve provocar uma resposta estética e impactar a psique do fruidor. Considera-se que a arte, por sua estrutura específica e condição de objeto cultural, pode trazer desenvolvimento à psique humana pois, entre outros aspectos, possibilita a duplicação do real no âmbito intrapsiquíco, ao oferecer ao fruidor a vivência, por meio indireto, sobretudo de emoções e sentimentos não cotidianos.

  13. O indivíduo e o coletivo: alguns desafios da Epidemiologia e da Medicina Social

    Directory of Open Access Journals (Sweden)

    Edson Perini

    2001-02-01

    Full Text Available Alguns conceitos fundamentais da Epidemiologia são revisados, explorando contrapontos de suas principais contradições filosóficas. Nesse sentido, discute-se a interdependência conceitual entre o indivíduo e o coletivo, a complementaridade das abordagens quantitativas e qualitativas, o caráter natural e social da existência humana e, finalmente, as expressões coletiva e individual do risco. Da análise conclui-se que o conceito de risco traz em si potencial para uma revisão da prática epidemiológica. Sem fugir aos limites que a ciência coloca à produção do conhecimento, essa revisão é proposta a partir da prática da confluência dos métodos quantitativo e qualitativo de investigação, mais próxima das necessidades imediatas dos indivíduos. Suas chances de contribuir para tornar mais eficientes as ações da Medicina Social crescem à medida que o conhecimento da realidade coletiva ganha sentido para eles.

  14. Várias Marias: efeitos da Lei Maria da Penha nas delegacias

    Directory of Open Access Journals (Sweden)

    Roberta Carvalho Romagnoli

    2015-08-01

    Full Text Available Este artigo discute os dados qualitativos da pesquisa “Violência Doméstica perpetrada contra a mulher no município de Montes Claros: um recorte possível”, financiada pelo CNPq e pela FAPEMIG. O objetivo do estudo foi investigar quantitativamente e qualitativamente os atos violentos contra as mulheres na cidade de Montes Claros, Minas Gerais. A vertente qualitativa pretendia conhecer o sentido da violência para as mulheres envolvidas e seus reflexos na família, através de entrevistas semiestruturadas que não se efetivaram. A partir da Análise Institucional de René Lourau analisamos essa inviabilidade como dado qualitativo, examinando o cotidiano da delegacia após a lei Maria da Penha. Concluímos que a intervenção judicial não é suficiente para a inibição da violência contra a mulher, pois em certos casos afasta da delegacia mulheres com outras demandas acerca da violência, que sofrem e que não podem contar com a ajuda policial para a resolução dos seus conflitos.

  15. A Tragédia da Cultura na Era da Técnica: Georg Simmel

    Directory of Open Access Journals (Sweden)

    Francisco Rüdiger

    2008-12-01

    Full Text Available Georg Simmel, embora pouco conhecido entre nós, conta-se entre os primeiros críticos ocidentais a pensar o futuro da cultura na era da técnica. Destoando dos juízos correntes em seu tempo (1900, o pensador não viu nesse processo um estágio superior da marcha do progresso, relacionando-o antes com a crise da cultura para a qual havia nos alertado Nietzsche. As considerações seguintes pretendem dar conta da maneira como sua reflexão sobre a tragédia da cultura que tem lugar em nosso tempo comporta um exame do sentido da técnica que pode nos ajudar a pensar o problema das novas tecnologias de comunicação, após ter se tornado um motivo recorrente nos escritos de vários pensadores da técnica de nosso século, de Oswald Spengler e Heidegger a Jacques Ellul, Yves Barel, Arthur Kroker e Eduardo Subirats.

  16. Responsabilidade Social das empresas: a contraface da sociedade civil e da cidadania

    Directory of Open Access Journals (Sweden)

    Simionatto, Ivete

    2006-01-01

    Full Text Available O artigo tem como objeto o estudo das mudanças que vêm ocorrendo nas relações entre Estado e sociedade civil e sua manifestação específica nas propostas articuladas em torno da responsabilidade social das empresas. Parte-se da hipótese de que estas práticas vêm contribuindo para a formação de consensos que fortalecem a hegemonia do capital na atualidade, mediante a redução do papel do Estado e o fortalecimento da esfera privada como setor de regulação social. Este cenário indica mudanças nas relações entre Estado e sociedade civil, uma vez que a responsabilidade social das empresas manifesta-se como uma nova proposta de sociabilidade e de resposta às expressões da questão social. Por fim, identifica-se que os serviços sociais oferecidos através da responsabilidade social fortalecem o campo do voluntariado, da solidariedade e das instituições do terceiro setor, precarizam o trabalho do Assistente Social com rebatimentos na esfera da cidadania e dos demais valores e princípios que sustentam o projeto ético-político da profissão

  17. Notas Acerca da Disciplina "Estrutura e Funcionamento da Educação Brasileira".

    Directory of Open Access Journals (Sweden)

    Débora Mazza

    2007-06-01

    Full Text Available Considerando: - a obrigatoriedade da disciplina estrutura e funcionamento da educação brasileira nos currículos dos cursos de licenciatura. - a falta de motivação dos alunos frente a disciplinas que, aparentemente, não lidam com conteúdos de aplicação prática imediata.

  18. O PAPEL DA EDUCAÇÃO ESCOLAR NO DESENVOLVIMENTO DA PERSONALIDADE DO ADOLESCENTE

    Directory of Open Access Journals (Sweden)

    Ricardo Eleutério dos Anjos

    2014-05-01

    Full Text Available A partir dos pressupostos da psicologia histórico-cultural e da pedagogia histórico-crítica, este artigo procurou analisar teoricamente o papel da educação escolar no desenvolvimento da personalidade do adolescente. Foram pesquisadas não somente as obras de Vygotski, como também de Leontiev, Luria, Elkonin, entre outros autores que contribuíram e contribuem para a formação do conjunto de trabalhos elaborados pela psicologia histórico-cultural. A pedagogia histórico-crítica, a partir das obras de Dermeval Saviani e Newton Duarte, foi utilizada como mediação entre a psicologia histórico-cultural e a educação escolar, por entender que esta teoria pedagógica é compatível com os pressupostos da “Escola de Vygotski”. Este trabalho apresenta a concepção da psicologia histórico-cultural sobre a personalidade do adolescente como superação das concepções psicológicas naturalizantes e idealistas, explicitando, ainda, a relevância da transmissão dos conteúdos escolares para o desenvolvimento da personalidade nessa idade de transição.http://dx.doi.org/10.14572/nuances.v25i1.2941

  19. O OFÍCIO DA PINTURA EM PORTUGAL E O PROJETO DA ACADEMIA DE PINTURA

    Directory of Open Access Journals (Sweden)

    Raquel Quinet Pifano

    2013-06-01

    Full Text Available O presente artigo aborda o processo de reconhecimento do estatuto teórico das artes visuais e a consequente transformação do estatuto social do artista na Europa a partir do século XV. A formulação inédita de uma teoria da arte fundamentará tal processo e justificará a criação da Academia de Desenho em Florença no século XVI. A partir daí, muitas academias serão fundadas na Europa, consolidando paulatinamente a institucionalização da arte da pintura, escultura e arquitetura como artes liberais. Embora Portugal não se mantenha à margem deste processo, precisou esperar a dissolução do sistema de organização dos ofícios mecânicos em corporações para então fundar uma Academia de Belas Artes. Reflete-se aqui sobre o processo português de liberalização da arte: as relações entre a prática efetiva da pintura, a teoria da arte e o projeto de uma Academia de Pintura proposto pelo pintor Cyrillo Volkmar Machado.

  20. A inclusão da subjetividade no ensino da Psicopatologia

    Directory of Open Access Journals (Sweden)

    Octavio Domont de Serpa Junior

    2007-08-01

    Full Text Available O estudo da Psicopatologia tem sido freqüentemente apresentado em sua dimensão descritiva. Apesar da relevância para o ensino - auxiliar o aluno a reconhecer a dimensão sintomatológica dos quadros psicopatológicos -, exclui a dimensão subjetiva da experiência do adoecimento e seus aspectos relacionais. Partindo da tradição antropológico-existencial, apresentamos uma experiência de ensino de Psicopatologia que considera tais dimensões relevantes para a compreensão do sofrimento mental. Trabalhando com estudo de caso descritivo, são apresentadas duas novas modalidades de práticas na disciplina Psicopatologia Especial I, oferecida para alunos do curso de Psicologia da UFRJ. A proposta é ampliar o ensino prático, tradicionalmente centrado no modelo da extensa entrevista clínica, realizada diante de um grande grupo de alunos que a tudo assistem passivamente. Pretendemos aproximar o ensino e a prática da Psicopatologia dos ideais da Reforma Psiquiátrica Brasileira, que concebe o adoecimento mental como fenômeno complexo, envolvendo a relação do sujeito com o mundo.

  1. Uma 'biblioteca sem paredes': história da criação da Bireme

    Directory of Open Access Journals (Sweden)

    Silva Márcia Regina Barros da

    2006-01-01

    Full Text Available O presente artigo analisa o processo de criação da Bireme, Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde, relacionando-o com o contextos social, político e econômico respectivos. O período em questão assistiu à solidificação da influência norte-americana no mundo ocidental, entre as décadas de 1950 e 1970. Nossa intenção foi resgatar documentos e depoimentos referenciais para discutir as questões envolvidas na implantação da então Biblioteca Regional de Medicina, iniciativa que teve grande influência no âmbito da integração cultural e científica latino-americana no campo das ciências da saúde. Procurou-se ainda estabelecer marcos analíticos que possibilitem reflexões sobre o desenvolvimento histórico da instituição e sobre seu papel como iniciativa da Organização Panamericana de Saúde.

  2. A Liberdade da Imprensa Agrilhoada

    Directory of Open Access Journals (Sweden)

    Marco Aurelio Peri Guedes

    2010-12-01

    Full Text Available O presente trabalho aborda caso decidido no ano de 2009 - MCRecl. nº 9.428 - pelo STF, envolvendo possível censura ao jornal O Estado de São Paulo. O jornal publicou matéria sobre operação da Polícia Federal designada Boi Barrica, envolvendo entre tantas outras pessoas o empresário Fernando Sarney, filho do então presidente do Senado José Sarney. O empresário, então, ingressa com ação junto ao T.J.D.F. a fim de tutelar o seu direito fundamental à intimidade, que estaria sendo violado pelo jornal. Medida liminar favorável lhe é concedida por desembargador daquele tribunal, que havia sido anteriormente indicado politicamente pelo Senador José Sarney – pai do empresário. Sem o conhecimento de todos os detalhes, poderíamos dizer que ponderação de interesses foi realizada – liberdade de imprensa e direito à privacidade - e direitos fundamentais foram protegidos, tendo o poder judiciário agido proativamente em sua defesa – sob uma leitura de ativismo judicial. Contudo, o que se observou foi a expressão de práticas oligárquicas a influenciar politicamente a composição do poder judiciário com vistas a dirigir suas decisões, denotando a força do patrimonialismo na república e a fragilidade de nossa constituição. Assim, teria se estabelecido uma censura em via oblíqua à liberdade de imprensa em plena vigor de um Estado democrático e social de direito, a ferir mortalmente nossas liberdades públicas e a constituição. Lembre-se que a constituição de 1988 veda todas as formas de censuta. Precisamos compreender o significado desta decisão e reverter este quadro de insegurança à liberdade de imprensa.

  3. As implicações filosóficas da teoria da Gestalt

    OpenAIRE

    Jonas Fornitano Cholfe

    2009-01-01

    A Teoria da Gestalt, cujos fundamentos são erigidos no intercâmbio entre as idéias de Köhler, Koffka e Wertheimer, tem como objetivo principal o restabelecimento do vínculo entre a ciência e a vida humana. A noção de Gestalt, pensada como uma entidade da qual o sentido e o valor são características intrínsecas, constitui-se como a chave desse empreendimento. Partindo da tese fenomenológica, da defesa de que a elucidação conceitual exige o retorno aos dados da experiência direta, os gestaltist...

  4. Clarice Lispector e Adriana Varejão: o corpo aberto da escrita e da arte

    Directory of Open Access Journals (Sweden)

    Eleonora Frenkel

    2013-12-01

    Full Text Available Este artigo se propõe a abrir um espaço comparativo entre algumas das obras de Clarice Lispector e de Adriana Varejão, observando especialmente a questão do corpo e de sua “dissecação” simbólica, poética, metalinguística e meta-artística a partir das coordenadas da memória, da reescrita, da abertura e da transfiguração. A aproximação intensiva, menos analítica que experimental, pretende dar conta da potencialidade poética dessas obras, de seu caráter visceral, exposto, transbordante e vivo.

  5. Uma história da literatura de jornal: o imparcial da Bahia

    OpenAIRE

    Pinho, Adeítalo Manoel

    2008-01-01

    Este trabalho tem por objeto a seção literária do periódico O Imparcial, do estado brasileiro da Bahia (1918-1947). A presente tese desenvolve-se no âmbito disciplinar da história da literatura, fundamentando-se em um sistema literário às margens da historiografia oficial. Suas bases teóricas foram buscadas na “Ciência da Literatura Empírica”, sob liderança de Siegfried Schmidt, e representada no Brasil por Heidrun Krieger Olinto. O pensamento do estudioso germânico quanto à atuação no espaço...

  6. DESENVOLVIMENTO SUSTENTÁVEL À LUZ DA TEORIA DA JUSTIÇA COMO EQUIDADE

    OpenAIRE

    Vargas Neto, Sebastião Domingues

    2009-01-01

    Esta dissertação dedica-se ao exame teórico do desenvolvimento sustentável à luz da teoria da justiça como equidade, de John Rawls. O problema de pesquisa tem caráter teórico e reside na análise do desenvolvimento sustentável (precipuamente resultante do Relatório Brundtland), destacado em seu aspecto social e implicações político-jurídicas e jusfilosóficas, à luz da teoria da justiça como equidade, investigando-se, em eixo que relaciona teoria da justiça, justiça social e l...

  7. Os termos da cultura e da industrialização do caju

    Directory of Open Access Journals (Sweden)

    Antônio Luciano Pontes

    2001-02-01

    Full Text Available

    Este artigo apresenta aspectos relativos à metodologia do glossário sobre os termos da Cultura e da Industrialização do Caju, o qual tomou por base os fundamentos teórico-metodológicos da Terminologia. O corpus que se utilizou para a constituição da nomenclatura do glossário foram os termos extraídos de textos técnico-científicos sobre a área em questão, abrangendo os campos a partir dos termos centrais - caju, cajueiro e castanha. O Glossário é constituído de 2 mil entradas, que incluem informações gramaticais, definição, notas explicativas, remissivas. Destina-se o produto a profissionais da área, pesquisadores, docentes e alunos dos cursos ligados às Ciências Agrárias.

  8. A emergência da Filosofia da Química como campo disciplinar

    OpenAIRE

    Ribeiro, Marcos Antonio Pinto

    2016-01-01

    Química e filosofia tiveram pouco diálogo no século XX. A despeito de sua importância cultural, a química, a ciência mais central, é, surpreendentemente, a mais insular em questões filosóficas e não tem sido um objeto importante das análises dos filósofos e da epistemologia geral. Apenas recentemente, no início da década de 1990, químicos/filósofos têm construído a filosofia da química como um campo disciplinar emergente no quadro da filosofia da ciência geral. O objetivo deste trabalho é car...

  9. Gestões do desenvolvimento e desenvolvimentos da gestão: da unilateralidade reificada à dialogicidade da simbiose homem/natureza

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Justen

    Full Text Available Este artigo, ao situar culturalmente os fenômenos da gestão e do desenvolvimento, em sua concepção tradicional, no projeto da modernidade e ao identificar o predomínio da unilateralidade reificada na interface entre gestão e desenvolvimento - a primeira vista como instrumento técnico submisso à via clássica do segundo - almeja evidenciar as potencialidades da compreensão e da construção de alternativas, tanto para a gestão como para o desenvolvimento, a partir da ressignificação dessa interface. Para tanto, o esforço foi direcionado ao resgate do que é comum aos fenômenos da gestão e do desenvolvimento - os substratos antropológico e ecológico -, nucleados nos princípios da reciprocidade dialógica, concretizadora da condição antropológica, e da finitude, caracterizadora da condição ecológica. Ao final, são apresentadas oito potenciais contribuições advindas da exploração renovada da interface entre a gestão e o desenvolvimento. Propôs-se, ainda, a substituição da lógica instrumental da eficiência financeira, comum à concepção tradicional dos fenômenos estudados, pela lógica da simbiose dialógica homem/natureza, uma vez que, como fenômenos sociais, desenvolvimento e gestão, mediados pelo meio, também são ecológicos em sua essência.

  10. Influência da dieta hipossódica e da alergia alimentar no tratamento da epilepsia

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Leite

    1981-09-01

    Full Text Available É feita uma apreciação dos métodos de tratamento da epilepsia no início do século como o jejum, a dieta desidratante e a restrição de cloreto de sódio. O autor se fixa neste último, julgando que ele possa ser um fator desencadeante de crises epilépticas. Apresenta oito casos tratados com dietas restritas em cloreto de sódio, havendo melhora do quadro convulsivo em todos os pacientes. Fato surpreendente foi a melhora concomitante do comportamento em geral, da excitabilidade e de dores de cabeça, referidos pelos doentes e seus familiares. Por fim, é realçada a importância da alergia alimentar como causa de crises epilépticas.

  11. A epistemologia transdisciplinar nos pressupostos da teoria da complexidade e no contexto da organização do trabalho

    Directory of Open Access Journals (Sweden)

    Osmar Ponchirolli

    2014-03-01

    Full Text Available A teoria da complexidade parte basicamente da ideia de que todo sistema constitui uma unidade complexa, comportando diversidade e multiplicidade, inclusive antagonismos. O ecossistema e a biosfera dão sentido pleno ao termo complexo, que significa entrelaçamento, portanto aquilo que está entrelaçado em conjunto constitui um tecido estreitamente unido, embora os fios que o constituam sejam extremamente diversos. A partir da obra O Método, de Edgar Morin, este estudo se concentra primeiramente na elaboração das características do conceito de transdisciplinaridade; em seguida nos pressupostos da teoria da complexidade, para somente a seguir verificar como a teoria da complexidade pode dialogar com as organizações do trabalho e com a área da educação, que também se caracteriza como uma empresa, pois a formação profissional se fundamenta teoricamente no ambiente educacional. O pensamento complexo pretende ultrapassar as entidades fechadas ou as disciplinas, como um meio necessário para conceber o fundamental. Seja diretamente na área da educação, na construção do pensamento complexo ou nas organizações como campo do conhecimento, a complexidade se mostra disponível para dialogar com todas as demais teorias do conhecimento, considerando o método transdisciplinar como norteador dessa abordagem. O fio condutor da observação dos pressupostos da epistemologia proposta pela complexidade considera que aquele que pesquisa é antes um pesquisador de si mesmo, por isso a vida de Edgar Morin, idealizador da teoria da complexidade, é o principal elemento constituinte das considerações finais deste estudo. Abstract: The theory of complexity basically comes from the idea that every system is a complex unit holding diversity and multiplicity, even antagonisms. The ecosystem and biosphere give full meaning to the term complex, which means interlacing, therefore, what is interlaced together, it consists of a closely oven together fabric

  12. Acompanhamento de familias de criancas com doenca cronica: percepcao da equipe de Saude da Familia

    Directory of Open Access Journals (Sweden)

    Etelvaldo Francisco Rego Sousa

    2013-12-01

    Full Text Available Este estudo objetivou caracterizar como a equipe da Estratégia Saúde da Família percebe sua dinâmica de acompanhamento de famílias que convivem com a doença crônica da criança. Trata-se de uma pesquisa qualitativa que teve como referencial teórico o Interacionismo Simbólico e como método a Análise de Conteúdo, técnica de análise categorial temática. Para a coleta de dados utilizou-se o grupo focal, que foi desenvolvido com três equipes de Saúde da Família, totalizando 32 sujeitos. Os resultados foram organizados em três categorias temáticas: Peculiaridades das famílias que convivem com a doença crônica da criança; Equipe, família e Estratégia Saúde da Família e Limitações para cuidar. A percepção da equipe é que o desenho da Estratégia Saúde da Família favorece o acesso à experiência familiar, permitindo o reconhecimento de suas especificidades. Os dados revelam ainda as limitações da equipe em sua capacidade de resolução e a necessidade de investimentos na articulação entre os distintos serviços, setores e equipamentos sociais.

  13. FUNDAMENTOS COGNITIVOS PARA O ENSINO DA LEITURA

    Directory of Open Access Journals (Sweden)

    Lucilene Bender de Sousa

    2010-01-01

    Full Text Available Neste artigo, revisamos alguns fundamentos teóricos para o ensino da leitura baseados em recentes estudos das neurociências e ciências cognitivas. A leitura, enquanto processo cognitivo, deve ser compreendida em todos os seus níveis de processamento para que o ensino possa identificar e atender às necessidades do aluno. Primeiramente, abordamos o processamento da leitura do nível mais básico, a decodificação, ao nível mais avançado, a compreensão. Em seguida, exploramos funções cognitivas que não são exclusivas da leitura, a memória, a emoção e a aprendizagem. Por fim, propomos uma visão integrada desses processos, considerando a intrínseca relação entre língua, cognição e cultura, a qual permeia todas as nossas atividades, destacando o papel da cultura e da educação no desenvolvimento cognitivo.

  14. ATLAS BigPanDA Monitoring

    CERN Document Server

    Padolski, Siarhei; The ATLAS collaboration; Klimentov, Alexei; Korchuganova, Tatiana

    2017-01-01

    BigPanDA monitoring is a web based application which provides various processing and representation of the Production and Distributed Analysis (PanDA) system objects states. Analyzing hundreds of millions of computation entities such as an event or a job BigPanDA monitoring builds different scale and levels of abstraction reports in real time mode. Provided information allows users to drill down into the reason of a concrete event failure or observe system bigger picture such as tracking the computation nucleus and satellites performance or the progress of whole production campaign. PanDA system was originally developed for the Atlas experiment and today effectively managing more than 2 million jobs per day distributed over 170 computing centers worldwide. BigPanDA is its core component commissioned in the middle of 2014 and now is the primary source of information for ATLAS users about state of their computations and the source of decision support information for shifters, operators and managers. In this wor...

  15. O paradoxo da teoria: interpretando Niklas Luhmann

    Directory of Open Access Journals (Sweden)

    Hans-Georg Moeller

    2015-12-01

    Full Text Available RESUMO O artigo discute o papel do paradoxo na teoria social de Niklas Luhmann a partir de uma perspectiva hermenêutica "autológica": uma tentativa de interpretação "ortodoxa" da teoria de Luhmann, incluindo sua teoria do paradoxo, descobrirá que esta teoria não se presta a uma interpretação ortodoxa. Assim, mesmo que o paradoxo da teoria de Luhmann só possa ser compreendido por meio de uma interpretação ortodoxa, os fundamentos mesmos de tal abordagem hermenêutica ortodoxa são desconstruídos por seus próprios resultados. Com base em uma visada sobre esse paradoxo hermenêutico, o papel fundamental do paradoxo na teoria de Luhmann pode ser apreciado. Para Luhmann, a autoconstrução da sociedade como um sistema complexo de funções de comunicação baseia-se na Paradoxieentfaltung - o desenvolvimento de paradoxos -, que, por sua vez, se fundamenta no "paradoxo fundamental da observação" (die Grundparadoxie des Beobachtens. Assim, a construção social não opera por meio da eliminação de paradoxos, mas por meio do uso deles.

  16. A PROPAGANDA NA VAZANTE DA INFOMARÉ

    Directory of Open Access Journals (Sweden)

    Admir Borges

    2008-06-01

    Full Text Available Este artigo pretende fazer uma reflexão sobre a origem sistêmica da Internet, sua adoção pelo marketing e a tímida tentativa da publicidade de agregar e conceber a Web como uma nova e importante mídia. Apresenta-se uma exposição sobre o surgimento da preocupação com a integração das ciências no contexto e abordagem proposta pela Teoria Geral dos Sistemas (sistema aberto, do biólogo alemão Ludwig Von Bertalanffy. O fenômeno da Internet tornou possível a democratização da informação e abriu para o marketing significativas fronteiras para a maior aproximação com o consumidor, através de suas estratégias de relacionamento, logística e interatividade. No entanto, a publicidade ainda não conseguiu criar uma linguagem e uma forma adequada de mensagem para esse novo meio.

  17. ANTROPOLOGIA DA IGUALDADE: DO ANONIMATO À FAMA

    Directory of Open Access Journals (Sweden)

    Nizia Maria Souza Villaça

    2015-08-01

    Full Text Available O texto pretende refletir sobre a cultura da performance, discutindo paralelamente a antropologia da igualdade que, no contemporâneo, dá lugar ao surgimento de novos heróis interpelados pela generalização da publicidade que promete a todos a possibilidade de atingir uma repentina notabilidade. A estratégia consegue seduzir uma quantidade grande de anônimos que participam dos certames e/ou se identificam com os que se sobressaem por meio dos dispositivos midiáticos. Tal modelo é pautado por uma cultura de estilo atlético e empresarial e tem seu foco na obtenção da fama. O fracasso de tal busca gera frequentemente um paradigma depressivo entre ansiolíticos, drogas, reclusão e imobilidade. A dinâmica da identidade/diferença é dinamizada pelas práticas do marketing cultural cujas ações serão objeto de discussão no sentido de verificar se o recurso à cultura propicia, efetivamente, um envolvimento individual e comunitário.

  18. AS INQUIETAÇÕES DA MODERNIDADE

    Directory of Open Access Journals (Sweden)

    Maria Suely Paula da Silva

    2007-12-01

    Full Text Available A época em que vivemos, chamada por alguns de pós-modernidade, é vista pela maioria dos autores nacionais e internacionais, como a época das incertezas, das fragmentações, das desconstruções, do vazio, do niilismo, da substituição da ética pela estética, do consumo de sensações, etc... Enfim, uma época de transição, de transformação, onde o projeto da modernidade parece ter se cumprido em excesso ou ser insuficiente para solucionar os problemas que assolam a humanidade. Há o argumento de que estamos entrando em uma nova era e, nessa transição, surgem vários termos, como sociedade de informação, sociedade de consumo, sociedade pós-industrial. O presente artigo busca avaliar se há a exaustão do paradigma moderno e o surgimento de um novo paradigma, observando quais são os pressupostos e fundamentos filosóficos da modernidade e em que medida estes se encontram transformados, alterados no contexto de uma nova articulação da realidade, uma pós-modernidade. Palavras-have: Sociedade, Modernidade, Pós-modernidade, Modernização reflexiva.

  19. Estudo experimental da inibição da proliferação vitreorretiniana pelo uso da hiperecina

    OpenAIRE

    Machado,Roberto Augusto Fernandes; Casella, Antonio Marcelo Barbante; Malaguido,Marcus Rudolph; Oguido,Ana Paula Miyagusko Taba

    2009-01-01

    OBJETIVOS: Induzir a produção de membranas vitreorretinianas em modelo de trauma ocular animal. Avaliar a inibição do desenvolvimento da proliferação vitreorretiniana (PVR) com o uso de hiperecina. MÉTODOS: Estudo Experimental. Foram utilizados 19 coelhos machos pigmentados adultos com peso entre 2.000 e 3.000 gramas. Todos submetidos a modelo de trauma com dispase associada à diatermia da retina para indução de membranas de PVR. Separados randomicamente para receberem hiperecina (10 µM em 0,...

  20. Avaliação da magnitude da desvantagem da osteoartrite na vida das pessoas: estudo MOVES

    Directory of Open Access Journals (Sweden)

    Luís Cunha-Miranda

    2015-02-01

    Full Text Available Introdução A osteoartrite (OA é uma das dez doenças mais incapacitantes nos países desenvolvidos e uma das principais causas de dor e incapacitação no mundo. O diagnóstico precoce aumenta a probabilidade de prevenção da progressão da doença. Objetivos Estimar a prevalência de osteoartrite auto-referida e a qualidade de vida em adultos portugueses com 45 ou mais anos de idade. Métodos Estudo observacional, transversal, implementado em domicílios por entrevista interpessoal. Resultados Foram incluídos no estudo 1039 indivíduos com idade média de 62 anos, sendo 54,2% do gênero feminino. A prevalência de osteoartrite auto-referida foi de 9,9%. Os joelhos e as mãos foram o local mais freqüente da doença. A prevalência de OA foi maior em mulheres e em participantes sem atividade profissional. A presença de OA foi maior em participantes com comorbidades. A maioria dos indivíduos já tinham passado por algum tratamento em alguma ocasião de suas vidas para esta doença: 94,5% tiveram tratamento farmacológico, 49,5% fisioterapia, e 19,8% atividade física. A dor estava associada com a estatura, com alguns locais da doença, especificamente pescoço, coluna lombar e ombros, pontuação do SF12 para qualidade de vida, e medidas de impacto no cotidiano dos participantes, gravidade da doença e incapacitação. O impacto da OA no dia-a-dia foi maior em indivíduos que tinham gozado licença por doença ou que pararam de trabalhar por causa da OA, apresentavam-se com pior saúde física e mental, e exibiam maior gravidade da doença. Conclusão Este estudo confirmou que a osteoartrite é uma doença muito relevante, com impacto potencial elevado na qualidade de vida, no funcionamento e na capacidade para o trabalho e, por causa de sua prevalência, exerce um impacto social muito elevado e crescente.

  1. Uma filosofia da história tornada sóbria sobre o papel da filosofia da história na teoria crítica da sociedade de Jürgen Habermas

    Directory of Open Access Journals (Sweden)

    Georg Lohmann

    2013-12-01

    Full Text Available Após uma parte introdutória sobre o estatuto da filosofia da história como conhecimento, o texto procura analisar o corte efetuado por Habermas em sua trajetória teórica visando livrar sua teoria social daquela filosofia e, consequentemente, superar as teses acerca da construção de um sujeito da história e da exequibilidade da história. Com essa análise procura-se diagnosticar as transformações fundamentais que esse corte ou rejeição, por parte de Habermas, do pensamento próprio da filosofia da história trouxe para a sua teoria crítica da sociedade, e também apontar os rudimentos e traços daquela filosofia nessa teoria.

  2. Influência da nutrição mineral foliar sobre doenças da parte aérea da cultura do trigo

    Directory of Open Access Journals (Sweden)

    Rafael Gustavo Ferreira Morales

    2012-02-01

    Full Text Available A utilização de fungicida para o controle de doenças foliares na cultura do trigo é prática comum entre os triticultores. Contudo, devido ao impacto ambiental provocado pelo seu uso generalizado, buscam-se alternativas para controle dos fitopatógenos. Sendo assim, este trabalho teve como objetivo avaliar o efeito da nutrição mineral foliar sobre as doenças foliares do trigo, bem como seu efeito sobre o desenvolvimento da planta. O delineamento experimental foi em blocos casualizados com quatro repetições e quatro tratamentos: 1- testemunha; 2- adubação foliar aos 30 dias após a emergência (DAE e aos 75 DAE; 3- fungicida aos 30 e 75 DAE; e 4- adubação foliar aos 30 DAE e adubação foliar mais fungicida aos 75 DAE. Foram realizadas nove avaliações da incidência e da severidade do oídio, cujos dados foram utilizados para o cálculo das áreas abaixo das curvas de progresso da doença; três avaliações da severidade da ferrugem e da mancha da gluma; e duas avaliações da mancha amarela. Foram determinadas a massa de matéria fresca e seca da parte aérea e do sistema radicular e a produtividade da cultura. Foi observada redução da incidência e da severidade de oídio em função da adubação foliar, apenas na primeira avaliação de incidência e nas segunda e quinta avaliações de severidade da doença. O efeito complementar dos nutrientes com o fungicida para redução das doenças foi observado apenas para a mancha amarela, com redução de aproximadamente 11,16 % da severidade. Os maiores valores de produtividade foram observados para os tratamentos apenas com fungicida e, com fungicida mais nutrientes. A adubação foliar proporcionou aumento da massa fresca de raízes e massa seca de raízes. Apesar disso, não houve aumento da massa fresca da parte aérea em função da adubação foliar.

  3. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  4. Tendencia secular da amamentacao no Brasil

    Directory of Open Access Journals (Sweden)

    Sonia Isoyama Venancio

    2013-12-01

    Full Text Available Com o objetivo de documentar a tendência secular da amamentação no Brasil, foram reanalisadas as bases de dados de sete pesquisas nacionais realizadas de 1975 a 2008. Para obter dados comparáveis entre os diferentes inquéritos, foram analisadas as mesmas faixas etárias e indicadores, e utilizadas as mesmas técnicas estatísticas. A duração mediana da amamentação aumentou de 2,5 para 11,3 meses e a prevalência da amamentação exclusiva em menores de seis meses passou de 3,1% para 41,0% no período. Os resultados apontam importantes desafios no sentido de acelerar o ritmo de crescimento dessa prática no País, rumo às recomendações internacionais.

  5. O ano da Ucrânia

    OpenAIRE

    Franco, Lívia

    2016-01-01

    2014 foi o ano da Ucrânia. Para o bem e para o mal. Pela terceira vez desde a sua independência, o país tenta (re)iniciar um processo de transição democrática. As duas tentativas anteriores – depois do referendo de Dezembro de 1991 que resultou na desintegração da URSS, e após a Revolução Laranja de 2004 – serviram para os ucranianos compreenderem que a transição estava destinada a ser um desafio complexo. A localização da Ucrânia mostram bem a sua relevância geo...

  6. The Supernova Impostor SN 2010da

    Science.gov (United States)

    Binder, Breanna A.; Williams, Benjamin F.; Kong, Albert K. H.; Plucinsky, Paul P.; Gaetz, Terrance J.; Skillman, Evan D.; Dolphin, Andrew E.

    2016-01-01

    Supernova impostors are optical transients that, despite being assigned a supernova designation, do not signal the death of a massive star or accreting white dwarf. Instead, many impostors are thought to be major eruptions from luminous blue variables. Although the physical cause of these eruptions is still debated, tidal interactions from a binary companion has recently gained traction as a possible explanation for observations of some supernova impostors. In this talk, I will discuss the particularly interesting impostor SN 2010da, which exhibits high-luminosity, variable X-ray emission. The X-ray emission is consistent with accretion onto a neutron star, making SN 2010da a likely high mass X-ray binary in addition to a supernova impostor. SN 2010da is a unique laboratory for understanding both binary interactions as drivers of massive star eruptions and the evolutionary processes that create high mass X-ray binaries.

  7. A Cirurgia da interface vitreo-retiniana

    OpenAIRE

    Gomes, Nuno; Carneiro-Freitas, Rui

    2016-01-01

    As patologias da interface vítreorretiniana são extremamente comuns na consulta de retina cirúrgica. Com os recentes avanços na área da imagiologia, nomeadamente com o aparecimento do OCT de alta resolução e de domínio espectral, estas patologias são diagnosticadas cada vez mais frequentemente, e muitas vezes antes de causarem sintomas ao paciente. O conhecimento da história natural destes distúrbios, bem como as indicações para cirurgia, são cruciais na orientação e decisão terapêutica deste...

  8. Interatómica da cavidade oral

    OpenAIRE

    Soares, André do Nascimento Gonçalves

    2014-01-01

    A cavidade oral humana é um ecossistema complexo onde fatores do hospedeiro, microbianos e ambientais interagem num equilíbrio dinâmico. A compreensão da biologia da cavidade oral e dos distúrbios que a afetam depende de ferramentas bioinformáticas que permitam a compilação, integração e aplicação da informação gerada por técnicas de alto rendimento, como as técnicas de proteómica, que se dedica à identificação de todas as proteínas expressas. A compreensão dos mecanismos moleculares que s...

  9. A atualidade da ética husserliana

    Directory of Open Access Journals (Sweden)

    Fabri, Marcelo

    2006-01-01

    Full Text Available O artigo argumenta em favor da atualidade da ética husserliana a partir de três eixos temáticos, que se complementam: a relação entre razão teórica e razão prática no interior da fenomenologia, o conceito de humanidade autêntica e, finalmente, a reflexão fenomenológica sobre a esfera do estrangeiro. Parte-se do pressuposto segundo o qual o pensamento de Husserl abre caminho para uma superação de duas atitudes éticas radicais: o ceticismo de caráter biológico e o universalismo abstrato

  10. Elogio da Loucura por Campos de Carvalho

    Directory of Open Access Journals (Sweden)

    Luisa Buarque

    2011-08-01

    Full Text Available Em 1972, o autor Campos de Carvalho publica uma série de crônicas no Pasquim, reunidas e lançadas em um pequeno livro, trinta anos mais tarde. Em uma delas, apresenta-se uma espécie de dialética da loucura e da normalidade que, de alguma forma, pode ser aproximada de certas ideias contidas tanto em O Mito de Sísifo, de Camus, quanto em O Nascimento da Tragédia, de Nietzsche. O presente artigo propõe uma interpretação dessa crônica literária, sob a luz das referidas filosofias.

  11. GOVERNANÇA DA ÁGUA

    OpenAIRE

    Tundisi,José Galizia

    2016-01-01

    Este trabalho trata da governança da água relativamente aos processos de integração da gestão e montagem deum sistema operacional que envolva bases científicas e tecnológicas, sistemas de suporte para a decisão e participação dacomunidade. O trabalho examina a evolução do conceito de gestão integrada de recursos hídricos e apresenta soluções paraa implementação de uma governança de bacia hidrográfica, com integração de dados de águas atmosféricas superficiais esubterrâneas e com caráter predi...

  12. Nuances da vida e da morte no cotidiano da cidade de Salvador da Bahia seiscentista: a busca de evidências em um estudo paleobiológico

    OpenAIRE

    Mendonça, Teresa Cristina de Sousa

    2012-01-01

    Tese de doutoramento em Antropologia, apresentada à Faculdade de Ciências e Tecnologia da Universidade de Coimbra Os esqueletos e os dentes são fontes documentais antropológicas que atuam como registo ou memória das circunstâncias que afetaram o indivíduo durante sua vida. O objetivo do presente estudo é tirar o máximo de ilações sobre a vida e a morte dos indivíduos inumados no espaço cemiterial da Antiga Igreja da Sé, em Salvador, na Bahia, a partir das características demográficas e pat...

  13. Bases históricas da Epidemiologia

    OpenAIRE

    1986-01-01

    O presente ensaio tenta sistematizar uma série de informações esquemáticas sobre a história da Epidemiologia, a fim de compreender a sua evolução enquanto disciplina articulada ao desenvolvimento histórico dos principais movimentos sociais na área da saúde. Discute-se as raízes da Epidemiologia a partir do tripé Clínica-Estatística-Medicina Social, o seu desenvolvimento inicial subsidiário à Saúde Pública, a sua constituição ideológica e o seu avanço técnico no bojo do projeto preventiv...

  14. Bases históricas da Epidemiologia

    OpenAIRE

    1986-01-01

    O presente ensaio tenta sistematizar uma série de informações esquemáticas sobre a história da Epidemiologia, a fim de compreender a sua evolução enquanto disciplina articulada ao desenvolvimento histórico dos principais movimentos sociais na área da saúde. Discute-se as raízes da Epidemiologia a partir do tripé Clínica-Estatística-Medicina Social, o seu desenvolvimento inicial subsidiário à Saúde Pública, a sua constituição ideológica e o seu avanço técnico no bojo do projeto preventivista. ...

  15. Pungente vislumbre: a triste infalibilidade da culpa

    Directory of Open Access Journals (Sweden)

    Thales Augusto Barretto de Castro

    2012-12-01

    Full Text Available O crime do professor de Matemática, de Clarice Lispector, aborda a necessidade inconsciente de punição advinda do sentimento de culpa, que constitui elemento inexorável da psique humana. O espelhamento do homem em seu animal o conduz à aproximação de uma possível consciência deste transtorno, fato que culmina no irremissível abandono do cão. Com base nos ensaios O estranho e O mal-estar na civilização, de Sigmund Freud, almeja-se entender a origem da dolente identificação entre estes dois personagens narrada no conto, bem como o corolário da cultura, responsável pela tristeza humana com a qual o professor irremediavelmente se coaduna.

  16. Origens da vida Origins of life

    Directory of Open Access Journals (Sweden)

    Augusto Damineli

    2007-04-01

    Full Text Available Apresentamos um panorama geral das idéias sobre a origem da vida na história. Após delinearmos os principais temas necessários para o entendimento da origem da vida, mostramos as características básicas da vida atual e as relações entre os seres vivos que sugerem um ancestral comum. Revemos as condições químicas pré-bióticas no ambiente terrestre e fora dele. Quanto ao aparecimento da vida, confrontamos as principais vertentes sobre a precedência do código genético ou do metabolismo. Evidenciamos a curta janela de tempo para o estabelecimento da vida na Terra, indicando a facilidade de esse processo ocorrer no Universo. Finalmente, são apresentados os fundamentos dos projetos atuais de procura de vida fora de nosso planeta.We present a historical perspective about the ideas concerning the origin of life. After displaying the main topics necessary for understanding life’s origin, the main characteristics of the present life forms and their relationships are shown, suggesting a common ancestor. The conditions for prebiotic chemistry in terrestrial or interplanetary environments are reviewed. We put in context the arguments about the early origin of replicators versus metabolism. The very narrow window for life settlement in the early Earth is stressed, pointing to the likelihood of life arising in other places in the Universe. Finally, we present the cornerstones of current search for life outside our planet.

  17. A GENEALOGIA DA ÉTICA DE MICHEL FOUCAULT

    OpenAIRE

    2013-01-01

    A problematização da ética, observável principalmente nos últimos escritos de Michel Foucault foi, durante muito tempo, insuficientemente analisada, se comparada aos estudos em torno da analítica do poder e da arqueologia do saber. Ainda que, inicialmente, ela tenha sido explicitada a partir do estudo da conduta sexual dos homens livres da antiga Grécia e da Roma imperial, não é o aprofundamento desse domínio o que realmente interessa neste ensaio. Antes, importa o modo como a ética é singula...

  18. França, Brasil e a sociologia da arte

    OpenAIRE

    Quemin, Alain; Villas Bôas, Glaucia

    2016-01-01

    Os primórdios da sociologia da arte remetem, na Europa e, particularmente na França, quase que ao desenvolvimento da disciplina. Mesmo que uma comunidade de pesquisadores tenha sido constituída apenas muito mais tarde em torno de questões, métodos e problemas comuns relacionados a esse objeto, os temas da arte e da cultura apareceram bem antes nos estudos dos sociólogos. O primeiro trabalho associando arte e sociologia em seu título é de autoria de um escritor francês bastante esquecido hoje,...

  19. Aspectos Gerais da Agroecologia no Brasil

    OpenAIRE

    Lívia Mara Siqueira Faria

    2014-01-01

    A expansão da agricultura convencional ou moderna com o desafio de atender a uma demanda crescente de alimentos e de outros produtos gerou uma série de conflitos que intermediaram a insustentabilidade nas praticas agrícolas. Assim acarretou para o meio ambiente diversos impactos adventos da abertura de grandes áreas pelo monocultivo e a contaminação do ecossistema pelo uso intensivo de produtos químicos. Contudo mostra a necessidade de mudança no modelo de agricultura praticado nas ultimas dé...

  20. Os teares da memória

    Directory of Open Access Journals (Sweden)

    Ana Luísa Amaral

    2012-10-01

    Full Text Available Partindo da ideia de que a verdade do texto e a verdade da vida não são coincidentes, mas que a uni‑las está um rasto de verdade, forçosamente diverso daquilo a que se convencionou designar por fingimento, debato aqui a questão de uma identidade de mulher no texto e ainda o papel que a memória desempenha na construção de identidades mais latas, as que ao humano dizem respeito.

  1. Da kvinderne greb bøgerne

    DEFF Research Database (Denmark)

    Sørensen, Astrid Elkjær

    2016-01-01

    I 1800-tallet blev det anset for at være særdeles skadeligt for kvinder at bruge hovedet, og da den første kvindelige studerende startede på Københavns Universitet i 1877 ventede der en lang kamp for anerkendelse......I 1800-tallet blev det anset for at være særdeles skadeligt for kvinder at bruge hovedet, og da den første kvindelige studerende startede på Københavns Universitet i 1877 ventede der en lang kamp for anerkendelse...

  2. Da mulher na Bíblia

    Directory of Open Access Journals (Sweden)

    Jacó Guinsburg

    2013-03-01

    Full Text Available Este artigo discute a figura e a representação da mulher na Bíblia. Elas são multidão no relato bíblico. Desde Eva, a cada página surge um vulto de mulher. Virtuoso ou pecador, desalmado ou abnegado, terno ou tirânico, ele suscita, hoje como outrora, a impressão viva de um temperamento, de um gesto, de um sentimento. O jogo sutil da psicologia e das motivações femininas, das suas relações com o mundo masculino, continua palpitando nas heroínas das Escrituras.

  3. Tecer sobe no ranking da Capes

    Directory of Open Access Journals (Sweden)

    José Aparecido

    2013-11-01

    Full Text Available Surpresa ainda maior foi verificar que prosseguimos no rumo da consolidação, crescendo no ranking – chegando a B3 em alguns campos, como pode ser visto no portal de buscas do Qualis Capes http://qualis.capes.gov.br/webqualis/principal.seamhttp://qualis.capes.gov, que apresenta nossa classificação abaixo:   B3 ADMINISTRAÇÃO, CIÊNCIAS CONTÁBEIS E TURISMO B4 CIÊNCIAS SOCIAIS APLICADAS I B4 EDUCAÇÃO B4 INTERDISCIPLINAR B5 DIREITO B5 HISTÓRIA C CIÊNCIA DA COMPUTAÇÃO

  4. Imunologia da retinocoroidite toxoplásmica

    Directory of Open Access Journals (Sweden)

    Cynthia Azeredo Cordeiro

    2010-12-01

    Full Text Available A infecção pelo Toxoplasma gondii é uma importante causa de doença ocular, tanto em indivíduos imunocomprometidos como em imunocompetentes. A patogênese da destruição retinocoroidiana associada a essa infecção ainda não está totalmente esclarecida. Nesta revisão, discute-se o papel do sistema imune no controle da infecção pelo Toxoplasma, especialmente, no olho.

  5. O paradoxo da teoria: interpretando Niklas Luhmann

    OpenAIRE

    Hans-Georg Moeller

    2015-01-01

    RESUMO O artigo discute o papel do paradoxo na teoria social de Niklas Luhmann a partir de uma perspectiva hermenêutica "autológica": uma tentativa de interpretação "ortodoxa" da teoria de Luhmann, incluindo sua teoria do paradoxo, descobrirá que esta teoria não se presta a uma interpretação ortodoxa. Assim, mesmo que o paradoxo da teoria de Luhmann só possa ser compreendido por meio de uma interpretação ortodoxa, os fundamentos mesmos de tal abordagem hermenêutica ortodoxa são desconstruídos...

  6. Resultados Preliminares da Reorganização da Coleção de Paleontologia da Faculdade de Geologia da Universidade do Estado do Rio de Janeiro.

    Directory of Open Access Journals (Sweden)

    Paulo Roberto de Figueiredo Souto

    2007-07-01

    Full Text Available A coleção de fósseis do Departamentode Estratigrafia e Paleontologia da Faculdade deGeologia da Universidade do Estado do Rio deJaneiro (FGEO/UERJ, foi iniciada pelos professoresJosué Camargo Mendes, Maria Antonieta daConceição Rodriguez e Benedicto HumbertoRodriguez Francisco, a partir dos anos setenta nofinal do século passado, muitos dos exemplares destacoleção, utilizados em publicações e dissertações eteses. Entretanto, a inexistência de uma infraestruturadestinada a viabilizar os trabalhos de curadoriadificultou a organização e acessibilidade da mesmapor um longo tempo. O acervo é constituído por cercade novecentos exemplares, entre os quais figuram:microfósseis, vegetais, invertebrados, vertebrados eicnofósseis, com a maioria proveniente de diferentesbacias brasileiras (Paraná, Araripe, Parnaíba e SãoJosé de Itaboraí e alguns adquiridos por doaçãode instituições estrangeiras. Atualmente, após umano da implantação do Projeto de Reorganização eAtualização da Coleção, os trabalhos de reestruturaçãoda coleção foram retomados, possibilitando aadequação do espaço, triagem, recuperação e aotimização do armazenamento, alem da inclusãode novos exemplares. Esses procedimentos jáestão concluídos com a parte do acervo referente acoleção de invertebrados (conularia, braquiópodes,trilobitas, amonóides, gastrópodes, biválvios etentaculites constando de: 563 exemplares fósseise 298 exemplares atuais. A etapa seguinte do projetoserá dedicada aos exemplares de paleobotânica,paleovertebrados e icnofósseis. Em fase futura, omaterial da coleção será disponibilizado através demeio digital. Esse projeto recebe o apoio do InstitutoVirtual de Paleontologia/IVP – Fundação CarlosChagas Filho de Amparo à Pesquisa do Estado doRio de Janeiro/FAPERJ (Proc. E-26/150939-2005.

  7. Aspetos clínicos da sarcoidose

    OpenAIRE

    Gomes, Sara Fernanda Madureira

    2015-01-01

    Trabalho final de mestrado integrado em Medicina, apresentado à Faculdade de Medicina da Universidade de Coimbra. Objetivo: Analisar as características clínicas da sarcoidose, numa amostra de doentes seguidos no Serviço de Pneumologia A do Centro Hospitalar e Universitário de Coimbra. Materiais e métodos: Estudo descritivo retrospetivo, envolvendo uma amostra consecutiva de 79 doentes, com diagnóstico de Sarcoidose seguidos no Serviço de Pneumologia A do Centro Hospitalar e Universitári...

  8. DA495 - an aging pulsar wind nebula

    CERN Document Server

    Kothes, R; Reich, W; Safi-Harb, S; Arzoumanian, Z

    2008-01-01

    We present a radio continuum study of the pulsar wind nebula (PWN) DA 495 (G65.7+1.2), including images of total intensity and linear polarization from 408 to 10550 MHz based on the Canadian Galactic Plane Survey and observations with the Effelsberg 100-m Radio Telescope. Removal of flux density contributions from a superimposed \\ion{H}{2} region and from compact extragalactic sources reveals a break in the spectrum of DA 495 at 1.3 GHz, with a spectral index ${\\alpha}={-0.45 \\pm 0.20}$ below the break and ${\\alpha}={-0.87 \\pm 0.10}$ above it (${S}_\

  9. Aspectos matemáticos da entropia

    OpenAIRE

    Tavares, Ana Helena Marques de Pinho

    2003-01-01

    Com o presente trabalho pretende-se fazer uma abordagem ao desenvolvimento do conceito Entropia. Inicia-se esta dissertação com a apresentação de uma perspectiva histórica da evolução do conceito. Enunciam-se as propriedades mais importantes das entropias de Shannon, Rényi e de Tsallis, assim como do ganho de informação de Kullback-Leibler. Apresentam-se as demonstrações de algumas destas propriedades. São expostas e analisadas as definiçõpes axiomáticas da entropia...

  10. Sobre a sistematizabilidade da filosofia da história de Kant

    Directory of Open Access Journals (Sweden)

    Hamm, Christian

    2005-01-01

    Full Text Available São muitas e, até hoje, muito controvertidas as opiniões referentes à função e ao lugar sistemático da filosofia da história de Kant no todo do seu projeto crítico-transcendental; nem há consenso quanto à importância ou relevância filosófica dos diversos escritos em que Kant aborda e defende os seus teoremas histórico-políticos. - No presente trabalho, pretende-se interpretar a "doutrina" histórico-filosófica kantiana - não obstante o seu caráter fragmentário e até aparentemente nem sempre coerente - na perspectiva da sua possível homogeneidade e compatibilidade com os elementos centrais da própria teoria-base transcendental. Isso significa, antes de mais nada, ler os respectivos teoremas não como resultados de um raciocínio dogmático baseado num saber do processo histórico, mas como um conjunto de teses e postulados baseados no mero suposto subjetivo-racional de um progresso, ou seja, na idéia não só da possibilidade mas da necessidade (subjetiva da razão de implantar princípios racionais na história

  11. Turismo cultural e patrimônio sob a perspectiva da gastronomia: o caso da mandioca

    Directory of Open Access Journals (Sweden)

    Patrícia Lisboa

    2015-07-01

    Full Text Available A gastronomia é uma manifestação cultural das mais importantes, em que a cozinha é um símbolo da cultura, da memória e, também, da identidade de um povo. Por isso, na atualidade, a gastronomia tem sido reconhecida como patrimônio cultural, o que contribui diretamente no processo de valorização do turismo cultural, pois, proporciona experiências singulares ao turista e contribui na conservação das cozinhas regionais. Nesse universo de estudos em que a identidade cultural se relaciona com produtos alimentícios e práticas alimentares destaca-se a mandioca, o produto mais popular da alimentação brasileira desde o início da colonização. Esta pesquisa objetivou reconhecer, sob o viés da gastronomia, a mandioca como um elemento representativo da cozinha tradicional brasileira. Para tanto, fez-se uso de pesquisa descritiva exploratória de caráter bibliográfico. Os resultados permitem identificá-la como uma comida presente na memória cultural brasileira, constituindo-se, inclusive, como base para ritualização de festas e manifestações culturais.

  12. LIÇÕES DA TEORIA DA JUSTIÇA DE DAVID HUME

    Directory of Open Access Journals (Sweden)

    Giovani Mendonça Lunardi

    2017-06-01

    Full Text Available No presente trabalho, examina-se a teoria da justiça de David Hume, sustentando que seu modelo leva em conta aspectos constitutivos da natureza e sociedade humana que podem contribuir de modo alternativo para o debate político contemporâneo. O filósofo escocês realiza uma demonstração da justiça, enquanto uma virtude artificial que apresenta uma ontogênese histórica da natureza humana, baseada na dinâmica da experiência das ações humanas, que permite também a demonstração das virtudes naturais. O exame da base das virtudes, tanto naturais como artificiais, e de como se originam e desempenham seus diferentes papéis, é um dos temas morais que compõem a ciência da natureza humana e possibilitam a discriminação do seu conteúdo moral.

  13. Por uma nova abordagem da interface ciência/sociedade: a tarefa da filosofia da ciência no contexto dos science studies

    OpenAIRE

    André Luís De Oliveira Mendonça

    2008-01-01

    Com esta tese, eu examino a relação entre ciência e sociedade a partir das novas discussões no interior da filosofia da ciência, suscitadas, em grande parte, pelos trabalhos empíricos produzidos pelos science studies. Trata-se de uma abordagem temática, na qual eu discorro sobre as principais teses dos profissionais mais renomados e autorizados de escrita inglesa nas áreas de história da ciência, sociologia da ciência e filosofia da ciência, tais como Thomas Kuhn, Paul Feyerabend, David Bloor...

  14. Os Desafios da Epidemia do Ebola

    Directory of Open Access Journals (Sweden)

    Manoel Dias da Fonsêca Neto

    2014-09-01

    Full Text Available Desde que se criaram as condições para a existência de aglomerados populacionais, os grandes flagelos sanitários da humanidade sempre estiveram presentes. As condições de vida, os desastres naturais ou provocados, podem agravar consideravelmente o risco de epidemias. Ao largo da história da humanidade, se viu populações de todo o mundo afetadas esporadicamente por surtos devastadores de doenças infecciosas, com destaque para cólera, peste e varíola. Hipocrates (460-377 AC e Galeno (129-216 DC já descreveram em suas épocas um doença que provavelmente era a cólera(1.A relação entre doença e civilização tem raízes mais antigas que a historia escrita. Os males sofridos durante os primeiros estágios da evolução humana foram identificados através de estudos arqueológicos(2.A atualidade é marcada por erupções recorrentes de doenças recém- descobertas, como o hantavirus, a AIDS, o ebola e gripes provocadas por vírus de diversas estruturas, entre outras epidemias de doenças que migraram para novas áreas, moléstias que adquiriram importância através de tecnologias humanas, como as síndromes de choques tóxicos, a doença dos legionários e zoonoses, em decorrência da destruição dos habitats naturais dos animais pelo homem. Algumas dessas doenças são potencialmente epidêmicas, e poderão gerar epidemias em grande escala, até mundial, a exemplo da epidemia global do vírus da imunodeficiência humana, a AIDS, considerada a primeira doença infecciosa epidêmica moderna(2,3.O grande aumento da movimentação de pessoas e mercadorias pelo mundo é força motriz por trás da globalização das doenças, tornando o mundo mais rapidamente vulnerável às mesmas e à sua propagação, tanto de antigas como de novas enfermidades. As pessoas e as mercadorias passaram a viajar e circular mais, muito mais rápido e a mais lugares e com elas, transportam-se micro-organismos a locais onde antes inexistiam. A nova epidemia

  15. Horizonte negativo da arte na era da saturação estética

    Directory of Open Access Journals (Sweden)

    Eugênio Trivinho

    2001-11-01

    Full Text Available Inspirado no arco teórico que vai da Escola de Frankfurt ao pós-estruturalismo francês e ao pós-modernismo teórico, o presente ensaio discute a condição da arte no contexto social-histórico de excesso de produção tecnoestética, a partir da segunda metade do século XX. Na esteira (contra metodológica de radicalização de todas as hipóteses de trabalho, como política de reflexão teórica voltada para a otimização da epistème, a argumentação traça os principais momentos da trajetória social-histórica da arte. Nesse quadro, a tendência da argumentação, no que toca à empiria estética, descarta tanto o apoio melancólico a formas, esquemas e contextos artísticos do passado, quanto sobretudo o apoio político-ufanista a formas, esquemas e contextos artísticos que reforçam o fetichismo estético integral, socialmente instituído; e, no que toca à teoria, evita tanto o essencialismo da estética moderna de Theodor Adorno, quanto o niilismo irônico do pós-modernismo de Jean Baudrillard acerca do destino da arte.

  16. Custos da ampliação da licença-paternidade no Brasil

    Directory of Open Access Journals (Sweden)

    Sergio Almeida

    Full Text Available Resumo Há uma crescente literatura empírica documentando que educação e cuidado parental de qualidade estão associados com um melhor desenvolvimento emocional e cognitivo da criança. Diante disso, governos de vários países vêm promovendo mudanças nas suas leis trabalhistas, com o objetivo de dar suporte financeiro e legal (proteção do emprego para as mães e também os pais com crianças recém-nascidas. O Brasil aprovou recentemente o Marco Legal da Primeira Infância (Lei n. 13.257/2016, que ampliou a licença-paternidade de 5 para 20 dias. Pouco se sabe, entretanto, sobre o impacto econômico desse tipo de política pública. O presente trabalho procura quantificar os custos intertemporais do custo econômico direto da extensão da licença-paternidade para o Brasil. Para isso utilizam-se microdados da Pesquisa Nacional por Amostra de Domicílios, indicadores do mercado de trabalho brasileiro e uma série de projeções populacionais para construir cenários estáticos para estimativas da probabilidade de os pais solicitarem o uso da licença. Os resultados indicam que a extensão da licença-paternidade para 20 dias tem baixo custo – cerca de R$ 100 milhões por ano no cenário mais provável, o que representa 0,01% da arrecadação federal em 2014. Conquanto a magnitude dos benefícios seja ainda desconhecida no Brasil, os resultados sugerem que esse tipo de intervenção será provavelmente custo-efetiva.

  17. Breves considerações acerca da poesia, da filosofia e da crítica literária

    Directory of Open Access Journals (Sweden)

    Affonso Henrique Vieira da Costa

    2016-07-01

    Full Text Available O trabalho se constitui diante de uma indagação: É possível falar sobre a arte? Ele tem por objetivo tecer considerações em torno da relação existente entre poesia, filosofia e crítica literária.

  18. EFEITO DA DESIDRATAÇÃO FOAM MAT NA RETENÇÃO DA VITAMINA C DA POLPA DE CAJAMANGA

    Directory of Open Access Journals (Sweden)

    Caroline Alves BREDA

    2013-04-01

    Full Text Available O objetivo do trabalho foi avaliar o efeito da desidratação foam mat na retenção da vitamina C em polpa de cajamanga. A polpa de cajamanga foi elaborada a partir de quatro formulações utilizando três agentes espumantes combinados em diferentes concentrações: 1 pectina cítrica, 2 produto à base de monoglicerídeos destilados, monoestearato de sorbitana e polissorbato 60 (Emustab e 3 produto à base de sacarose, carboximetilcelulose e goma guar (Super Liga Neutra. A composição proximal e o conteúdo de vitamina C foram determinados na polpa fresca e nas polpas desidratadas obtidas a partir das formulações. Os resultados mostraram que a adição de agentes espumantes favoreceu ao incremento de açúcares e fibras na polpa desidratada. Os agentes formadores de espuma influenciaram na retenção da vitamina C. A polpa desidratada contendo 1,5% de Emustab e 1,0% de pectina obteve maior retenção da vitamina (28,55%.

  19. AS INFLUÊNCIAS DA FILOSOFIA NATURAL E DA NATURPHILOSOPHIE NA CONSTITUIÇÃO DO DARWINISMO: ELEMENTOS PARA UMA FILOSOFIA DA GEOGRAFIA FÍSICA MODERNA

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Vitte

    2009-06-01

    Full Text Available Esse trabalho argumenta que a teoria da evolução de Charles Darwin sofreu forte influência da naturphilosophie de Schelling e Hegel, representando um avanço positivo nas concepções de teleologia da natureza. Fortemente influenciado pelas obras de Alexander von Humboldt, de Werner e pelas pesquisas no campo da paleontologia, a Teoria da Evolução, concebeu a transformação dos organismos e a sua especiação a partir determinantes geográficos e temporais. Ideologicamente influenciado por Lyell, que acreditava na hipótese da vera causa, Darwin relegou a matriz espacial e concentrou suas argumentações nas mudanças temporais, basicamente climáticas, como determinante da evolução. Os impactos da teoria da evolução atingem tanto o campo da geografia física, quanto da geografia humana, influenciando fortemente na postura metodológica das pesquisas geográficas, mas chamando a atenção para a complexidade das relações entre o espaço e tempo que estão em constante mudança.

  20. IMPLICAÇÕES DA ANÁLISE V-A-T DA TEORIA DAS RESTRIÇÕES NA GESTÃO DA CADEIA DE SUPRIMENTOS

    Directory of Open Access Journals (Sweden)

    Diego Augusto de Jesus Pacheco

    2016-03-01

    Full Text Available O objetivo dessa pesquisa é identificar o impacto da análise V-A-T da Teoria das Restrições na gestão estratégica de materiais à luz da Matriz de Posicionamento Estratégico dos Materiais (MPEM. A partir de dois estudos de caso, buscou-se verificar: i em qual classificação cada empresa se enquadrava dentro da lógica V-A-T, e ii se a gestão estratégica de materiais a partir da abordagem da MPEM pode ser considerada semelhante ou não nos casos investigados. Os resultados da pesquisa apontaram que a classificação V-A-T no caso da empresa S é do tipo A e no caso da empresa K é do tipo V. Já a análise da gestão estratégica de materiais a partir da MPEM, evidenciou que no caso S pertence ao quadrante não crítico e no caso K pertence ao quadrante estratégico. Identificou-se que a classificação V-A-T tende a impactar na gestão de materiais e no controle de estoques.